LOCUS       JF974318              411003 bp    DNA     linear   HTG 22-FEB-2012
DEFINITION  Emiliania huxleyi virus 208, *** SEQUENCING IN PROGRESS ***, 17
            unordered pieces.
ACCESSION   JF974318
VERSION     JF974318.1
DBLINK      BioProject: PRJNA47659
KEYWORDS    HTG; HTGS_PHASE1.
SOURCE      Emiliania huxleyi virus 208
  ORGANISM  Emiliania huxleyi virus 208
            Viruses; dsDNA viruses, no RNA stage; Phycodnaviridae;
            Coccolithovirus; unclassified Coccolithovirus.
REFERENCE   1  (bases 1 to 411003)
  AUTHORS   Nissimov,J.I., Worthy,C.A., Rooks,P., Napier,J.A., Kimmance,S.A.,
            Henn,M.R., Ogata,H. and Allen,M.J.
  TITLE     Draft Genome Sequence of Four Coccolithoviruses: Emiliania huxleyi
            Virus EhV-88, EhV-201, EhV-207, and EhV-208
  JOURNAL   J. Virol. 86 (5), 2896-2897 (2012)
   PUBMED   22328700
REFERENCE   2  (bases 1 to 411003)
  AUTHORS   Henn,M.R., Allen,M., Levin,J., Malboeuf,C., Casali,M., Russ,C.,
            Lennon,N., Chapman,S.B., Erlich,R., Young,S.K., Yandava,C.,
            Zeng,Q., Alvarado,L., Anderson,S., Berlin,A., Chen,Z., Freedman,E.,
            Gellesch,M., Goldberg,J., Green,L., Griggs,A., Gujja,S.,
            Heilman,E.R., Heiman,D., Hollinger,A., Howarth,C., Larson,L.,
            Mehta,T., Pearson,M., Roberts,A., Ryan,E., Saif,S., Shea,T.,
            Shenoy,N., Sisk,P., Stolte,C., Sykes,S., White,J., Haas,B.,
            Nusbaum,C. and Birren,B.
  CONSRTM   The Broad Institute Genome Sequencing Platform
  TITLE     The Genome Sequence of Emiliania huxleyi virus 208
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 411003)
  AUTHORS   Henn,M.R., Allen,M., Levin,J., Malboeuf,C., Casali,M., Russ,C.,
            Lennon,N., Chapman,S.B., Erlich,R., Young,S.K., Yandava,C.,
            Zeng,Q., Alvarado,L., Anderson,S., Berlin,A., Chen,Z., Freedman,E.,
            Gellesch,M., Goldberg,J., Green,L., Griggs,A., Gujja,S.,
            Heilman,E.R., Heiman,D., Hollinger,A., Howarth,C., Larson,L.,
            Mehta,T., Pearson,M., Roberts,A., Ryan,E., Saif,S., Shea,T.,
            Shenoy,N., Sisk,P., Stolte,C., Sykes,S., White,J., Haas,B.,
            Nusbaum,C. and Birren,B.
  CONSRTM   The Broad Institute Genome Sequencing Platform
  TITLE     Direct Submission
  JOURNAL   Submitted (18-DEC-2010) Broad Institute of MIT and Harvard, 7
            Cambridge Center, Cambridge, MA 02142, USA
COMMENT     This genome was sequenced by the Broad Institute and co-owned with
            CAMERA.
            
            ##Metadata-START##
            Isolation method                 :: triple-plaque-purified
            Template preparation method      :: CsCl-gradient
            Phage/virus type                 :: DNA:ds Viral DNA
            Phage/virus "hybrid" information :: not applicable
            Phage/virus taxonomy             :: Coccolithoviridae
            Phage/virus strain               :: Strain 208
            Morphology                       :: Icosahedral
            Latitude                         :: 50.25N
            Longitude                        :: 4.22W
            Depth (m)                        :: 5.00
            Collection date                  :: 27-Jul-2007
            Sample collection site           :: English Channel
            Other collection site info       :: L4
            Filter fraction (um)             :: 0.45
            Volume filtered (L)              :: 1.0
            Habitat description              :: Collected from natural E.
                                                huxleyi bloom
            Other metadata available         :: http://www.westernchannelobserv
                                                atory.org.uk/data.php
            References                       :: PMID: 17359269; PMID: 16099989;
                                                PMID: 12209309; PMID: 16553948
            Lab Host                         :: Emiliania huxleyi 1516
            ##Metadata-END##
            * NOTE: This is a 'working draft' sequence. It currently
            * consists of 17 contigs. The true order of the pieces
            * is not known and their order in this sequence record is
            * arbitrary. Gaps between the contigs are represented as
            * runs of N, but the exact sizes of the gaps are unknown.
            * This record will be updated with the finished sequence
            * as soon as it is available and the accession number will
            * be preserved.
            *        1    85876: contig of 85876 bp in length
            *    85877    85976: gap of unknown length
            *    85977   149210: contig of 63234 bp in length
            *   149211   149310: gap of unknown length
            *   149311   201385: contig of 52075 bp in length
            *   201386   201485: gap of unknown length
            *   201486   242792: contig of 41307 bp in length
            *   242793   242892: gap of unknown length
            *   242893   277533: contig of 34641 bp in length
            *   277534   277633: gap of unknown length
            *   277634   302386: contig of 24753 bp in length
            *   302387   302486: gap of unknown length
            *   302487   324914: contig of 22428 bp in length
            *   324915   325014: gap of unknown length
            *   325015   345587: contig of 20573 bp in length
            *   345588   345687: gap of unknown length
            *   345688   363458: contig of 17771 bp in length
            *   363459   363558: gap of unknown length
            *   363559   374887: contig of 11329 bp in length
            *   374888   374987: gap of unknown length
            *   374988   383661: contig of 8674 bp in length
            *   383662   383761: gap of unknown length
            *   383762   389006: contig of 5245 bp in length
            *   389007   389106: gap of unknown length
            *   389107   393990: contig of 4884 bp in length
            *   393991   394090: gap of unknown length
            *   394091   398901: contig of 4811 bp in length
            *   398902   399001: gap of unknown length
            *   399002   403688: contig of 4687 bp in length
            *   403689   403788: gap of unknown length
            *   403789   407683: contig of 3895 bp in length
            *   407684   407783: gap of unknown length
            *   407784   411003: contig of 3220 bp in length.
FEATURES             Location/Qualifiers
     source          1..411003
                     /organism="Emiliania huxleyi virus 208"
                     /mol_type="genomic DNA"
                     /strain="208"
                     /isolation_source="English Channel"
                     /db_xref="taxon:181215"
                     /lab_host="Emiliania huxleyi 1516"
                     /lat_lon="50.25 N 4.22 W"
                     /collection_date="27-Jul-2007"
     gene            complement(<1..867)
                     /locus_tag="ERVG_00001"
     CDS             complement(<1..867)
                     /locus_tag="ERVG_00001"
                     /codon_start=1
                     /product="thymidylate kinase"
                     /protein_id="AEP15879.1"
                     /translation="MYDLTHAEMKHAECIIVNHDTNDDYNRIARVTYAIHVLKKPMYI
                     MIHDDIPVPHLWNEEHVVMGDKYKIHEFFAKPERRGRIFVIEGGDGCGKQTQATLLRR
                     RLEQEDYPVKTIDFPNNERQHGMLIREILAGSHGDIKNLDPFLFASLYAQNRWSVKHI
                     LNFWITRGYNIILDRYIISNIAHQGAHEYRNREYVAKQTELFENEILGLPRANHIIYL
                     DLPPEVARTAMDKDTTRAALDQNELAPLEYKNNVRKIYLEQKNTLRRTYDIVKCMDDD
                     IRISRKDVHNKIY"
     gene            complement(976..1485)
                     /locus_tag="ERVG_00002"
     CDS             complement(976..1485)
                     /locus_tag="ERVG_00002"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15880.1"
                     /translation="MSLHTTLDIIESHKDEMPEGLYLNLMNSAKRKYDELGSSEPEKL
                     YRVGMFKMVQQFVINKSDDEQSMHIILDNEDIDPEQFMHAGVRQLVSEPTVTPVKYKN
                     MTLQEIKNLQDGKVYWDHMSLLTNDILSQSTTFPIDVGYSNVRCRIHNFSSVCTRTHH
                     YIISVVECN"
     gene            complement(2052..2993)
                     /locus_tag="ERVG_00003"
     CDS             complement(2052..2993)
                     /locus_tag="ERVG_00003"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15881.1"
                     /translation="MSYVMKCGDGYKTVLYTDKYKKFKGTFYGFIRASIASSYYRKYK
                     IYHKKNILNMNNLEYRQRNKALYGNTTILENEVVSHLGFKLLNEFTRADGFLAENEAE
                     HNILCNNQFIFSNMEYTGYAIQVKTTSRVYNNIKDMYCFGHCKGYSNMLVILWINLSS
                     VKFGILVDGSKLNEYLSSHLSDGLIISMNTVHTKNYYIRTFTAQDNIREIIIHGGNKT
                     TMGKCMFDFENNKSNNELIRLFAVYCYYLKSSISYKFPDSHGDVVDVLKICKRTGVSK
                     KNTNEDSKLFLVSKWIRCTNYSICRSTVRTTKNATAI"
     gene            complement(3167..5469)
                     /locus_tag="ERVG_00004"
     CDS             complement(join(3167..4548,4611..5469))
                     /locus_tag="ERVG_00004"
                     /codon_start=1
                     /product="ribonucleoside-diphosphate reductase"
                     /protein_id="AEP15882.1"
                     /translation="MEVIKRNGTSESVQLDKIMKRLKNLSYGLDHVDPAVVSIKVVQG
                     LYDGVTTVQLDNLAVETATYLTMTHPDYSKLAARIAVSSLHKMTSNKFSSVMESLYNY
                     VNTKTGQWSPLIADDIIECIRSNAVVLDDVINYEKDLEYDIFGYKTMEKSYLSRINGD
                     IVERPQHMLMRVAIGIHCPDVDAAIETYKLLSQKKFTHATPTMYNAGTKNPQMSSCFL
                     LKMKDDSIEGIFDTIKNCALISKNAGGIGVSIHNVRAQNSYISGTGGYSNGLVPMLRV
                     FDSTARYVDQGGGRRKGAFAMYLEPHHADIFEFLELRKNTGKEELRARDLFYALWVSD
                     HFMKRVEAGKNWSLFCPHECPGLSDVWGDDYVALYEKYESEGKARKTIPAQKLWFAIM
                     DSQIETGTPYMLYKDSCNRKSNQQHLGTIQQSNLCTEIIEYTAPDETAVCNLASIALP
                     AFVKDGSFDHQHLYDVTYHATCNLDKVIDKNYYPIPEAERSNMRHRPIGLGVQGLADV
                     FMMLKMAFDSPDARVLNKEIFETMYFAAMTASCDIAKTKGRYSTYEGSPLSNGKFQFD
                     MWNVTPSDRWDWNTLRSNVKKYGARNSLLTAPMPTASTAQILGFNECFEPFTSNLYSR
                     RVLSGEFPVVNKYLVKDLSDRGLWGDNMKNYIIAANGSVQNIPGFPEDLKPIYKTVWE
                     ISMRTLIDMSADRGAFICQSQSFNVFMTQPTSAKLTSMHFYGWKSGLKTGALAIYHIQ
                     YTHYIS"
     gene            complement(5560..6210)
                     /locus_tag="ERVG_00005"
     CDS             complement(5560..6210)
                     /locus_tag="ERVG_00005"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15883.1"
                     /translation="MSIVIHPSAVYVIDRGFGPMLNLFGFVLIFSLINVFPLHTPLRS
                     AQLTVHCILIYFVARFLFHLVDVMILHVILINICNMAYMCMSHHAFSVAYVNISPKMR
                     ISAVNTSRMITSMLMFITVSFSIEINGTLTQYSRLHTVLSWCIYIWTGLPATNGKWLL
                     IFSLNWGMFLIMEMIKITDSTLRMATSINEIFCVIGNICLANYVISKSVQEHARNQ"
     gene            6279..7346
                     /locus_tag="ERVG_00006"
     CDS             6279..7346
                     /locus_tag="ERVG_00006"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15884.1"
                     /translation="MFTDLTNQILELAGLPPTTLGDEPLLLSWKDALDLETSGSWTAA
                     VLRITGYDKTTGYHAVGYTDINALLPCLNAFAPFPEEFSEELLDTLTVQKFSRNPVVW
                     RALKSMTKIVTDTQEDFTVHVPDVDEIRTNIADFRASKLVAAAKPNLANIPEPEITDT
                     NASIPKAVRQVFTNLIKEVSADSTAGKKFVAYTKTMTGEFILAKLQELHATYGEDFEE
                     ACDNSDTGYLCDTVDWSPLFPDEKRRNYFVTKIDQADDEQLKRIRTQLNHMNSFTRVQ
                     GHLPTGMMSKIEEYTSGLLTKLKNKEMKFSDLNIEEIGRDVVESSAEADVDAMGENIN
                     ELIPVIQRSGLFDQIMKQHMS"
     gene            complement(7343..7660)
                     /locus_tag="ERVG_00007"
     CDS             complement(7343..7660)
                     /locus_tag="ERVG_00007"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15885.1"
                     /translation="MIPPASRSGIAPTAPMTTGEYIKNWNPNDPLILLFRNSLFTAFA
                     ISIVLTWADALVEVMVDTLDTWNTGSAKIIGSIVVTGFSLFGVLFLTALFDFCGHKIA
                     PSN"
     gene            complement(7691..8590)
                     /locus_tag="ERVG_00008"
     CDS             complement(7691..8590)
                     /locus_tag="ERVG_00008"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15886.1"
                     /translation="MLLQFVGSYAMRSVYIDLGVNWCNTIRMFKEFDNRSSFDVYGFE
                     ASPLIHPFADKYFKWLNGETNEEPETCLPRSGSSKHLSEYAKYYNCPNKPLDNMRSCM
                     WNKLSNALNALTNDPRFNDTALIDSRLRKTASYNNNYDRYTFIPAAVSTSTGWLHLSG
                     DARQVIRGGAIPPNGIGSFVVRSIDFVTWFKKSFSKNDYIILKMDIEGAEHSIIYEME
                     KQGLLSYVNVISMECHGKKSSCKTLVNLLYSYMPALKIMTEGIAHNGIDKYTIKETNE
                     RAKRVADVCSHVDLTKFSISHIH"
     gene            8704..9450
                     /locus_tag="ERVG_00009"
     CDS             8704..9450
                     /locus_tag="ERVG_00009"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15887.1"
                     /translation="MNWTHWLSVCNTRCNSWNYYVHMAHRVHTSLQTFDVNPKYPYDT
                     YEPLWNCNTRERIPAATGDGAKFACGVDAYNTKKNVTIYSIGSNGNTMFEEGIHARIP
                     HSKIITFDPTLSETARKNVLKHSYITLKEVGIGSGRPFYAKEHAYNTMVLTTAFYIHG
                     IPNILKIDIEGSEYGLFNMITCNKIKHVDQILIEVHGKNPEPIFQWFDKCNFLMFNKE
                     PNIWGCHGILCGEYSFINAHFAYTVFKFFR"
     gene            9499..10314
                     /locus_tag="ERVG_00010"
     CDS             9499..10314
                     /locus_tag="ERVG_00010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15888.1"
                     /translation="MDSITFLTFAFNSIFYKSHHGMACPLCVALHTLRTYHPDDNIIL
                     MHTPEVHSNELKLLNDDYSVILKKVSNIPMPRSCKNGSLHKSNVFMKLNMWKLNKYTN
                     ILAFDADVMFVNRVSLSPCKYTYCGSPRGVQYVPHFLQRLIPSKYRSINHGVVQFSPS
                     HSVFHKLLRQLANLSGCGNGEGYEQRLYKVALENDYNNKMPIFTKDVGTFSSAFNCRS
                     FGSWTGCGMADLQKTTIYHWSSGSGKPWLSLHNRYEDNMWHKIHKIVLVKISI"
     gene            10341..11042
                     /locus_tag="ERVG_00011"
     CDS             10341..11042
                     /locus_tag="ERVG_00011"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15889.1"
                     /translation="MFCIITLSYLTACNNMFLDLGANVGVNALFLYANNSYFHKSKGM
                     RPLMDKVFGQSRKDVCYRGFEPNPLHRKRLESFENMHKKYNIKFFPYAVGVKNTTETF
                     YKKHDTYTNMVGFGKTYRLGYTPYNVSVINIANYITNNLHKQATVFVKMDIEGYEYEV
                     LFYLITQGILCEFVDYLSIEFHARYCNGPLCKLESDIKHILAHLKYMKCNTVVKFMDD
                     ETYLRITEKDYNILN"
     gene            11045..11902
                     /locus_tag="ERVG_00012"
     CDS             11045..11902
                     /locus_tag="ERVG_00012"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15890.1"
                     /translation="MLSCTTINVYILTICVSHTTASLTTFDYCSQFISLVEDRIWRAD
                     FWNSVKINTTNILKTSSIVSASNGRINTNNTLEISLRNQGKWNGTFHIELITDQPENA
                     FYSSRKAKLSSFDTMFSLGFSRVLYVDGDIIVLKSIMDSTLAPYLDTSSGIWDKKCDI
                     YVQRPSSSPYILNGGVIIGDKKRSKHIIHKWMQQTLSGKFTTDQDAFKHIGLVDGMKK
                     TRRENNQSTYCYLPNDVGYVNSFNSKFGKMSIFGENMCTFLHFKGTRQKKILEKACVK
                     REWPCNMYS"
     gene            11977..12945
                     /locus_tag="ERVG_00013"
     CDS             11977..12945
                     /locus_tag="ERVG_00013"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15891.1"
                     /translation="MQLSAANYTNVAICVIGAPRTLSHTANNIAKSFAQTKVRSDYFI
                     LLRKTQYSEHNSKEQISHYDKLSWLELSRAIAHLTPLISIRNSSTKFSINPNCELPRD
                     AMKLCDKTNQPSYQRLWETMIGFTECFADLKKHEYKIKKQYTTIIRLRPDTFFYDTIN
                     PMLLSPTVPIFPYGHISCTSTKNDHVCVNDHIAFLPRIFADRYLEMADRYTHCNTKND
                     TIDQHKFWKQYVSNKWTLARTIVLEMMTTPKITWRREKVPYIILRSSNPPFLSCKRAA
                     ITHEYVTSNNWNTSECIKCVKYIRTYFHNASTDGYTKICSTITGVV"
     gene            13036..14445
                     /locus_tag="ERVG_00014"
     CDS             13036..14445
                     /locus_tag="ERVG_00014"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15892.1"
                     /translation="MSYQASVESDLQGGDLGEVYASNTIDHMTHREIDSEIKNSDGHV
                     VGHTVRNAFPDANADYSNKQIGANRLITHLGHNPYETRTRRETMNDMPERGPDELKVQ
                     RSLATRNASNAHRNNIQMHQGGNVLGEKIMDSGHQSYNMGGQDRRDYKDRVYVAPIIR
                     KAGVAKPIDVNPSSHVNPVSQQSRLGHITVGNRTETPQMRAVARSAKDATEKNYMGSI
                     RVPDINSKRAQTTLSDHNVKNDVTLEARRQSDYTHEGVVNRHHDVSYLPSVRNMDENP
                     VNGTFDVRNTSHERVDNLPPEYDYANINSRNARESMAPGGMNFTSGETRPTPNRADYE
                     DNKTTFIKRSELEKANPVGINDKKTVKKTPGGARSYTFEAIVHDRAPGTITNPGQDDS
                     LHSYINGPTNVDNRSLNIHNRFNYDVKQSVAGRRMIVPTATLGKQEKWRKQVYEPTPG
                     NNTVRPAPANYTNRMIGPD"
     gene            complement(14672..15568)
                     /locus_tag="ERVG_00015"
     CDS             complement(14672..15568)
                     /locus_tag="ERVG_00015"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15893.1"
                     /translation="MTDFSAELSDNSMISRNFEKTSGSGSRLPFKDTKQTHVLFSISH
                     VGVPPIATDPTNPGIRIYGTFGSAAAAAHYGKIIMTVDPTCHLGICETHSWTLAASNM
                     NYLQDADYIKTKTEKLMKRADVENSVREARFKQHQEELRNATIIKDEKPITAEKMEDA
                     TPTEPVIEEIVENNLPVLTSDCIPINQSVYCISIINDDPVEDVPEFLFYIYRTCRDEA
                     EADGYVRNVASRNVLDHNIYVVDSGEWVFPVTDTKFAPRTYRDKRLNDLMNRDMSPDE
                     LLAQIDENVASNASGAVLENNA"
     gene            complement(15625..16377)
                     /locus_tag="ERVG_00016"
     CDS             complement(15625..16377)
                     /locus_tag="ERVG_00016"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15894.1"
                     /translation="MGKKRPPSESSSSGSYGSDEYSDSGVSTSMSKSASTSVSKPSKV
                     SKVSKVSKAKTAKSSAISSASTKISKGGKSTAYSTATSVKSKKSATSYAPSAPPETSS
                     PDHSVVALSNAPPSVFEENAKEDKRTDVASTVASSALPVKDAPQISNWDRAEGGGWSI
                     WNGIISQKISEKNSVPGYLKRAMYAAKDSYIAILVGMVVVLVTLVTLRPSFVLGANVS
                     RYEDPPLDMMRVGVFTIVFGVISFVAIQSVAK"
     gene            16446..17222
                     /locus_tag="ERVG_00017"
     CDS             16446..17222
                     /locus_tag="ERVG_00017"
                     /codon_start=1
                     /product="fatty acid desaturase"
                     /protein_id="AEP15895.1"
                     /translation="MQYSTFFIFTYIFPITLLFNLFCVYGLPSILQFFTSFALIMVLT
                     GTAMSATLHRYFSHSAYKTSRLFQCVLGLFSTLAYQGGPIWWASKHRRHHKHCDNPHD
                     PHSVVQTNFFYSFVGWTIMKKEQSIDTEFVQKFMTFPELVLIDRFWYMIPWTIWTISY
                     MYIGSYTTCVLFVAPMLGCRFITLLFNVEYHTPNRHSIPGKCLALDTARFLGDCVGES
                     GHARHHIHPSELARPSLGIPYFDLPYYIYLKPLIYTGLIW"
     gene            complement(17228..17623)
                     /locus_tag="ERVG_00018"
     CDS             complement(17228..17623)
                     /locus_tag="ERVG_00018"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15896.1"
                     /translation="MNPLDNPDVKTELVQMRPEELMKKAKKEGARVYENTFSLEFTPW
                     PRDKIDACMERIRNGEEDDDEIKEFKKYHPTLAKMAGGGMQTQALCNLFAAHDDILSG
                     KTTKEDAMKKLIGGIFANISKSQPPDEKK"
     gene            17696..18358
                     /locus_tag="ERVG_00019"
     CDS             17696..18358
                     /locus_tag="ERVG_00019"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15897.1"
                     /translation="MEQQAIDNHRITVLEERVKALETLIRSRLGATLNTAVETSGLHW
                     IHVGADEVNEDIIEAITSMYIGRNFEGFRDHVQGQFPASVLLLGENGNVSRPAAAIII
                     KKHPCGNHIKLNIHKHRSLVTSHIAPKYIELLTGDTPHFTEISSGTLEDAIRDSGVNN
                     VTDPNTVTFIAQIGSSRIVLDAADSKCRMHPLANGEPCPVGSYITQSGKRMALYGTPR
                     VL"
     gene            18384..18761
                     /locus_tag="ERVG_00020"
     CDS             18384..18761
                     /locus_tag="ERVG_00020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15898.1"
                     /translation="MDSSQILYSLVVNIIKLAIMVFVFYIVKNQFELQTGKTLTWDMI
                     LGKEPMFDTKGDGCSESIESGATVVKRTQRFHDTEHGNGLLCFTDDGILKKSQTGEVI
                     HTTSKQEFTVNEYNDLIVENKSF"
     gene            complement(18758..19861)
                     /locus_tag="ERVG_00021"
     CDS             complement(18758..19861)
                     /locus_tag="ERVG_00021"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15899.1"
                     /translation="MDKPQQTETDKETEKDIDRKQFRLAIGVLIASIICVCLYHIRSI
                     NDRNNHVVNPVDLDDTILVLVVSPANRDTAIATTTKPPILNTIEGLYNNAYEPSRVMV
                     AAYDMNDHLKNQLPVQLQPSVRVARNMKTIQSKHSSASDARAYLMKHLYRGERYVMTL
                     QSNAEICKDWDKILIDMIKPIKNRHTIFTSAVMPKNMQSNIRPTYFKLDALKGGKMVI
                     GSSAVHEVPEDPVPSIFWSPALSFAPAPAYTEFVDGNIISSDDMDITLNTIKLWTNGF
                     NFYSLPITMAWASRPEDSNWAHSSKRSMSKTATVGTARTFKDFEQYVGISFERKKASK
                     RTYHGLTNHVTAFEAGVKVGSLEAARLANHAKH"
     gene            19883..20536
                     /locus_tag="ERVG_00022"
     CDS             19883..20536
                     /locus_tag="ERVG_00022"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15900.1"
                     /translation="MKDIERRLLAAQRSLMFAEAEAGDFIVLHSELDPRRSIPKFRKC
                     GTILKKNDTMLYIKPDGNDELFSIKKNDAKAPSFDLPRFHRFDKTDQSTHIIKTTNVT
                     YIITVLATGAVTIRDNMHKIILELHSLTALPIGTQAILFQLDEKIYISISDKIQIFKT
                     HITDVSIQDDIVSYKASDNSDWCTDSIILHDSKDGDITEDVQRFMYKTIKKLAPHRR"
     gene            complement(20516..20764)
                     /locus_tag="ERVG_00023"
     CDS             complement(20516..20764)
                     /locus_tag="ERVG_00023"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15901.1"
                     /translation="MEYITVRQTWNGAVQKAAKKVTYNSSSKGTTAMTRDISHAENAP
                     SAVMLRDKINKITNDLHTQGVPSYNSCKATPGLASVWG"
     gene            20828..21529
                     /locus_tag="ERVG_00024"
     CDS             20828..21529
                     /locus_tag="ERVG_00024"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15902.1"
                     /translation="MFRNRRGNLPFQIAGIEMYIYPVDDDAIKFHDLQEGDIIAMEGK
                     RVTSFVIAAASGKVSHVGQMMKLGGKLWLVESVDNINSSITRWDNEGCCPVRSGVSAS
                     ALPTLMFLYKRSGVYRPTPALTEKELDIMRTEFLKLYGNPYETNLLMFLNAFTGMPTL
                     WKRKNFYCSQLTAYLFRKAGRLNSQYNLIRYKTGNYRPNDLVNSIKCNYKGKLPGTKP
                     IVFKRHVHTDEPTTS"
     gene            complement(21516..22001)
                     /locus_tag="ERVG_00025"
     CDS             complement(21516..22001)
                     /locus_tag="ERVG_00025"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15903.1"
                     /translation="MDSDSFLTGMLIAYLVYLIVRLFIWPSCEERVMRFMAEHGMTKV
                     DSTKTVTHSVVVLDDPTPSGPTTESVMIPVENVQEAKKLEIVSKDDENAVMVPSSTQV
                     GAAELKSMSQRAAESSMERDAHIINRFNPAVPVSSLKNPWHDEIAANVQSKPDEYIKM
                     S"
     gene            complement(22294..22809)
                     /locus_tag="ERVG_00026"
     CDS             complement(22294..22809)
                     /locus_tag="ERVG_00026"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15904.1"
                     /translation="MSGTSSPLPDRPDSPGTVRTAPISEPAWLKRASAALGEEQPIDT
                     PVDQPTDTIPEESSAGADNNSSTDPTVDDTDKPSSPPPAPYSIADLNDKFREILERVE
                     KLETSPRVSVPIEVTEDEEISAPLTSPVVVKTETINTDTRMIISSKTGRSYLPVSRGI
                     FASIYGRRRNN"
     gene            complement(22907..23707)
                     /locus_tag="ERVG_00027"
     CDS             complement(22907..23707)
                     /locus_tag="ERVG_00027"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15905.1"
                     /translation="MSSTTYDFTTTKPSEVKFSDFDWNKKAVTKVYINPGIALRIGSY
                     EKWATVPWYLNTPFGQGGKPTTAQEFLAKVEQAIKNPGDLGPLTYTMDIRINHDVDDY
                     KKFFGELHNNIADVAKEKVWFDDNAEEITRDNIIFVTQASLRLQRQHDYHFMRVKVVP
                     TGLPNAPTLRMATGKDDTGYTWKNITTTDLLSPQDGGNGQLRNAKIIAILEDVGVWAR
                     KDPALGVGWRLAQAFIIPSDDRPVSDSRVANRSVDAYSGIFPGEMRFE"
     gene            complement(23867..24115)
                     /locus_tag="ERVG_00028"
     CDS             complement(23867..24115)
                     /locus_tag="ERVG_00028"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15906.1"
                     /translation="MEEYLPYVNTFLFLCMLLVGSFYAYNSYRQVVLQRKEARNQIIF
                     GVLTTAAGLLQTYYAKAPRDDVLERVLKSRIGKANAAQ"
     gene            complement(24136..25272)
                     /locus_tag="ERVG_00029"
     CDS             complement(24136..25272)
                     /locus_tag="ERVG_00029"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15907.1"
                     /translation="MPIKRTRQPVEVVTLSSVIEKAENDVKYMSNSIDDINQKIGDID
                     HELSKLSNDRFNILKRKVITNTRKQLVDEVYKIKNDIYVERLELLTSKYTISQNRMDT
                     AIAIANKKPKHSTTTTAIDTCPDKHKLTHEYNAIVNGVAPIVKINNDDSKCIKCGGPV
                     LMQAARSLLNCQECGYSAAVLDATASAVSFGDEVVFNQSFSYKRSNHFTEWLIRTQAK
                     ETYVVPDDVIKKVMEGLAIRNVHPDEVDQHIVLDILKKNKMKSKTYRYTAQITMKCTG
                     VPPPRLTSEMDQLAGLIFIAIQEPFNKYMPADRKNFLSYSYCIYRIYELMGADDLLPT
                     LSLLSGTGKIPPQDAVMKKIYNEMEWDWPGDMPEKMTMPKSTAE"
     gene            25352..26380
                     /locus_tag="ERVG_00030"
     CDS             25352..26380
                     /locus_tag="ERVG_00030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15908.1"
                     /translation="MGRTKKRIGKRNNLNDRFYKSKGLFDNLKSTAAIMEASVEESVE
                     QLKEVSIQIDKVNRVGHMTIYGVDTPFRIGKKLGEGSFGAVYELSGSLDGTVLKVVGY
                     DPRDPDNASYEDWVIRIVSEAALTRIFSAVKAGPTTPPISLGMSPDKKVAYFFMESMA
                     GSGFDLMEAILYNGDFNKFKSTLTKQIRHHITVAVKLGIVCTDMKPDNMLYRITDKHK
                     LKIVLADFDSLFCCALAESYARKHLHGVKMAVPDRKNDGHWTNINGTLLHDRIPETGA
                     PCPTKRNKYTRQIIKVTLGLIGSMMNLFPEERRYTRKYLGDRRNRGEYVFDLFKIRWD
                     HYKPLFIV"
     gene            complement(26370..26999)
                     /locus_tag="ERVG_00031"
     CDS             complement(26370..26999)
                     /locus_tag="ERVG_00031"
                     /codon_start=1
                     /product="ribonuclease H"
                     /protein_id="AEP15909.1"
                     /translation="MNRDEELLTICNTFGSFGDNIVVGVDEAGRGCLAGPVVAGACFV
                     PENEPIHPLIKDSKKMTEKQRMEAFEYLTLNSNIKCYSSFIEPYEIDDINILKATMKA
                     MGNVINESGANLSLVDGDKTPKMFVDTSEIQTFIKGDSRMYSISCASVIAKVSRDLYM
                     EELSKTYPEYGFENHMGYGTQAHMAAIEKNGPIPFVHRYSYSPIKKFTQ"
     gene            27079..27687
                     /locus_tag="ERVG_00032"
     CDS             27079..27687
                     /locus_tag="ERVG_00032"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15910.1"
                     /translation="MPGLKPTRGKNSLGYYSSSSDDDDSSVTIRKKILPVDKVDLNSY
                     MGKWYQVYTSLSPLLTFELGGRNTTAVYTKTDRPDVIAVLNRNEPSYLPAQEIRGWAR
                     ASGNRPGVFHVTLGAGAASDAEHAVFRAPGNYWIVALGPKDGNLYQWSVVTNSSKSQL
                     YILCRNPQVFKETYEKEVLKLTTEMGFTTTWNRPRATEQSHY"
     gene            27724..28413
                     /locus_tag="ERVG_00033"
     CDS             27724..28413
                     /locus_tag="ERVG_00033"
                     /codon_start=1
                     /product="RNA polymerase subunit"
                     /protein_id="AEP15911.1"
                     /translation="MISEAYVFGNECTIKFSPEVPHTMVNTIRRTLMLDLAELAPTDV
                     TIHKNTSVYPCELLAHRIGLVPIISECTNISLQSVGPCTLYSDSIVCKDTGKPVTEPG
                     IMLFPLGTGHEINFSCKVTKETGRKHARFVHCSSISMKKCSVGNTLLEKECWCGANFK
                     PKETEPSFCARCNYKKYSTGKDHDVHYVLSYKTINPTVHPITYTMRAIDVVYKKIGKL
                     KEVASSLMECS"
     gene            complement(28376..29311)
                     /locus_tag="ERVG_00034"
     CDS             complement(28376..29311)
                     /locus_tag="ERVG_00034"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15912.1"
                     /translation="MEHSDNESPEEYNISGAGIVPISTAPNGVVYALLGREKYVKNWS
                     SSLKWSGFEGGNIGAESASLNAAREMIEESLGMIFSDKNSLVNMLETKNYIAQIAVKT
                     MGGTRTHVTYVKYVPWDPDLPVRFGTAINYLVELSKVGNRLKTLTKSTNRNNMRDEEI
                     DDGWTRVKSNDSNAFDRIHTQATEMINNPPVEIQFPHPAVDIKYNKDGSLLSVHVKDE
                     HIEKGQIKYWPLSELEVAAKNGGNGMPGVSIRPYFCIIAKLICKYVTKDGERNKNNVR
                     IPKRVYVRMKPERDLTYPPGLNNAKNIPSVKKQLP"
     gene            29364..29810
                     /locus_tag="ERVG_00035"
     CDS             29364..29810
                     /locus_tag="ERVG_00035"
                     /codon_start=1
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="AEP15913.1"
                     /translation="MSSTTTNLYVSRLTDDAKLPTKGTTLSAGYDLYSSEDVQIPPWS
                     KKMVSTGLSMTVPDGTYGRIAPRSGLAHKNSIDVLAGVIDRGYIGEVKVILMNLSNET
                     QTFPKHTRIAQLVLEKIEYAEVKEVVDITTSVVSDRGTSGFGSTGM"
     gene            29833..30243
                     /locus_tag="ERVG_00036"
     CDS             29833..30243
                     /locus_tag="ERVG_00036"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15914.1"
                     /translation="MKLSEVSDSTRKLLFWLICIPSRIGIALITALAFPNAVPEVKYI
                     FGIVYLLPVLVWAIYILGIKHRTAGTFKQTAFWANARPIHATLWLTASILTFIGTTDS
                     FRWAGGVFGADIMVGIALWLVNYDVAFRKPDLPT"
     gene            complement(30236..30883)
                     /locus_tag="ERVG_00037"
     CDS             complement(30236..30883)
                     /locus_tag="ERVG_00037"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15915.1"
                     /translation="MVTGTTNDMLEYNRFMDTAPNKKLGQQRYEKYLSWRNKHFPLST
                     THPHFGNGMPEFIVFSSIIDTPGVRNAFFFSSRMDRYEFTPEQYTLAIANCIQTNLSR
                     DSADSVNIYVDIRPKVGWPNVKVLQMLHILKHIAATITHFYPGRLNKLYVFSTPSFAQ
                     AIWSLIRPVLDPIVASKVKLISGYSNEAQPLPGALKKVMSDALIKEMVDIRNALM"
     gene            complement(30883..31389)
                     /locus_tag="ERVG_00038"
     CDS             complement(30883..31389)
                     /locus_tag="ERVG_00038"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15916.1"
                     /translation="MNVLNNLIKEYVYPRDNEEVESYKKNLELVSKFESMPNVSDALQ
                     HSQCFASMYVNMHQTIQQLFCEELRRLSGRQVTIRYAMERGIMSDSTNNPGCEFKTFW
                     SVRTNIEFSNEELLVKEPVFLHSGIRSFYITVFSVALPIGDTRETIVYNDSSTVKYFP
                     RYNFLAYI"
     gene            31413..32423
                     /locus_tag="ERVG_00039"
     CDS             31413..32423
                     /locus_tag="ERVG_00039"
                     /codon_start=1
                     /product="DnaJ domain-containing protein"
                     /protein_id="AEP15917.1"
                     /translation="MQYITQSVPKPSRIDEQKRIIAEILAAITIWEVLGLPNESRMVN
                     PSLKGIRSEYLKRSLLIHPDKCSLDDSERASRLLNTAYSDIVNKTNTFCPHNYTEGSS
                     SNTKSTRNPSPEPKRPSYNEKRKIRREYEALYNTYKRSKADELILFRKKVERESEITV
                     LEEQLEQANIAAVQQRLQRARAAYIRMMIDTRLLKLSVDLIIKLSKEINVEPSTDNIR
                     TWATCGQENTIHRPYYVNKFIVENVQNRPRALVRKDKNDLITRASELNKDSAGERHDQ
                     IRIIHITSTIRTATTVRDDFQSKYEQQVNETSKLHAKLMDMQDKIGKNNTSNKRNWFW
                     FI"
     gene            32429..33187
                     /locus_tag="ERVG_00040"
     CDS             32429..33187
                     /locus_tag="ERVG_00040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15918.1"
                     /translation="MYKHLATLKTEANKSKTYRQRNSGVITKKQKTQTTTLPETILND
                     ITTHVLSTGLDHQEIYTSLLAIATTKYTIKKHKAPVIDVDIKDVQCNKCLHKYKYERR
                     KGDGGNTCPGCGHAPGIDIYEGDPFPHYENVIPQWSLVYSSNELTTIENAMTPYTNLL
                     HLTPDQLEYAKRIVRAKTSINDPNPHVIVAAILYVTNPDMLETKRIITHTPTRGKFNC
                     SKCSKSWHSRKCALMCCKYGPMADSYIPINKGII"
     gene            33214..33660
                     /locus_tag="ERVG_00041"
     CDS             33214..33660
                     /locus_tag="ERVG_00041"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15919.1"
                     /translation="MQDILIGQLAMNISTIILHAMKNAASDEQVSPDTCNPDDGGAVD
                     EVMNQLSEHIMVELTKSLVERAKRVKSEEVPSAAAVDTVKRLGVAASERITKSMDNST
                     IDTARKISDAKLIIQDMQMWGKKQWSGTKKNEFLTYTAQLYNILDQ"
     gene            complement(33670..34851)
                     /locus_tag="ERVG_00042"
     CDS             complement(33670..34851)
                     /locus_tag="ERVG_00042"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15920.1"
                     /translation="MVEVKHYFTRTQLVADVITKFAKKNTQILCGRKKYSVSGYNKML
                     KKFIEKHRRSHTLTPFECEQITISAVVTDNKEIYKNKYTKTINSDLDTTFFLPENPKP
                     LLDYIQKLIRAIHSKGISVSKELDCNIYVEDDDATYIKLLQNATMKDIERYRDGIYLK
                     LYRHGCIGVRETDRLVSKNTNKQTSKLYRKFDKQSSIRKTTKSLLRAEDELYSEYFDR
                     AINYMKQKTLETLFYFNSVKIEGYVAIPTLMFYLHPTKITNKKLLDIVIAENLADSLI
                     HLETSNHMKKAKYLLRMNSAMKAATMSCSVEKQTQVDTLTQFCLVFERMRKTATDMTD
                     FDGSYRNLTLMILNQIDSSIGIPYNLQKISKGDGNITKKELQHATMTVLTDGSRVSCR
                     R"
     gene            34960..35478
                     /locus_tag="ERVG_00043"
     CDS             34960..35478
                     /locus_tag="ERVG_00043"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15921.1"
                     /translation="MPRKTKTLLNELDELKLDYDPGELPARRSTRGVRKTTYLEEILS
                     SEENTRIRNDILDGADELPDSDDDDDWVDNGDGADNSSEYDSGPDSDDDDPDWDESVE
                     EKEDDTEISSEDDEEDVDDEEDDTDMAQDESETEFEEEDNDIESVVIHVPVIESSDKK
                     NVEPMEVEYDED"
     gene            complement(35487..39209)
                     /locus_tag="ERVG_00044"
     CDS             complement(35487..39209)
                     /locus_tag="ERVG_00044"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15922.1"
                     /translation="MAKKSGKTSNKKKSSDDTFTYILIGLIIIGIGYYYYYYYYNGDY
                     DPAQIGGTSEVIGTIQEDDTDDTDDTPAPIITRPNEPPKPIEKPKPVWLFKDGARNMI
                     VLGETPIASSAYGVAPAKLNQRAAHNMDYCIKSCKSLSANVAAISPLRAMTLPSCQCY
                     KVQNKVKLAADMYSISKIAYLSNVTEEISNDCSNPAACAPQRSSQTSVVTKTCNTAAS
                     KNMYGYHQYHATDSLINNTLIHIWFDTGTKKLMYKRRNNELDTGSLVYGTPAGVSFGT
                     QYTVFKNSMRLTANFRLGLVYSGTPPIGHKSNNASYSRARINGIWYDWQSIIQCAVLR
                     DARTGKITNMDIDEYSFYTDKHKDVRVADRKMTESPDEMVMFEHNTKYYVFINRMAIE
                     SSIDNLSAIPIYPQVTYNQAHGDPSLFHYGTLKIEQVINWVDSSTRDVWLLVHAPSGT
                     MQGHTFKPDSNTMYTYYVKNTATPDNCLSCQVRERDVCPDNTILIGCGFGQQGRCGTC
                     YMSSTEHGMATRNDKIDDSPCGNCQIGRLMVKTNTGKIWTDANRRILKNAVPSHKNIN
                     DIFEGPFVNDDKGRSGKYSIEDGMKNAQLYRRIVKAARDTGRTNPTAQPAYCNLATGS
                     IKNDNDTNTQMATGSNTWKQFKNFAYISTLNAESYGPAICQLGTSAPNKFDGGFCTIG
                     YADVHLNNFALDAARQQFPSYSDGGNRDNAGCIAALDRDHARGKYRHYAQNAAKNMDV
                     TVKWTLVPRLMFPHSSPPIYNPYIGIQFLQLTLTVKIYNKAYTDGAVEVNENQFAEFN
                     KGDKNYMFKFTDPGKAQNFTNTKLIVMPPYSDIRVGFNKLYRVVHNVNVDFLDFIPSL
                     SGFSSGCVVTDVTPANMMEDKKKYTPNDKEQTYVKSNIVKSVPNSTCDKNNCMQFDTV
                     NHHIVPHQRRTIRGKPSFTRCYNLKSGPCRDHGHYVAWHLPRIVAECRVMGAKPGDAF
                     IEHHSGCQHEGTHPVRTDCGPVNGSTKDYRVWEGIVEEKPPKITGNYNGYSGSMKSKD
                     VDNGCHPNDCMISTKHGQVAIQHLNIGDHVYTPSGYEPIIGFFDKNNNKTAEYYEIAL
                     ENNEIITVSRHHAIPIDGTLTDPSLIKSGDIVNTLHGITTVTSNTMISKQGAHHFIVP
                     SGLYYIDNVVCSDYTMHVPLIVFNIVHMYILARYNMGIPIIYREQSILSPYWPYHILG
                     KMNASTTTYNACSIIFVPIIIVTEFILSIYVNLCKK"
     gene            39274..40410
                     /locus_tag="ERVG_00045"
     CDS             39274..40410
                     /locus_tag="ERVG_00045"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15923.1"
                     /translation="MNLKDYANMLLRGDDGKSVVDLMLEEIEHKCSVRVAMTSVRNII
                     LQGSDPRRFHPKHAASIKALKELGKTTTVAAKQKLKTFISGDLKYKYNAKRKVRKQGY
                     YFDDEEMDTILKGIEIFPDNMKTFVLPKEIARECIQIAQHNLQVANENIKIIKNTTIN
                     INICIDYIEFAIKESAKRNPEYIVSDKKLGTCLLAMSGRRTSEIFNGKSRFKKGKTQT
                     TVIFDGQLKRNNAGQESIDKSYEIPLLCYSDIFIKGFNTLRKLQNYQEFTNKEVNAKY
                     STNVKYWSSKLFPIVPGRKSTDEEVTPHDLRRIYVVAIFEMYNYEDVRIGINSVAKKI
                     LGHTSIDTSINYLSIRLNGLTASFPDEYRLDLSSGNRKIKKRRI"
     gene            complement(40407..40979)
                     /locus_tag="ERVG_00046"
     CDS             complement(40407..40979)
                     /locus_tag="ERVG_00046"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15924.1"
                     /translation="MYAPNRAPSGSISGNNVETGQVTQEKPPKNSTYFGREFTPAQVD
                     AMKGAIGEIYSFMSDNRDKPTITRNGIADTPQPPPPPTNNTPPPPPSGPIKQFVPTAV
                     ETVTTTNETTAPVGEKIYPVTAEYVIMMLLVIIVILVYLDYRMRARVSHMENMIRYME
                     YGNPHMMNQNRYPMHQTPYMGMGYPSPMYI"
     gene            complement(41024..41575)
                     /locus_tag="ERVG_00047"
     CDS             complement(41024..41575)
                     /locus_tag="ERVG_00047"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15925.1"
                     /translation="MKLPGSLIKKRATAVEKYNKTHKLPTDTRKSVSAPTPSPIHSPV
                     AMSAAPAEIKYIDSTVESMSKITPVVNMMMSKLEQLEKKHSPEPVRVTNTSPIVDAVV
                     PVDVPVDVPAVVPAVVPAAVPAVVPESPIPELTEADLQKKSKPELMCMCSTHKVYVKL
                     PATRKVLIAALLNQQTLNSNKKD"
     gene            complement(41626..42684)
                     /locus_tag="ERVG_00048"
     CDS             complement(41626..42684)
                     /locus_tag="ERVG_00048"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15926.1"
                     /translation="MGGPGSTFSETDVRHFMAIGNPEQIDVNAKVEPTLSSSAPRMPA
                     PKPQDGMEPFTLSAQQQRGAGALPRIGEGGTEYDSSSSEGEPISSRIVGGKKPEVKKP
                     QKSERTVRPTRSTASAPTTAKKAMSNSGSDSDSYSDYSNSSDGSTSRRARTMAASKVS
                     SAPAETTVSSTAESTIKYDRPSKQDMLYELDRFVETHNVTLSRHFTISDHIDDIEREL
                     NMHRQQVSDASMIVIMREGLLALTAGVEMANSRLGLLSLDGWSNEVSADSRRYDPTLV
                     RLKQKYMRTSVLQPEAELAFLLGSSAISFHIKSRNKKIESAARRESRRKSTKNVEETD
                     DEEEELPSTFTEQKAAPA"
     gene            complement(42743..43132)
                     /locus_tag="ERVG_00049"
     CDS             complement(42743..43132)
                     /locus_tag="ERVG_00049"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15927.1"
                     /translation="MMNNDPQAVRLFKRMEDDVMHMRFFNIILESVLIGLAFAIASAW
                     SDVIVSTASHWLTTWAIPLQKLIAALFVTLFSIIAAALAVFLLVVKPQQRAADMARNT
                     HVPRSREMTHVDIERYRGAIAPQSRGL"
     gene            complement(43159..43515)
                     /locus_tag="ERVG_00050"
     CDS             complement(43159..43515)
                     /locus_tag="ERVG_00050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15928.1"
                     /translation="MYSFVQYCRLPYHLQDDDSKSLKCTLINSVIGGIVAFLVGIFAM
                     SLKIDIKLALYFAIPLSIFSTIAVYLQNTIMRKRELKKRDARYLEHLDELNVMFPKLP
                     IDKREGIALAQANRNS"
     gene            complement(43526..43747)
                     /locus_tag="ERVG_00051"
     CDS             complement(43526..43747)
                     /locus_tag="ERVG_00051"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15929.1"
                     /translation="MDTPTESATTFVKECNDRIDARIALLISSDQSGGDLDEFSKKIA
                     NKKLHLIIKVLVLVVIILLLVVYLLQKYL"
     gene            complement(43785..44162)
                     /locus_tag="ERVG_00052"
     CDS             complement(43785..44162)
                     /locus_tag="ERVG_00052"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15930.1"
                     /translation="MISIGLPNILKACLGYIVIVLMDAIWLPFSTYMEFYPKLDDTHI
                     LFAILAWMSIATLLSCGDVSSGKDAAIFGMYVGLIAYSTWNFTEAAVRKDWRNTAIIF
                     DLTYGTLLCTFTGFVVYKIDALI"
     gene            complement(44196..44537)
                     /locus_tag="ERVG_00053"
     CDS             complement(44196..44537)
                     /locus_tag="ERVG_00053"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15931.1"
                     /translation="MAPPTRRYQDINPPATGVDANGNRINITQVQAGGATTYLVQRRS
                     MMELFYVGIYTGSAFSVIFIISDSIPIFVDEFTPDDWNPAAIRGIAVAMWIVINLAFV
                     ILLSRIIPLND"
     gene            complement(44562..45905)
                     /locus_tag="ERVG_00054"
     CDS             complement(44562..45905)
                     /locus_tag="ERVG_00054"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15932.1"
                     /translation="MSKTLDAIHMSDNRAVFKTNALIVKVFPKNDSGKGSRSFMVIDD
                     TTKETPITVKAWGDAANQPLIEAGKCVLIPGSVNEWNGRKSLNLNFAMKLADSSIAVR
                     LNTLWENVKDKYSAADPVVKTISTLSDANTSENGTVVKDLYAVVRDVYPLAFSKNDKP
                     MRSLSLRDNEVEQFYIKVFGDDATKEIEVGKLIKISFGRVNIFNENRSLNVNTMPMQV
                     ETTPNVNFNEWYSKNSVFFIPSQTRLSVHDALNYDMQKNPVVAMKHIVVDTIEDGKSV
                     DRNNNWKRSFTAVDKSVTESHINITMCGENAETVLEEGDVVSIKRVKLSTYNDKVTGW
                     INNEPPIVVNDTELHEWWHTTKSTTKPKTITSHGLNVTVDRIHSMTPGCRVHLMNVSV
                     GKMGKKHIIVGDTRNVQLKLPDDVPEFTQLNAEIRSAIVGNGEITVTNVDDFIIM"
     gene            complement(46292..46804)
                     /locus_tag="ERVG_00055"
     CDS             complement(46292..46804)
                     /locus_tag="ERVG_00055"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15933.1"
                     /translation="MDSMMMTPPTPNRRIRVIFLTILVAGLLAYIIIQAVKPSILPNE
                     FRLFRSPEEVSFSASSIPQESKVTDEPDLAFDEDTDAVPAEAEGPIDFENPPKSIDSE
                     VLAMTSRPEMDTIRESNNAIPQRLMGSVNGAVQIFRAQTSGKNETVGDEFGYNGPDVT
                     QFNGTQGTLD"
     gene            complement(46835..47404)
                     /locus_tag="ERVG_00056"
     CDS             complement(46835..47404)
                     /locus_tag="ERVG_00056"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15934.1"
                     /translation="MDLDQKVLIASIVICIYICLHARLVAIKHTPDGGADFRIPLDIF
                     MTYAAGALTYVAIFNGAIGVEQVIRHPLMGITFFMPLFIFINEIKRDRDWVDEVKVKD
                     GYGIFRVNVLVSVAMAAAGMMSKNTKVRVTSLAMGMGAVVMPMTTSLPGSSQGAVMDA
                     AQRVGIITTTWAVVGVVAKELFEQEQLKW"
     gene            47455..47772
                     /locus_tag="ERVG_00057"
     CDS             47455..47772
                     /locus_tag="ERVG_00057"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15935.1"
                     /translation="MTTVDLTYLLVIGIPLLIILCVIMFIIGRQSGKKQVYRMMNGGQ
                     VHDYPSPVVGSAINGGVKFDKKTWAAINHYDTLSPVEIARILRERHGEPKNDQYPSPY
                     GDM"
     gene            47820..48473
                     /locus_tag="ERVG_00058"
     CDS             47820..48473
                     /locus_tag="ERVG_00058"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15936.1"
                     /translation="MQVNMPNTYVMESEESFLNDHNVRCVSLSFKHSQHTNKKAKQSI
                     LLSKQQYIDVLNDIKAWKYIVFNHPLMSQDTKIKMRITPDGVILDDTPFKYGSDYRGF
                     RNYMSYFLQPPTFPYDEDDDVWFLLETAHKGTIDLGGSDIIIKQRLDFLKYRETTYNN
                     RINNPLTPEDDKCGKFSWKLIGSREEIHPGEEVASRIISYDENEELLFWAKRPRLME"
     gene            48504..48869
                     /locus_tag="ERVG_00059"
     CDS             48504..48869
                     /locus_tag="ERVG_00059"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15937.1"
                     /translation="MDAKLLLVGVFVLCFIAWVTHVKTLSYTEEHQTMVRNAVKQCKD
                     WHNVAETTKKAFNASLAATRAAVYLDAVRLSVPDTDIEKITGVDISKLIVDVEKTQVE
                     KIKTVDPSTEQSAIANVIR"
     gene            complement(48921..49631)
                     /locus_tag="ERVG_00060"
     CDS             complement(48921..49631)
                     /locus_tag="ERVG_00060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15938.1"
                     /translation="MKTSTRYLIVAVVMCIFLCIVMYLFIDSSKPAAVPSGPCGKGGC
                     AENTNVVPPPPPEPNVNNTPTEPVVSESNMFTTPVSIPEDDEAAPDMVDLGDLDDTTP
                     DVPSIEKALRAFGVPSFMTEAMATVGDKVPPIVMTEDQYDELKETRKVVHAAIEEIYD
                     ATEEVEAPLDPVVDSITEPVTDEYASSDSDEVIPDTVPDTVPDTVPDTVPATIPDTPK
                     KRRGRHHPRVFMVKKVSK"
     gene            complement(49678..50241)
                     /locus_tag="ERVG_00061"
     CDS             complement(49678..50241)
                     /locus_tag="ERVG_00061"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15939.1"
                     /translation="MSVMLLCIVVVLSLKPMKQDNPARSSVVKLLEREPEQEDIDELH
                     TKPTQEKEETDEVIEEIRHSRNDHLPSLPNDRVGNEYNRNRQDYQYASAHGDDADMVG
                     KHNIRVSAFDPKHKTSGYGADYIGVRRETLKYFENVTHICINNKLYTIRRIDPHSSDT
                     HAYIYITEKIEDHENISVGTKIKLDIC"
     gene            complement(50373..52592)
                     /locus_tag="ERVG_00062"
     CDS             complement(50373..52592)
                     /locus_tag="ERVG_00062"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15940.1"
                     /translation="MGSSANAVVTPLPFAPPTLPSTSPMPPSTPPSSPPSTPPPLNPP
                     SPPPLNPPSPPPLNPPSTPPPSSPPAPPVPVGTECDCSSGEYPYSNGVHLGDNAGCFH
                     DYRNLPGPPLSDSQLCFTAGACPHAYTDATSEPLEYISYWLVKYPGAYMTRCTAPPSP
                     PPPSPPPPSPPPPSPPPPSPPPSTPPPSPPPPSPPPPSPPPPSPTPPPPSPPPPSPPP
                     PSPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPAPPIPDGSDQCACTTSEYPYS
                     NGINIGTDTGCFYDNNDTGLHVNYDSSVRLCFTVGDCNHAFKNVPTVQDPVHDYIGYW
                     ITKHPGAHVLPCTAPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP
                     PSPPPPPHHHHLPHHRHRHHRLPRHHRRHHRLPHHHRRHHRPPHHHHRHHRLPHHHHL
                     ATTAFPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSAPPFSPAGVDATHTITTSG
                     KVTLASNTAEDLFTLLQNGNIGHGRRMDEAILQSILVEQYTDFTVESDTTTAQLFALL
                     RDSGCQTNCRVLYVNTNEYRMTRDITGTTVPMHELPSFMVPMTSPILSIGDVYIKVTL
                     TYISGENSADEFATQYVSLLSEYFGTTFSAPTDIATVYEKDEKITDSEIALASVMSIL
                     GFVLVAVIVYKTIKLLKKSKEATDVPSDIPTLTHDPVVTPTGPSVIVPTDMSGIPPV"
     gene            complement(52760..53182)
                     /locus_tag="ERVG_00063"
     CDS             complement(52760..53182)
                     /locus_tag="ERVG_00063"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15941.1"
                     /translation="MVHDTVSKWCTHYGAAYYQGIVRKNGRPDYVFDTDGRDAIKTIC
                     QVNDPHDDATVSQEIHNAAVRRGESYANRMEVMKEREQQRLHLKMMPTKNVQAVREYD
                     KMYDIPGSQDLDRQIFSERHARQLQEMDAYRPIDYDEV"
     gene            complement(53234..54178)
                     /locus_tag="ERVG_00064"
     CDS             complement(53234..54178)
                     /locus_tag="ERVG_00064"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15942.1"
                     /translation="MLLISNSKHMQTPYNGIFLKSETAALLCNNVLKLVIDVYKPVYL
                     RCGKDAEIMTACMEAVPAQFTEEMYEKYTRQICNRNRDFKALLCTVIKQMASERHEKD
                     GYRVVLEGTEDVVGKVFVKRFLIAMAASDSVRSGRFFDPNQTVECALVTQTNARDCLW
                     GIADEFIRVENPDDATSDVESEASTAVSKRKRNKKSRRARSEVSVVSSVSHAAPSIND
                     HDIQEDDVDEDDWGDVDDTIKPMDSVSQVFASTDNRSHTSEPTQIKMSPPLQFPPKSA
                     VYTPPSHHPPQPPPPAQYPPPPPPPPPPPPIRSTGYYS"
     gene            complement(54203..54667)
                     /locus_tag="ERVG_00065"
     CDS             complement(54203..54667)
                     /locus_tag="ERVG_00065"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15943.1"
                     /translation="MSGSDVDFYRESYKNRENLKKSDGGQCYSCFHEFKYSGVEDWAD
                     ADLTAICPHCMVDAVVPYNKLPDDLDDCKDLMEAWHKRGFGTAKLNHEDDRKKLEDDI
                     PQYESDPDEGVKKTINVFIDKTTKSQPKKVGRNDQCPCGSGKKYKKCCVTAE"
     gene            54709..55398
                     /locus_tag="ERVG_00066"
     CDS             54709..55398
                     /locus_tag="ERVG_00066"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15944.1"
                     /translation="MIKSLIVVGVAVVLIIVTATQNTKSSIGVSIITSSLLLAYIVGI
                     VYDSAYDTPTSLGNVAPMAAPPDPVRRSSSTSDFLHSLPLPTTDPGEHTPTGKRLTPR
                     RRRKIMRSIKSAAKEHTALLSKSPEIQSIARESGITPKQVLHRMTSYMPSLPSARTTG
                     AVTLGMLTAGAVHHLNGHGNSQSVATGGSTLGPFMSAANHSNIPRVVMQEPQFSHRNM
                     PQYVRSQGLFG"
     gene            55437..56228
                     /locus_tag="ERVG_00067"
     CDS             55437..56228
                     /locus_tag="ERVG_00067"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15945.1"
                     /translation="MLHKFETHRYKLEYIEENRFESDHVLLFIHGFLGTKETWDKVTR
                     LIGTNHHYITIDLPGSGNSSNVENFSYTLSELAEIMYEFVEHLNLKSIILVGHGTGAV
                     VASMLYEHIHAYVIGMVQLCPGFHMQPSSTFQRLPRCMTDFVAGKMCEYTKRYTFLKQ
                     SHHEAHNASYYIEHFSKSARPDVVSKFLQGKDPPYETFINIIDRPVIVIVGRGDTISP
                     PDTVINLTKINRNFEYRQVETTSHYLQHEFPQVVANLIKEHIIKC"
     gene            56249..56506
                     /locus_tag="ERVG_00068"
     CDS             56249..56506
                     /locus_tag="ERVG_00068"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15946.1"
                     /translation="MTTIDAMLPVVIIVFFIFWATVAWCQWNSKRQMRNRIAQQRAAA
                     LQTISISTTSRTHAPVYESVPGQVAVAMPVVVAEIVTPTNE"
     gene            56418..57851
                     /locus_tag="ERVG_00069"
     CDS             56418..57851
                     /locus_tag="ERVG_00069"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15947.1"
                     /translation="MPLCMNLYLVKWRWRCQLLLLKLLHQQMSKLVDEFINNICVIIN
                     MKFTRTKAVASKALRGAKLIRLQIYQRSKYILAALVILLVLITATLAVMTQTHDLFGL
                     RIKASVKKPSAMRAIISGDLADTYDDAEGIVSLSYSDPDSASNSPHYCGGTLINNRWV
                     LTAAHCIYGHGREDTLEDSIKYIKEYHHARIGAKKSHEENISGDEFGIRNVIVYPNYN
                     KNTLENDIALLELDREVGTDIAKPMKVNSSKSWSSQTEDVVTDVQQPPKSQIFTDGNI
                     MIRNSSVIAAGWGKTKMSDTHAATVLKTTDLTLVATDAGQCVPISSFGAPGTRSGIHL
                     TDQCICASGGNSNRGICQGDSGGPLFVHDGDTNVLIGISSFVAMPCGTPNTPDVFTRT
                     DTYTDWITWYADREKIDPVVEQMVLENGDDAPFSVEPVLTPYDDKGDIMVGIIAAAVA
                     VVAIGTITSIARTLRLRKSVDNINEAS"
     gene            57838..58485
                     /locus_tag="ERVG_00070"
     CDS             57838..58485
                     /locus_tag="ERVG_00070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15948.1"
                     /translation="MKLHKWLKYSLTKELVDYIKTGKLPEWIERAPSTSKWKDRCDKL
                     EGVLYDIARTVDYKLSERYQTFIKLANSSSEEYHSYVTNKACPVIEDVSTYAHRLKKA
                     LFDRHSYIRKEYKSHQDEILEALEDGSHRYKAASEILNEETMYIETKLQQEVAEYIKK
                     FEQYCINKLVPLISAIELLPLITIPRNYHKTFEEYIKSKRSYTDATVIKTIKNQL"
     gene            complement(58503..58982)
                     /locus_tag="ERVG_00071"
     CDS             complement(58503..58982)
                     /locus_tag="ERVG_00071"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15949.1"
                     /translation="MVNGNETMSNIQNLARYYKEYVFESTISILTDMENQDNADVLAE
                     NYINIIRNANYKQIITECDSSLYKNAFAPMCIDNVSLRVDLDKITVLVRKHDLEIIAL
                     KSDNAKLLSDNAKLLSDNAKLLSDNAKLFSDNAKLIFINIAFIVCIFSQYIYFAITC"
     gene            59058..59534
                     /locus_tag="ERVG_00072"
     CDS             59058..59534
                     /locus_tag="ERVG_00072"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15950.1"
                     /translation="MELSMKMVMGLGALILALVAVIGYLIYDKFWGSTPAPSKVEQQD
                     KPHEFKIKNEEILINSADELNTLVKESDDAGVTVFFGHPGCGHCISSIGAYEEGAGEN
                     AGKTAFVAQYNVVGDAVDAFGVEGFPTILKFKDGGNTKQEYEGDRSADSFKEFIEK"
     gene            59593..61638
                     /locus_tag="ERVG_00073"
     CDS             59593..61638
                     /locus_tag="ERVG_00073"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15951.1"
                     /translation="MGEHSSASDHVKQIDDKFTRALGHASKTVKKNQIVFETPKNKRG
                     SKQFTEEYRHVSKIEEELPPHDSELWANPYETMEYFHAYLGEHFNIEDNEKNITCASR
                     EPTIDMWQLAATIPLLRVDELLVIAGTGTGKSWVMSQAARMFMIKQYLKQQSDITDIV
                     SRDPSHVIYVLRDDKAKQQQYVEFMKNPSIIGAAEKYFTEADKIKFRRGQSDPSQNPV
                     VDTRFSPRRGLVKIVTFMSYAQAGNFLELHGESAFNDAILIVDEIHEIQIAAEAAGAT
                     WKESVERFEQYLSNRVESENKGLLLALTATPYKSLDGFVRLMNYFSPIGTEPLSMEEF
                     SEQEIDPVLGEQMKLCGIDRTFYNDISTGRLNGFRFVFYSIELSDQVYAQWFAQPEII
                     KIHVPTDRSEADVSWIMGIANVKNNRYLAGHKNIGMDQKKKWTPRGLNWSGRQRSIAI
                     TTADYVNIKIQEDGIEKTIIFFPTDVGAKAFSKFISAYQPNIDVIYISNEDTKNDVET
                     KKSMFDISDDNTMLVTNSDKFGTGHTFADPVMLSNGLSMGPKHIYYIQPSTYAGMIQI
                     EGRARRRCLHAGWGDILPKIKRSIILPVATVDNQEMETCYSIMKQVTDLEKPFVESID
                     PAIFNASYTKHAFWSRRPLGLLYAEKEDPSPNKKYKIGKRNKQMNIWDIIAHYLGIS"
     gene            complement(61658..62431)
                     /locus_tag="ERVG_00074"
     CDS             complement(61658..62431)
                     /locus_tag="ERVG_00074"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15952.1"
                     /translation="MYYNELCNNGYTILKNVMSKEACDNFLSDIIMPALERHGVVDGC
                     IEQSEEYKAWDDDTGAVITGEDNGHPIPLHQDKWPYFFESPVLNSFLDYAHGGSNWEW
                     TDGAKFGMGWVHLRYPVGDTGEWEPPDEYNGWHIDGDTDRQFTSKSLVMLPFLTDVGN
                     GGGGTAVLPGSHNAMMGFMYNKSPEKVESKLPKFIERTVRWAHHPNKSYLNNMCVTEA
                     TGTAGDVLIMHPLLLHCGSVNLEGNPTRVTFNMSTGWKR"
     gene            complement(62436..64298)
                     /locus_tag="ERVG_00075"
     CDS             complement(62436..64298)
                     /locus_tag="ERVG_00075"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15953.1"
                     /translation="MDQRRWDQLGFSELWNQTAAQNVQQAPVSSRAFPMSYAQYSPYG
                     GYHPGIPYTNAYQISNSNASVLPVANAYTPPVVNVYAPPVANAYAPPVANAYYAPPVA
                     NAYYAPAPAPSNTGNKRQRSREKSKEKTAEQMLEELANTPSPQMIDKPVENVMKDIGK
                     TNKKINNVIHDDYSSDEERPLKDRRIASTTVTKNDESSDDEMPLSQRRVNTKKQQVLN
                     ALTEEKAEWQRDVLEYFKDLGVTRYESDCAYVMSNRQYPSGCFMASATNLLANMVMKF
                     PMLAKKLDKFSGNNYDMRIDEYLKGTIPINAFMAGGDTSVRNDANYTCARIPTQAWGL
                     YEVINTTKPSTSVLSNSPNPPSILTIETVPQFTNRLSSVVIHELLPGREDFNGKTFIS
                     NHNVVPRQRVIERGGKAHDFLMCLLANSGTRLVFTQSLFEHGAININQIPNTLMQEFF
                     LNAAINAYTGEDGDILHTIRLKVDKRAYNILAKPMFEWILHMGQLGAAILSNYESDMA
                     ERSGISAYNDVYFVGANISYVNPRKQRRSHVLSLIPCNDGREQVGDSAGGNDAVIVNT
                     LHRTGLAWPLSGDLPQLPLMDAIGLPTVKGHRRISAIAFQFYQPKTDFDPSRYD"
     gene            64368..64841
                     /locus_tag="ERVG_00076"
     CDS             64368..64841
                     /locus_tag="ERVG_00076"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15954.1"
                     /translation="MYIDMIDQNKLTDSNKLSFHLATAEYRGKVVCSAPNRAGTHAEV
                     SLLRKHTMQRYRNKNITVYVTRLSKNGHAMSRPCVSCSRYIKAYWPLATVYYTNAEGN
                     WVRDNNLDTNHLCLSDRMNLATAATREKKRRPRSHSDTGSSSSGTESTELCSECE"
     gene            complement(64892..65242)
                     /locus_tag="ERVG_00077"
     CDS             complement(64892..65242)
                     /locus_tag="ERVG_00077"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15955.1"
                     /translation="MTLNTDEVECNNAGGNCPKYDAVKADGIKDSKDSKKVVQSKKVK
                     ADRKAKRAAAKNEMTRTKRLVRAAKFWQWFSKKTPEVQFEVTATAPPSRSAGMAAPAT
                     DSSGAAAKGANVAK"
     gene            65311..65928
                     /locus_tag="ERVG_00078"
     CDS             65311..65928
                     /locus_tag="ERVG_00078"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15956.1"
                     /translation="MDYITSTHNDHMKKLAVLKSQIDCDGDVCKRVKLVPPKVYDKWV
                     NTVKLSGHYKDEMDVAQRRFNVLCNLLFKDRGDFMVTSSNHDPNDVVFVKENNIYCDF
                     GKMDISKITESQKNSFFVVRNFLENAVSNEFDIIADCTELTLSQTFSYYRHANQDQHI
                     AAYLLVETFEKLPSSLVIKTPNIAYKAIAKLISRLFDSKIKIRIE"
     gene            65977..67131
                     /locus_tag="ERVG_00079"
     CDS             65977..67131
                     /locus_tag="ERVG_00079"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15957.1"
                     /translation="MYSHKTTIPVVHAIPIINPRKRSAIMNEFLTETEDLPLHKRKKA
                     KDALQQIFNQLDREFYDQRNDFVSKTEELNEKMNAFQTTADICMEVEKQLTHENEKLT
                     EEITTLNKIIQETPSLKCSVCMEDLHSLIRDGIEMISCESNHIFCAECLNAKTEGSII
                     NAPANGVLRCDHDKCKHNLCDHFNFNTIVSKSTRRKFENACMEARVRKEVEENNTQVA
                     HGIVPGAFVCKRPCCGKPMPINFNGCMSFDCPDCNACFCGLCMKVFKPKGNNLAENNV
                     LFRCHEHVSTCKHNVQAKNEDGVASYYINEQAQTSVTRALWQKYFLTQRMLIDHNPAT
                     VRKLLGLKPSIQKMTAFCASLGLPIGPYGFVGTLGEDRHNVPADEVIILD"
     gene            67154..67858
                     /locus_tag="ERVG_00080"
     CDS             67154..67858
                     /locus_tag="ERVG_00080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15958.1"
                     /translation="MEYAHNKCFIPKSRRKFTSATNTTHRHQFPKPNDMSLRSSARLT
                     GITKPNYREVSTISSLVSSFDFNAMQYQMAPVTKKSPLDLMIPAMRKRVTRSQMLKNA
                     LASHGLEKKSSPGDGNCLYHSLTDQINATGLYSECNHISMRRSIVAHIYRNYDFYGNF
                     LEEKLVTKLRLGKWGSHVDVSAAADLFNIKITVIKYNGDDVILPRHNNPDSVVGSIFL
                     CFQSELHYDSTARVEY"
     gene            67879..68511
                     /locus_tag="ERVG_00081"
     CDS             67879..68511
                     /locus_tag="ERVG_00081"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15959.1"
                     /translation="MDFKEMFENEQYQVINLEHDCEIIKGRMRADLMPTPDELTGLWD
                     SRPKTRDTYSIYGKVVNVPRYFTFYSKRMLLTAFGGQTFCADMVKDASYTSRVMEQCP
                     DKYNYNSVLVNWYMTGNDYVSLHGDRERGLVQSTPIVSISLGGSRTFQVKKNDTKELV
                     YQEMLNDGDCIIMKGTDFQHKYKHCIPKMIAKKHGTVLPRINLTIRSYYI"
     gene            complement(68513..68926)
                     /locus_tag="ERVG_00082"
     CDS             complement(68513..68926)
                     /locus_tag="ERVG_00082"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15960.1"
                     /translation="MVDFLTYRLNMAEDNSVTARFVLGLAIVAGIYMFWKMFIRRESL
                     ATKLEKRGYSNGAIQQPIGAPDVATQLQDHERDQKMLEQHNAVNNIHPSDEAKKPPAI
                     ARLEQVAEELKRDPDHQQRASARMSAIAEGDEEEW"
     gene            68908..69402
                     /locus_tag="ERVG_00083"
     CDS             68908..69402
                     /locus_tag="ERVG_00083"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15961.1"
                     /translation="MLENLPLTIDQQFHDLDCKYILPSNLPSLDSTLFPQTPDEPRRK
                     SRGISPEEPINTLPPLCVLAWYGATFDLLQKVILSHPRLLTPKVVLYCLKYKDFEMVA
                     YFTEELRILEEYQPKAILFRNSALIAQAFNDRSSLRLIHYLSYVINKLNPSTIHGQNH
                     PLLM"
     gene            69468..69845
                     /locus_tag="ERVG_00084"
     CDS             69468..69845
                     /locus_tag="ERVG_00084"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15962.1"
                     /translation="MGYSWMSYASAAKHIPEAKRLRVSTVARSSGGFMGNYKRAGSSS
                     KMNKRPLGRNTVGGKTWGQKREAFIKRHLAQYKKNKTERRWYALVMWAYKPGTKPSVK
                     NKKSKRKTTKRSMTKNRPRSTRR"
     gene            complement(69831..70796)
                     /locus_tag="ERVG_00085"
     CDS             complement(69831..70796)
                     /locus_tag="ERVG_00085"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15963.1"
                     /translation="MHYKTDTFNSISMPTACDHHSSLNGKRICIPIYIHPHEYIESTV
                     TARPSVYNKSPYVGDIHSEKDNGITHMPSLDLGGKCTPGAAICVTQKMDKRGHHVKQE
                     YSKKYGTPATMYITQLIKCTYSDIWIGAHPSQGEKLFNFYASRNHLPGFQDVVSIQAE
                     VANVAGCDMRSDFLVKHADGTYTLVEVKTIVDLDRDKSPKSYVDGLSIFPWGKPRQKD
                     DLTGNKVVSSRAIKHVRELTKIATQENQDPRYPKLKTAIVFMVVRNDATAFMPDYRTC
                     PTFHKELIVAKNKGVKIVSYAFNMKRNGTCPFISELPIVYNLSTS"
     gene            complement(70824..71369)
                     /locus_tag="ERVG_00086"
     CDS             complement(70824..71369)
                     /locus_tag="ERVG_00086"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15964.1"
                     /translation="MSAPAHKVYPPTGVPYSTYTFCGKNLLHVNRAIKAIRRNDFKTL
                     DFMLKTNPSIIKGGTRKPIIFYAIKYQKHNCLDTILQNDGIKHLSRAEVISWLSIYFN
                     INVYTTWKTTVPSSSWDDLSVMLRYAVSDNYMGAKNLGKIEAMLWYGACPDKDCGYPF
                     TTREYAVKFNVPCVHLFRDCI"
     gene            complement(71374..71865)
                     /locus_tag="ERVG_00087"
     CDS             complement(71374..71865)
                     /locus_tag="ERVG_00087"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15965.1"
                     /translation="MSSIKNPEDGPSILEKIKKRAIEYKKVIITVIVVGIVLGLVYYF
                     TTRDSGIIDNDGVVGCPICENPSCAAEQAEINTLKGEIVILEGHKERLEGRISTLETE
                     LDDTEDALARKTRDFIGSTIGLTFATILTGVGTFFITRSVYGGSSKSTVAATSTTSTG
                     TSP"
     gene            71923..72321
                     /locus_tag="ERVG_00088"
     CDS             71923..72321
                     /locus_tag="ERVG_00088"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15966.1"
                     /translation="MKNFSSDISAPRQKVASSNTVRWWLSVAIGVLVGNLIFLGIVAL
                     IIRNTNFEEKIFKPIGKAIGEGMEPGMIRASKIAVTSAQKTVYETVDGVQDQAIEGTS
                     QRVVEAVSNTRDDIINDAREVASSYLDQYQ"
     gene            complement(72322..73200)
                     /locus_tag="ERVG_00089"
     CDS             complement(72322..73200)
                     /locus_tag="ERVG_00089"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15967.1"
                     /translation="MDSLGERVIKYIDNSSVTDAHNRVIVDLPNILSNPKNNEFLDDA
                     DEFILVTKLESIVWHYNKKREILEKALNKYTNRHYHIIIIDLPKCSAKNDLVSCTKYV
                     DTYDKSYNTLSEKPCATANLQGNTYITDMSTVGHDTCSPDDMIQILLNMSAHGNYRGV
                     LSRDNNILTSFQNSQFNVDLSDFDKLAVSGIMIMSGRGSEVADYPYNYVSIYNSNGDN
                     VNTYEQPLFEAVMDMVNHYLNPPGRIVYLEPYFALPEYVQEKLENDNYNYLSRRRYTG
                     RATGRATERNWNTLRN"
     gene            complement(73220..73813)
                     /locus_tag="ERVG_00090"
     CDS             complement(73220..73813)
                     /locus_tag="ERVG_00090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15968.1"
                     /translation="MSTVPQSRKNVKRTFADDLMDNQYRIRDENSALKKEIKKLRLEL
                     DATHAAVDTWMLEAQGIEADYIEAEGRMDTQCSAHAAELLKQNQKLAEKNAIISNLLA
                     TVGGERRKANAAKAALKPPDWYTTHMDRTYKKYFQVLEDAQVHPMSEFAKKETIDMQQ
                     EYSKHISSQSKTDLNERAEDFACFTAESINNLFPGFY"
     gene            73921..74400
                     /locus_tag="ERVG_00091"
                     /note="hypothetical protein; frameshift"
                     /pseudo
     gene            74440..74721
                     /locus_tag="ERVG_00092"
     CDS             74440..74721
                     /locus_tag="ERVG_00092"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15969.1"
                     /translation="MSSSQQNLVNDMALSYTRMNFYYSEFIREVGVFRALAMRMRHYY
                     PIRDSCTNNGINRTIQDVINLSSIDTNFVGNRLSVFNTLVSKLTRDIGK"
     gene            74955..75533
                     /locus_tag="ERVG_00093"
     CDS             74955..75533
                     /locus_tag="ERVG_00093"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15970.1"
                     /translation="MDRINSGIAYSQEFVKPLNGSYIATTVGLGFIVYLLLWGMLFTS
                     IGMLATKGNKPLYGSLLGASIICIISFHVWGYRHNKKLGITTFSTQDSSLPSIPVPDR
                     TITIRTPPELRRQDSMTTHTNEHDRFEKEKYLETMNHDPERYNMSYIDGYIFYTVTGP
                     DGKPRKMFERATPQSLWARTKDKIKNYRKKKR"
     gene            75575..75997
                     /locus_tag="ERVG_00094"
     CDS             75575..75997
                     /locus_tag="ERVG_00094"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15971.1"
                     /translation="MANVTLINKLEVLHAKLDIVVSSYTTKGEKISALSELKDYNAIL
                     MFQKNQNDAAIYAQGGITLIKMMKNMTNVNKHTIAHLKDSVESKFFHTLLLLDKDAGA
                     YIKMPQIYDKDIVFPSPDLLTYYLGVKNTLSLIEPCIV"
     gene            complement(76027..76398)
                     /locus_tag="ERVG_00095"
     CDS             complement(76027..76398)
                     /locus_tag="ERVG_00095"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15972.1"
                     /translation="MNTPFHIMLVVGFIAIQVMAFSLNDPSMIWVSIVASTFMILYVF
                     GQFMTAKGYDVAAVQRLKDTGTAIGNAANSVRDPDNKFNKWMRDRAFPNVNPRASAVL
                     GAESRLGRTMRRMGLGSKIEP"
     gene            complement(76431..76826)
                     /locus_tag="ERVG_00096"
     CDS             complement(76431..76826)
                     /locus_tag="ERVG_00096"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15973.1"
                     /translation="MQWKTALVVGGILCGIVINILIILWWVRVSDKSDIIEIFTGASI
                     DQVNTDLNGNFITLDHIELSEKNKEQHASNKCTDLIKNLKLVDACRNVPRSDPCGAYY
                     QRHTDGYASCDTAMADSVKTCEPRKIFCK"
     gene            76864..77325
                     /locus_tag="ERVG_00097"
     CDS             76864..77325
                     /locus_tag="ERVG_00097"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15974.1"
                     /translation="MSTDEYIKKSLTNILKAIKNNDESRLVAHVNALKFLIHLMDNAS
                     ITTILPDIMSLVTSPSREVQRRGIKIIMDLGISPGEFASQLVVTMGNVDSTKNEPSPK
                     RSHNELLLENEPKSKRHVPARIGAVAPVSRAAGSHPPIPAVVDDEETDNED"
     gene            77360..77788
                     /locus_tag="ERVG_00098"
     CDS             77360..77788
                     /locus_tag="ERVG_00098"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15975.1"
                     /translation="MDVLFSKLMFTLGRKRIIYDRDSDEPYLERYYIFLKERTWFPFN
                     IFLHKFLKSDPDDMHSHPWSFATLILWGGYYEQTLNGVTWHGPGSFRVADADTYHRVE
                     LYNKQPCWTLFVPLKKKQNWGFLTPNGWVSHVNYRKDKVE"
     gene            complement(77799..78938)
                     /locus_tag="ERVG_00099"
     CDS             complement(77799..78938)
                     /locus_tag="ERVG_00099"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15976.1"
                     /translation="MLLYYASCYVTTQTDLKRASTCGVHIMKSIRRTPTSVPSKPRSV
                     TGLDLCCNHSSPYNHFESCKHHCGMNIGNKYNYVTDDILISIKNGSTKLDGPPMCGIF
                     NDKCNLQLMHWDNRCKKSVNSFAYFDRLAVVSTVYYTKGNGHFMQETVPSWLRFLMYL
                     PDVPIHFANTRLHVRFINYLSMIGYNTTRFVSTQNLHVRADTLYTWRPYPRWNGPSRK
                     RPLTVRSYDDFMLLKDSLSPKYCANTKPSLLYVLRSDKKSRSFENHESIRNVLSNFSE
                     NSGLEFVPLLPGKMSVHADACEFNRARVVFAAHGAGLSNMVFCQTGTHIIEVGYRKNI
                     PPIYHEQAYFMSLKYHAIIATKGGYDTSLMVSISHIRRTLMSFSL"
     gene            complement(78971..79774)
                     /locus_tag="ERVG_00100"
     CDS             complement(78971..79774)
                     /locus_tag="ERVG_00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15977.1"
                     /translation="MVIWCEEMHNIDHPTRFQPANVATAFFAIVYGIIMLWQNRPIPF
                     NFHTVTAVLLIYAGVGSVAFHAAPIYAQHTHPADLIPVYALFATIVVHVTKVFLTQIV
                     MVKVSYFWLFAILSTGIYVMLIYFANDADTLRKAELPLAFVMIGLHGIVGICQFICTD
                     SPFICLMFYVSVIGLLGGAYYSQQVEAGGCPTWLFEQGISLHAFWHFGIFTVVYLQAN
                     LLYWYEFKFELPPIRYVIAAVKPHTVFCAPHYAVRRQPVAVDMTSVITV"
     gene            complement(79811..80260)
                     /locus_tag="ERVG_00101"
     CDS             complement(79811..80260)
                     /locus_tag="ERVG_00101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15978.1"
                     /translation="MKFPNFKRMFKRNNNKYDPDDMHPNEDTNKVGSFPGPVFYMPDI
                     VFESYRKYFSGDRQLVVPTAKPVLDDVRVMESVYKKRLDDANANTALMPGVVSEIFSA
                     RRVIDQQKEDIKKELSELPTLIMYDNIVRRVEWSPPPEVMEKAVRLW"
     gene            80330..80632
                     /locus_tag="ERVG_00102"
     CDS             80330..80632
                     /locus_tag="ERVG_00102"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15979.1"
                     /translation="MYSMSCYQDRHKSNMELAHQIITTTRKSFHDVIKIHDINPSHLT
                     RSATFNNMCFTVSNLKQDPTMMQCGICGDIRVVRYNSICPCRRVCTGCTGYDCIYC"
     gene            80671..81306
                     /locus_tag="ERVG_00103"
     CDS             80671..81306
                     /locus_tag="ERVG_00103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15980.1"
                     /translation="METRRIIQIVLVVILLLGAFIVSILYSFTSLLGKFASVASIEVV
                     DRDQAEIDNDDSLPEKIDEHEDDVKTTGANPPGENLLPGPDTTISNGNAPLEAPNVFT
                     INAVNGNTKLFRIDKVKFMKYVNDTNQQDSGNNNYKLRAVRIVKNNKIENQGWDLYKS
                     DAFNVEIFNAPGTGQFSPNTSKAQVHGSSDPADVMWDVGDKIAFVTATVIA"
     gene            complement(81308..81736)
                     /locus_tag="ERVG_00104"
     CDS             complement(81308..81736)
                     /locus_tag="ERVG_00104"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15981.1"
                     /translation="MNRLGYIAIGFTVVLAIVGIVFAILGSKNALPGQASLPESNTVT
                     DPGYVADQVEKNCYKLGTEVYHKVPDREKYMRNPRQPTQVLTYNGTAWQAYTTDRVAR
                     EGVVYQFITESSDALPANGDWVIMKEQPNTVSGERVPCMQ"
     gene            81779..82759
                     /locus_tag="ERVG_00105"
     CDS             81779..82759
                     /locus_tag="ERVG_00105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15982.1"
                     /translation="MDIPYREIQGCKFRAGHQLGGTCYMAAANAVFATSYAFEHSTNN
                     PDIINYIAGYSDSHLPSVYGSTTCPMVPSYIGDLYNDMALLFNDSGATLQTVYLFSTV
                     ITLAQTTNPNLSSVLLYDTTADIGEKHVKVPKENIDNDYFKIYQIWDIFGRHSNMNND
                     GFDEVQPFDKNSAMVGGGFPHLHLLALLLASGSTPTYSRAKAAAVDHAIDTYVTTNFP
                     TVLALNMRHSKNVTSGQSSQLQNIQDRYFFWELYKVSDKIASRSNCLISGIILSVSGE
                     NGLVHAFQLIPCKKDFIICSYNKCYNTSDPSHHLITKLYSKILMVTFLLE"
     gene            complement(83498..83833)
                     /locus_tag="ERVG_00106"
     CDS             complement(83498..83833)
                     /locus_tag="ERVG_00106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15983.1"
                     /translation="MSAATLSRRARRQRSQARRNEQLIDTEPLSRVTALVRMLGVPVQ
                     HADIRTMFSDECKRVHSTNTTSAVTLICDTLFTHKSEVYTAADVRDIIKSSVVIEASA
                     RAFVGRPVW"
     gene            83982..85310
                     /locus_tag="ERVG_00107"
     CDS             83982..85310
                     /locus_tag="ERVG_00107"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15984.1"
                     /translation="MATQSVPQMPIALAVPMLPVASVTPVNGASKRKLDEIVMTAVEN
                     APLAKRTAFREAFDTVAVPITAYLADSRIPCTETVNRLSAEISELKHQRDDQDAALAK
                     EMSDKYNLEGEIERLKEDDLRSEVEDLRSELETATTRTQEREREIADIRNDFDQLRRN
                     FDDAEAANASITQDLQDAITARDNADAALREHRENTATNTATQPGAVPQCVVCYTDIF
                     SIAKVGGLVKCDNDECSEFLCKTCVSPKIESDLPTLTDEGIKCTNKKCNSPICEASFM
                     SFLTPDVSTKYVRKMGEITAAKESGTCSDFVKTPCGCGDAMRPYFDGCATIKCNKCPA
                     YWDAITFTPFILGENDPNETADELYQRAHGATSRIVREHNMGDSYFINNRAARNVNEI
                     ERIWMKYFITNKAGRDQVLAVFPKFETSTKKKLQEMLTLMGLPTVGYGMS"
     gene            85642..>85876
                     /locus_tag="ERVG_00108"
     CDS             85642..>85876
                     /locus_tag="ERVG_00108"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15985.1"
                     /translation="MDLGASLTISPPSSPKHDTSPPEEYDALWYLTKCVFIDHGDRSY
                     LKASDLKVQILKQTLLDILDAHRQSIHGKHERRV"
     gap             85877..85976
                     /estimated_length=unknown
     gene            <85977..86470
                     /locus_tag="ERVG_00109"
     CDS             <85977..86470
                     /locus_tag="ERVG_00109"
                     /codon_start=3
                     /product="hypothetical protein"
                     /protein_id="AEP15986.1"
                     /translation="VQHQAHLQQVSSNNVTARLNFNFPVLEFYYFLRRKANKDAGDHF
                     NFSGIGGRDPVVSAELLFNNTARVTQKPAVWWRAVQALQFHSSAPLTNIYSYSFSLSP
                     EDPITPSGSANFSRLDSVELALTLQDDFGAAHDANSELFVFARSYNILKFTNGLAGLL
                     YSN"
     gene            86681..87865
                     /locus_tag="ERVG_00110"
     CDS             86681..87865
                     /locus_tag="ERVG_00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15987.1"
                     /translation="MDAMDYEQRRQNVMERFQLLGPPPSAMAVDADTNARIYELVARN
                     FNTNLAYEKVPYLNKRRSSAVDFDVDLLLRMQAGKSCYLFVAVLMIYTSYLRYILEKR
                     LKYLQYIANHTGSMTGAQQRQLESLLWLKKTTKNSEVCDTTLPRDIVDLYTSTAVRTN
                     EMAQQGNTWRPFTVGITLEHGGDPDHMLFSVLNSCGMSVPENNFVGLILKNIPNEVRV
                     DHVYTIRKGFTYSDMTMPDIVNVTTHDVYSRGTLLTHPFIASFDTSTKPEAIDDHGLR
                     VDGNKAEESFIAVLKSVMLYVELFKQKYNYSEITRTHFSMVVIQVSYGHDGEPLYADD
                     AHAVLVDMDEDENVFVFDGNEGKSYPLHVWYAWFTERYIEIENISVAMIPVTDQSAIS
                     VI"
     gene            complement(87893..88717)
                     /locus_tag="ERVG_00111"
     CDS             complement(87893..88717)
                     /locus_tag="ERVG_00111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15988.1"
                     /translation="MGDVNRLKEDRHIYDWISEGITTDLEDPIDKENYNAILNICIAR
                     LMLTDATEALEFVSRFPTIEQIFGYGYNPEIFQYAFNITIAEVINRINQLRINALQLQ
                     RNCNKVLNISYIILMILAPTSTFSEHIPAADFMTFARAVTNNNVQDPDILLNKLFRGL
                     DGDFRIHDEDISTIITAVNNNQMNVVLNEITDVLKLPYSASIDLDMNYNDKLNMIQRE
                     AFRVDSRRLYRPYADMRASFVDLNEIRNLTNPQVLIDNAPNKIMYPYEHYFEAEYI"
     gene            88766..89293
                     /locus_tag="ERVG_00112"
     CDS             88766..89293
                     /locus_tag="ERVG_00112"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15989.1"
                     /translation="MLALTVCIATSFIGSTRYMHTTHTTHVRPYAFVPDLFEVSSLSV
                     LQKDMSDVYLPAITGLTHIFNFYAIFLLFDLYIIPFYKNNGLLSPSKEEILAHNMFLA
                     LDDPLFTPITAEQYPLKEDLDEDELYYVGTGAHAKQYITITDDEYLKYDLVVRSREFS
                     AHYDMDIMICKIVDN"
     gene            89361..89651
                     /locus_tag="ERVG_00113"
     CDS             89361..89651
                     /locus_tag="ERVG_00113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15990.1"
                     /translation="METRDYIIVGLSVALTLTLVAVIIVLVNGKAQQLENPRYHSGDI
                     MDEVNAAINRGEVVAPNVIGIDAEVRRRQEEAAKSRLSDAVVNNMAADYLEL"
     gene            complement(89654..89923)
                     /locus_tag="ERVG_00114"
     CDS             complement(89654..89923)
                     /locus_tag="ERVG_00114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15991.1"
                     /translation="MSVFTIPSDTIHLPSAPSQKIEYTPNFGIRKLFVIIVVIGIISA
                     LAVAALMYQNGDTQKSGIVLMTAGGIGLLTMIISAIVKARSSTHG"
     gene            89967..90698
                     /locus_tag="ERVG_00115"
     CDS             89967..90698
                     /locus_tag="ERVG_00115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15992.1"
                     /translation="MVLNIIRMFLQCEYVMPMIYVIMMACIPLTFIINEEMVPYQTIT
                     INGETHLIKDFRYDHPLIEETVTTSLLAVINSFGTFVIIAVTWFGAYAELYKWKSAVH
                     TLVAYGLAYMIQDFIVAFGKYYIGAFCPNFYDGCGWDNDLGICTVNFEKGRRSFPSGH
                     SSSAAVVFVYLILSMNDIRTVLRTQNNVPIIIDKLLFLVTLLSAFVFLFVGASRIHDF
                     WNHPPDVIAGFLIGGLSACACRYTL"
     gene            complement(90702..91520)
                     /locus_tag="ERVG_00116"
     CDS             complement(90702..91520)
                     /locus_tag="ERVG_00116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15993.1"
                     /translation="MIAFVLHLILAIVTGTVGNIHLSPPIYNTKVTFTYNSSDTGFYL
                     DPYYVSYGGYPITALTLVFFVITAFFHLANATFLNDIYISSLELCFTPTRWIEYFITA
                     SLMSCTIAYLTGARSVLVIVGVCGLIASTMLFGFMSELYNRPMENVDAWERTTFLKRS
                     IPHFLGYVPYMFAWFMILYSFFGGGGTCAAPTWVWIIIMGQFIQFSLFVIPQLYQLKN
                     PPSKFVRGEYIFIFLSFFAKATLGINLLAGGITLENFDAGVIDSNTTCDVIDLA"
     gene            91606..92574
                     /locus_tag="ERVG_00117"
     CDS             91606..92574
                     /locus_tag="ERVG_00117"
                     /codon_start=1
                     /product="fatty-acyl elongase"
                     /protein_id="AEP15994.1"
                     /translation="MFGKYRDLILNNQSDIYHSTTCHYHNWSTLIHTPINELLFPSLP
                     RDCDFGYDIPQFKKHIDIFDGWRMIHFTSSNWCIPITFCLCYLLMIAGTKKYMGPKDG
                     GRAPIRSNKYIIAWNLFLSFFSFIGVYFTLPHHLFDEENGLFVHGFYSTVCNTGAYYG
                     NGNVGFFVWLFIYSKMVELVDTFFLLIRKNPVIFLHWYHHLTVLLYCWHAYSVRIGSG
                     IWFATMNYFVHSLMYLYFAMTQYSPATKKFAKKFSKFITTIQILQMVIGLIVTLAAML
                     YVTFDVPCYTSLVNSILGLVMYASYFVLFVQLYVSHYVSPKRVKKA"
     gene            92454..93410
                     /locus_tag="ERVG_00118"
     CDS             92454..93410
                     /locus_tag="ERVG_00118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15995.1"
                     /translation="MLYEFSKLNPGPCDVCFLFCSVCSVVCVTLRFPKTCKEGIIYKY
                     ISMQINDMSSADYEHIDVSFKNDAYDLYNVHITDNPVFNTIDSLYVITMANSKRRAGL
                     ITQLKNARLTKTAKILINHGYKTGKKEGIVNTTADLLHANKMICMLEQENDNPVVILE
                     DDCEFCASPLELAYVEVLALSGKADGVSLGALMHLSCPGPLGTLRVISGGLTHAMIYS
                     KKTRAALMRMPYSVGAHDTVVYTQTSMIAPRMPLAVQRHYRTENSLTYDPYGIASGIL
                     WILGADRYPIRTYRMFHLIGLFGGIVPLAFFTLAFFVYMCFF"
     gene            93431..93793
                     /locus_tag="ERVG_00119"
     CDS             93431..93793
                     /locus_tag="ERVG_00119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15996.1"
                     /translation="MSIFFIILIALAAMFAVYLLGGYLNIRDKRADNEIYIQQISPYL
                     TIEPGADPVKPIEPEKFVLNPKAYGEQFQLSSAEQSSRARASVVKLEALRQRLASSAR
                     GSERESRKYYTSEDGWHA"
     gene            93911..94375
                     /locus_tag="ERVG_00120"
     CDS             93911..94375
                     /locus_tag="ERVG_00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15997.1"
                     /translation="MCFRSPFLNFLLAFFVISSATVGSCAITFPGIMSSMYGYLVTPS
                     QDINIIAPGLQVSGKAAEYIASATNTRASIAYLHELRGMVKDVGFISASLLLTSCVHP
                     IVGVGVLAMTVTSPITILPPTNNEWEVVREVDALQVPHIVSHDSPILADAWY"
     gene            94311..94790
                     /locus_tag="ERVG_00121"
     CDS             94311..94790
                     /locus_tag="ERVG_00121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15998.1"
                     /translation="MRCKYPILFHMTVPFLRTRGTDKTYVSELKVLSIISSLLPTLIA
                     ELNDSDDSCTADMYALAHHIIFNRAQDLVLKYSKKFDRAQLNDIVQNKQTIDAIQRNY
                     NDGDHTTRREASKRYLYKFKMELIAVHLEKKNSIRGTLTSKICIALHDITEREITLH"
     gene            complement(95081..95962)
                     /locus_tag="ERVG_00122"
     CDS             complement(95081..95962)
                     /locus_tag="ERVG_00122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP15999.1"
                     /translation="MDAVPITRYDFASQFPRHGTFAAIGRRACGKSRLILDVMYNLRD
                     RFDLGIAFTTTTPMAEALAEIMPRGCIFTEFNVDRIKTLLDEQELMMARKKPRSVFLL
                     LDDCGFDTKSMNSAPMKELFMNGRHKYITFLCALQTPMALKPDMRMQIDIVVALKENQ
                     VANRRRLHDAFFGVIPSWHDFERLFMAFTQNYGALLVDQTVQSTDLTKVIYHYKAQID
                     LPKFVCISRKYVKIWEQIKKSQREVMMLKEKKIDEERKQKLVETAKQRGEKIRQVHTA
                     VNARNGDPNAKIVLSSF"
     gene            96012..96554
                     /locus_tag="ERVG_00123"
     CDS             96012..96554
                     /locus_tag="ERVG_00123"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16000.1"
                     /translation="MSYRLYIGHAKHDNGKLCPGSEQCMRIINNNSDLEKMVRVENLN
                     TILANGSPVPQWLDGTPVLVAVDTKKIYYGSSAIDTLKDIQPPVPVSHRNSQKPPGIP
                     LAEANVDPSSLHQFSASHEADPDAVVEQHDEFDWDPGDKSRTETRGKKFDQKELEKMM
                     KERAARTEQLAGPRPAGSDR"
     gene            96568..96966
                     /locus_tag="ERVG_00124"
     CDS             96568..96966
                     /locus_tag="ERVG_00124"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16001.1"
                     /translation="MSWIVTVQLLCRQLPIEIVNLITDPIFCEKVHVLQTHARRMLKH
                     NAERSERIAIRYYETILNNRREPVIIINGKRKWIFNKNIDYAKRVNHVIEHQVDRLPF
                     KNPVYDNTYMYPFAKKRKLPSINRHYYFTD"
     gene            complement(96956..97795)
                     /locus_tag="ERVG_00125"
     CDS             complement(96956..97795)
                     /locus_tag="ERVG_00125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16002.1"
                     /translation="MKWVYLITGFIVSYILTSVVLNGAHPFSILLTSLLVFLTLWITL
                     RYAALTGGAYSAPIPSLPGEENMIHHARNDLEVVNYILAQRLNECNEDKVALEAKVLH
                     HDNVAIPNYAYAFNPKYEQGSIRKGKRPTYNTQDRRDYWYDKAVQAGEVVGAVGGAGF
                     GAAKAIGGYGLGIAENVAGDAWDVAVDVGRQKAGLAPKNGGRKGKKGGKNEHIGKGKG
                     GAHNMGIKKDGNAARPVGRPKKTRPPDDGKPKKKGRPGPKPKNSKGEVMVYDPDLKKY
                     VNP"
     gene            97838..99181
                     /locus_tag="ERVG_00126"
     CDS             97838..99181
                     /locus_tag="ERVG_00126"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16003.1"
                     /translation="MTTEVPELMYMFDEKTELARYTYPSPTDTPFRDYPTTFGEEYVL
                     PQHRDKFLTTKNPIPYFDDNIVMYEGPHVYVCFGRVSSGSVSGVLKPYLKPFNATDVI
                     MVMKRKHWPRYNYVHAAREVSEDNPVIESDSVIVHDMETDKTTFSGWYGDIQDVKDTE
                     KIFTYDRVMTDEEIVQLWSDPCARNLGTEGHLMMENFFNGEVIYGSPEVHAGMHFVRD
                     QMQKIGAKGYRCELEIYGPEEDLAGSIDFLGYSESTNKYWIFDWKRAKKLQEIKGYNN
                     IKFFSHVTESDVGKYSFQLGIYAYIIQKYTDMKIDGLALVSILPDTNWWTWCPYLKYE
                     VEYLMRKRRELVAARLALAYLRPDLPRCCHSHDVAYDAVVDAEGKIWNDKVHKINGTS
                     AATTDFKSKNKVYNELNKICPMRRSVEEENLKKVKKFLDMVPLDGVREYKSCYDF"
     gene            complement(99196..100389)
                     /locus_tag="ERVG_00127"
     CDS             complement(99196..100389)
                     /locus_tag="ERVG_00127"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16004.1"
                     /translation="MAAPLPVFYHDSLMSYSANPTVFKGIPPKGGMRSRIGIGAAYHG
                     KKLPVIEERNNELIIPAETARHLLTDAYVGRPLRQNSKELNLVLPPGTKGRPSGFYSF
                     VNAATMFKRLTVTGSQHDDPFIHGLRMNGDIKQGANPRYMTPVDVAREFNVETQVVQE
                     GLAKAAAGFTELVLQTNNPAARIKGHKSIMFNLPNPHDPTKSKTFPVFVVPAHLNEYI
                     PTVMNLCEKTVIKNLKLGSGRNGTENNLSKMMNYAEFSKDDRLLNSLMSYDVNMRSMV
                     PRSAYAYLPTVQPPEGGASPVPLAVPHAPTLSENRQVPIIPTEVVKRANDGGTPSGKR
                     PRSSLSSSNAASSSNAAYSSNAASSSNAASSSNDIFSGETAFQGTTTDDAVAFRPVLS
                     DSDSE"
     gene            complement(100533..101774)
                     /locus_tag="ERVG_00128"
     CDS             complement(100533..101774)
                     /locus_tag="ERVG_00128"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16005.1"
                     /translation="MFIYSEYKEISSSMKEPFYDRIRYDLYNIIAYSLSWWLVIFFGW
                     AFFITLDIAGCAITDCDNNNGYLPWHYTNIAILFYFALFCISIIHGIFTVYTTQNLTQ
                     PEKILRRCYIIILIPIALNLIFWGPFISNIAKGQYLDNVAPIVPNHKHNITSSDIVVI
                     GNGPITMEQRSIIMTLDHTQIHRFNGMSTLYPDEPVGNLFVRKIKDNSAPSIGVGDFH
                     GLQPPNQVSHLLDKLYNPWSHELSKRSQCYRVNDAHTIEMLFADTTDADFYNTTSGCP
                     TKVSTFPEHAVRTMSKYGTIYHPERLSSGGIVILGSLDRYKNHIHTFGMNFGSLSNRH
                     PVRYERDIILKNQHRITVHKTPYNTYHDFITVKNSWFRRDPRVRGFACGEWNVLWLDE
                     TRFNPAWWAFNLIPIPPFFRD"
     gene            101816..102346
                     /locus_tag="ERVG_00129"
     CDS             101816..102346
                     /locus_tag="ERVG_00129"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16006.1"
                     /translation="MSVCKITNDGIDLANNVDVDTLYKREEVVIQPPASSLRICLYTL
                     DKPGTPVKQSTLLSYDLPPPFDNYLYNSPVYMQFIGGTITSVSQATQLIKLLGEIFVH
                     TDDSVSDSNTLVYEKVEDVESEEEEDDVPEEYYDHNEGSEYEEDEDVAYSDDEDDDES
                     KVEDSSTVYEDDSSLK"
     gene            102393..106870
                     /locus_tag="ERVG_00130"
     CDS             join(102393..105542,105614..106870)
                     /locus_tag="ERVG_00130"
                     /codon_start=1
                     /product="DNA-dependent RNA polymerase II largest subunit"
                     /protein_id="AEP16007.1"
                     /translation="MIPVHGLSTNAKVVKKVNFSVYGSDTIRQNAVTRVNEIALYTRG
                     IPTHNGVNSLAMGSSDRRIRCTTCNELMQKCPGHNGEIRLPLPVYQALYIDHTLKVLR
                     SVCFFCSEICLTDEDKVALMEKYTDDKTRFNHTYAIARTRKKCPHCKGIRPSYVRGPL
                     GIKTEWVDKSFDSEEEQEYAMQKFTPALAYSILDNIKDIDAKNFFGKGLHPRDLIATS
                     VLVPPPIIRPAISTAEGSRTKGQDDITLRLQEINRRGNELRLCMNKQEDSGLPTFLCD
                     ANKVLPPKTDTITYTVVDRLLNVDALTPDLIDRWNRLQADVFGLVNPAAIRGGMPASM
                     ANNNRNSANGKYIIDRIRGKNGRFRNCLMGKRVNFSGRSVITPDSTIDVDQLGVPYEL
                     AMILTVPEKVTPSNIADLRTRILNGPTELIGAQSVINTEGDLISLKSCKNRADIVLRI
                     GWIVERHLKNGDWVIFNRQPTLHRMGFNGHRVVLTKGKTFRLNLSVCAVYNADFDGDE
                     MNIHVCQSACATSEVSTLMAINRNIISAQNNKPCFGIVQDSLVGAWLMTDPSVFLTRA
                     DMLRFRIYVKFANNGTTMLPPPAISKPKELWTGSQLISFVFPYTLMYQRGSISGITSY
                     DTKDLLIQNGQILFGRLSKSTLGATAGAISDIIHHEHGGPKKAVEFLSDVQRVVNQWL
                     LYKNSFSIGASDCVTNEQSHNEVVECIKSAVNNSKMILTSKVPKSLKEMAEGATTRIL
                     SDVIMKTATIIKNNAPPDNSIITCVTAGSKGSPLNIAQVCGQVGQQIVGGERILNGTS
                     GRTLPCFKHGEHATVNANGYIQNSFMLGLQPTEFFFSAMSGREGLVDTAVKTANSGYI
                     QRCLVKASEDNMCNYDGTIRNAQGMVVQFKYADNFDPCKVERIKVEPLLMTSEEIKRN
                     AGPLEYDVIMSLRENAQKVLSQSNKPLMDVVLLPINISRMFESATWNNDVPHEFDEES
                     LLTAVSEVVHEIVKKHPVCKYVVPLYIQWCMRIGNIPEHLNVKAFLCEVKHRCLSSVV
                     AGGDAVGNTAALSIGEPSTQMTLNSFHTAGTGHAGVTMGIPRLKEVMGYSKQLRTPQT
                     TLEFSDKTPEELKAIAAKLTRLTLSHVTENMNVVLEPPGVIDESYPEDVKFALKMDTY
                     FAPDLSDPSMHVGVLELNKHLLNDYNLTPAKIAPIIKSLACNIIDTDVHVSYSEVNTI
                     DWWVRIRILDVSKHFPEVISNKEMCERGTVLRFVKLLCHEIKLGGFNGIEASAVDSIE
                     RWNGEKNEIVNVIQTRSTILHRAYAIPGVDWTKVMTNDIHNVVNTLGIEAALTVIFNE
                     LHSTLTADGSYIDPRHIELTASTMTLRGYVMPLNRHGLNNIKTGPLTRSSFEETSEVL
                     KDAAIFAESEDVSGSVSASIMMGQLSAIGTGRFDVRIPKPESISVKETSRIIKTNGTA
                     TLIHNKEDTWFIPRESASFKDRIPYVPYSPKR"
     gene            106892..107305
                     /locus_tag="ERVG_00131"
     CDS             106892..107305
                     /locus_tag="ERVG_00131"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16008.1"
                     /translation="MKSYLLISFLVKVCVCFTPIKNPSYTNLQLAHARIFNQLIAPAL
                     NGSSYKKFRKAMNNYGLSYSETSCTVGHCIPASKGGANLGYNLFAQFEDDNRKLGPKK
                     VNCGELFYYYRTGPPCTCTNENGDFDEECPLWMEH"
     gene            complement(107302..107916)
                     /locus_tag="ERVG_00132"
     CDS             complement(107302..107916)
                     /locus_tag="ERVG_00132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16009.1"
                     /translation="MFSLNNIVFILLIIYSSVSYATPPLPPSLPPPYPPPPSLPPPSP
                     PPPSLPPPYPPPPSLPPPSPINPPPLSPPSPINPPPLSPSSDDDAIYYIYAIDVIIPI
                     MFIGGILVALYLFCWKKREPPQPVVQTVPQNVEMPTVYNTIPPLGTQPASNVNIISTT
                     DSNGITQPITPRTPLTQSTTRVVNLADMQPTDTRNTENPFMTIV"
     gene            107977..108939
                     /locus_tag="ERVG_00133"
     CDS             107977..108939
                     /locus_tag="ERVG_00133"
                     /codon_start=1
                     /product="fatty acid desaturase"
                     /protein_id="AEP16010.1"
                     /translation="MSRSDYIWVNEDKVADWHAERKQKILKDHPEVKTLMGVEPITKY
                     LAVLMTVSQLVTAIYSVNLSWFMYLLSAYFVGATLMQTSFLFTHEITHNTVFKSVLYN
                     RIFAYVIQTPAIVAYHESFRFYHTSHHLELTREGGDPDIPSVMEATFTRQGVLAKMIW
                     LQTNLITYLLRPMFVKNLPFSWYLLANWTVQMTFNIGFFMMYGIAPFLYLMLSAFLAG
                     GIHPLAAHFITEHYNFPGMPEDQETSSYYGPFNMFIWNAGYHVEHHDFKSIPWTRLPD
                     LRKTAPEYYDSLYQFDSYVSTIYSFITDARINGFCRVRRVAKVE"
     gene            108992..114964
                     /locus_tag="ERVG_00134"
     CDS             108992..114964
                     /locus_tag="ERVG_00134"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16011.1"
                     /translation="MLSFIALLFIAVVNADVILVQQSNRQAFNGYVTSRNPGGNPTDG
                     LLCDVTPNGYIEMKNTCGQNFWGFAINSDAYKLSIKLRNVGTSQQFQYWLYGIGGAFA
                     GRETFVATTDTSAGTYYYYIPLTAQIVFPNELVIQINDGDNANGHEIQLMTAETCRDD
                     NTALSIVGGPSTCSSLASNQCDSSNVYGMHCPVRCGVCSKPPSPPPPPPSPFPPSPPP
                     LPPSPPPPVGIGSPLIRYEFAKTKLGTDVSEGTQYFDGNLLNDGQTGYISSAAGGTLQ
                     YKLTGVTDGKTLEFGNTGYLQYISNSGNNINLLRTVDFTFWLYLKISSSLTSDCTLVE
                     VDDQYRFGLQYSSGVYYVTLASSGSNPATTVVTDTPLSPGVWYDITFTNTATTTDNVI
                     ADAIQMFIDGSFTATHDVTPTVIGSGTFRIGGGSVGIFKGVIDKLGYWDGTLSVANIQ
                     SLTTPKVAPSPPPPLPPPPPPSPPPPSSPNPSPPPRPPPLPPPPPPPSPPPPSTPPPP
                     LPDGGWADNTVNIFPRDANSWPPTTITTECGIYKVLGGYEKIGPSAPHRTIGRTFNGL
                     TENHISLLIQFDFLKIDTWAATAPAILTIDSTEVWRKIYADESGTDQCGGAGVEVYET
                     IVLNVPHTATITSFNFATGEIGNDGYWGIQNLVITPLYESPSPPPPPSPPPSPPPSPP
                     PSPPPPPSPPPPSLPPSPPPPYPPLESGVLSISGCDAASVLCRPASFDTFSVRCCQFG
                     GAGGISICPNTSPDLEDRLGFSGQEDATLYQVQQACIDAGYRLCTATELSVGLTLGGA
                     CESPGCTYDNTRFIFASSTACSPPSPPPPSPPPPPPPNSPPPPSSPPPPPSPLTGELL
                     SDGKKRTWQDAKEFCESYPGGSLPSLFNIQGQIAMQSSLSNTGETGAWLAGTRVTTGT
                     WKWVPEEDIFWQNGEIVDGKFANWEEGAPYAGSPPCLLFQNTGFWTNAVSCTQAQITI
                     CEGISEYLSPPPPSPPPPPPSPPPGAPPPSAPPLPAPSPTVECGPYKIRQGTAPIPGA
                     LFGALDNLNGGMTTCFYAENPTNQYIEVLDIPSETPGGDSIYNIVVERERLVVTIQSI
                     KDASRIQEFSINFESRRHICILHQEGAGGQVTAYRDGTSAGTVFNVDFVQRAPLHAPV
                     NVGSPKGLDWPEGEYAYLENVNIYRKLLTNTQRNEDANNGLATSGSPTYILHALYTCS
                     PPPPPPPSPPPSPPPPSPPPSPPPPVPPPPSPPPPSPPPPSSPPPSSPPGAPPPSPPP
                     PIPLPDGSFDMTSSSDFPGSEFLWSSNTPLSTTLCKKYIVLGGYNVFGANAYIERYYQ
                     NFQVHSHLYIQFDFLKIDQWTSGDDAIVTVDGEVVWRQVFNGGNGDQLCGLPGDQALE
                     EFVTIQVIVPHTANDARVRFTTRLGVQANEASWGVNHIIVISQFPSPSPPPSPPPSPP
                     PLPPPSPSPPPPPPPLSPPPSPPPPSPPPLPSFPPLCNEGGVQSIGFSGLGDDLFGMT
                     GLENIGSNIDRGVTYSFEVRRFEIDNNEAFIFLGGNPYNPFQRVVFSFQNELTYSPMK
                     GIAIPLGVPRIDVEDYVKVIVQHFAGSGLIYTSIDNSPFEVAEGSTETMPADVYRPSL
                     LLGSGDPTEFNSLYVGRMRNIYVYNSIVDIADITGGNRPVLKAFTGGCYPPAAPPPPS
                     EPPLPPSPPSPPPPSPPPPASPPLLPPAPPSPPPPPDPAPPPPPGPGLDVSQFSAVIP
                     IVIAVVVLLLGCCTVYLRRRYGYNFGWLLTLVNLFKGDVANIAAAPADQRGRVAAEAG
                     QRQATDAAGRNGLDPGLASGAAGLFTGGMGAPSAPSAPSPRQSAAAASTPRPSVMSAI
                     FGGGAPAGNNTRPTYVRPTAASEPTGQTGGSMFGGILPSAPSANTVRTGRGTSGRASR
                     TARVAPTGQSSGNGNPFADFINTGPSTSGPRSNMRNTGPSTSGPRSNMRNTGPSTSGP
                     MSQFMNIGNAAWGAPNAPAQNTSGRNARTNRR"
     gene            complement(115003..115419)
                     /locus_tag="ERVG_00135"
     CDS             complement(115003..115419)
                     /locus_tag="ERVG_00135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16012.1"
                     /translation="MKATSIVSITFSVLFVLLCVWAFIWSRRYGPKNMDSIRRKNTRI
                     LTPDVSIDQLIDDGTPTGSTTKWIPPMDSIRGKNTRILIPDVSIDQLIDGTLTGSTTK
                     WITPADEIASRDIARQLSIIREKNGSRTLRKNPYLG"
     gene            complement(115476..118079)
                     /locus_tag="ERVG_00136"
     CDS             complement(115476..118079)
                     /locus_tag="ERVG_00136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16013.1"
                     /translation="MDPVIDTDVNNMSDLVPYKTLTPGCDDHLATLYESMAHADIDKP
                     PLTYTLHGGKFNGIASGPQIDATRRFMQSTNVYIEDEFRAGFVLGDEMGVGKTHVIAL
                     SLVQTVYEHYITHQRIGRHVVVIPKDTLFKPLSDIVQRIATVLGITLNFLQIKDIYTK
                     TNDTFIVRQTDGIVLATYNGYGSHVNRLVEWMEPHHTQAIFHDESHHLKNMNSQSAAA
                     ASIMMDVFRHARFMYSSGTCASTVKDLYLVGIRTGLWTKSSFQHVAKTLNGRNFFAYI
                     SNQLVRNGRYISRLLSTETSAEHIIDHIEMSDESIRVYDTCAELMAKTMRIIRAKISG
                     DEKRMHLTARLYNTSLAFFREMMLFVRLDYIIKTARHHAENNRAVVIAIQSTGESYAD
                     KEIQGIANTAMNLINAMKEKYPGDNQWDELNDEWMNLDLPHQSILDIVIDSLGGLDQV
                     ADITGRSKYWVRDEMGEWVMKTRNKNKINIDRTDFQEDRKPFAVISRTANEGINLHAL
                     YAHSKQRVMILAQQPWSADQEKQLEARVARTGQTSNPIVIHIVNTQLCELTVTGRHAS
                     GSRNSSSLTRGNQEISAIGSEMEDVNSMRGVYACIRLIGDLQDRVGLRTQEIRAEMGM
                     SDNEFRLYCDETLERLRIVGALDCIRVDNNKRKFGDDDDEHDASETDKNGAHSVRQFL
                     NRILLLSVKWQQTLYKHLVIQLRRVQETSTHTKPIKPVCKIHTITKLRNDIEFIQVKS
                     INLFSELENKNAKFYMDRANTNACALITFGKVTWRIAPRQCVPSNVPFYGYHQVHVDE
                     ARRVWNRGVEVKHILRNILVDEISELKSIVRVDAPLQRLKQMDGTSILGFNIPYRAVD
                     DVKNHYREHTV"
     gene            118330..119217
                     /locus_tag="ERVG_00137"
     CDS             118330..119217
                     /locus_tag="ERVG_00137"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16014.1"
                     /translation="MSLSFAEKMRMINAQQAQVPVHIRFAWDGVRLDNGEVSHMKNTR
                     GEHVHTGAWYAQHLDGSITVRAHHNSDWEDYVIEKRMAMYMIPSNCVNLFKIGTKVRY
                     IKSEGAINNYYGLHTIVAIKMIPVPHKSEIYALHMAYESMDMTYYTSMGQRSKSEEEH
                     YKLLNDSFITSFNLCKPPWLSVSVDYERIILQPPENYNLGSYTPDFRIIMTKKSFMLG
                     RIHVIVESKSSRAGLSEPKVNEKIQLVTDYHNMHILVMFGSPPIFKYIPKFTSDWKTA
                     NPDMNMDETIQLLLRLAEC"
     gene            complement(119183..119899)
                     /locus_tag="ERVG_00138"
     CDS             complement(119183..119899)
                     /locus_tag="ERVG_00138"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16015.1"
                     /translation="MFGIIIATLGIFRKPPSDGKWWYDSRIHNLGNIGSFGKFHANVA
                     GWCTDIIDKYAYNQRNIRDEILSNMPYHARVCDMGCGVGKSTTDNILSIGIDTSDEML
                     AVARKNNKDKLCTFAKGNAISYGEDDEFDYSTIFFLLHEAPQDGRIAIIENAMRISER
                     GVLIVDMHPKMRTPRSMLSGEPYVLNYMKHIREDINKCCYTNDWYIHDTYTHIDNYVM
                     VWALRPNKNINTLLTAEAIV"
     gene            119964..120893
                     /locus_tag="ERVG_00139"
     CDS             119964..120893
                     /locus_tag="ERVG_00139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16016.1"
                     /translation="MIFSDKTLKHLLIWNFIAGTCNLAMAIVTGVVGNLNLRPDLYNV
                     QAEFTGMTDAYMLAPTNHVYGTFPITALMMATFIISAVFNYGNIMLWPNAYYSKLEKG
                     CSPFRWTDVFFSTTLLTGCVAFASGMRDLNQLVLVSGLSVTVTSLLYLTDVYLKPKDD
                     VDAWKEESFVMRAKPHLISVIPFTFMWVMLFMTFLNGPSCVAPNWLWATFILFFILSI
                     ANFLPQVYQVAMPPSLYVKGEFKYITLTTFTKVLIGILLVSSALGKTDFNSAVVKSDP
                     SGCLAYPPPPWSPPSPPLPPPPSTSPSPPPGSP"
     gene            120952..121347
                     /locus_tag="ERVG_00140"
     CDS             120952..121347
                     /locus_tag="ERVG_00140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16017.1"
                     /translation="MTLAFLVVLSQSICFPMDKLQVRMQYRQAMAAAAEHQKMPATAL
                     MNLGIYRVYARRLHDWSKGTLSDDFDSCSFDIEDGDVQLEEYEELLRENVKNVPGLEQ
                     LLDRTSAPSDMEPDENVETENVENDETDV"
     gene            121408..121926
                     /locus_tag="ERVG_00141"
     CDS             121408..121926
                     /locus_tag="ERVG_00141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16018.1"
                     /translation="MPYVPRTRNGANKTTRTIAHAKNYRNNTPAIIEMGNLDEVPKTP
                     LQNISLVRKYMPPGCCTGMMSESHDVHVEHKFGTYRSRNWSCFTMKIKDAKSKWCDIC
                     VCWYCCCMPIACACLCKKDAEGANGNYYVGSCCSELVWASDDVMFARKCLAWSSSGYN
                     RISPIPGTMVRT"
     gene            122116..122544
                     /locus_tag="ERVG_00142"
     CDS             122116..122544
                     /locus_tag="ERVG_00142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16019.1"
                     /translation="MYKTCVCAKLREMERKHYVSSYTYGRCPSCITRINEVVPRCFSC
                     DMHPAPASGRACRGCIRRTRREFAKYETNYNDALVAHRAWTSNLNQDEYTRLALKEDL
                     DGSTQLDSPKRKDYYSTYPSPITKWDVTQFLTDNPNFLWG"
     gene            122557..125169
                     /locus_tag="ERVG_00143"
     CDS             122557..125169
                     /locus_tag="ERVG_00143"
                     /codon_start=1
                     /product="serine palmitoyltransferase"
                     /protein_id="AEP16020.1"
                     /translation="MYTAVFICLCMIALPTFVNKYAKFMTIVFAFSKIFIKSIFQELF
                     SGNYLSGNTGLTSSKNELFYRHIFTPIKDCWSRPIHGHASTVITVQPENGDKPCECIN
                     MGSYNYLGFGGIDKTITSQVKQAIETYGVASTSVRDGSENDLQSVLETKIATFLNKDA
                     AVVIGMGFATNTSVIPVLLTDGVDPKNVLVLSDSFNHASIVEGIRLSGAKVKVFKHNN
                     ALDLEDILLRETSCCNWDKIVVFVEGIYSMEGDFCNLNEIVQVKTKYGAHLYLDEAHS
                     IGATGPTGRGVAEHFNINTSNIDVMMGTFTKSFGSVGGYVCASQPVINCIRATATACV
                     YSPGMSHAAVMQALVTLEILIAGSKKPMQLRENANYFRKCLMEMKYPVLGDVDSPIIP
                     FLIERPDKLVEFSRKCLARGVAIVIVGYPATPFLESRARFCISSEHTREQLDYVLMVI
                     DETSRELKLRKVSGYAESKKTHDFHSDVVLNPPSDLVSNLWNTVSVKKIETTTEFTTT
                     SFLNMHKHPDVIVSAKNAIDVYSCGTCGPRGFYGTLDIHMDLESTLATKLNVEKAIIY
                     SYGLVVVSSVVKAFAKPNDFLIYDELVSTPVKSGIVLSRASKLSFKHNDISSLVEQLE
                     YAKQLDPNGDATVYVLVEGVYANIGDIVNLPCIIALRSRYKFCLICDDSYGFGLLGKH
                     RLGTPDHYNVPHSEVDLYIGSFEHAIGSVGGFCAGVGDMISHQALNGSGYCFSASLPA
                     YCTSAIRTSLDVIERDYDVYHELNNVMRYTSVMLGKLSNFSRVDVDLSITPLYCIYIR
                     DNDGMYNIELLEKIKHDVAKQHGIRIDVVKHPKQPGIPTANPFIKFNVDNDQDLGING
                     TLNVFVKFMIEYLS"
     gene            complement(125164..125481)
                     /locus_tag="ERVG_00144"
     CDS             complement(125164..125481)
                     /locus_tag="ERVG_00144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16021.1"
                     /translation="MEQHKNTLDWLHNNEAEIVQNDVIDDHIESNTRRYDIMLATYST
                     FSMLYVPARMTYANNRFYINKKEYIVKKIKPKYYEIVLMPLNNSRFCVHARFVYKKEF
                     LEL"
     gene            complement(125505..126101)
                     /locus_tag="ERVG_00145"
     CDS             complement(125505..126101)
                     /locus_tag="ERVG_00145"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16022.1"
                     /translation="MNILEKLVDPNTKCKSELTKIINNAQSGDLLFVRKFGVPFFHLH
                     VGLVDGYGHVVVVTIDEHKNKYIIESGLIGNRKLLLSAYLQKTPYKVIKLFRPSIDID
                     HKCLWKLNEYQFKYSPIRSKLFGDRHSCTSFARLALSTCSEMTCSDSWKDGILPLTLL
                     NDVSGYDILQCGDEWYVYRIVLIALMYFAFAHVASYHI"
     gene            126111..126770
                     /locus_tag="ERVG_00146"
     CDS             126111..126770
                     /locus_tag="ERVG_00146"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16023.1"
                     /translation="MTYKRLPRVKYQSVCIRCYTSDMKPHNIDVCNNCAAYSCDKCKG
                     CDRHSIWGCWCPGRTVCSYETCSLIGYNVQNDIDDCLVCECWPFAPALPDLCQTCIRT
                     DTTCIDHTGELVTEKTEYTRCKECMDACSSKVCFSEEANSPDWCGPEYNCAYCMRMTN
                     RIVLGQAAARAAAMHARVKFGHEVSDYEKKIENYIAKHKYSTEKEIECRRGVPFVLIP
                     N"
     gene            126947..127020
                     /locus_tag="ERVG_01001"
     tRNA            126947..127020
                     /locus_tag="ERVG_01001"
                     /product="tRNA-Asn"
     gene            127024..127095
                     /locus_tag="ERVG_01002"
                     /pseudo
     tRNA            127024..127095
                     /locus_tag="ERVG_01002"
                     /product="tRNA-OTHER"
                     /pseudo
     gene            127164..127685
                     /locus_tag="ERVG_00147"
     CDS             127164..127685
                     /locus_tag="ERVG_00147"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16024.1"
                     /translation="MNTLRIIVIVESILLVVVAGVLMYLLYRMFMGGQANDDRDDKLT
                     GVEFDLFKDLDGGNEFLLKSLNNHYTTGLKNATQFKGKGTTNPDVSSAGVAFSPFARV
                     FEATDYGSSMYTDTLHNHILTYGKILQNGDTHYPKLADRGSIPFNSRKNILVHDPTIY
                     TEQQDKPMYHADL"
     gene            127726..128064
                     /locus_tag="ERVG_00148"
     CDS             127726..128064
                     /locus_tag="ERVG_00148"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16025.1"
                     /translation="MDTKDIIIICEAVLLAVLLIVLMAVIVRGNGQFFGRKPKTKEPK
                     FSELLGERIERGRQIQAEKEAAAEAKAAEAAEQARIDAEFRANRMAQEVQWRSTHRPR
                     TSTTSSNWWV"
     gene            complement(128521..129783)
                     /locus_tag="ERVG_00149"
     CDS             complement(128521..129783)
                     /locus_tag="ERVG_00149"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16026.1"
                     /translation="MAHPDFYTNGKFNEKLISSMGAENRMGILWDYFMLAYEQFTNIT
                     WDSRTRKLYIHNNSYDPQIYLGPSEIIDQNDETIIRKYPDYMDLWQNFIVTKHTKHAQ
                     GHQDITNLLAEATVLKLLGDIGVGVPCNITPVVQLDNGWETNIFVARDNDTGGVVIIM
                     NRMSCDLQSVNSPDIGWDLYNNLFTSDTTPLQIGVENQLVTKIEKMVQFGITCTDHKP
                     QNVLVISSSMMNDANTATRNYSGITSATNSDLSSEDILNVSKPNTPYGVDFEYNVYLA
                     DFDPEHCCRLMGFIHGMYTHGLYTLGIEDNVSDIACGVRKDDISLYINLSLGMIATVT
                     TPDPLGDAFLRPYVGELYKYIQYIEESYESTNKLPEQIYVDDILHYFKTFARSFRDNF
                     PTLNKRYGSSKKRSRSRGNQGNSNKRIR"
     gene            129979..130053
                     /locus_tag="ERVG_01003"
     tRNA            129979..130053
                     /locus_tag="ERVG_01003"
                     /product="tRNA-Glu"
     gene            130055..130127
                     /locus_tag="ERVG_01004"
     tRNA            130055..130127
                     /locus_tag="ERVG_01004"
                     /product="tRNA-Lys"
     gene            130203..130406
                     /locus_tag="ERVG_00150"
     CDS             130203..130406
                     /locus_tag="ERVG_00150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16027.1"
                     /translation="MNIKDYVIIGLSVTLLVLVAVIIYITWGSGQWFFTKTIPQEQPA
                     PIETSPLPYTILVASTVKNTRSG"
     gene            130981..131065
                     /locus_tag="ERVG_01005"
                     /pseudo
     tRNA            130981..131065
                     /locus_tag="ERVG_01005"
                     /product="tRNA-OTHER"
                     /pseudo
     gene            131097..132065
                     /locus_tag="ERVG_00151"
     CDS             131097..132065
                     /locus_tag="ERVG_00151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16028.1"
                     /translation="MSGIIYYIQSPSGKGYIGQTDNFERRMKDHQKKSSNCTLLKRAI
                     NKYGWSNMKITILLKCSVDDMGHYEQLMVNTYDTFAPNGYNCTSGGEEYKQISEYTKY
                     NISNALYNHNKHNICHNTGILLNNSSTFGVQIPGSWTNSKKRRKFFGFTTQEAALEFK
                     NAYYEKYVQNQETIIEESTDEVYNAIANIKRKHIRKPNTGRIFKQHSGSKNYTTVIPK
                     HAQKYYQQKSYKFPTYKEAEDFLETCTTCFITEENNSYKFTVPPPWLASPDAQKTYTG
                     FKTRQEAQLFMDNFYIIYVEGYDKPLPCVTSSVPNSQMPYNPYFIF"
     gene            132098..132550
                     /locus_tag="ERVG_00152"
     CDS             132098..132550
                     /locus_tag="ERVG_00152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16029.1"
                     /translation="MPEAYYNYAPVKRCYSEIIYTVSVPYLSEVEHDGIVHPVVDVNI
                     KFHVNALGAVLAIKNAFANNTNMSEKYTDRPWKTLNYDSSYKRFYGLTGITFQVFGLN
                     FYRSNALQHDVDINIQERIGDQEIEWSPQFIKNVLNIPAHLRDYTINY"
     gene            132626..132967
                     /locus_tag="ERVG_00153"
     CDS             132626..132967
                     /locus_tag="ERVG_00153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16030.1"
                     /translation="MACAVQYNLIASKEITLEQAETTLSNITAEIADKRAFLTVKQQD
                     LVELDNEVDALGAQLGKTRDELKKTRKSLGGVIGGFSAFVGIPLVIIAVILIVRKRRG
                     MKERAANQPVV"
     gene            133004..133531
                     /locus_tag="ERVG_00154"
     CDS             133004..133531
                     /locus_tag="ERVG_00154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16031.1"
                     /translation="MACLAEKSIIKSKEAIKNAKSLELDSLQTQIIRLDGELSRKKEE
                     WQSLENQIDTLTIQLGKTRDDIKKTRKSLSGVIGGFGGMVGLILVVIGIILYMKRRKS
                     SPTEKPVDTWTMPVYTPPSNDEPKVETKTETKSEAISIPKLNLSNTGGTTENTGNIGR
                     DIKRRMARYELETFR"
     gene            133558..134070
                     /locus_tag="ERVG_00155"
     CDS             133558..134070
                     /locus_tag="ERVG_00155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16032.1"
                     /translation="MSENTTSVSETKTSTFQKVKDFVITNKFYVIAGVITIGLAVGIY
                     YYSRTPDSIPPVTNPGTTQTVEDCTTEDLAIVALDNSIKQLNISINTSKNTKANLETD
                     ILKVEGDIKESEADLAEAKRELGEATDDLSDAKKSLVGVSSGFGVFGALVIVVGGIYL
                     YRKRKAKKDE"
     gene            134338..135537
                     /locus_tag="ERVG_00156"
     CDS             134338..135537
                     /locus_tag="ERVG_00156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16033.1"
                     /translation="MNRNRVGRYRPRTSVNKLLDVKPDSILQSRKTAREKKAYIQGLI
                     RDADTYLQREAAADSIANDSCSDYLIAKQTEKGCFMSTAISILYQAYRMFPTLEPDAR
                     VPQNASYNNKIMPYIMQFLDNRNDICPAVPTTIYAIYNTITDRMNGSNKKGGVPFSES
                     ITYQVAYDTNLFDESAPAFSYHLFLRNPLINPILEVNEVDSGLRTIPYSMDQINVINQ
                     PRKIEKGGYEQLFIAAMLMNSNAYVVYSEISSQTDINDGLRYISSKVYSDAFHIIEKT
                     FSGTVLPYNSDTLRYLLESGRNAASILSRPNISTELIALTVSYKYPISGQHVVSIVPC
                     GETNAILCNTDASVSSCVYFDDYSYAPTDKEYYMTILDRIGHTYEEQKCTLERVTYYL
                     FNGVTMS"
     gene            135594..139349
                     /locus_tag="ERVG_00157"
     CDS             135594..139349
                     /locus_tag="ERVG_00157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16034.1"
                     /translation="MAAKKNTSTKTKGKKDTQPAGKSNLRWYLMLTLKIIIALAVVLL
                     FIYMYWRNQNEEARMFAKIEQLKKEIGAQAASLSDSHAELSELNAELEATELELKDSE
                     EESVNLEKNIAEKTKEMMALQKQKELQREQMRKANSEKMKEKQKEIDNLIAVYQSNID
                     ALSANSPEEMKKIAAEKKITLDKLKESNAAEIAEMEQSYSKLATTVASDIETRKNILS
                     GELEKELLKYDKQLETITAELEPLAEKDGDEVKEKIKLLNDEIKVIGQKRATAQSEHV
                     AQLLSIETNKNNELADMQKTKRASINARKASQASFIAKEDASYKAMLKNDENERNAMI
                     DKHKKQMEQLQFEKDSEIEDLEEQNNSLDSDLSKLADDLSVMKTQKEMLIIQKSDLQQ
                     AIEVHKKRDVEIKKLAGVYGCGSKTSTDLANCTTKVTANINAKKVERDNLISTITKKH
                     ANGVASLKFHKGWKANSKYTPCPNGATLVGGGPNDTYACVYSVGKFRSSQSTACVPGH
                     GIPMTEKLVLPPGQMKQWFPRLPSCNYESTNVWYIPWHFMRTYDEHIKMAKRYLVQLA
                     TFNTTEEWHMFMHFERAYRTGRYFDQRGAYIVGTEVVSEDGGFKGNPRSSESWKNYDD
                     SVFFKDIPGNASAQPFKSVVILHEHPIGSRENNASIGYGVGKYNLPGHLNDRVSSILI
                     HRGYSVHAFEHHDFKGHSEKFTGKVDLRGNRLERRISSVIIEKVGDDVYDMIQKTKQK
                     GIIGVAILEGKGIVPVPRNARLPAIYKITAPTAALAAEAAKLFMTKHGRQRPDSIFAL
                     ERGNDFDVYTVHKDRPLISENGRYELIIKDQRAQVGKVGGPYTVISRNSKTDMIQIDV
                     NGVLRFLDYAKTPNQTTMIGTKYLRLSNLGVLSTNKHVLGNLSENNASGTLGTVNGSI
                     APTPEPKPPPKPPPKLPTQPRPMPSPKPPPPIAQLKLVEIVAFNSYHQKEGYDQNFIG
                     VPSYAVRDISRAKVLCIGGVRHSVTHIMQTKDPKIPYVYLNPYLKRRVKVGTPVVIGD
                     CNILTKPAPSSNKKGCHPNNCMVSTEHGAVAIQHLNVGDRIYTPSGYEPIIGFFDKDI
                     KKTAEYYEITMENKQHITISKHHAIPINGRMTDPSLIKSGDVINTVSGITSVVSNNKV
                     LQQGAHHFLVPSGLYYIDNVVCSDYTMHLPLVMFNLVHMYIRARYNIGLPIIYREQSV
                     LSPYWPYHILGKLNASTTMYNICSVLFVPLVILTEFILAVYVSMNKK"
     gene            139399..139971
                     /locus_tag="ERVG_00158"
     CDS             139399..139971
                     /locus_tag="ERVG_00158"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16035.1"
                     /translation="MYYHWWYFCISSFFWLFVITTFKKRMVCDLHAIPCVILSILSIY
                     DIVPDQITWAWSLGYFVVDGVDVFDRGETIMTVHHGITTLLCIGSIMEPQMTFGTHTT
                     PYFLLVEISGIALSYWEYNRQSLIRYMMLIISYFFNRVVWVAYLMYFSFISRPDTTLG
                     YAVVLLARLMHILMCVWYTTLLKKVKNYIN"
     gene            139980..140552
                     /locus_tag="ERVG_00159"
     CDS             139980..140552
                     /locus_tag="ERVG_00159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16036.1"
                     /translation="MYPLIVFLGFGLLFWTIAIHSVPYEYISDIHAGISFVLSVITVL
                     RLIPDYILFSWSMTYFMVDLIELIIQWDVTYIIHHTLSIIVPIAGLFDPVLTLGTNAG
                     AYIMLIEYSTVILNHWQRNRNNKNIYFELLIVYFVNRIVYLTYLLYFSFISRPKNKYG
                     YFAVSCLRILHVLMFVWFYKLLKKLPRYSD"
     gene            complement(140562..141548)
                     /locus_tag="ERVG_00160"
     CDS             complement(140562..141548)
                     /locus_tag="ERVG_00160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16037.1"
                     /translation="MFRWRTYDTFDLIINIIGFSAIFMYKKSADGFDNPLLEYITGGI
                     GFYILDTTMGKSPFAWFIACISYMTTEQQWITFKLWLTSYISNEIFAYTIAASIAFTA
                     TYSLHGMYLLFFSHVLGNNQRAKLHVTKVQENKHVPFEKIMDALPTMFKNLLTLAYPF
                     MGIIVLYSFKTTNGLRFDKLPTFTERFWSLLSVILTNEVLFYYSHRALHHPKLYAKFH
                     KKHHEFISPVGAVAIYCTQIEFLVSDLLPLGVGLLFPYAAHAHFALTWIIAANIATQV
                     HHSGMHMPYALGIDEQPTYHDLHHKHFNYNYGAIGILDKIHGTEYVTKDVIS"
     gene            complement(141553..144591)
                     /locus_tag="ERVG_00161"
     CDS             complement(141553..144591)
                     /locus_tag="ERVG_00161"
                     /codon_start=1
                     /product="DNA-directed DNA polymerase"
                     /protein_id="AEP16038.1"
                     /translation="MSILGKYGLRAQPPNEYVSTDINIQLMAIEVEDLPIESTLDEEY
                     NESVIASDQFISTLPPENAHEYVKRKAVAYLFGAEEHTGATVCVKVDKFRPVLYYHTN
                     DSVSTLKNKIDESLNLKGDIDAKVIKRKRTYGFHPDKDDSTSHEQIRIVEVSFPSVSK
                     MKAACYRSGDKEPPETRLPKPWEQGVDPGSMFMERNGLTPCGWFKMKACKTITKHKIS
                     HCTMEFEVSNPKNIQPVDLDKIAPILIASYDFEMYSETRGFPMADRQGDHIAIIGVAF
                     WRLGTPVEDTKTVLLCLNECAPVEGSYVESYNTEAELYNAFRDLITVHSDADVCTGYN
                     IFGFDNEYITTRAKMCKASRFAYNGRLITVKTESQAKELESSALGQNRMFPIEWKGRC
                     NFDLFNFIKSNHKLSLYGLGPVSQHFIGETKVDLPYQEMFDCVRPGATPEEVARAAAY
                     CKGDVLLPIRLMKALQVMPGMIEMSRVTFTTINQLVFRGQSIKVMQQITRYSHQLGHV
                     VNPVPRPINTSGYEGAIVIDAKSGFYTDPVATLDFASLYPSIMLAHNLCYSTFVEKGT
                     PRVDGVEYETHKISPTEEYTFALNVPGVLTHMLKYLLGARKKAKKQMAAAKTPEEKAI
                     YNARQLALKISCNSIYGFCGAEKLGKYPLGAIAKCTTFNGRKMINKTSEMAIELFKPW
                     IAEIIYGDTDSVFVRVKDKNGKELTPSEVFKVGEDVAQKISDSFREDIELEMEKVYSG
                     FLLITKKRYFGGMHEPNKAGDVVFSKVDAKGVELVRRDNCPLLKNLYKKIVDFLVFDK
                     DPLKALASVKETLERVVNDEVPYEEYIITKELRKEESYANPKQEQLMLAKKISARTNG
                     GVTPQPGDRIPFVIRYDKHAKHICDRAEDIDYLRENNIPLDRLYYITNKITKPILTIF
                     QAFKEHIHDVQRTIQSAMSRVQLQLDKQPTITSFFNKLPPLPVINMDVDDENDHRITW
                     DDDTHTTDMEIEQPTPKKGFKRPQPPTHNKNLLARKKLRN"
     gene            144663..145310
                     /locus_tag="ERVG_00162"
     CDS             144663..145310
                     /locus_tag="ERVG_00162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16039.1"
                     /translation="MYLEDLDSLTIAISCASFMFFIISIYAIFLIDRLEELTIFQNIM
                     GSIQAGISSILLILSHRIIMTELSDVIYVVLLFEIFPVASLIARVFDQYPRSLQVVFN
                     IFASIFTTAISFGFSALIINWYNKNPDVMVYYPVVAPIMLSFKCLNAYIATYSSYIGP
                     STQPIYWEWRRNVQRARENRERENRERERIHNENQSSDNTEHHVSTEIVSLDVAV"
     gene            145369..146160
                     /locus_tag="ERVG_00163"
     CDS             145369..146160
                     /locus_tag="ERVG_00163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16040.1"
                     /translation="MFFIITALTALTALTPCNNARNNKLLINKCVKLSDAIYVKGHRD
                     LKNRLNDYGLNNIEIVENKQNNRALVYMDDKNTIVTFRGTVYPQNVVQDLNTRLMHAD
                     QYGHNGKVHTGFHEIWKTLEPEITKLCGDKHITFTGHSMAGSVAQIASCYTPSSDVIT
                     FGSSRTGNVEFAETVNDGNDFIYMFRNKGDYVTSLPLNTMGYRDTTPYIIELDENGNW
                     RDVRLNPIPYIDDANALNAVTRGKISVSDVIKKHQMSEYAKRMLL"
     gene            146207..146800
                     /locus_tag="ERVG_00164"
     CDS             146207..146800
                     /locus_tag="ERVG_00164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16041.1"
                     /translation="MKLKIVVRTQLINNEVLRVCKSRLQHHTDVDARTMYIIDKMTTL
                     SNIMMENGISNKITISTLFNNIGVSLETAMQLCGSTEMEYTEMRNLKEIDVRSIISKS
                     STKRSNKAVTVIGNRTIVKAPSVVSVKQTQLMPPPIKPQSLVGKRPGENSSTILSAHG
                     DSASSISRISKVSVRSTQSKVSNISKASSVRRPRSSV"
     gene            146815..147267
                     /locus_tag="ERVG_00165"
     CDS             146815..147267
                     /locus_tag="ERVG_00165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16042.1"
                     /translation="MRKSSMSKAAKFINSKIRVLSNVFDDPHGESSRNMYMGNYNIVH
                     NSRGTLKPTQTDREYWNLVNIGNEASEKRRSSNRRRSIDERSSRIPTNERSSVNPLPV
                     LETVYSSVAVGPSSDGIWDGMYSDPLSREMMYNGEMMHNGKIMYNADL"
     gene            complement(147293..148270)
                     /locus_tag="ERVG_00166"
     CDS             complement(147293..148270)
                     /locus_tag="ERVG_00166"
                     /codon_start=1
                     /product="ribonucleoside-diphosphate reductase small
                     subunit"
                     /protein_id="AEP16043.1"
                     /translation="MSEPLIIENKDRFVLFPIVHEDIYEEYKKAEASLWGVSEIDIST
                     DKTDWPKLTENEQHFIKYILAFFATADGIVFENLVTNFASEIQYPEARCFYGVQMMIE
                     NVHAETYSMMLQSLVEDKDEQRNLFRAIRTIQSIKNKADWALKWMNNERSFAERLIAF
                     AVVEGIFFSGAFCAIFWLKKRAIMPGLTFSNELISRDEGLHTDFACMLYRNHIIHKLP
                     YETVLDIITHAVELERLFICEALPVSLIGINAESMSTYIKFVADRLLISLGYEKHYNV
                     VNPFEWMELISLEGKTNFFEKRVGEYQKAGVMDALNDSSKHGFTLDEEF"
     gene            148365..148879
                     /locus_tag="ERVG_00167"
                     /note="hypothetical protein; frameshift"
                     /pseudo
     gene            148935..>149210
                     /locus_tag="ERVG_00168"
     CDS             148935..>149210
                     /locus_tag="ERVG_00168"
                     /codon_start=1
                     /product="deoxycytidylate deaminase"
                     /protein_id="AEP16044.1"
                     /translation="MSCTEEKRADYISWDQYFMGVAKLSAMRSKDPSTQVGSCIIEST
                     TNKIISIGYNGMPRGCNDDDFPWGKKREKIQTSLIQNIHLLYIVRQML"
     gap             149211..149310
                     /estimated_length=unknown
     gene            149496..149798
                     /locus_tag="ERVG_00169"
     CDS             149496..149798
                     /locus_tag="ERVG_00169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16045.1"
                     /translation="MFNVTQLALSIIFFENNNYSMQFLSEQIDNNTFESTEFYKMNPK
                     QAKYIQNYFTLEDTYSYNNFEYGIEFFAWFVMACVVIVYLVHEVYDIQSRDNNVML"
     gene            complement(150379..151293)
                     /locus_tag="ERVG_00170"
     CDS             complement(150379..151293)
                     /locus_tag="ERVG_00170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16046.1"
                     /translation="MIINSAPAFTRVVDFVNCIDMFSLYSTILCTLHLRSNINLFNQS
                     TWKRYTKCASICDTYKVSDAFRYRHPRVCYTHNVSTLLSARTYPISTSTLNKCKGSTC
                     PFEGNLLTSYPSNPTRSNVNNIQIPSYKTCAVVGSGMGAMGFGYEIDQHHAVIRINDA
                     PIDQQYMVGSKTTHRILACWPIHGKSIPMCSKYNDPSTLWIGGYNIYKLGNRGYWKIN
                     NTNTLCQSYKGWGKCSTGLWAVSFALSTCNIIDLYGFMPSHINETWQYSRYYQTDSYT
                     KHDAGHNYIFEKSKLYSLHCNDKITVKS"
     gene            151489..152355
                     /locus_tag="ERVG_00171"
     CDS             151489..152355
                     /locus_tag="ERVG_00171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16047.1"
                     /translation="MSTGLYTITTGNLYVNDEALVRELVHTAAKHSKDVGTLVTVVSA
                     IGTACGVTIALGNTLLTTFALKKAKENKKPKQLSNKMASYHAFRSQVKEDLKRIIPGG
                     QDAPIYEINRFASMVWKAIANELKEQWANEFTELTTERINKWNEIFRTTINSTLEEDT
                     DSMIAAEEHEERNEEPEEHEDTNEHLEDIPEENTEDISRDVDKKHKKKRPRTSIPPEY
                     ASFYELMLPYYTELDSIASRAEAKQLIEHVWQQLEDGHSNGWIVVHDKPGDKTKWVNL
                     FIKYAKRILENP"
     gene            152386..152661
                     /locus_tag="ERVG_00172"
     CDS             152386..152661
                     /locus_tag="ERVG_00172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16048.1"
                     /translation="MSYPFAIYWKMRYIEIIIYFIVLTTLFTLSFVPTISSHKGYKIS
                     LQVLMGIGVYMSFMTFVFATHRRYKEYPVLVMQTNGLLWPREYGTHY"
     gene            152681..153193
                     /locus_tag="ERVG_00173"
     CDS             152681..153193
                     /locus_tag="ERVG_00173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16049.1"
                     /translation="MNSHVVLLAVVCSALLAICTIGYSVYKYNTYSNYINWARIFHTL
                     QGACISLPLIAFSVPMSTSAHVAMVTGGVIATLSYPTYNIIKLIRTRNDPPISRQNGS
                     IVSPNTSSHVNGLVLGIIVATMIRQMIQTEQHHKPKNKVIDIMQFVILIGGLLTSSIV
                     ILTAILVQQS"
     gene            complement(153190..153780)
                     /locus_tag="ERVG_00174"
     CDS             complement(153190..153780)
                     /locus_tag="ERVG_00174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16050.1"
                     /translation="MIFIIAPVAGLIVAGIIAATVVSNSEEEEEQPRMTNFEEPRVMF
                     WSKVVGHRGTLDNVVNLNDKNFFLKLKKDTGVPTVVLFYWKSCGPCKRFMPYWNALVQ
                     VLAGENRVNLIALERDNMDNFFANKGKAGGSVYQFPTMRILNGVKKIAAYDNDSTNYP
                     PPNVIQQIAMQHDVEEISVENPEKLFAMLQFVDESI"
     gene            complement(153803..154135)
                     /locus_tag="ERVG_00175"
     CDS             complement(153803..154135)
                     /locus_tag="ERVG_00175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16051.1"
                     /translation="MYRTQYSAPQQNISNVSKVFRMNGAIETTLRFRKIIFLVIFTLI
                     MSLVYHFAFNDTVSHVSGGGKYIDSLHFSIVAMWGLVGEQFNVEDRLARFIILAQTSV
                     SLLVVAFI"
     gene            complement(154245..154562)
                     /locus_tag="ERVG_00176"
     CDS             complement(154245..154562)
                     /locus_tag="ERVG_00176"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16052.1"
                     /translation="MRTYTLESNNKVYVGQNARDNEEMVLFFNEFDALWFHIEDESGP
                     HVIVESASAMDIKEAARYARGNHIGKCTIMYCNIRELSKNHKCAVGEFITPENYNTVT
                     LKK"
     gene            complement(154559..156007)
                     /locus_tag="ERVG_00177"
     CDS             complement(154559..156007)
                     /locus_tag="ERVG_00177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16053.1"
                     /translation="MATPEKALATLNNIAKDFSECYILACRVYVRTPASRDQYKHVDV
                     NYSIMSSSFDSNLYLTKADIEYYASVPIWILSPNDYWGNVRQFTRNEDIEIDPTTGII
                     MDQSKKPWLKAAIGNPGNLTVFNNISKFLPISTVMYDQVTAMYYQSYLDNVKNHVIHY
                     EFQGNPNERMYISKLLTMAVNAYSRAGPMAVTIPELLMQYFGNDDVMLFDYYDVLEVK
                     AAVVVDEVFLLSPNDAYSTIQSITIMKRDATIDNEQCKKLALFGQSVSGKYAVTIKSS
                     GPWLYVHPKLIPAFKEMITMYDNIRKQNADGNGGQDVRFTCEEHIARAMHLMKYLSVD
                     DYEHNMGLYSLAVQLLKIRKDLLDPANCLISVGNDPINGSDTKLYCKLKKTILDNFKA
                     GNQGIAELYVFPVNLSGDVINEEITHITSKDNMVVNGVDLKNNKNDIVTTNNHQWLVL
                     YNEGKSSGIMAKALYDSVKKIIESANNAVNRI"
     gene            complement(156052..156957)
                     /locus_tag="ERVG_00178"
     CDS             complement(156052..156957)
                     /locus_tag="ERVG_00178"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16054.1"
                     /translation="MSVSSNIAGRRSRAMESSQLAAAMAAAGGGAPNPQAAGAAQRPP
                     AQPDTSSLINAQMAASASEATAQKQKEQMARLQQELERMKNEQKNSKSNMSNLIKWGN
                     DNPKDFRQAVVIGFIVILALVLIGFMMFGPGADCNAIGQQYMENIDANIDLHGFVIAF
                     KADLTANDNGNMVTIATSDDVKDDSWLKTNAIELRRDSGAFVLSLYGNSVDSPGNDSV
                     EFNARVDAHGPVEIRVIAFEGFAAIRIIQSGHTDKYEIKPFKRLTEELRFRYMNVSNG
                     NRTKISKVDVYSLSPKNSKVDTCYN"
     gene            complement(156996..157229)
                     /locus_tag="ERVG_00179"
     CDS             complement(156996..157229)
                     /locus_tag="ERVG_00179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16055.1"
                     /translation="MDQLMNDVKIGKEDIDTLINTMMTDYPTEEMQDGSSHVMWIRRE
                     TAKLMRSQIELANKEAKLDNREKAIVARERALR"
     gene            157372..159473
                     /locus_tag="ERVG_00180"
     CDS             join(157372..158577,158652..159473)
                     /locus_tag="ERVG_00180"
                     /codon_start=1
                     /product="nucleic acid independent nucleoside
                     triphosphatase"
                     /protein_id="AEP16056.1"
                     /translation="MQTDAAVYSPEELFALLCANEQYAISRIGGFENIDDLFDMLSNV
                     WLDNHPDLETISYYKWLLGKVSDLHSATDSELKPAEIEQLFDITSIGIYRLFRICMTV
                     PDENRDVYMSDTAEGLERRGRLAHILKTVQVCKNYMVAHSMMTNHINSSRYASLTKYE
                     TTVNIISDTDLKPHQQVENHILNQLDNYGYRHYKKYCYKRIVTKDNSPVFAWERKEKV
                     TDFIPNELTMEKNYAMYKLYTHAPSYNMNAHLSRFLTEDSKQIRFLPLNPNRHIYSCT
                     NGIYHTKHCAFYDYADEQNWPQITQQAIDRMVKYDPSAVDFVPPNGNDTCLRHYEYEF
                     KHGDYINNCTDFMDIDPSVFKCRDFDNVLEYQKLTPDTIENIYGLIGRLFFETKQYDD
                     MQLLLFFKGVAGSGKSSVLNLISECFDPEAIGILNSNCQDQFSLEHIADAHIVITYEA
                     KRDFRFNQATLQQCVSGEGVTIVRKGEKSYDKKWTAPFVMAGNELPGWKDAAGSMARR
                     LVLVPFNHRVIEQDEELGDRMSKDILEYIPKFTIMYRQMTIRSNKKGFWSVRGDGTTL
                     CSQQLLDVRNEIISELQPLVNYMLRSGKFELSHMDNSLPAADTYITEAIFLEGYRQYC
                     RDTGLQMGTWNADLYRTVFEDYKITRRQAVLEYDGVETNAYFLFGLRLVQA"
     gene            159478..159723
                     /locus_tag="ERVG_00181"
     CDS             159478..159723
                     /locus_tag="ERVG_00181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16057.1"
                     /translation="MYPVQTSSYLTRFELARLAGIVELQLQDNKTSVIDSSKTLHDQA
                     VDIVLNKETDIVIRRILPGDSYEDVSLKTLETSHLKI"
     gene            159740..159946
                     /locus_tag="ERVG_00182"
     CDS             159740..159946
                     /locus_tag="ERVG_00182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16058.1"
                     /translation="MKFHKSLIIPFTRRILWFMMVFIILYLLWELAEVDWPVLVIILL
                     TFVAYEAGTYDHKKAPFIPGLVTA"
     gene            159971..160309
                     /locus_tag="ERVG_00183"
     CDS             159971..160309
                     /locus_tag="ERVG_00183"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16059.1"
                     /translation="MLDMTDNTYNVTEVEPVNAHILRCTLVNADSTIIIDINNELFPL
                     SLGDTIEVSHTSPEYEVNYTTITNTTNKQLASAGGLLVEFTPSINAGTTFTIGLAKVT
                     SNSSKRSKIV"
     gene            complement(160286..160489)
                     /locus_tag="ERVG_00184"
     CDS             complement(160286..160489)
                     /locus_tag="ERVG_00184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16060.1"
                     /translation="MTGVLYLFYDFIAFHIISLCITVVQWYNTIMDICFGKTGIMFGA
                     PRDIVTIYKRNEDDYQLNYFRTL"
     gene            complement(160953..162935)
                     /locus_tag="ERVG_00185"
     CDS             complement(160953..162935)
                     /locus_tag="ERVG_00185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16061.1"
                     /translation="MPDYVLNGEITFPSGRPLFRNGTVIMIMPRGVASVYDEARTFAP
                     FIGKGAMGCCPDLTTSQCKRMIDNNEACPIKRKLDEKCGDPDNPNCWVVQSITPSISE
                     HVEASKAIRDRCLGTAKNAIMCTELMDPPGSIGDIIDLMQHVREAPIPLKFMNIGEKP
                     GATVCYRRSHSYYYRKYLYSNTPKTTPAVSAAMDEGFYIGKAMGKVNNAGPASPTNPI
                     IVQDSISGEAVEVNPLACYVLDSWDSPIVGCWGDLCLQLGSRVMDKRDRCPCIIIAFN
                     GRAGNDLRNVAKSTVTSITLLTDLEQVRVVTANEIALIPGLSVNSFLNTRTTAYRYNK
                     DDIKHRYAYYYGISNDYVQHIDPMMIIHNAGAGAEWQRVMEVYIDPTIPHNTSDTARN
                     LLKWDMHTYLGIKNDKHDSTNFYSTESARNAKFEQVSYIMGNQYILRWSGDYLEIKKG
                     EGTGAKPSVDAQNQINMAAALETNSLKNDCKKSLGVTPDDNTENRCKSIAVDHIYGKI
                     PTATVTTRQILESCNSDGQLMSRTCMEAARLSSREDVEALLGPAFTKYCTQIHPEDSR
                     CVEGTAFTFVNTEQATSADFKAAYYHEYLWPIVMVVVCATVYCIQKTTTTTGKDRNFY
                     FQVLACLGIGSLLSHMLLPTYTADAISGFKRNAFIS"
     gene            complement(162972..164099)
                     /locus_tag="ERVG_00186"
     CDS             complement(162972..164099)
                     /locus_tag="ERVG_00186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16062.1"
                     /translation="MLSDCKTVIYHIDMRYNDILYTSGEILHLSSYPVPNDHGKLVID
                     EDKKTFLQHRLTQLTGSTSKNGFPIAQPESFKRSVIPTIMNGKFCASLKTDGVRAMLL
                     LTKYNNEFVAVLIDRKLTIREVEVWAPEKYFNDTLFDGEIVTERSDNVPRRDVFLAFD
                     MYVDKGVSLLLEDYTTRITAMNNSILDDDVDAMDVEGAIQEMNKVYIPPAIGISIRAK
                     MIKKAEDTISLWNTRMQVPHLNDGIIFTPDTTVVTSKVYKWKPLNTIDVFVYKGDRTP
                     YIMHYRALTPSVNITLNNKVFELYEVRNNVILDTYFSRFPAENSVIVECGVDIDTHTQ
                     RVSFAPIKTREDKTAPNALYVVKETINNVLENVEIREFRKK"
     gene            164169..165113
                     /locus_tag="ERVG_00187"
     CDS             164169..165113
                     /locus_tag="ERVG_00187"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16063.1"
                     /translation="MYKSYSRTVLDSSYHIIMVKRIRQDGQPKRPVSGFIRFMNENRD
                     RFNTQCKDQNIQGSLVTHVARLAKVEWREMNDETRQFWNAPAAEKIALYNEEVAKWNA
                     ANPTPVPVQEPKKAKKVKKERPPGKVKKTTTSYILYYVNERNNTIAELNSEGAEITFA
                     NIVRRTSSKWKAHTPEQRAPWDAKAAELVVLAKAEAAKELEEHNAKMEMETTDTPVDD
                     TQQVADAPIVDAPPPKPKRKYTRKPRVTEPVADPVSEPVTEPVAEPVTEPVTEPVAEP
                     VTEPVAESVTEPVTEPVTEPVAEPDIPKPKKKRISKKQ"
     gene            complement(165145..165960)
                     /locus_tag="ERVG_00188"
     CDS             complement(165145..165960)
                     /locus_tag="ERVG_00188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16064.1"
                     /translation="MSTNSYVSQIIVLTDAIITDCTPFTSGGHSSIYTGKVNMKGSMT
                     QNVIVKYLTNDFNTEGGNEVRFAREQFRHPNITEIIAAETTPIGTYICMPIYARSMAD
                     VIYSTDPINDRLRFMSELIAALSHLHNNSFVHRDIKPENIMLTSQQKVVLIDFSLSGL
                     IQPGEFEYFAPHSEWYRGPEYYFHEQNDPMKADLWALGMTLIEFDTRKPILSHAPNRA
                     YCTYLSKLLYPVPLNDTSGIDHFIYQRLVNGNGTLPFKGMNNLLCINPKLRTC"
     gene            165969..166385
                     /locus_tag="ERVG_00189"
     CDS             165969..166385
                     /locus_tag="ERVG_00189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16065.1"
                     /translation="MYINKVMYGFEYIYQASRITKTAIILGIFIIIGLATRNWSGEID
                     PDKVQLEDEIAHKYTGPHIGKKIKAAGKFDNIKITGTDNIEDSIDYCADTCITNKQCG
                     GFNFIGNKCEFIAGELTTPVDSVEEDGAVSFIKTWL"
     gene            complement(166382..166954)
                     /locus_tag="ERVG_00190"
     CDS             complement(166382..166954)
                     /locus_tag="ERVG_00190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16066.1"
                     /translation="MLYKSDRCQIDFFCCIYKQEAYTPNTIDMSMPVKETVRKPSTEE
                     TKRSKKEEDEYMSDASTETSESEAESDYSDSDEDEEVLFDFSLSLNKGRRILRKGDCV
                     NHFAIDVLCEAAKLGCELHKKENSIRVRGATMTLKFACEGDDGRELIDEAFEDITGEN
                     EASDEAKLLAFMLAYSPPADDDDAKKKRDD"
     gene            167070..167762
                     /locus_tag="ERVG_00191"
     CDS             167070..167762
                     /locus_tag="ERVG_00191"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16067.1"
                     /translation="MYIKKVTALLDEAKKLHKQDIPVEIEVRIGSIENGTFKAGVPRG
                     RYNMMMDWFQQSNLTTTGNWTTSIAHFTGKHERCIITKDTPGSVRNIELVEKKPVGSI
                     ILSSNHPEGIALRFCVYTEKPLPNKGIVTTGGMVRYRQRKSYSIDSKGYENTFSFDFT
                     QVWQGTSERNAKELHRHSKDTRFEIELELTNNTYLEDMSSNYLADSIVGKCVSLFQHE
                     MEVGKAFDLTVV"
     gene            167785..168672
                     /locus_tag="ERVG_00192"
     CDS             167785..168672
                     /locus_tag="ERVG_00192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16068.1"
                     /translation="MFLFITLIFSQTPVPHIINGVDADISEYPSSLSMQANDQHFCGA
                     VLISDYYALSAGHCFDAIDFTGIVMAGGKTNLNSNGGKSVFVESAYLHASYDGSLITN
                     DIAVIKLASPLPFGFADFTATSVAETEDVTSVGWGLTSPNGKSSMTLQSTEQRVYADN
                     TCGAALIGTVVCTKSPTLDTTTCNGDSGGGLYDIFNKVAGVLSYGYVGCPVDGVSAYT
                     DVSYYKDFICCYSKNTAVFDNAQCNIDLETCQAANPAVLIVSYANLIFIFPVLAGAFA
                     LCMCTWNAVDNYKKYSLRT"
     gene            168728..169141
                     /locus_tag="ERVG_00193"
     CDS             168728..169141
                     /locus_tag="ERVG_00193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16069.1"
                     /translation="MGRFSIDQAILNLDWEVANRVQMNINALRSTMSLRYNVGVRDDS
                     RLAYNWAIGTVRAPIEEIMEELAFIQWLSSHTNYQQVCEDGLRSIANYIKFKYPDISW
                     SKVWTIVRGIGPDLIKYTLVDKYSAGVPDLTKINA"
     gene            169291..169977
                     /locus_tag="ERVG_00194"
     CDS             169291..169977
                     /locus_tag="ERVG_00194"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16070.1"
                     /translation="MNSTWYDSSYNAGYDPASYLALAAAAGTVAPSRAEVRGGYEPPI
                     IYVAPTSFARPTDANMHLGVMRYDPEYIRENMPEFNTIEPPMPIGPLVDPELRERLER
                     AYETLVTLQRKNNSEMAQRVAAAAVEDMELRRLAQRETLQGIYGEYNERLKTKRIQES
                     IQREHLKDRVNRKQIAERIQRRRIANGGRPVHIQADGEFYDNSQMFTDENGLHVMVRN
                     PDERDLHVMV"
     gene            complement(170110..170595)
                     /locus_tag="ERVG_00195"
     CDS             complement(170110..170595)
                     /locus_tag="ERVG_00195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16071.1"
                     /translation="MSNWNSLEPLTKNIIKTASAAAGVYGIAFVAKSIRTSGHALPKF
                     DEDVDIEILLPIMYDYTMAHALHRIYVVLKREENYTEKKFTLFITCITKLSEFMTITL
                     DEEDVKKSNKMIEQVEGLFKKLINTFKDPLTLSIVEQDMELISGAISAHLHNLMMDKF
                     T"
     gene            complement(170627..173938)
                     /locus_tag="ERVG_00196"
     CDS             complement(170627..173938)
                     /locus_tag="ERVG_00196"
                     /codon_start=1
                     /product="DNA topoisomerase II"
                     /protein_id="AEP16072.1"
                     /translation="MSDQKMQVLTQHDHILARPGMYVGGVEPVEYNKEVMTMTGPKHV
                     KEMMVPALLKIIEEPLANASDASQNNPVAKNIKVTTDQRDSSIKIETNTKFVIEYVPD
                     GNDYSVALAVSRFMTGTNFGDDDESFKLGQHGLGIKLTNVFSKYFEVVVHDPSTKQSY
                     HGIWTNNMYTVEKSVVKKASHKTPYVSITFIPDLPYFGLRGPLTTGQWDIIHSQVFDL
                     AVTAPKHTTVHLNGEKIPFKGIKGYIQAVMGDSLDKICMDKVEVNGMVRLEVAVTIAR
                     DHAESIVYVNGAHTTRGTIHDYIFKNIANALSKKHNINPSMLRGLLLIVAEAWIPNAR
                     FTSQAKEELYTPVSKYGFKWDLSQSFIKSLAKTDLYTSVVNLLHDKDDKKAQKDMKVG
                     KNKIPQFAKYDPATKLFKVNDAELLITEGDSAKQLANVGRNAVKRHANMGLYPLRGKL
                     MNAGNSSLKALAANKEISELIQILGITPYKKYDLASARALPYRHLVIFTDQDVDGSHI
                     SGLCIQLIMTLVPSLLEVFPDYIKRFATPILKITSGKHAGKTFYTDAEYREYIDKHPD
                     SKNAAVKYYKGLGTSTDKDAKQYFNEWSKNVITISNTGQPSTEAMKLAFDAKMSAERR
                     EYLANQYNPNANVDYSAQSTTIERFIYDDLMHFSNYDNIRSIPKMLDGQKAGQRKVVF
                     YALNHVGKNEAKVAQMAGTAAQVTQYHHGEVSLANTIIGMAATYTGSHNLPLLYPSGQ
                     FGSRHAKNSAAAPRYIFTHISSFLPRLIKSEDNDVLTYNVDENKKVEPTVYIPVIPIV
                     LVNGANGIGTGWKCDVPQYNPLEVIDACKRMANGGELSTSKWVPWYVGYNGKMEETTD
                     GFNSIGTYEVSGNTLTVTELPIGRATEDWIESIQHLIPDKIKNYEKNLGPDSVTIKLN
                     LTSPIDDPVATLKLSTKLQTNRMWLYNANNKITHYDGPTQIIQEHARERLKLYESSRI
                     SQIYKASHKMDLLNNKIRYIMEFIEGKIKIGKMSTSSLNEYLAQNGYLRSNNSFRYLT
                     DDISTGQLTTDNVDKLRNQIRNITTDIDALRETTANKMWIADLNALRKEVDEYIVERL
                     TPLDEDAPKPKKARK"
     gene            complement(174129..181220)
                     /locus_tag="ERVG_00197"
     CDS             complement(174129..181220)
                     /locus_tag="ERVG_00197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16073.1"
                     /translation="MPFNVVASEQSYQTVFLEGWTKCQPPSAPPPSPPPPSPPPPSPP
                     PPSPPPPSPPPPSPPPPSPPPPSPPPVPPPPSPPPPSPPPYPPPPSPPPPSPPPSPPP
                     PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPLPPPPSPPPPSPPPPSPPPSPPPSMPPT
                     PPFCNNTGVGVFDGTENSVIGLGARPGYIGALGPVTYTFSPTRTIQETGGVLYIGQYN
                     DSPSNDVIQIGFKNNKLRYVLSSDFDTVVTGTFAEWTIPTINENQRIVIVHKNDGAGG
                     TVVTLRIGGGINSETNQPVVGTTISPDQSLNYFPPEVYRPEILAGEVRYGTGDPPGNY
                     YFIGELTALYVANGDIDDLAGGESSLYRYISTYADDDGFGSNIIVHSFTSTCGPSPPP
                     SPPTPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPPPP
                     SPPPPSPPPPSPPPPSPPPSPPPPSPPPVPPPPSPPPPSPPPPSPPPPSPPPPSPPPP
                     SPPPPSPPPPSPPPPSPPPPSTPPPSFSPYPPPPTPPPPGPPPPEPPPPSPPPPSPPP
                     PSPPPSQPPPPAAPPLAPIVPARCKSANMLLNTFPDIDASFTGASMVYPAGDLVVEYD
                     NSGDQKTPSANAVMLLDRTYSPVATSTGSVVARIQTKQYLSTTLAASRNDPASVAIIL
                     RTLHAWEDRVAIRVAVQVKDKYGSPATTGSYALELTLTDPGNSLSQTYTNACAERQGN
                     NGNRFATYCSVTSSPGSTWFLLAASATVSVALRVNGVLVDTATSGDTLSFVTSPAWYN
                     PLYRSDFSSNFRSSPPGYSPSIDKLFATMPISPMYASEPFDVFIYASSQSFSIAAWRV
                     QLYYDTTQFDVENQAVSDKFQAPAVTIDGTGITLAVAGLLCGTGCTTTQLNDVTGDVI
                     YLAKITLKSKAGVPVGSIDTGAYPYAYEMVNYGGGIVQDKTTGVMFDYRGSKRSTGFV
                     EIQEVVPRGIFAFPPPSNKPRGELLNSALLDGNDAVYTMVVNEYNSNDEANEGSNVVS
                     TATSPSCSFPVGINNNVIDSVTNCVVRMTTTETDSQGGVTLGVQVISSGATMTRNIGF
                     DVYAPQSIVILASDTNNILERITVGTTPLDASGCTSDETVYQPTTLHAIVDGVDLTNE
                     VSFFIDDTNVIRFASGTGDRQDVVQGVTPGSTTIRLYSGAPDSISLSVSDTQVTATVT
                     ARVVTSMSWVTKPPSTYNYPGSFSASVRYENAMNSEGDSGLIFTTLEWSDGSRSDVGY
                     ASSLGSLAFTSQISSSIEVDAPGVNGNSDDFTRVTVAQGASPMCTEQGIETRVSWCDT
                     EIVTPDYVPIFLDLPYPISVELTVDASKLTSIVNDARLSPISVATTSGMTLVVTFQDT
                     TTGELSYRTMTADNRVVYTAVSSCASVDNDANTVTINDDSCVGVTATVSATITLDGRP
                     LTDTASVNVVGVDNSQTSLTFLKYPSGGAASSTIGLIECTSDYHSVRTRLRVRLTDGT
                     LINVDNQASYSSGTPGVASVSDRRVLGISAGTSVITGTFGSSTSGSSPITVVDSVVNP
                     VNIVEWSVPTSGTTLSGVVNSTFGTSVTLRFQDGLVFSLGSSENAGVPAVSTLIEFES
                     DGEYSIAVIDDDGTIELRKNSITDVSMFARLTCNAGKFDGKFTQGNLMADTLDVDLGS
                     QSGLQFEPTQTGEIIQIDVYANPGNAYLRSISLVIETTDIGVIDPATAVWIDPATPQF
                     PVTVNTQIPGEPNRIAVLSGASAPSGSSNKGKVFLGTIQIIAVGSGASVVFGEIQSME
                     TVSTLGCDITQDPKPACYAVAVEQPVVAGLGIVTVDAVSGFGANLYDELVSDVTYSFD
                     YRRMSECDPCNGVGQVPGDVNGDCKLLSSDASALQAFIGARQTFENTGIGTDPLETYT
                     ANGQSCQWLREQLNPNRDKFTAQDGYVNNAIGKPKIDTSDVVSLIRTEVGFYRFLTGV
                     TIECTSSGGVDVTLDLSEPDGTGGARPADGNFVDVKFEMRIDPTRTVIAATAGSIIAS
                     DPSFPSSFPDYPDGGTGSQTPLVVQAAAIGNGKFRAAISMDYQPEATEFYVAFLIETK
                     NAQLIKTIPTSYQSLLGSDLQPYSDSGISFNPSIGSYQSLVRDTAFVCNGITPPPSPP
                     PPSPPPPAPPPPSPPPPSPPPLPPPPLPPPPSPPPPSPPPPSPPPPVPPLCFDQELLF
                     IDNSPREDIAFSENIGGGSAITIAGWIEVGDISPDDGYIFQTSQSGTDLIAVQVSGGT
                     GTTRSVRYRSEPVGGALVDVQTSNVITTNVFTHVAVVVQNVESPNNDIAIYVNGQSVF
                     EISSPEVRIFPRDVSRNIREIGGNYIGRMRDVVGLNRALTADEVALLMIRELDVVYK"
     gene            181370..182179
                     /locus_tag="ERVG_00198"
     CDS             181370..182179
                     /locus_tag="ERVG_00198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16074.1"
                     /translation="MKSILFTIVITGTNAYSYCHDHSRNCRSWADSGYCIDDNVTIAS
                     RTKEMCPVSCNIVPHICDDSNPSCAQWAVMGECKNNPEVMYKECPLACGHASSVCVDL
                     SPSCPYWKDHGQCETNADFMNKMCAASCICKRSCIDKHNSCQGWALAGECRKNSNFTL
                     FTCPMSCGLCEGHHETLVDKDTTKCPLWARNGECVKNPSHMAFYCPVSCNIGDNTCGD
                     NRAYDECTGWRDEGYCELQPDFMEKECAATCGTCSVLELHYATSLLTHDEL"
     gene            182393..183451
                     /locus_tag="ERVG_00199"
     CDS             182393..183451
                     /locus_tag="ERVG_00199"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16075.1"
                     /translation="MHNIVLFSAGQIPTVFIEGSTLCLPPYAPPPSAPAIVAELKVTT
                     IMTLDGTYNRSVTASAIVSKTYEILVTFANNTEYLPPSNILVFQTYTVVVEEPIPSNI
                     RELLCLPFPRQSYDFMRCIVKNRIEFNGISDEIRRLSENLNNTYTVSVPMTIDGYPGR
                     EPSFNNTFNYSAVNIDAVTMQIQTDVSDTENYQLLRDADIVASKRGLSLLVESGTSDF
                     INDTEIVLPSPPGIPPVQPGQLHPPSLPPPPLSPPNEGGKVNFGLAVCIPILVIFLML
                     ALYFRKVLKQTINRILLSRLQVAPVDVDELDAEDTELDAEDTELQENYEQVPSSYFGA
                     SSRFATGSRFNTHRSRFM"
     gene            183566..183856
                     /locus_tag="ERVG_00200"
     CDS             183566..183856
                     /locus_tag="ERVG_00200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16076.1"
                     /translation="MITFLILLLHYAYVYCDVTPSSPPPSPPLFPQCSAPLSFPPEIT
                     DVEFSTTFGGRYGITVAAWVNIGSVDSEVNSIITLTDNVLNSIVEFELHCPS"
     gene            183899..186583
                     /locus_tag="ERVG_00201"
     CDS             183899..186583
                     /locus_tag="ERVG_00201"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16077.1"
                     /translation="MIVVLILLLHCAYVFSIDPLRVGNVLDLRLATTYQDLANVFDVQ
                     APVNTLAFVDSRTGRPWSECQAFSFEWWGVDLGSVVTVGFVRLQNRNDCCPERLHDVD
                     IHLGLIPNTYVGNAKVASGVTVLSNVMLELEINAQGRYMYFRRPPEVVVSFTGITLCK
                     LYVFTFYPPSPPPPSPPLPSPPPPSPPPPSPSPPPPSPPPPSPSPPPPSPSPPPPPPP
                     PPSPPPSPPIPPPPSASPTPPPPSPPTPPVAPPPSSPTFCETYAIRFDPTAGEKNEYR
                     IDIDLTNYGAGEYILSADVYFSDDFDGDARITHSRWYNENSQIAIEGQTSSTPSSQWR
                     SITDSITISFNPVYMYWFLGYPIESTTGYVWVTNVQVTAPIGDLLIPDGTFPNGQNLG
                     QYEPVRFPGLISTVPSCSTPPVAPPPSSPPPTLPPLSPLLTGTLVITGCNIDTVRCEP
                     ATFNTGSVRCCRDDPPNRGISVCPSAPGAPGGAQKLPPVGINITGSQDASLYTTSLVC
                     TTLGYRLCSIDELRRTQSTQIACDSGCAYNGNTHSMISSDPCAPPSPPPSPPPPSPPP
                     PSPSPPPPSPPPPSPPPPSPPPPSPPPPSPPISPPEPPSPPPSCSVVFRSKTDASPLP
                     VVVTKTNAVEQNIWVHLTVTFNQVDGNIKFYKDGLVIKNVIVSQVHFPDGIEYSSRII
                     GKSFTNGQMRDIAGFNYILNQIEIIQLMHQTLNLEFGPNPPEVPLAQQVVVGSPSTTE
                     YSTPPYIISARFDDANGVHYIYISNTLPRPTVGALVTFTFNTYKCVMKYTEEIIRDNF
                     GIEYWALIATPEQPLKGANLISNTFPPSNPSCSSCVNQGYILDSNTNNNESGDLVFSF
                     ELNSPSPPPPLPPIAPSPPLFPPSSPADTYDPYFGYTG"
     gene            complement(186697..190332)
                     /locus_tag="ERVG_00202"
     CDS             complement(186697..190332)
                     /locus_tag="ERVG_00202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16078.1"
                     /translation="MAKSSGPWYANLKTNQIVALVAAGIVVTLIVLQVFGFDLWSRFG
                     KSDNFIPSFIDGGGDTDPASLLNVDEELVGNLSESIVAEQPVSYMSPEEITHGDMLLG
                     ILSEGYVMAAEEIASSRLETMMNRIMVSGTALPPGQFVNTLDDKLAYAIMKDLGGEAS
                     EDATKAAVKKAAKILGDPKLISELPADSVLKQYLVSEAGEEVSEKAFKRIGKNTQKML
                     LEFGGMKSTSLTGAIGNLAWDAGKTIAVMIAQRKLAGFAQKKAFLIAQKKAMMAAGKR
                     LISMLAKKQFMMAAKFMMSMAMGPIGWAIEAVGLIGTLIDLWDPNNENDRLDPKDYND
                     EVEYIECRAALVAKTNGRPWPPVAQVQKFFPEEYEQAYDDVYFTYQQRAVAHILDNPD
                     QDVGLTAIVMQMTFGIPDRVLEEQILKKVEEIDVPELEHQHAKFSALILEMMRQSPQY
                     RDATMYGHLVRHITENSNRDFENAKAAPFWYFAMSIPTAAYTGAISTEDIPAAKRGIT
                     YSNLTIYDIKVTPEREEFGRKCIDIYRAKVPYAEERVRAYEIKEEDIMDDLETALIPE
                     MPDIDEVKERTAEYFRYKRKGIGDNMISQMITKKMGPPTEMSKKKFGFRDEGNVTGGR
                     AKNGAHSNWLAMCCFQQFLLQLAQHPGVNVNLGDAAAAYNEGDTSVKLFGVFKWKEKY
                     YRAFAPRPWHEPRFVSLDLRYCNQTETSIFLNKAAARRWNEVFEHQRTAGNVLYQFRG
                     IPPDRVPNAPVAIWSRNYPDVSVGNEVSDDEHPTPLKTRIIKNLTNFERVYKQDGRIY
                     FKKWIDARVVKIMSESDYNKITNNLKDKSKGWGEFLQTESFDPTPVDYETAADTLEAK
                     KFYKIKLAGRQYIFYNGNTTGVNPWLKKAEAVIKKKSDVKEFPAISGITFGIKLYIKG
                     EFKHHLKNRPNGTLLKDDDEGMFDAEVEINEKTYHDLVWVNIIGPPDPKVYKNPDGTP
                     RDIPHIKVGEYTNDLRVGIYKLSVTSYDQKNYGEEEICHFVNYDGNVNPKWEPVAHEG
                     TISEPRMFFLGINRLYQWCTKGMENDDSMMLHAKDGHGRIDTYDDAHISKHYKHRNQD
                     RMIYEVYRVQTKSGVPHAIMNRGSKPYIGFNDWYEESSFTDANYVRHAWQTFHEDTRR
                     CFVKNEDAAKHYCKKYKGENWVRKNTQTDPRDGHSMYQGECRLPRWSLLFSFILGENL
                     IRMANRV"
     gene            190399..190941
                     /locus_tag="ERVG_00203"
     CDS             190399..190941
                     /locus_tag="ERVG_00203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16079.1"
                     /translation="MTDWKEAGYSGLAAYGKFKAVMGAIVGTVICLLMIVFGFKYLGK
                     TTKYSASTNVTLAMTEGCKQTTETRDGNTRTVYTCMVSAEYTVGSDTFTYNDTISSGT
                     KYANGSNVTLYYDPKNPGDATLKYHINPGTLALAGVIIGFLGLFGTWGYTYFVLKNKE
                     IAAVTGGVHLAGDIVGAFRR"
     gene            complement(190938..191924)
                     /locus_tag="ERVG_00204"
     CDS             complement(190938..191924)
                     /locus_tag="ERVG_00204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16080.1"
                     /translation="MQQSELEHYESSDDETSSYNLVETNKLFMTELYKYLWELKIVCM
                     AICPEKTMMELANIAKFDKKYRYTTRNRGKHMVFKYLNINELDCIPKISSKTIKDGNG
                     CIELQNGDYLCDENRLHRSSYLLNTNSLTRELSRKLKSMRAFVSRIQDKMHDAFSYTI
                     ELYTTIQKELRTLYDLRILLNSLAYVVNGKKLAIGNVKAKDKLWELENSVFPVHMDKT
                     YMLKYKFAQYVYKMKTPDDYSILISFPPEYSTISSISEIDEKKIVDVNGYAYYGNMPI
                     LFIKRSLHTVLTESISKYQKAIHEVAYGSHQDTARMVRLPKRNTTLTFEVLN"
     gene            191964..192830
                     /locus_tag="ERVG_00205"
     CDS             191964..192830
                     /locus_tag="ERVG_00205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16081.1"
                     /translation="MSNQSITVTFEGISGTVNVFEAVSSLVTDLMFKIFNEDDFTGIR
                     ICTLDSNQVCVIYADFEATVDNLDVGSSVQVCVPAKLLVSVLKCIKEQNILVFEYPQS
                     SGTQQLIIHQYEQENSSITQKFIIDAIDAPIQDELDTEFDYPCSMNISLTEVREFIVN
                     SGTFGADTLTIGVYRSVKDQYNIANKLTLSTDGSIKCEKVYYTEHTTEEQANEFSVDN
                     TLAMKDQPVGHSFNPLVRNTFGVKYIKDFLRPLQAIDIRLSMANEMPIRLDYPISEKS
                     FITLFITPRNID"
     gene            192839..193942
                     /locus_tag="ERVG_00206"
     CDS             192839..193942
                     /locus_tag="ERVG_00206"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16082.1"
                     /translation="MYRTALSAHEAIKWVSCPTHGQCILFKNHMYPNGDLLQRKSYNT
                     CASCVTTDILPTLNTNHIVFDDSKKIGGLGSHIRLYLQASTSHVAISLLVLDISCPTK
                     QARLEKYVENTASLSLKEECDPYYPFNGDMATDLILETPSKLPTVILQLALLDISCVS
                     FDTEDSITVIVDKFTRTYSMFTANADHALNKPTREPQNWQAITYLGTQHYTAESLGRA
                     IAKTNKLPSLYDDYLPEILTRSIHTQTAIISPTGSHQGQTPTPKLKGDTIPKMCYEYQ
                     KLVIMAYMINKYIPTHKYSSQIEALFLFFGMHGYIVRQLGAYVRSDKYRGTGKNVRTF
                     SGEDAGSENIDEYSLKRLKMIDGKWRGLKYNDK"
     gene            193985..194716
                     /locus_tag="ERVG_00207"
     CDS             193985..194716
                     /locus_tag="ERVG_00207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16083.1"
                     /translation="MDPPPRQTSKIPLPEDTIIRKSVFGRAVTGFSDENDPRYSELKC
                     GSAITQIVNDSHVFHSHELNGRKEWNRPTKIACYHCCHQFKTAPIPIPKKYDSYSRQF
                     IVHGNFCSLSCAKTYVLDREASSPHALTLFLKMASEVYGIKECIPTAPPKEALVLFGG
                     NMSIETFRNNKVNVAVMQPPFINSYTVIEERTLMEQTSSYHMPIGSVKGLKRPRDKLQ
                     LIVEPKPEKSPYQIYLEQRNKPNDA"
     gene            194709..195113
                     /locus_tag="ERVG_00208"
     CDS             194709..195113
                     /locus_tag="ERVG_00208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16084.1"
                     /translation="MLSEYVLVKFQKSMDDLDRVPLPLHRMPVAPMVPTDKVQFYTKS
                     FNELMELYTELTKTSNDNIIASVIKEELERRLFDVVDNKISRLTLLVNEPFNDDAIML
                     YENTRQSLMKSKELYNNGSITLAQFSNNVRVF"
     gene            195159..195485
                     /locus_tag="ERVG_00209"
     CDS             195159..195485
                     /locus_tag="ERVG_00209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16085.1"
                     /translation="MFTTADVWDCMRAERFLLKLLHTIKNTILPELIIPDKLKKYTHK
                     IEIPNNVSVSQLGITISPDPQTFGYIECKYYKNNYPTCLNGTQKRIFKTYPSLIIHIQ
                     MLLFRE"
     gene            complement(195566..196579)
                     /locus_tag="ERVG_00210"
     CDS             complement(195566..196579)
                     /locus_tag="ERVG_00210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16086.1"
                     /translation="MSKQQKVNAFDKLMTASRQLNDVYHVELYDDGVVRYTDTLPESR
                     WSSAPFNSCIRRGSRKYTTRIQLHDKRTSARVTYHPKFRLQKIPVHHLKSALQKNVRT
                     GNVVGALNIAWTCTCNPDGLRELLRRLPIIAIEDAIVPFNFNLITWLMLASHSHSYEF
                     TNHDIQQIIKFVYYIATVMYRDPMFDIVEDAPVFNIANTPLANSIILRESFGGMKGDI
                     EMLKCAAKKWQCRYYDKIALVSYNTVFGFMKPGKYVHERMINETDIPLSAVDFHCDSR
                     ILENIPRDETSYTKEMQRKAMWDCSSSLNLKTDWINGKFLHTGDDTMYAQKQLAKLSC
                     KKI"
     gene            196680..200150
                     /locus_tag="ERVG_00211"
     CDS             196680..200150
                     /locus_tag="ERVG_00211"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase subunit B"
                     /protein_id="AEP16087.1"
                     /translation="MFSNIEDATWSVIGDYINSVSPVAHQIESYDHFIENQLPYIISE
                     GSDISYMHSSGKVSHHVHFTNPSVNRPAIQESDGFYKPITPHIARLRGLTYSSTVVVD
                     VIHDRINHTVSPPTLINRKVFRNVIIAQIPVMVRSKLCYLADVSENDLSADAKKHECK
                     VDPGGYFIISGNEKTLIPQTKIRTNHVFIFPSKHGEKHKYTAEVRSCHEAKLRSTSTI
                     YMNINDISNGEVPVITCKLPFLKSNLSVFILFRMLGAESTDDIINYIGNIPKDTEAIL
                     RIMLDSDTKQNYSRDAIMDWVGRNVTSDTTRATKESREKYIDHIITSELAPHMGLVNN
                     PETNKKKMIFIGHMIQRLMSVATGQEVVDDRDDFVNKRIDSAGALLALLLRQHHRGNA
                     MQGLSTQLRKQVESPREATFNVGEIVSHKKITSGLKFAFATGTWGISRGGGTANGGQT
                     GVVQILPRLTTMATLGASRKINTPIAREGRTAGPRMLHPSSWGLVCCSDTPEGQACGL
                     VSNLAMTTRIRIGAPMQPIAILLMTLDHTIDISTATSHERYIGYALHVNGTIVGYAIT
                     IDQIKEIATQMRSLRRHGNLPFDCSISISNDNSLFVNSDHGALLRPLIIRDRYHDFVC
                     MAMQNPAVVPNKYTRMLREGIIEYIDSAEQTNMRVAIHHTDIEQDEYTHIEIHPALLT
                     GICVSQIPFCDHNQSPRIAYQAAQCKQAIGLYTTNFAERLDTVGHVLATPQKPLVTTR
                     LEELLGTSVVRSGAVPIVAIMCYSGFNQDDSVLLNQSSIDRGLFTSFAYHTIRDEEKG
                     TGADIERFENPKNIPGCSGMKEADYSKIDDKGMPIIGKTFYNGDVLIGKVVSMSLLQA
                     DPKEGEVRRDTKRDRSHVLRTDEPVVVDAVFLSKTPEGHGYVKVRTRAIRIPMVGDKF
                     SARHGQKGVCGVTMPAADFPCTADGVAPDIIINPHAIPSRMTIGMLMEMVLSKVACYE
                     GETQDGTPFTGNNIELIADRLETHGMQRYGNEMLYNGMSGEILESMIFIAPCYYQRLK
                     HMVVDKSHARNRGAQQLLTRAPTEGRSRDGGLRIGEMEKDSIISHGAGDVAKDRLFEQ
                     SDIFECVACEKCGHFAREGTDDTSVKNSGMWCEHCKTGEHCTHTQLPYSMKLLIQELA
                     AAHISATLEF"
     gene            complement(200153..200494)
                     /locus_tag="ERVG_00212"
     CDS             complement(200153..200494)
                     /locus_tag="ERVG_00212"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16088.1"
                     /translation="MNNIVVIGILFVFAIVVARIAWNNKLKYSYTDAEIGDTKQENLK
                     ELQQLTDAEVLAVDDSMHQAGRDVIKRNVGKRMRATSLSERKGAEFYVDEHKYNTKAY
                     KAHMASKYGTN"
     gene            complement(200502..201236)
                     /locus_tag="ERVG_00213"
     CDS             complement(200502..201236)
                     /locus_tag="ERVG_00213"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16089.1"
                     /translation="MKTLTFFLSVCIVTSALDIKPSGFVSKSNAILNTPIHFMPNHGL
                     MGKFHASVAQTLEDATDAYLYEGVNPRAKFAKYISQYYKDSSVIDIGCGVGQTTFELN
                     KFLDRSCKLIGIDASCEMLDVAKERDVNQDVEFHQLNAVDIKHKYDVAVISNLFHELP
                     HQAHKEILNNLVNWCDDIWVLDYNPDTLPPADEMLSTVREYEPFLADYQKHFSDVIYD
                     TCYVHEVDIPDMPIGVKVWNLNKKYP"
     gap             201386..201485
                     /estimated_length=unknown
     gene            201486..202265
                     /locus_tag="ERVG_00214"
     CDS             201486..202265
                     /locus_tag="ERVG_00214"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16090.1"
                     /translation="MVVVDLAAVAMVVAMAVDLVEGAMVVVDLVVVDLVVVDLVVVMV
                     GVTGWWDGGGGDGGGGDGGGGDGGGGDGGGGDGGGGDGGGDGGGGDGGGGDGGGEMAV
                     AGMVVVMAVAGMVVVVMAAVAMVVAMVVEMVEVETVVVETVVVVMVVEVTVGGMVVVA
                     RAEVGMVVVGLAAAGMVAAGLVAVVMVAVVMVAVAMVVALKAEVAMGVVEMVEVLVAV
                     LMVVVTVEAVTVEAVTVEAVTVEVVWMEEHVARIFLRKNSE"
     gene            202641..203360
                     /locus_tag="ERVG_00215"
     CDS             202641..203360
                     /locus_tag="ERVG_00215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16091.1"
                     /translation="MRVVVVMVVVVMVVVDLEVVVTAVVVMVVVARVVVDLEVVVTVV
                     VRVEVAKAVVVMAVVVMAEGMVAEEKGEVMAGDLVVVVRAAADLAVVGLVAVVMVVEE
                     TVVVAMVVVETAVEGTVEVMVVGLVVVVTVVAGTVVAGTVVAGTVVVVMVAVMAAAVM
                     VVVEMVVVGMAVVMVVVMVAVVTEEGLVVAMVVAVTEEGLVVEMVVVVTAAVMAVVVM
                     AVVVMAVVVMAAGEKVIYQSE"
     gene            complement(205064..205645)
                     /locus_tag="ERVG_00216"
     CDS             complement(205064..205645)
                     /locus_tag="ERVG_00216"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16092.1"
                     /translation="MSTLDYVIDMSQSHLPGYVHLTNLNKETFPPTATVSAFGESSTV
                     VLLPYTADRVENNTNVVITSAIHNKVGTTPVLVVLGARKATLMDIQLDRMNLTHTPGG
                     VLKKRTNDVIITPIAEVGTTPGNFKIQGVITFKNCRSYKNGFMCKFRIQDDTGNIGMT
                     AWNDTYEQFDQLLEQNQTYTISEMTVKKGKSNI"
     gene            205673..205990
                     /locus_tag="ERVG_00217"
     CDS             205673..205990
                     /locus_tag="ERVG_00217"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16093.1"
                     /translation="MPPSTQLKQTVNVTSKRWWIQYSQGFIITAIIVIFLSAMTGNMR
                     DIGIGAGVLALFIGIGLFASFRKYGVWATIASGPTLIFGSPPPPKEKQATMDSTFNLT
                     SGY"
     gene            complement(206007..206291)
                     /locus_tag="ERVG_00218"
     CDS             complement(206007..206291)
                     /locus_tag="ERVG_00218"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16094.1"
                     /translation="MFNVTDITKKYNIPVSNFANYVCSTNIRLSSSYKQDSQHAIDLF
                     ESRIRDNLEELHASAYYSDELLFSIVTSVCAHELAYVFTPYNGEDLSPKW"
     gene            complement(206299..207015)
                     /locus_tag="ERVG_00219"
     CDS             complement(206299..207015)
                     /locus_tag="ERVG_00219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16095.1"
                     /translation="MLYKSNAYVSARKRKYGNIENVDNVENADKKTNDDNNSKSKKKS
                     GDDDDDDDDDEDSDTEVYVMGTSVYYSTSVSTKNTGKLRKALHKATQTAINSNYGLHA
                     PYVSLYIHSCGGDLFAGFSAFSLIRRNVIPVVTIADGYVASAATFLLLAGSYRYIVPS
                     SHVLIHQLSTGGYGKFQEIEDDYKNCKRIMERMHALYKEETWLPSAILKKLLKSELDL
                     TDDKCVKYGIVNELLPTELL"
     gene            complement(207019..208149)
                     /locus_tag="ERVG_00220"
     CDS             complement(207019..208149)
                     /locus_tag="ERVG_00220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16096.1"
                     /translation="MSIDRYTQFICKRRCGDEQIHTHLDMFEGKYCITTKNNDHSTFL
                     RLRAAAIDAGYKDCITEIATPEHIFHADIDAHVPTDIEFDYIGFARALQLTLQQQPEV
                     HVSNTTLIILTAPSANEEEGVKHGMHIIAPYIKCSFDYEKGVREASFERFQEILDRIS
                     PNKKIYAADIYDPAPYTGKTGSGLRMAYSYKTKKLDDGTKELVNRRYTVHAVLNPNGT
                     IHEKQTASFKSSTLLTIQRCTIRSYAKSINYVKKRKRDAPTIGSISTEKGKKIFEYAA
                     QIDTIFSHPVVKDTMQYDHPNPKYAGHILKLDETYCPHMQKKHKQSTIYIKYNLFACV
                     TAGCYCKKYTCHKWKPECIPTDMETAKEYNLLGKDNIPLGFF"
     gene            208203..209789
                     /locus_tag="ERVG_00221"
     CDS             208203..209789
                     /locus_tag="ERVG_00221"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16097.1"
                     /translation="MGKKTSKPKIDSAYYFIGAIVVAILGYYYYINYYQNGINLEVYG
                     YVLINASENITSPTMPSLPNPPSPTTQPIDPLPVPEPAPMPDPPTPSPPPGPGPPPSV
                     PHVEVFPTMPVIPPFTPPSEVTQANAPLPPAPKVLPKPCSQHKCASHRKLHPQASSKN
                     GTNDADCCVDIMCDEYTKCPIDHLRKLNPERIAGTTTPQCCVKMNVSSGWYIIPHKYY
                     DDRTINLFHNTRSSDECSKKCQSKGNYAFSWNMKNNTCYCKNDIKQPKKSTGQGDVWV
                     SGRYGNGVKLCEHRSMKGKCQTFTAPGKYNVHHPKMAGNPRECETTPLAGRTVALYSD
                     HWKRFVKIDGRRVIMSPTINVPSVPAWWHSEKFELVSAQDGQFALYNHKYKNYLRMPG
                     RNKDMDGSDRQNKHSSIPHNQMGWERFQFIHKGDGQYAIKCPYSIGGPSYMRAGGHHV
                     NGVPHSGSWEQFRLIDVHCRVGFNDSFSSALVYPGYAVGLYEHNNFDGKKWWIGPGQR
                     NELGDHGDRASSIIVRRDTW"
     gene            209827..210252
                     /locus_tag="ERVG_00222"
     CDS             209827..210252
                     /locus_tag="ERVG_00222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16098.1"
                     /translation="MYLMYCVMILSICVTARSLGIFPQRRIGHGPINGAIYKGEHKFA
                     FMFKETFELEITDNTSGILRMNGYVSHEDQNIQIKPLNQCEFVLECSRCTSEKLETFN
                     VELEQAIYDYDMDAICLYIKPKNGKVQKTFMYRERHATY"
     gene            210253..210555
                     /locus_tag="ERVG_00223"
     CDS             210253..210555
                     /locus_tag="ERVG_00223"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16099.1"
                     /translation="MFSFVLFALSVCFPMDNLPIRIKTRRMMAAEDLKTGSRVAALAH
                     FEVSNYYVQNGPKLLTPSSVSNATDNVTISAAEIEGTLRKYLEEYLKKRREDENDF"
     gene            complement(210552..211064)
                     /locus_tag="ERVG_00224"
     CDS             complement(210552..211064)
                     /locus_tag="ERVG_00224"
                     /codon_start=1
                     /product="ERV1/ALR family protein"
                     /protein_id="AEP16100.1"
                     /translation="MPNKTDETSQVSIDVWGNALWNAIHALSFSHPVACEDTCNKKQG
                     MHDFLKSLKQVIPCEECRGHYSAWFDENVKEGKNSAIFKSRDSLTTALVNLHNEVNTR
                     TNKPQVSIDTVRAKYITASTKCPGNATTSSLGLSGENSNRNIIILISSVVVASVIAAG
                     VVGYRKYKKS"
     gene            complement(211193..212296)
                     /locus_tag="ERVG_00225"
     CDS             complement(211193..212296)
                     /locus_tag="ERVG_00225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16101.1"
                     /translation="MMFFITTKSMSRYFPISRVIGDYEIGGRVIPETGQIVREFTPSP
                     IPGKYKQFWITKDTGDIYLRKLNQDNSYTWEYVSSHEFNITRAVAQAWVEPPQSNEQL
                     YPRAWNDNDCNAEHIAWFPSFGSSLDFKITMSDAYTQWPLKFVKDDEPENSDHINNDQ
                     TTPYELLVLPSYTGNNILTRTTYYFDTRDNVMYVYNQLGKLEPYEGIKTGNPKTQMKY
                     TLPECTIMLYDLRRKIFGIPSRSDEKHETIYKYIRKHGLVYDGLRQELRSKASDNTII
                     SYISAAVQPTDKLDRKIWKKITTRAMRTAITEIYNPVESMRHSEIYDLIHQKYDSAMI
                     GRSDAEIYMQIKFITRILTILYNKGEAYPTGWL"
     gene            complement(212327..212569)
                     /locus_tag="ERVG_00226"
     CDS             complement(212327..212569)
                     /locus_tag="ERVG_00226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16102.1"
                     /translation="MSPGPKSHIKKPKRKKVKRDPEYPLNTDIEVYVKFGSEFIAQLP
                     EIGEEFGEDKAILVDTSEIESHIVTQPKSTRSASRV"
     gene            complement(212605..213660)
                     /locus_tag="ERVG_00227"
     CDS             complement(212605..213660)
                     /locus_tag="ERVG_00227"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16103.1"
                     /translation="MNKRKTSSSVTLTSNKCQTLLKNRSKKIILKHNCSVLSKSDISE
                     LKDAFNPNLPTKLVAIHGPIGCGKTYIVNELAKQTNHTISIFDPSSDCNISEELQSLT
                     ATKNKFKKNINQYKIMFIDDVDALPEQQVNNIVEYMQTEFNPTQCCNIIISYTSSTKI
                     KSLIDRCNIDIEISAPSVDQLLNFAQGYKTVTHEHKTLCAVECNGDIRQFMRMVGIVD
                     LDDSVTIIIKPDQVYTPHDAIRKMLEYPDQAPTLTNTYCNSKELTPLLWNATTNVYAQ
                     YDLDIGHMASVQSSLNNCNIKNTYETYDFNNELNNAILGIVPVACEIPYTSDISSHHV
                     QSTSQIAKLSKSYLLYK"
     gene            213690..214496
                     /locus_tag="ERVG_00228"
     CDS             213690..214496
                     /locus_tag="ERVG_00228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16104.1"
                     /translation="MADYTNNMFLRIEAAMTLLRMELEQVNLKLTDMESSINRFETNS
                     ANPMNRPASYASMVSLNPSASYADITLSLPTQSMPTESHVPLISEWTDVEQVEPYMEI
                     LLNYVLDRHKDEMRRVSKGASAFLCKDTNGVIIAALIYRYRAGCGNEILRHIATSHVV
                     FHEHVILKYVELLTSTTQNFYTETHTSVAEALICRGVTHIVDVNHISRVLPHIRKTVN
                     ARNTPSNLIITNEHDYRRTFKPYSETEKAPLYSYIIPPGNRIRLLLGNPQ"
     gene            214535..215092
                     /locus_tag="ERVG_00229"
     CDS             214535..215092
                     /locus_tag="ERVG_00229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16105.1"
                     /translation="MENGSVIDAFSMWLFHTRPLYVLQTVSCLNREWNAVANTIDTGD
                     ICNNMNKICNKWFENIKEIYDESDNTVHYNIRHSVKNEVIRMSGVNHYTILKLKQSGL
                     SRDHACRIVRSLQILYRQPWAIRKLHRDGVPVITPHFLKTLNSNLCAVHGTKCNRTRR
                     KICITHDYKFELSCRCRTSITRLGR"
     gene            complement(215073..215462)
                     /locus_tag="ERVG_00230"
     CDS             complement(215073..215462)
                     /locus_tag="ERVG_00230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16106.1"
                     /translation="MSDSDSSVSSAIQTPPIRIRQKYNRTEQNEPVAEQRKIAPDKPV
                     EPVAITPPSAPEPVNYKKYIVIACMILMMLLVTYIFMNPSTIYRKKPEPEKVAEITPP
                     PLPEPIKDSVWDKPHHHFDPLFTVQVE"
     gene            215503..216726
                     /locus_tag="ERVG_00231"
     CDS             215503..216726
                     /locus_tag="ERVG_00231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16107.1"
                     /translation="MVDLASIKKKLAPYKMMIIIGALVGVLMYWHYTSNGIQTSESTI
                     GGGYTGGYTGGYTGGYTPPQTGSGGTQHSSEDDNWTVGYYSVVPTDTTEIIASSSRTY
                     TDAKYLNLPHKFTDEQCIAACKKEKGDFVNIGSVLPGVSRSCNCYTTSMQCIKFSGMS
                     NGIQKTYSPSYLKRCPAIITTKETTSTKTIYPDCDPRNEYPDDKTKECKRCTASPGMY
                     VQVCDVHLKVVTCPPCDTNMVRVGCGGTSVGRCIGRPSCKKFQTYDRNNNICISSAHC
                     PPGTGPYTHSNNCVQCMGGTKRQEKPLMSGKVKIVYDMDSNKPVYIRSASNWGYLNTI
                     KAYGQNATKEIVNKDGAGYVFEAKNGGPGSLTDVISHELAVVSVDEYSGMVYPYNGQK
                     VHVTFMNIEIPYKCL"
     gene            complement(216744..218348)
                     /locus_tag="ERVG_00232"
     CDS             complement(216744..218348)
                     /locus_tag="ERVG_00232"
                     /codon_start=1
                     /product="phosphate permease"
                     /protein_id="AEP16108.1"
                     /translation="MSGFVEYTWIVVFGAFAAFFAAFGIGANDVANAYATSVGSKALT
                     IKQACFLAVIFEFLGAVLAGSAVAETIRKGTADYECFDGSYMDRAILMYGNLCVIGAV
                     GIWLLVATKFEMPVSTTHSCVGGLVGMTIAAKGADCVVWYKEIDIDSGKYLPGGIVGI
                     VLSWVFSPLLSGIVAVLLFLSIRTFVLRSAQPFIRSIRAYPFLVWGAVTINAFFIISK
                     GVSKKICPSKYNIWICQGWDASLPNGAEVTKAIAPGKVNAGIAFGLSAGCGVVAAIAL
                     IPLYKYIHRTTLDTFSKPKQIENKAEDIEKPKNILAKTASKLFDIDIHAITVTDEKVS
                     VIYNNAEHFDEKAEYVFKYIQIFSAIFDSFAHGANDVANAMGPFMTIWVIWKAEGGAI
                     GGSKTDIGDDSYWILAIGGIGIGIGLLLYGYNIMQAIGVKLAVITPSRGVCIELGSAV
                     IIIVGSYMGIPLSTTHAQVGATVGVALLEGKKGINTKVLSKAGFGWIITLIVAGLLAG
                     LLTAQGIYSPINEYAFNSAIVFNETS"
     gene            218454..219437
                     /locus_tag="ERVG_00233"
     CDS             218454..219437
                     /locus_tag="ERVG_00233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16109.1"
                     /translation="MNSGILALLIGTVLTTNTENIFMQVVSAAILTTLPFAHSLLIMF
                     AFVAFAIFPLLSSTHAEYTRKRDFVIDLYCRDIIVICFRYIIYSNLSQYMLLLPCLGI
                     FESYSIQNMVDSYDMNTKKRIVPTQIVNHTSLAIVELLALVIGRMLLPLDTLDDTKYA
                     GFYPSLIVVIPLFTILFDLFADIGFYNIHRNFHETPFLRTFHIPDHHKNTGKHNKLMA
                     YETYTISTIETLSIALTYFIGFGALILVYGELSTLIVSIMVSWMHTVELMGHTELSWT
                     PKFTYNRIVHDILGISLTSKDHLIHHIYPTTNYSKRTRLMDYICNTYREKL"
     gene            complement(219432..219851)
                     /locus_tag="ERVG_00234"
     CDS             complement(219432..219851)
                     /locus_tag="ERVG_00234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16110.1"
                     /translation="MPSIRITTTLTNEERDSLYLGNIPRIVLLFDQYYRKNKRYPTLS
                     WYRKQLIITDSMPTVVDWEYNIDHILPQKMAGKLNHPKNLIIIPACMNKSFGKFIDKD
                     KLNFIGNDIFNTATEFLKDILEDKQEYNPFGIYKYTS"
     gene            219913..220251
                     /locus_tag="ERVG_00235"
     CDS             219913..220251
                     /locus_tag="ERVG_00235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16111.1"
                     /translation="MQLNFQSVGAIVVTSIILIVIIIVILTTIRRRYINAREQKRVMA
                     WKQPALSKHVPSTTTSLLRGADHGTREMLRHRNATDYRTGIIKTLPVPPMTTHAVVQK
                     NPFFIPELMM"
     gene            complement(220252..221694)
                     /locus_tag="ERVG_00236"
     CDS             complement(220252..221694)
                     /locus_tag="ERVG_00236"
                     /codon_start=1
                     /product="thymidylate synthase"
                     /protein_id="AEP16112.1"
                     /translation="MSYGKVCIVVAGAKCSDGRIAIGINNKIPWNSKADMHNFRQLTA
                     STSMPICENVVIMGAKTWQSMGKRLPNRYNIVISRNKDARRVYNIPNNVGISSSIELA
                     ISELKTVSDIETIYVIGGSYIYKDVIDLKIVDKIHMTFVSNQHDPGAFDTCDTFFPLT
                     VNDLESNFIKSKTSYVTKEAHLTCSYHTYNATVIHEEYQYLQLISKVLEHGEYRSDRT
                     GTGTVSLFGETMRFNLSTHFPLLTTKRTYWKGIVEELLWFIRGSTNANELAAKNVKIW
                     DGNGSRDFLDSVGLVDNEEGDLGPVYGFQWRHFGADYKTMHDSYDSQGTDQLQNVIDQ
                     IKNNPTSRRIIMSAWNPNALEKMALPPCHLMCQFYVHDGMLSCQMYQRSADIGLGVPF
                     NIASYALLTCLIAHFTNLKPGEFIHVIGDAHVYTNHIDALKTQLKRKPYDFPTIHINN
                     IPKTIFDVTSDDIILNDYKCHPKIHMDMSA"
     gene            221802..222542
                     /locus_tag="ERVG_00237"
     CDS             221802..222542
                     /locus_tag="ERVG_00237"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16113.1"
                     /translation="MSLHLSASDMSDYMGFATAGSSSLHPVMRQQFQQTRQANPSNAK
                     RPINIVPTKQAVEVKQPFVAAHPPVAPGQRTQTRQPPRASLLAARKAAMAKPNVPAPA
                     AASLTESSLMGPRLDHVEKTLKEVCENITAVDNNQTRVEEVVNTSWLVADVVCDTTEY
                     VTTNDNHEEAVANTPSTVVTSKQRVSVTYPMVESVVDGNEVFLMRRRAVDPETAEVVA
                     SWIVVYKPSDTVEAADGDVAYVTNFSFW"
     gene            complement(222650..223351)
                     /locus_tag="ERVG_00238"
     CDS             complement(222650..223351)
                     /locus_tag="ERVG_00238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16114.1"
                     /translation="MYNRGNLPEICRSCKNEVPPGAPQCLHCGRIFERNNPHLQQRIP
                     SQPHLQPRIPSQPYPVGIPPRQHQYAQPRFPERGFHTNMPPGYEMPMQRRGMLPPHDA
                     VDTKKNKKKSKKKLSDKLVESSSDEEEEMLTIRTKVKKEKKPVVEQPPPTPVAPPPPV
                     APVVASAPPVENREPRRRDDDRRRNDDRRRNDDRRRNDDRRRNDDRDDRSHRDDRRRE
                     KDRKKILALSRRNDN"
     gene            complement(223430..224266)
                     /locus_tag="ERVG_00239"
     CDS             complement(223430..224266)
                     /locus_tag="ERVG_00239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16115.1"
                     /translation="MSNEEVAIDMFNTGLSDTRNFNACPDTDLASNASQTTVEDDLEQ
                     HTLTHSHHDDSTSSDDDPECTICMMPMSHAPDGENIVLGTRTLECNHTFHTHCIETWL
                     SHNNHCPLCRQSVHTTPRSTTPNRNIINIPAVLATIRPELRRIMFRQIITSAISPAAY
                     IYEVSTNLYMSTYALILLFFMNILTIGILTPFVKERGNVSMHTINHAQEVFSNLPLLR
                     IVVLTLFITSRLLELNLLNATAYIACITTTLSLADDFLAMTTIVPARITLHGENQIAV
                     TM"
     gene            224299..224826
                     /locus_tag="ERVG_00240"
     CDS             224299..224826
                     /locus_tag="ERVG_00240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16116.1"
                     /translation="MTSTASRIRFLFYLVIFGVCIYFIHGYASRQGVSQSGATIMVDG
                     KSYRLKQISGHDNNCMMRCIADQYNRTHNDTVHHLDVRRTITREIENKPQLYDTDART
                     VSIDDMKKSGTQGGHMELVAAANYFKRPIHINDVTAGNVIKIPPKNPKHTTPWVLNFT
                     SNGSESGHYDSLVKQ"
     gene            complement(224827..225471)
                     /locus_tag="ERVG_00241"
     CDS             complement(224827..225471)
                     /locus_tag="ERVG_00241"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16117.1"
                     /translation="MDFDTALFTTAGAGILNKKDTLLNCARVAREMLSARGYGCIEGD
                     VTSYSTIEYAMENTTPLLTGSFSNRCRPDSVIYFFNELKVGVKIVRDLLEKLGATPES
                     VHLILVSVQGGTSSRPAHKMENVEFITYKQISYNITKHVLVKPHTYIDKEQADVIINS
                     FAAKPEHFPMMLSTDPMAVFCHYKIGDLIEIDRSSLGGVTEGGITYRLVVSPNV"
     gene            complement(225523..227532)
                     /locus_tag="ERVG_00242"
     CDS             complement(225523..227532)
                     /locus_tag="ERVG_00242"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16118.1"
                     /translation="MPKYSLSSQQQHVLDLWKQGDNIRVIAVAGAGKSTVILEICEHT
                     TEPVCIITYNKPLQEELRDKLIAINSTSVAYTFHGLASEYCSNCRDDTTLSDIVTTIT
                     PKPFLYKNVIIDESQDMKQVYFDFLHLLIPDFSSVQIGLVGDPEQMLYDYDPDDPAIL
                     GFINDPDTHFGVPFSKGELSVSFRLTPCITHLSNALSVKDSVQIVPGNTKVTNEKVDV
                     QICSKSLWSDIAINWILKHHPITFPGTIHILAAHRRKNVEIRQLVNALARYGYGIYVH
                     IDDCIENKKFSNVHVMSWHSSKGSESETTIILGMGASSAQNPLHVAITRSKHRLLVLA
                     ERENIHLPFAKLVVESPDYLNLIDTQRTIESAQFAIDSSIETERNRKKPEGDIENEEI
                     PARERTPNINPPHKIVSNKSHWEPLGREYRVSGHLQLFGTEYLVTPDQIPVDHETIIG
                     NFHGATAIHYLTYAMIRNEYAHTGKVRMYDFIKAPIPTAKRKRRYLENIHDLPAKGSR
                     EYDLLPGFAQKLLKTKYTSLFELTGISDWMTLAVLLNSWQRFHNKTQMQIPVENWLSD
                     GIAITMERTLHEAIPDNITDYNGHVSFTRSETLTYRAKYFARGNGIIYQCIFDDDISY
                     QTKARLSLPAIFAREKLKIINLKKGIVSIYEFPMDPVKTLELFKL"
     gene            complement(227572..228975)
                     /locus_tag="ERVG_00243"
     CDS             complement(227572..228975)
                     /locus_tag="ERVG_00243"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16119.1"
                     /translation="MSDVRTSLQELIHHKLDKHSTACPTHTFTSNNKDSHMRLPTHES
                     VVTVISSYITDIRNDGSTRHPSHQIYEHLATECHKFYVDAKLPDDISSPLQLLKLMKT
                     VLDEFASADKTEQCIILTDKTKRARFVWPRFLISPRDAAIVVTRLAAVFSGMDGIRSA
                     SYRWKELFTHPSKYIPKRGHPVLLMPYSTSTPACTLCNTKNERENCMNCNGSGKVFSP
                     ELSWVIRYNVTFDEHERRPLITDIYDIPGVDLLIASSISSVYYTANETKPSEPDNTQI
                     TYPVGTPHCQHVDKKIKANGSLWGAKNKNATPPEEGFVRYIQRLVRTTFPEFHSEVVV
                     SVECILIDQKRKQIKVAVKGKGCNTCAGKRKDHKDSYIYFLITPQGIKQCCFSKEIVD
                     GMQCKKRMDNKPFKPLPSDDIKRCFPTHIDTRSQQNLSVLNERENEIKILDINIVNLL
                     SKQESNKRKANVLGEIV"
     gene            complement(229041..229547)
                     /locus_tag="ERVG_00244"
     CDS             complement(229041..229547)
                     /locus_tag="ERVG_00244"
                     /codon_start=1
                     /product="transcription factor S-II family protein"
                     /protein_id="AEP16120.1"
                     /translation="MLNDMLPDYTDVQCEQIEMSLFTKNPLNTEEYIRNAKRICHNIA
                     FLPKSHVLKYLSNDETHPTMAQYTMTKCKIQPTTIAFISDENMRGPVLQKVMDDEREQ
                     YDISLKMLYDKVEEGSVASMKQKAAITCNKCGSSEILMAMAQTRSADEGTTMFFRCVK
                     CNQKWKVQ"
     gene            229633..231216
                     /locus_tag="ERVG_00245"
     CDS             229633..231216
                     /locus_tag="ERVG_00245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16121.1"
                     /translation="MFAKCISKPLCNVLYNMEWDPLSSDFDAISSTAMHLYNPEVRRI
                     IDKNCNDILDDVITVTDSSSKWNYTHPMSLVFHGECKMPLRDHVTPHLHQKQVLTDIY
                     DEVNKTFTSATIQSPCASGKSLLSLLIISKVMEVTGACALYVTINSTAIAQVVNQAVK
                     FFHISPDEILVLDTTESCNPLSLINRKYKIVIATYQLLTASEHPDESKHFFDLLFCII
                     TFGVVILDEAHYSSAKNYKQIYRIKAALKYGVSATLKRMDNLLVHLTEYTGPYQIKID
                     RDALIKQNLIPDVSLQEFHIDEPEHRDRLMSVRKMELFYDILQRHIGRNQSIIAFFET
                     IHELDNTYACMNNILFKQGRSDVLLPSMKGDTNSETRISLINTFRQRVNDNKPVVLFL
                     SSVGNAAYDFLCEIVVQVRCSDGSGPIAAQRIGRVQRYIKQTTAHVSYTLVATGTSEI
                     NHAQSRRDFLDLDNYKTSIIKSSQIYTKTPSDVHRQFIDFVMELGTKHQKRQRGKPVN
                     RKKTSSTRFSALKKKIGKL"
     gene            231221..231574
                     /locus_tag="ERVG_00246"
     CDS             231221..231574
                     /locus_tag="ERVG_00246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16122.1"
                     /translation="MLSSTINPMVSENVSVEEVTVQIEDVANTMRQNAQYALRNLEST
                     SQLAERTESLSANANRFARTTRRVRQKMWWKNCKYMFYCVLTLFILGGGAALLAQTIK
                     EESAVPDPPSPPSDV"
     gene            complement(231571..232158)
                     /locus_tag="ERVG_00247"
     CDS             complement(231571..232158)
                     /locus_tag="ERVG_00247"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16123.1"
                     /translation="MASSRSNVVIVTIALIVTIVIWFMFGTFAGIGAGVVSCFILYRM
                     FVTTSENDEKKFIAGTIQQETDPSKILQKQMSRTSRRIGGETTQMSIDQENKHLMAMR
                     IRAADARVEEQNIKDMQLHKAATQMEIDTLKKQKELDGLMSTEPSLDAQVHEASQKLK
                     LVELTTKLERISAEKDAMEARKAEIQEASAMDSLV"
     gene            232191..232997
                     /locus_tag="ERVG_00248"
     CDS             232191..232997
                     /locus_tag="ERVG_00248"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16124.1"
                     /translation="MVYEAIDDTLIHYSYNKCNGNCNCIVMIHDIFASKESWFYLQQH
                     FTKSNITNISIDIPGFGASPTLTTKYDYSYRSLAVIISLLLTKLAIGPCVVIGHGTGC
                     IIAASLSTISANIKGIVMISPNFDTPPSYLKVAPSCFVSSYVSRICKQYYQYNRLETL
                     HEHQIIVKPFKHHFQNSYRRDVVERMIYAVESSYIDIIEMIFCPLFTIAPSKEKHAIH
                     SNVLTTLADAGSTFKFVDHVGNFMHHEAPELIFTYIYEFVKQLSKSDMSI"
     gene            233023..234084
                     /locus_tag="ERVG_00249"
     CDS             233023..234084
                     /locus_tag="ERVG_00249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16125.1"
                     /translation="MRGIVVGVIIVIILLIVWASVATNLLVVSLGKTDDTIAYSNQTI
                     SDLKRLIDSGDVANSDLHALLDKLESDFASQETALITCRNTKTQCGTDLSACMTEKSV
                     CDQTLTQCTTEKGTCTTEKGTCIGNLTQCTTEKGTCTGNLTQCTTEKGTCTGNLTQCT
                     TEKGSCVSAKATCDTNLIEANAAIVALQGQITTLGETPTTSTTTTSSSNTGQTIGITV
                     AVTLVVVGAIWFLMRSASAKITTVTANGPPVKYRNRTSFAPSSLIPSTRKLFSRKMSA
                     LGADMPVRDLDLPPIPPLVRQDAVFFEQPAAPAVPFLPRATASRLENGLAEREAARSL
                     IGRDIAKATAVLTDDDLRI"
     gene            234126..234341
                     /locus_tag="ERVG_00250"
     CDS             234126..234341
                     /locus_tag="ERVG_00250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16126.1"
                     /translation="MHPAPASGRACRGCIRRTRREFAKYETNYNDALVAHRAWTSNLN
                     QDLPAAKIRWVRSIVYKYHKYKIFFHV"
     gene            234349..235677
                     /locus_tag="ERVG_00251"
     CDS             234349..235677
                     /locus_tag="ERVG_00251"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16127.1"
                     /translation="MAEGVAESIPFPKETEPQKLQRERTEREETSKLAGDDIWNIVYY
                     AGIVLLGIIVMMVINSEGFQFLKNSLGKMVGAAASVMDFIGKNPWLLFLLPLIAPLFR
                     FLSTMGSRFGSPEGKKQAGLIDKLFTDAKFKGRNVGFSARVRAEYANFTPDQKAYLNG
                     KLEQMKTPIDSKSLAADIETRMPNATIEAKANAYSQQMVVMKKNQADMVFSDLIATMG
                     PDNPRSGPSNLLIEGTINSAQNAGDMLRSGKPVSKVDVQNVFMAVTALKKAESALRAS
                     YKDGFDELKADIESTGRTMESEMKLRERIAVLNNTDAITDPDGKKPNMKIDPDAVLKL
                     AHGKAMAKLTQKHKSLVNVSQAQINYAVKTELDNAYTAFDPENPKSRANVGAKLTDPT
                     NKKSTAVLSFKPPKEYGDALKKKSYWSNPKTANSFGDVPSFKAPKLKFPL"
     gene            235726..236073
                     /locus_tag="ERVG_00252"
     CDS             235726..236073
                     /locus_tag="ERVG_00252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16128.1"
                     /translation="MSETPSREELRRRLREKTSSRNRAGPSKSKDGVPSGVGRNVDMA
                     SMMMSMGIDDPSLIKELASSNNPKAMLSKLGSMVDKMKKDEDTQEYEKTCAPSHIVPE
                     VSDDEEAPELVVV"
     gene            236115..236589
                     /locus_tag="ERVG_00253"
                     /note="hypothetical protein; frameshift"
                     /pseudo
     gene            236611..236940
                     /locus_tag="ERVG_00254"
     CDS             236611..236940
                     /locus_tag="ERVG_00254"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16129.1"
                     /translation="MQTDSGRWVPLSMENVVKPAFPRGATIDLSNCIINIQNYTVYTH
                     VKIKRHKYGRETIITFLNKPRFTQAYKFPVRVMHVTNGDMYMETTMPPLNKTYGISHV
                     TPDASWH"
     gene            complement(236888..238480)
                     /locus_tag="ERVG_00255"
     CDS             complement(236888..238480)
                     /locus_tag="ERVG_00255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16130.1"
                     /translation="MIYHAYCDTALLTVCLFITLQYYSVSDINRHLTTTISNYPNVYN
                     GKFEYTENVNVFFTTGMYLVGLYAILKLDYGEFLANPSSVYNVIELTLGFLSVFYNIQ
                     WLTSFYLMFTIATAHQKQIVYFMGPWYMRIALNHLYRFFVLTESIKSLSNPYNAYAIW
                     AITYVNVTIRLLMYFVTPYISHARNNGPKILLAWMDPLCSTFSAYLGFYITMAFVISP
                     NALLACLIPISMYHTMYPPKLTRANGSIPVDMYEPTHFTKVYDRIFVIILSILLISSW
                     KYGGLSEYVNYLYQNFNMFPNHFTPNTDYITTEMHPVLCMNIYAVTVYFLIKTYYVER
                     KVVDRAHKKYIAHNVSVYVMFHGIGSAIELTLGMVAIIYPEKYFLAYLSAGIALLNNI
                     PTGFALTSGVYGVKHITVPGFTIFGVIRILECIRVFGVHPRNYPNAWILLQVGTIVRL
                     LGYFVLPFSSMNGSRGDLFTEPLNYSTNILLSGYIAASYVYHPAWLVVSLFLYVGYQY
                     YHPHTISAKMRPVLHEKYHKFY"
     gene            complement(238523..238885)
                     /locus_tag="ERVG_00256"
     CDS             complement(238523..238885)
                     /locus_tag="ERVG_00256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16131.1"
                     /translation="MSITPSTVILGILIAAVAILIVMLIIFLLGWKNGAAPFLASALS
                     SEYIPENFDVDPPPVLTEDTTDPNPTDEVPHEEPVLDTVPPKIENTPRPEPDKLLPSD
                     NIASFSGDILVGSELNNA"
     gene            complement(239119..239499)
                     /locus_tag="ERVG_00257"
     CDS             complement(239119..239499)
                     /locus_tag="ERVG_00257"
                     /codon_start=1
                     /product="HNH endonuclease"
                     /protein_id="AEP16132.1"
                     /translation="MYNYRSRRLKISRNYNEKRKYLKAKPIKKKSRVPLPEPTERINI
                     PKAIREQIWENSCIVVQGYKTLSIVCPICKRESERKHCHLAHKTSLHNGGSNSQNNLF
                     YICSQCNQSMGTMNVDEYKEFYYY"
     gene            239531..240076
                     /locus_tag="ERVG_00258"
     CDS             239531..240076
                     /locus_tag="ERVG_00258"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16133.1"
                     /translation="MSTENTFTNNLATTLKNIVNDPSGNMKKLTEAMRTEGGVVCDAC
                     FCCYRAIDINDVTLCCNKKGQCICITHECCIDMSLAPYAFEVTKTDNSVTIGVGICLL
                     GLTRDFKNPCFGTDKCLCCRNTYQILPTESMGDLIPAPLCACCFIECIPSVAFANQTP
                     PGNFIVGSARDGAPASSEMAR"
     gene            240084..240434
                     /locus_tag="ERVG_00259"
     CDS             240084..240434
                     /locus_tag="ERVG_00259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16134.1"
                     /translation="MTESADECVICMSNPPVNDARIKCIHNDNFCKECIDECIKKDIY
                     TCPNCREPFDVDLPIYIEITDDGVVQPRRIFTLLTNYLVSVVVHFILIMWLTGIMLSF
                     IDLCRAIVTMDSNI"
     gene            complement(240470..241081)
                     /locus_tag="ERVG_00260"
     CDS             complement(240470..241081)
                     /locus_tag="ERVG_00260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16135.1"
                     /translation="MWGSDTPMLYLNITHELCAFVPFKHTMDIYVKCQGGTHWGYNDG
                     YNPPPTDDEFPPETRRIRDWEWFIKLDDGYSHMTQISCCHRTIHGDKFEITTKKNYRR
                     QGMFNPHLDVSYDVQNPEAYREALNHIMETARSENLRRTEEVDVSLNGTISLYRMDRY
                     SYSHKTTLRVNQPFFALLDENVRRFIEEHPEGRDTETTELEEL"
     gene            complement(241102..241680)
                     /locus_tag="ERVG_00261"
     CDS             complement(241102..241680)
                     /locus_tag="ERVG_00261"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16136.1"
                     /translation="MEKRILLIAILALVVINIISITMKNYTVAIVFSSLCIAYVLLSM
                     LTSTVMNRRQRERTNPLGDAAAKLHPNPGDTSRIEPRYRAPNVTPDDQDTQPTMRPIR
                     PSINSNLRPTSLDNRWSTGSYDDVGEPGGWDPLRQGVSDLDKFMEAEKINGRSSFDTR
                     LSLSDQVNSFFNKTRNYSPAHFAGDSSRPKDA"
     gene            241754..242371
                     /locus_tag="ERVG_00262"
     CDS             241754..242371
                     /locus_tag="ERVG_00262"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16137.1"
                     /translation="MLITAISIVACFQILVGFINDGLSKVLISRATTHFGLVSGIPII
                     TAYLFVTFQLGNMHPSYYTHHATRPFHVICALLIMDAFMYFMHRMEHITKSSFHQVHH
                     KYSIPEWHNAYDASIIDTCLMILLPLHLTTHLFHLSLSEYIWFGTLLSSWLTLIHSNR
                     TFWFEKYLNRMGLCSPEFHRKHHMYRNVNYGHIFVIWDYGFGTIK"
     gene            complement(242387..>242792)
                     /locus_tag="ERVG_00263"
     CDS             complement(242387..>242792)
                     /locus_tag="ERVG_00263"
                     /codon_start=2
                     /product="hypothetical protein"
                     /protein_id="AEP16138.1"
                     /translation="ITRQNIGKAVNRATPTPNKSGTLYYYFVNGEHDVPKRQPNKKPA
                     HPRKGTTLWSIEVSQKKDHIPEFDPTRWKMHISKPAAAEALNITTKAVEGATNRSTPT
                     PNVDKSIYYYIVNANNDIVKPFVESVVDMEVS"
     gap             242793..242892
                     /estimated_length=unknown
     gene            <242893..243844
                     /locus_tag="ERVG_00264"
     CDS             <242893..243844
                     /locus_tag="ERVG_00264"
                     /codon_start=2
                     /product="hypothetical protein"
                     /protein_id="AEP16139.1"
                     /translation="NRERSTCKECGGSQICEHNRERSTCKQCGGSQICEHSRRRNQCK
                     ECGGSQICEHNRERSTCKQCGGSSICEHSRQRSKCKECGGASICEHNRERSKCKECGG
                     ASICEHNRQRRQCKECAPIGSKNFCQICCATMLSSHRMRQGIIMCAKCDAEVPQRTEH
                     WIRDKLLQLGIYEPSAADDILFGGSECTEINKRRRPDLIWFGEDSRVLIVEIDEHSHT
                     SSGYQPSCESAWISDMTDVCLKLNMQPPHVIRFNPDAYDAETVGINVRIDELYTKIDT
                     FLTAQFEPCNAPTVEYMYYHSNAQAYIDHAMASEGIHVIT"
     gene            complement(243932..246268)
                     /locus_tag="ERVG_00265"
     CDS             complement(243932..246268)
                     /locus_tag="ERVG_00265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16140.1"
                     /translation="MTQDSKCLITLSIDSYRLSSLSQILYMSAVPQMDVKRNIDDVNN
                     AEYPEPLREISPTVVIINEIIQLSQHAIDVMSRYSSKELYDYRVNKSGEHIAFTDFDL
                     AELNLPGTLPLKKSLHNVLSGGDYQYMPLTEFVEGTHFVNYSTFINNNRYRTSPINIK
                     MHTRDIEYARFFRANAHELISEWTQYVPLEFGNIKITPEQIMAGLSTTVPLPVDAVTT
                     IDDTSIVVKAGTFPTILTYTAMPGAGKTCACMAAARFALQSERCHEAYQTMNQSQFNP
                     LSGGFYEYREINTLLPVICFMTPTPLMKQTIAAAHKFMAGSDITVWVGLTHGTLKEAH
                     AHGRPIFWVLPQDQRTTKMLINSKGYSYYADYIDEMNTSMTKRGDPAKASPMQTVIIQ
                     ATPKKLIDSTTNKPNAILRTEFCKPKHQFDMTEPFTNACMRNSMLPDWIRIAWNKKAV
                     AMMPDGYHIHNVMAKSNNLNRVFGQENAPLAPRSMADNISSLVPIRNTTFNQETMNSF
                     VARANAGVSPPELLQILRDMRDAISDPAREHNTINSLVRTIINMTGVVDQSATDPPEC
                     PVLLEPIPVDKAAILPCCSNVLHVDALTGLQRRVCPMCRAPLHDTFTFGTADVRTPMY
                     AHDYSGPLEDGLKQLSNARLTAVNAVENTIRNVLARKPDARIILSSYNATDSRDVITG
                     FCNDIKRDHPNLELYFIGSRGKKFDINRYNDPSFTNPQIAVLNTSTSSNNSQGLDLHN
                     TYVTIVIGRSRSDIKAQLIGRCCRTGTSGTRVLVNVEY"
     gene            complement(246273..247097)
                     /locus_tag="ERVG_00266"
     CDS             complement(246273..247097)
                     /locus_tag="ERVG_00266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16141.1"
                     /translation="MKPNIFFYPVTHGWSKSEWNAAYKKLIKLCKGSSFETLFVCETD
                     QHSDIFVNKFDEGYDQLVQALGYEPPWPVHVPTCDNVNIQWFEPSNSMSIYMNDPIFS
                     VAYMAYVNKATDIRTDISNYLDEFFGCDVPNDQLLENSIAFLNDNTFSTLSSIVKREV
                     IKLGTSEDEYQALLAVMCETTISEVLSTDTFPNSYHGVAFLGNRPLTMAFNLHRGIWN
                     IHAAKTANNMITQNKNIVFILGRMHIYCIQKMIDVVYGPDGKVKCKTHTSFPCNIM"
     gene            247141..247506
                     /locus_tag="ERVG_00267"
     CDS             247141..247506
                     /locus_tag="ERVG_00267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16142.1"
                     /translation="MATFKPNNTHRNNNTRRNIKIAAIICGGLILLAILVYVSIVYLS
                     PEVAPDTVTLDAFDEIPDIETGGMDTDESSIDITDPVDPLTVAPAAESTNEIGLPGDD
                     GPPEVDIPQHPYRIEQESS"
     gene            247516..247902
                     /locus_tag="ERVG_00268"
     CDS             247516..247902
                     /locus_tag="ERVG_00268"
                     /codon_start=1
                     /product="endonuclease"
                     /protein_id="AEP16143.1"
                     /translation="MTRINVVPATELTNKHLMAEYRELPRIFTEVKKKVINGISVNDL
                     TQPEHYKMGQGHVMFFMSRCGWLIHRYVMLHDELIRRGYSLNDEMYTSIVNGVNDIPM
                     EFMDWYEPTDSAMTINRARITDRLNN"
     gene            complement(247899..248720)
                     /locus_tag="ERVG_00269"
     CDS             complement(247899..248720)
                     /locus_tag="ERVG_00269"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16144.1"
                     /translation="MAERILRDENIVAWVESELQQIEDDEINTVESSQHDEMRLMRIK
                     YHTMLEIGYAKMVRKVALAARRELQKVPINSIYTVFGNVDDANDIEQRYMQLNDAIQT
                     AVVDTEYVINMAYLRLALLLPIGIDATPGTLEQYTNLNKEIEERVRHVDSDSLSLMLF
                     YTPPAGVTAGQLGQLSVAFDHQDVDAAFNALAAAADVPMISRVNLGMNLHDRIELADY
                     DIGVGRIGIYGISYMVTNIESLVISLMGMPSGDALYQTARYTDDGVFDPEGQMEI"
     gene            248773..249321
                     /locus_tag="ERVG_00270"
     CDS             248773..249321
                     /locus_tag="ERVG_00270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16145.1"
                     /translation="MAIPVGAIIAGIIGFLVIVGVGVGLYMIAPTARSGLGDGELPAG
                     MGGAAVGAPDETEAGGIVGDTTSPASDADNTNITEEQIVNSVSVETPDNYEFMFDDCP
                     KGLSSSVISTNMTITSCADECTKRENCGAFLMTGCTTSKNCGGQCTLLTNNTTNIISK
                     SEFGNGLCSTTVGDMKLYRKKA"
     gene            complement(249301..249894)
                     /locus_tag="ERVG_00271"
     CDS             complement(249301..249894)
                     /locus_tag="ERVG_00271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16146.1"
                     /translation="MFKMKHCCNRCNEQIEFLHMMAINASICQSCMDIYSERKSDYFN
                     TRPSHTFTEFYQEYRQRYTERCDQVYFMSYTTALKAIRKKMDMVTQIVQTHAPYLRWD
                     SGPGIILAETIWGTLDAHGFEQPGQRVVQQKYSRPYVSKPRHTKQQIFEVWDIHDKYD
                     LICNEYANKLPRIIGKPGCAASIREDFGETYLSLFTI"
     gene            complement(249931..251058)
                     /locus_tag="ERVG_00272"
     CDS             complement(249931..251058)
                     /locus_tag="ERVG_00272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16147.1"
                     /translation="MSAISYFHNEHAANNMPFIDISDPRAEFLQQFVMAGPTTHDISF
                     PIKQKGQICYLFSAALCIYYSHLRPQIDAIKLNILNNKVPNINPVLRAHAGNELFLEL
                     LVNLKDNTLNACNLLYHFIHSHFVEFNMMPEWIQKLYPIFLEEHYALVEQDGKNGGYV
                     DVAIFTLINACGIPCENGNLLQVDYNELEKYYNNHKDVIPFRINPEQPIVIQLLSEHQ
                     THENNETVHPAGTPQFETNPTEIFKIAVLLLQNVIAICDIIRQYYVEYNEYKMSNGAL
                     SFEYHSKSTNTLKSHCVFLSYTLSDIYVIDGNIGKAMLLETYIHYMRREICNDMCIGA
                     ITAISIPIAHDQDVIDFINGNITDQYDIADALMDFADSGAI"
     gene            251158..251790
                     /locus_tag="ERVG_00273"
     CDS             251158..251790
                     /locus_tag="ERVG_00273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16148.1"
                     /translation="MPIHNRTVTEFTNETMHLAALANTIFNDCVVENSTIPPESPPPV
                     DVTAVASIDDDESPTDANVEKLLIKLTESTEDGIATSSTCDDVISYAISLLRDLRHKK
                     AALIKKERRADTITNPRERAKYRTNAPTPAMLFCNNHRAEAGEWYDSGGRIEGVRESR
                     PSQIQRRLANQWKFADSSVRIKYRNKANSLGNLASTVRETDATDDDVIVD"
     gene            251946..252170
                     /locus_tag="ERVG_00274"
     CDS             251946..252170
                     /locus_tag="ERVG_00274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16149.1"
                     /translation="METLDFTHITPSGNTVKINVKNGDVVGYNGRSGYIKFGPVWHID
                     GAMFIAGKTAGYMWFSEIRSVNGVELDDFI"
     gene            complement(252163..252456)
                     /locus_tag="ERVG_00275"
     CDS             complement(252163..252456)
                     /locus_tag="ERVG_00275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16150.1"
                     /translation="MEASPTVSVVVLLSAILLGVIIALLQPANRVRIYRMKKHRQKFA
                     DTHNNTRSMWGNASRVQNMMHQEMYERNKLLTNYMWNSMKLGRLMKKSNTRTR"
     gene            252570..252797
                     /locus_tag="ERVG_00276"
     CDS             252570..252797
                     /locus_tag="ERVG_00276"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16151.1"
                     /translation="MSDTSYVKKVTFNTENLPPIPPLVRQDAVFFEPPPSLVRQDATF
                     FEPPPIVHKRTRSDTQKIQSILKKVGKKWLM"
     gene            253026..253400
                     /locus_tag="ERVG_00277"
     CDS             253026..253400
                     /locus_tag="ERVG_00277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16152.1"
                     /translation="MALTDIVNEKMQGKGIFFKSVHMDPLKGKRAHVLITATVLWRGT
                     STLMDVQKQLYFAIKQLSAEFDHVIKSTVREPVRLRDIPENTNEDQRKRMENRRVRFL
                     EHPAPKPIKFSVNFVWNVQDVS"
     gene            253432..253860
                     /locus_tag="ERVG_00278"
     CDS             253432..253860
                     /locus_tag="ERVG_00278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16153.1"
                     /translation="MTLEFSYPNPIHIYGQPPMRVSSFAFLCFSSAVFDQDIVLSMIL
                     LANFMTSFNIHKRCFIFDQTCSALYYDHLAIGTWFLYNFYLLVTTTVPLKNKIYASSC
                     AILTWGTNRLCKLFEFRHPIRDVIHCSMHGIGILGTWFLI"
     gene            complement(253934..254359)
                     /locus_tag="ERVG_00279"
     CDS             complement(253934..254359)
                     /locus_tag="ERVG_00279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16154.1"
                     /translation="MSITFLALLIVTWAVVIFSLSLLFVFGGGQVLVPETATEIDSAF
                     NDSIGNTDEMDYVVSGLNPDDLDDLVAGLNPDDLDDLVAGVNQDDVNDVVSGINEDDL
                     AYFIDDIGPDPVPGSIRPRGISKVDGRPSNFKRRRIMLN"
     gene            complement(254528..254749)
                     /locus_tag="ERVG_00280"
     CDS             complement(254528..254749)
                     /locus_tag="ERVG_00280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16155.1"
                     /translation="MSTRLSRSSSIVSIPMTHICGGNATASPYNGHDFTNFKNKKRGK
                     YALLIPIIGGTVFIGIIILISVITFTNKN"
     gene            complement(254769..263033)
                     /locus_tag="ERVG_00281"
     CDS             complement(254769..263033)
                     /locus_tag="ERVG_00281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16156.1"
                     /translation="MKATALLYLLHFVTSDLLSVNITVPTEQSASSCPPPSPPPGTPR
                     TYEKVLDLRFNQAYEDQQSSDDAYDDNKPVGDNSFVNSTTGRSWAECGHFSYEWWGVD
                     LGSEVNVGFVRLQSRNDCCPERLTQVEIYLGSTPNTYIGNALVKSDVNVLPSNVMLEV
                     DIDAVGRYLYYRRPPDANEYGTQTGLTVCKTYVFLASPSPPPCPPSTPPLLPPPPPSP
                     PSSPPPSPPPPSPPPPSPPPPSVSPSPPPPSASPSPPPPSASPSPPPPSASPSPPPPS
                     ASPSPPPPSASPSPPPPSASPSPPPPSASPSPPPPSASPYPPPFSPGQMAPPVSPPPP
                     PSLPPPSSPPPSASPSPPPPSASPSPPPPSASPSPPPPSASPSPPPSASPSPPPPPSA
                     SPSPPPPPSASPSPPPPPASPPPSKPSPLPPPSPLPPPSPPSPPPPSPPSPPPPSSPP
                     PSASPSPPSPSPPPPSPHPPSPLSPPSPPSLPPPSPPSSPPPPPSPPPPSPPPPSPQP
                     PLPPPPSPPPPSPPPPIPPLSPPSIPPSPPPPPSPPPPFAPFGGLCEDLTALNIASEP
                     TIWCNVTATDVSKVFDYLFTFSATEQTVLVASLYDVDNTLLGEVTRDVVGGSFGANIF
                     ATRLLDEEFNTYLLQPGDRIQFGFNSTIETPLNVTDFRGRFVPPDAPAAPPSPPPPSP
                     PSSPPPSSPLPSPPPSSPPSLPPRAPVACSSLIGRSLTSNCDNENPPTCNQFYQIRND
                     DEIRLCEQFGPVCDKTSIIFCSPPASPPPSLPSPSPPVPFPPRPVFPPFPPPLGPITI
                     PTSNPVNVIADPGSSCDVACYDIGMQCERPLTPNFVFETEESMQDIVSLAGFNCLGVE
                     IAQATIQTIEPIQTDFIIVSGFENDYYNGLYAGDGEVWRQQDTVDLRIELSENVADQR
                     TLAYEGNYTLIIDEDTFKYTYTKETDDGTIEMVKSDDGLSWELTGPGLPELNIGVFPP
                     IFDVSIEVDEVVNGISLVSYARGDATLANLKPRMQVSKGKGTRRFELTMLDVDFGDQF
                     ADAILLNGADFVDDEVDALTTGGSKQYRAIIPSIGAFIIKVEVDRTWSEDIPVDAPAW
                     TLRYTKSSDVYVFTTPVALDFTVGDVTMLFSSEGEYKAARFGTALGIEMANQYIIRPQ
                     YATFDVPRAVGAYWYYNLAGNRQVRVYGPSPFSLLSDGTESELNDIQITQLPFPPNTP
                     PLAPPPPISPPSPPANCCVDPGRFTQDYGSRCTSARYGNGNPSPKYCRGQDANGIPTP
                     KFDWFATCCEWTGSECVDLVPDELCANPSFPPPSPFPPYGPPPSAPNLEDHNADAKAP
                     FISNLTSVADRTGTCKILPKQAMGMLSLNYCNQTYLSSERALCPCKPSAPSAPPPSPP
                     PHPPPPFAPFAGICDEIAGIRVLTEPIVWCNVVAPYLSKAFGFLFRFSATEQTGLIAS
                     LYDVNETLVGEVTREVVEYGSFFGTNVFATRFLAEDFNTYLFQPGDRIQLGFNTTTFA
                     TLNVSDFRGRFIPPDTPSEPPSPPLPSPPPPSPPPPSPPPPSPPPPSPPPTPPPSSPP
                     PLPSQPPPSPSQPPQTPPPSPPPSSPPPSLPPPPAFPSPPPILDFEYSGEIEFDIEYD
                     KAKWPLYNFIVSKEYDGSSYTTVNPFSGIKGTTPYTVDLEYLTLSTATENHIFEIGGG
                     GLAEEESTNRFINGYLTSGNTMNHDWYNNNLVGPENVNALSNGEFYCVMMRSNSSQRS
                     TYLRSADLYGNWKDNERTAFESPVSTKNTHEKYLHVGGSYIAGVRKYFTGSIRNFRVF
                     NYTKEDRTIPAQNVTVQNLPRRNDPFTISLDVNTSNSDGLGVNNLLGFGDFEMHMNSK
                     TRSYTIGGNFSRIGYFGKTGHTYVVKVPIYSLMNTVIGFVLEKDSVNQTILTVRLTNA
                     GLQLNDGDINWWTMTPSGSGHLVVTFEYQGLLVSQDNTFLINPISPIAFIGALGEFSS
                     SGFIPSYITVEEKSRGSFWASEENKGYIQIYRYECQYGVCNPLSDIGDDRYIVGVVVD
                     DDNIATPFINGYEYLIGFPVQNHVVYGTSKIRVGTSNLTVEADSPFGDNNYHSIEVSY
                     IYPTLRLKVDGSVVATAEGKMNLVYTSGLTDRLRLGGGTFMYIWGSGYIAKQQNMPAV
                     PQKDEFVGAMKNIVLNNDVPSPLPPSPPSPSPPPPSLSPSPPPSLPPPPPSPPPPSQP
                     PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPFPPS
                     PPLSPPSPPPPFSPFSGICNDLIAISVASEPTIWCNVTATDVSKAFDLLFTFSGPKQT
                     VLVASLYNVDNTLFGEVTREVVEFGAFGANVFATRILDEAFNTYLFQPGDRIQFGFNS
                     TIETPLNVTAFRGRFVPPDAPSAPPSPPPPSPPSSPPPSSPPLPPPPSPPPPSPPPPS
                     PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSTSPSPPPQSTSPSPPP
                     STSPSPPLPVCNTMCVGLSKDISDDIQYTNTCCDLDTLNGAAFSGVVGDIIPTGERFI
                     DTYEIWNDAYESDTVLVVYSLNIPVYATVRTYTFTVDVTSVLNDGLELQLDAVPNATA
                     DTLDDFATLVESNNVFYDINSTDSIILDNAFIPSGISPIKSFSYDITSYIRYLNELGH
                     AGKYGGVRITPQYESNIQSRNANPTIGYALSNIEIIVTEPDDQPGISTGALIGIIIGT
                     VAVFSILLTIAYLSYTKKITNRPHIPSFSNTIPPTRQGTYFI"
     gene            263186..263398
                     /locus_tag="ERVG_00282"
     CDS             263186..263398
                     /locus_tag="ERVG_00282"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16157.1"
                     /translation="MADKIGNLSVGAFVAIMVTTAVILIASLWMLTRRRKSSYVRFYD
                     EPVQRQSHAGLVPGPHRENDNTYRTF"
     gene            263431..263943
                     /locus_tag="ERVG_00283"
     CDS             263431..263943
                     /locus_tag="ERVG_00283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16158.1"
                     /translation="MEVWKLVLAAVFYTYISYDLTRKSLNKSVGKTLPRQAERLRNTI
                     NTLTGQRDQYLDSPSMGYFEQQKNRNSGVEIDEIDDTNYPSVPYKETTFHAPRVTQST
                     RSRGGFASRGPTSTNRGMGTFGSRGQDSGVFINMNPNGTRESTRRTRERRDGNIPSFT
                     RRSNIPARTF"
     gene            complement(263940..264533)
                     /locus_tag="ERVG_00284"
     CDS             complement(263940..264533)
                     /locus_tag="ERVG_00284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16159.1"
                     /translation="MRMIGLISHVRLLSFSIILLFYITLIKQMNKVVLIGFVFIVTAV
                     MIGMLIMAFYPKNAAPGSIDNAATLTAGDESEMQIAGNDPETVGKNYETIDANEDTNP
                     VPVPPDSLIQTNSITSPRIDPPISSRDQTDRDVPNPLFVDSNNMTHPTCKVHDGGVWA
                     ICNNAPFKRWTQMHTTTEDTLAACTTHYAQTVCPPRV"
     gene            complement(264487..264876)
                     /locus_tag="ERVG_00285"
     CDS             complement(264487..264876)
                     /locus_tag="ERVG_00285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16160.1"
                     /translation="MFSYIWSSTPTNTDDDTPTKKSVSTDTSDLVATTPIPTPPPTIL
                     TPSMWCVCISEYYVDPMDCCGRGSYDRDYSAYSIVQAHTAEEAKAHFIRDDLKHRNVT
                     VQVFPYKFGHWMDENDWFDLSRETAVF"
     gene            265446..266210
                     /locus_tag="ERVG_00286"
     CDS             265446..266210
                     /locus_tag="ERVG_00286"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16161.1"
                     /translation="MGKSKSKASPKPKDNDSSKKEKETPPTETSPPKVASKGRGWIQI
                     ITSMIIKLLILAILSACAYAGYVAYERFKPTPTSLDRGDAVQLQKEYNSKTYEYKVSL
                     QEKSWEEHEASARKWGGHLVSFTAEEEYYKILQQLDDDMNKSENLAVAQQLIIEFSNS
                     YKNGQKHGFWTGGRFKDESRSTPPSYSENNAKTSQFWSWSDNSKWGYGMSLWEDRSPD
                     GDGSCVLMKIKRRGDMEFLNSEDCTRRLTAIYKRRK"
     gene            complement(266273..266536)
                     /locus_tag="ERVG_00287"
     CDS             complement(266273..266536)
                     /locus_tag="ERVG_00287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16162.1"
                     /translation="MDNPGDMPVVCTQCGQVVKAYVPVKTIPTDNFMEMIHFLVKENA
                     SLKPEIASLKTENASLKTEIASLVSKVDALTKFIKGQYPDAPF"
     gene            complement(266579..266866)
                     /locus_tag="ERVG_00288"
     CDS             complement(266579..266866)
                     /locus_tag="ERVG_00288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16163.1"
                     /translation="MSSDSSLNAILKSFGYDSIEEFDREDAAKLAATGCSSWTEVNKR
                     NDEIALDATGCSSWTDINKRNDEIALDATGCSSWTEVNAAKKCRGARAGSH"
     gene            complement(266859..267305)
                     /locus_tag="ERVG_00289"
     CDS             complement(266859..267305)
                     /locus_tag="ERVG_00289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16164.1"
                     /translation="MQLSCFRSFLIMTINQVTEQIQRYAITQALCLKSRYNMYLSNYE
                     ILTNAQDIIGDTSIQTIDETCNILFGAGYRSYAHEIATHLVKVGIGFAHIRAALSDND
                     PSYIGAMVHGNVIKSWGDLNDPTTLEFVKIYSELRKRRIDSDISNV"
     gene            267496..267762
                     /locus_tag="ERVG_00290"
     CDS             267496..267762
                     /locus_tag="ERVG_00290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16165.1"
                     /translation="MLAAILISVFLVIIILLLLLLIRKRRNIARLIYSRSTGTDKNYP
                     TSFEETENTPGYLSARSALRQIHALDKSRALDKSRASFETRQRL"
     gene            267874..268245
                     /locus_tag="ERVG_00291"
     CDS             267874..268245
                     /locus_tag="ERVG_00291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16166.1"
                     /translation="MANINKIHTSLRNVKPNTDILITITRPGYRVFQNIIIKCATIEE
                     HDDETAIDPVLSTSFIIRSNCALPTVFGYTITKHAGNPDSDTIAIVDGYGMKFPIGYH
                     GVNKNWTHEFDIVDARESTGK"
     gene            268339..268614
                     /locus_tag="ERVG_00292"
     CDS             268339..268614
                     /locus_tag="ERVG_00292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16167.1"
                     /translation="MEIETIIDGVAAIGKKINEKLGTLGDVSDTAECKKYNQSYNNIC
                     KTLTIYNEHQTHMNTHMLDECVQLLLQRACDIPGMPKYNKNMSPDEL"
     gene            complement(268615..268965)
                     /locus_tag="ERVG_00293"
     CDS             complement(268615..268965)
                     /locus_tag="ERVG_00293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16168.1"
                     /translation="MFVHSWQSMRVRNFRSVPQMHHSRTLTRATCNHLRTRGQRILYA
                     MRQRVQSEWGAIIKGDDTLTSWARDTELTFRVDLLDDFIYYGQSEDLLRKQYTEMLAF
                     IHVSLQDMVAQRTN"
     gene            269189..269404
                     /locus_tag="ERVG_00294"
     CDS             269189..269404
                     /locus_tag="ERVG_00294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16169.1"
                     /translation="MPVTIENMINRTNAEIVQILSSEPPESRRPPARAVYIHMRTNGG
                     SWRSRFVQYENAAKDTGVSSSEYINKK"
     gene            complement(269420..269959)
                     /locus_tag="ERVG_00295"
     CDS             complement(269420..269959)
                     /locus_tag="ERVG_00295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16170.1"
                     /translation="MYIITIYIYMGSGIVKKFKNMSTSKKAVILLVVGIMVVTIVVVG
                     ILFALGVIPKREPEMVYLPPSDVSTSDEPDIPDIPANDIVPGYFRDGGCMANLHSHKI
                     PASSIENCRAIARNINGVIAVGFRNGNHSDESNKNTCFFYKCISPKEFYDRNDPVNAN
                     DTVHTMSCVNDAEVFEECV"
     gene            270037..270477
                     /locus_tag="ERVG_00296"
     CDS             270037..270477
                     /locus_tag="ERVG_00296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16171.1"
                     /translation="MSYYSIPTKKHNEVGLEIIKTHTLDELPAFFRDQRLGYDFVIEA
                     LTLLEPTGGLPHDVYSHIEQRLTGYEMDVVHAEMCKEHGRSRLLDDFIKNEAVRITEQ
                     SKTLIQIQTSRLTHTQLRRMIPDEAVNSYYECDLACEFNVKFGA"
     gene            complement(270490..270915)
                     /locus_tag="ERVG_00297"
     CDS             complement(270490..270915)
                     /locus_tag="ERVG_00297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16172.1"
                     /translation="MICLSSGCKNGANHKGYCKYHRSRNHLIHTIETQWRKCTGCDHG
                     YSAINPMITRHQNFDWDGTRYIDDKNTVDYINKLVLQNRKNIGDILYPRERTKELDKY
                     GVAHCTDTMFGFCMFCNGYKLDDRVDTRWNNSSSSYHFF"
     gene            271009..271170
                     /locus_tag="ERVG_00298"
     CDS             271009..271170
                     /locus_tag="ERVG_00298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16173.1"
                     /translation="MPKIAPIVTAYVLMDDETRGGISSIDEQVSDEDKKEVVIKNVFD
                     GLRLAGIVD"
     gene            complement(271434..271706)
                     /locus_tag="ERVG_00299"
     CDS             complement(271434..271706)
                     /locus_tag="ERVG_00299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16174.1"
                     /translation="MLSFIVASTAMSMDPVMKLRVNTRTMMSVHDAKNNFPVTSAMHR
                     AVASYYQSSAPLPPCADAEMLQTVDKMEDALSENLKQYLRDLESGF"
     gene            271872..272246
                     /locus_tag="ERVG_00300"
     CDS             271872..272246
                     /locus_tag="ERVG_00300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16175.1"
                     /translation="MALTDLMNEAFASNGIFFESVYMDPLKSKQSRVLVTARVLWRGT
                     SSIADVQNKLYIALKPYASEFDHVIKASIHDPVHFLGIPENANDHCRQRMENRRVRYS
                     EYSDAGLIKFSPSFVWNVQDVS"
     gene            272305..272829
                     /locus_tag="ERVG_00301"
     CDS             272305..272829
                     /locus_tag="ERVG_00301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16176.1"
                     /translation="MYTGSSHAYSFPNRNQFAQDNIRNHRSVYLNPIRYQYVQDHPYN
                     YAMPAVPYYGGVVQIPELLNTQNALYNTLNSVPAASPASGYLDMFPGVRDGINVIETV
                     GTNQSFGQGEVRRPPFVSDAELQFYLNTLRTTPQQVRQPQGVNVSELKHVRDNLRHRP
                     RSSRQFRALTGRVL"
     gene            complement(272933..273883)
                     /locus_tag="ERVG_00302"
     CDS             complement(272933..273883)
                     /locus_tag="ERVG_00302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16177.1"
                     /translation="MVSAMPTMPNLSIDTTITRSESIDSTSSSSSSQFPKSMVSQMLT
                     SPQLDITNYFYIAPKSPSMSDSPAVPQMDDWDDDELMAAMNSPPSSPMRSPSPTIDDE
                     DDDETQAIWASNTQPSQDPASGDEIDEPPSPVADEPPSPVADEPPSPVADEPPSPVED
                     EPPSPVTDTPPVVTDTPLSIATTLAELTTDLSTTETCSQIIKVAMKLISSTRAHSKTL
                     SSAVKKQATASTTRVDGAPRQRAPKGSRPPTAAGIYNSEKRALATEEYINGRRAVKPP
                     KTDNKASHIQNILAEMWRDETPDTKAEYKAIAAARAVVVN"
     gene            273931..274671
                     /locus_tag="ERVG_00303"
     CDS             273931..274671
                     /locus_tag="ERVG_00303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16178.1"
                     /translation="MLSCVVNLHQLTPDRFNHPNTMANMDSVPQMPTQFDDSITVTDT
                     ITIETVADRPNTMANMDSVPQMHTQLSEFIPEPIDTTDDETHDTPSELISQLSEHLAT
                     EFDETTITAAAAVASKLLKTLKSRERAIKKKAKKAAAPPKERVAYGTKIPSMAAIFAK
                     DNSEIAAKWYADGGRVPDFNPARGAQTAKYLALLWRDVPDTVRDMYKTKRDAIIADRA
                     SVADMANVIHQAIVNPGGEIQDPVCPVV"
     gene            274774..275496
                     /locus_tag="ERVG_00304"
     CDS             274774..275496
                     /locus_tag="ERVG_00304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16179.1"
                     /translation="MDYKIIIIIIQSVLLFVLVSVLLYLIFGRGQAFMPPIDNTTLTL
                     LDTFAMTNNLGIFDSLYGEDMSLDEKQVAVADAYNLLDSHASMIKNSPNSNDERKLYT
                     INHLKSMFDATNDDLRKRQIKSRGLDIPVVSNIAFAASKLTDWLRTVPESKYPSEDAN
                     ISREIYNEFHLAEKRRMQTQIQREESIARELEHNNKIADEWGRQHPKELQKLREIRAH
                     DDRKKVEAAYLKRQKRHRRRRD"
     gene            complement(275650..276000)
                     /locus_tag="ERVG_00305"
     CDS             complement(275650..276000)
                     /locus_tag="ERVG_00305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16180.1"
                     /translation="MATVSFPIQKNYRTKVTARCSSYTKNFYVKFNEISDLNNNAPPP
                     STETMQRHVKNGQRIMTLIMKLHESIRTMAYVPSKYRVFQKVLADEYRRSQDLVSQCR
                     AISRAEKAVAKAAM"
     gene            complement(276145..276465)
                     /locus_tag="ERVG_00306"
     CDS             complement(276145..276465)
                     /locus_tag="ERVG_00306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16181.1"
                     /translation="MEIRNRDIRAVIFYRVLGVFLSVPTNLVDCHLGGVLRALVHNTE
                     RRCVIARALNVGGELVDNGRDGDGQGRHLGNWWRVVELIDASERGSRDCDLPKEIGLH
                     EGRL"
     gene            276590..277078
                     /locus_tag="ERVG_00307"
     CDS             276590..277078
                     /locus_tag="ERVG_00307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16182.1"
                     /translation="MTSFYNVSFCDQLVHLSDRKPTGTKQKKTTDNQLDAIRDALIPD
                     VLIIITKTMQQNKVKKQALSNLHKHRTMVENKIIEAQMLLTMVVECDKRQQEYMVRMQ
                     SHGVAMMAQYAEDYKRGKYYTPAELRDMLPILEQKLCEDIKRAAVNNHVVQSAVARGY
                     LA"
     gene            277169..277408
                     /locus_tag="ERVG_00308"
     CDS             277169..277408
                     /locus_tag="ERVG_00308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16183.1"
                     /translation="MATASPRLWAVTVERDAYYFQETDTSRHMFVVLTASSEEDARAR
                     FLAKHAPIGHYVINAFPYKLGDWIEIDTGDHTKPF"
     gap             277534..277633
                     /estimated_length=unknown
     gene            278429..280816
                     /locus_tag="ERVG_00309"
     CDS             278429..280816
                     /locus_tag="ERVG_00309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16184.1"
                     /translation="MSLGAGGFDDVTFSPDGNLVSEFLYMERLWRLASASDNYNDYTC
                     SVKNIGPLMECLDITGPFTLSGSNLGNLIVSTGTIVSMDQTASIYDPDTNIFVQLLNG
                     GANSSVSSLFGKQSDCADGSTGTIGDGIVGAFDIASLLWYQFSAKPFNMINRNPSQVT
                     TVVGRVGTAERCNFNGTYNQETRVNWVTAVVNDYCTNAHFYANRIAPPAPPPVGRRQL
                     AVIASDGLRLSPTSIIPGQYNMDVTVEEWLSTTNGRWFRISIDGVQITSELYITGIGQ
                     VTDVEFSAQAVPSQTCTFNCEPFPNSGYSLKPQVRFMRRMEYELYDYYYSLPDCANIQ
                     TIFSNNLAIYKNTVSLLQVPFTSACSYDTFIWVPGNNKNPCLLRGSHSQGTQFAFLTE
                     NICAYDNLIVASPPPPPNLPAVCECNLYYDEQNGLRQAATFTADTDAFFDIIETNDEW
                     PFDRPVLDENRGNCKCNNTDYRPIWVVANDICFWYSTQTPEIQDKLLTNQPIRDAYNR
                     SCTSGSAYIESYFHVRVCASSSVREELYYTVKEYCSPDALEIQNITNIRPRLARDGNL
                     YCGTDIGPLDATVQNNDLGSCPCNVYYDKNALSLFSETAIESVNIFLALTSSEQSKWP
                     VQPADIRGNECGCADANKSPVWLAPVDLCGYYQDAPNSLKDELIPPSPVYQELYKRSC
                     VDISPEDQNKLFLHVKMCANNSFIQELFFEKHFCKEELVNGRLVPLLASDGVLLCAST
                     VAESTDESTESESNQDFPIWAIALISVVGAMLLLCCCYCFVIRKRRNEQDRSMFV"
     gene            complement(280819..281130)
                     /locus_tag="ERVG_00310"
     CDS             complement(280819..281130)
                     /locus_tag="ERVG_00310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16185.1"
                     /translation="MLIFLVMTILNGIRLSTDRVVTKHMSSTQMEPVSEFVSVYDRRI
                     VRGSTVFLKYDYEQRAYGCTTANVIQPGTASNLYCSLFIRGFHQPVFVPYHAISFDRL
                     F"
     gene            complement(281027..281602)
                     /locus_tag="ERVG_00311"
     CDS             complement(281027..281602)
                     /locus_tag="ERVG_00311"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16186.1"
                     /translation="MRYNAATFNTHIYNANHAVKLLEYLKSGKISPTEGLSEKNVQKA
                     ASARDMINARSNVERPCALSCMSCHKFNAQINKSYCKGCEKNLNVERYNLKKVFGHLK
                     TDVCDICNRKSKVIVLEHDHVTGNARSWCCNRCNTTLGLITTNPTSFIIHCSQKFNVD
                     ISGYDYPERNPFKHRSCSDKAYVFNPDGTCQ"
     gene            complement(281640..282074)
                     /locus_tag="ERVG_00312"
     CDS             complement(281640..282074)
                     /locus_tag="ERVG_00312"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16187.1"
                     /translation="MAMNMYGIDMFGKATETSLAHECVYRHGKTRTSSVIVYIWHTKC
                     PHCPAKLAQLNNLCKIKKFTAIGVVLETPGNFSNSFQAMDLTMELIDELDVKNINHFF
                     MTTEQKEVAKTELNFKTVPQIFKFNSDELTYTPVTMDYIMNM"
     gene            282125..282691
                     /locus_tag="ERVG_00313"
     CDS             282125..282691
                     /locus_tag="ERVG_00313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16188.1"
                     /translation="MSLPQINKHLDSMRNEWISNKDKRIQSINASNSLLETALTRNTS
                     VIDKIVNVVYTDINYNNGPLVDLDIHDIKHLSKMFPIQTIAKCSKFIYTHEAYESFHT
                     NMPSRSKRKLCGSFGTLKYGLQKYDYSCERPRGYAYLSNRHEPITKHEYGKTYILSKV
                     IVSYMDGYGYIALHAQPLYTITFNKAPF"
     gene            282691..283953
                     /locus_tag="ERVG_00314"
     CDS             282691..283953
                     /locus_tag="ERVG_00314"
                     /codon_start=1
                     /product="DNA helicase"
                     /protein_id="AEP16189.1"
                     /translation="MSLTVCQQDVLNKTLNGKNVLISGSAGTGKSFLTRHIIHQLKLQ
                     KGPNNVGVVSPTGIAAANINGTTIHAWGGIGIGDGDAIALIKKARGNRLAFTRWKTAK
                     VLIIDEVSMLDGELFNKLEKIAQSIRSNSRPFGGIQLILVGDFYQLPPVTVTDAGFCF
                     ESDAWNAANIEKCELTEVIRQQNDTEFISILNSIRIGQCTTETENALAKCHVSVKPPP
                     SDGIVPTKLYCINRDVDRENELFLERLPGDRVLFKAIDVFNASTPVSAETKLVDMLNK
                     KTHQVLPIKIGAQVMLTKNMADFSLVNGSRGIVTDFAEKGAPIVRFANGVVMQMERAE
                     TEQKFMNSKCTRSQYPLKLAWAITIHKAQGATLERVEVQVSGAFAAGQTYVALSRCTK
                     LDGLWISGDKISQRHIFTDPKVVNFYCV"
     gene            284031..285428
                     /locus_tag="ERVG_00315"
     CDS             284031..285428
                     /locus_tag="ERVG_00315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16190.1"
                     /translation="MSDTNVKPLSIIIKNRTKKMKLSDEYMAKMKILRDGVIGVYVIS
                     DRQKFRATTGKKENGVYTCEYFPLTESGFEAAFKASNDYREKQDEERKRKENRTPNEK
                     RDENIETHGDNSALERDFLISLKPVFEGSDINYLILNDGTNADNAFKFVNDSMWLPIQ
                     TKTTRTYDRGNSMQFSGCSNYTCIMLCWNVDAQRGVFLDGAKVNSNHLNFTFKNVEKQ
                     DYFISHVNIGNIKDVVGILLHDTSKPRFSEIFLRWQLDSADNVKEMVDIQYLIKTENC
                     TFPNEQNSHVDLCSGPVRRQLKTCRVLPNQTGLLFNTTTNIGMTNGKCTTGPYPLLED
                     GSPPFDILDVFFIENGTLHHWSFPVDCLLGGSENVEYETKTSIFTQNFPSIFSHKEDG
                     RMVGGCTGGMVYLPEKPGIALKFKEGSRTQRSWAFKQSFYKTSVKLSSVLDDTLLSEM
                     PENTQKIVRDLMKTE"
     gene            285457..285969
                     /locus_tag="ERVG_00316"
     CDS             285457..285969
                     /locus_tag="ERVG_00316"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16191.1"
                     /translation="MAIIYNVLAGCLTAIVIGLIVYFYTEELRLLQAHNGTVNNITAI
                     AHMIADLLDSDSGADNTKVIQTVAKTAFSNSWITIYDTAENGKVLMDGSMASDRGGGW
                     QGQAGTAPDADQREALDAILAAEKESNIKGIATARRTGRAPNGSLRTITMSAARPSET
                     SSLVVIVQAL"
     gene            286015..286341
                     /locus_tag="ERVG_00317"
     CDS             286015..286341
                     /locus_tag="ERVG_00317"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16192.1"
                     /translation="MKVYTINGDAHTLANIVSSELVFNNKDASYRVPHPNSRTSQLVL
                     HDGCSNKDLESTCTNLQGILSEMRHELAVKFADDLIHTDEKIFDTLDISYQTANSSIV
                     TDGDIC"
     gene            286386..286745
                     /locus_tag="ERVG_00318"
     CDS             286386..286745
                     /locus_tag="ERVG_00318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16193.1"
                     /translation="MAVVSSVPGSRAEGMKVRKASDPPPTAVKTVKELKAEKKTEKKA
                     AKALKKEQKKKNDEKRKEAKKASKNTKKTDGETSKRFTTKNTTNLPMDQRTANPNVKL
                     GQRKESKSKSPLRILGM"
     gene            286807..287562
                     /locus_tag="ERVG_00319"
     CDS             286807..287562
                     /locus_tag="ERVG_00319"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16194.1"
                     /translation="MQQIVKKIIVLLISATISAIVYLLSPKDMFAPVLGLVASTAMVG
                     LCTNNILIKIFGRENQIDNEQVRMDNIPSEYYAQQAIEEELLRQGEKSFEGEGSTETG
                     DDKPYEPVDDATTEPEPVKTPNSVSFADNIAEYKEYVPDEDPPKRRRRRKQAIQEFVE
                     VIGTDGGESGSTSERHEDRIVELNESGLEHTQPESAIIESPTTEPIAELEHDKQYDIP
                     LIDDGPPYVENVPEGAAESPPTSPKKHRRRSRK"
     gene            287471..288070
                     /locus_tag="ERVG_00320"
     CDS             287471..288070
                     /locus_tag="ERVG_00320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16195.1"
                     /translation="MGRPTSRMYQKERLNRRRRHQRNTDVDRESKRNDPNIYIIDEDD
                     KEQIFLIKQEALIELKLISESLGLDVHTKYTMKDDLSDVQFEIRRLLILDEKRQAVES
                     MRGTIGMVASGIEVVNYQLGNNFELNGFSRAVAKEAKEGRYDLPLQKLYKKHWKTGVG
                     TGNPEYDLARALVTSAGMYHVKKSGMASEVMSKVTGMKQ"
     gene            288097..288462
                     /locus_tag="ERVG_00321"
     CDS             288097..288462
                     /locus_tag="ERVG_00321"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16196.1"
                     /translation="MFIEVIYCDNTNVANYNALTTHKTDTFIYVDDLHYPDQWQNYNG
                     QTCLIILSFDGGIPQQTLLSIFKNEIIPQYDANAIKLNLKTLCIATNVKMTHWYTSER
                     DYKKIIMDKINSYKYLEPQ"
     gene            288493..289434
                     /locus_tag="ERVG_00322"
     CDS             288493..289434
                     /locus_tag="ERVG_00322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16197.1"
                     /translation="MSTLVNVLVGLIVIGLAVGLTISLVKLNNVSTGAKKYDCAPGTK
                     VGPLGEKCIPELSTICTGKLEPGTDSNCVIKAGECATMDGTQTICSESCCTRIQNMKW
                     ENGVCVPKANYALCPNDMMSSNGTCVEVPATDGTGGNVISCGECTTLNDAGDACIMST
                     DPACVGTGATPQSSDSTSNKTARDAAIALAVIAVLAAAILYFVKLAPQRSEAVGKRAA
                     AAWEATRGMAGSAAEATGSAAKSFGSAAKTFGSAAARASLRIPGVSQAVILEGHLRDR
                     ANSVARYGTRRRTFNGTIDDVIEQSRRRFPPPTSERE"
     gene            289592..291397
                     /locus_tag="ERVG_00323"
     CDS             289592..291397
                     /locus_tag="ERVG_00323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16198.1"
                     /translation="MDEFHTTVDQFVMLRTPSSRRLLINKIDEFLPDTLTGFPNHNGM
                     LFTLVDRLSFKQPEDENILLSAYNKAPNSVFQGKDQHKRTMLQRVIHAGCSSGIVQLT
                     FERSPESHQIEHDKGGNTVMHYAARRADNGIITFLINNMNQRNLVQCMSKRNKGGRTP
                     LFEIIDSSSTHTMPIHRILNVSDTKTIWETKDKTGRFPIERVTTGTFELYADFVTRMT
                     SPTTQFYNNNTSILQCIIRDQNTISISNIVNLSAALIVYNPNFLHTLLTDTRSIRGIC
                     DDIFTQIIQKSQYPSLAFKLLNALAMSELRPIMLQKRDIWEQSIFHIAAHSFHELLHC
                     IRCVSPTGLSVKDCLTMYSLRGTPMHIIIKDGSTYDFETKIDMIRQECTEQFMDPILV
                     LNTALTTKDIHGKYAFEYAKSTKIIEVLFTYIKPCIHQVAKEVLYTAASVHSYPVFIE
                     TIEMTNINPVKDDKLLSEAARKQEIVVTIRPRRVFEYMIHAIHPITLTKSTLHHIVSI
                     AAALAPSTRDADIQLVQSIVELKNKWNVWKNWKRIQEKIKIRAIYHYWQENSLKKYYL
                     PDSGEEFLASIDEIYGNNSFMRLNYNSAAEHNTQQ"
     gene            complement(291348..292256)
                     /locus_tag="ERVG_00324"
     CDS             complement(291348..292256)
                     /locus_tag="ERVG_00324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16199.1"
                     /translation="MLLLLVKCMYAMPIIDTRIIGGDDIHIKEYPATVSLNVYQTAHI
                     CGGTLIGSHWVVTAAHCINPENSPDFYSINLNSTFIGDDALVDYTVKQYVIHPEYDET
                     KITSDIAILELDRDVTSLAKKAILSTTQPTVGIDVHTVGWGVIAYDGENNGYLSAKLQ
                     YTNGVVTSPLNCQIHEDRPGIVCMDPREDSTTCNGDSGTGLYNNDEALIGVTSFGYNL
                     FDQCSHYYPSGFARIDYFIDFICSNTDSSVQYTNGSCTDPPPKNTEPVPQVIIIGTIV
                     GVIVLGAILSFIVGYCVRRRSCNLDA"
     gene            292375..293238
                     /locus_tag="ERVG_00325"
     CDS             292375..293238
                     /locus_tag="ERVG_00325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16200.1"
                     /translation="MESLNVVKFLYRAFALQDFREANPEITQKYIEQLDTTLDVIKYS
                     DFSAMYKKWSELNGTNPRVPSTHNIIKICHQMCADVKMNSKTIMFDCKVNTYETGSGY
                     YFTFDRNTITTHMEHMTNTKILSERNIARIKSMQTNREKFIEYFKYDPYTAGILISNA
                     FIKHNLKEYIANMKHMDMTQFSNDELSLKRYEPLHRQMKKLNLWQGIIKSKSNAVKMV
                     TIESVSKYAGVNVVTANVLINDGRTILLEALPVHYAKSNDMWMHVIKTAQEEEEAREE
                     LKKSKRQKVSA"
     gene            complement(293230..293682)
                     /locus_tag="ERVG_00326"
     CDS             complement(293230..293682)
                     /locus_tag="ERVG_00326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16201.1"
                     /translation="MSEEFGLYIVRNLHTNVRNIERVTVSDMTNLYSRYCHDNGIVHM
                     DFATTHKLYAFVKKSLTYLCDKSNVDINQVMRNNIWTEDGKTTSGKSYNFRNMSVTHN
                     NNNDPISGITDLMAYENQQWLRDEMQQCIESIVTTSPDEFIKLTKRLR"
     gene            293711..294454
                     /locus_tag="ERVG_00327"
     CDS             293711..294454
                     /locus_tag="ERVG_00327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16202.1"
                     /translation="MYLPTSRDNIAQVPQTINRTLDQQPVVNKVRDSASKGLDVSDLK
                     PGDIILMLGNYPSSCLTCTTTLSPVSSHVGVVLELDGKLWLIEAVSFSENDVTQWIVP
                     DSAPKPAGVIASDIHDDIEYYSAMDVYRPDPPLAPSELQALQRTFYDLKGKPYEKSIL
                     QLFNVACGCPVIPTRNSIFCSELVARMFDNAGRLKADPYCGIIPRYRAWSYNYRPSDI
                     PNVINCKRIGHMTGTRNIWDIRGWTFGIC"
     gene            complement(294451..295164)
                     /locus_tag="ERVG_00328"
     CDS             complement(294451..295164)
                     /locus_tag="ERVG_00328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16203.1"
                     /translation="MFISWYEHLYNVSSVIGCLTIADYAIEFVLLSFCTKVINLRQTT
                     WFFLHALANACICVCSVNSFVNTLFFPDVCANGDVFTDRSMFGISSVWPLTISNGIHL
                     YHMYGGFSLSSSDYFHHLVFIPTLSFPGQYYKWGSLSNSQALFVTGLPGGIDYFLLGL
                     VKTGVIAKNTEKRINVRLNTWLRVPGMLFTSTLLYQAYMTGNVKAPVWSVLIQLALAP
                     FNALYFNKQAIENYAKHAN"
     gene            complement(295188..295940)
                     /locus_tag="ERVG_00329"
     CDS             complement(295188..295940)
                     /locus_tag="ERVG_00329"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16204.1"
                     /translation="MFTSVREFQEMDVYQRITRINEYFMTRDIQLSWKHKRLMEFIEP
                     YRSMIYGSTRAYIYNLEKLNDVMKQIHFFGILVYTGYQSQGQFVGMYEETTLLHYRPE
                     MIMKIVEHDIAYNYSSANILRLPIEFIASQKCADICSKRRRIIQNKMLKLTLLRNVST
                     FCKYSNIYENPQCRYENYIVQIIRGLAMSHDDPIVIDSMNEIHEQLKTNAMLIISKRI
                     VHLPIYERAMKRRYHPSSGYIEESMKEFDFIS"
     gene            complement(296249..296533)
                     /locus_tag="ERVG_00330"
     CDS             complement(296249..296533)
                     /locus_tag="ERVG_00330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16205.1"
                     /translation="MMLSRSMATAAKNMYNYPMLRLQVPSVEAPRVASPCKYNFSEIE
                     DELKCVHEILHTVIANQAELKQRVDFLVTATGTVIIGCPSFSFLMYCLMY"
     gene            complement(296533..298401)
                     /locus_tag="ERVG_00331"
     CDS             complement(296533..298401)
                     /locus_tag="ERVG_00331"
                     /codon_start=1
                     /product="DNA ligase I"
                     /protein_id="AEP16206.1"
                     /translation="MFSGYRSYQVDKEWKNDVPYIFLASSFNDIEKETKRLVIIEHAT
                     NAFRAVIHNDPSSLFHTISLMTNTIAAVHEGFELGIGDAIIVKTLTETYMKSTETVRK
                     DLKSLGDLGKVAESYAGAQATFVKPSPLTATHVYNTFRQIATTSGKDSMFTKRVLIKK
                     LLLSASKLETLYLVRALQGKMRIGMAEQSILTAIAYAYVMSNPDNIFDTKMTGKLSTA
                     VEQVKQAFCELPDYGELVKTLMETGDLNRSFIKPGVPVKPMLAKPTNGVTEVMDRMLK
                     SGRFTCDFKYDGMRAQIHMKEDGTVSVFSRNMESMTSSYPDVVNSIPSTLSNNTKSFI
                     IDTEAVAVDGDGNILPFQVLSTRKRKDASTDEIKVKVCIYAFDILYYNGESTLKKTLA
                     QRRDILYTAFSQVGNSFKFATSMNPSTEEEVAEMLNHAVLSKTEGLMVKSLDDNSSYE
                     PSKRSLNWLKLKKDYLAGMGDSCDLVPIAGYIGRGKRTGVYGAYLLAVYDPDEEVFQS
                     VCKIGTGFSDEDLIQLSDSLTPHIVPQKPSDYYVADAPSLKPDVWFSPTQVWEVLSAD
                     LSISPVHMAGHGIVDPNKGIALRFPRFIKVRTDKNITDATTNLSIVEMYQSQASVN"
     gene            complement(298412..298723)
                     /locus_tag="ERVG_00332"
     CDS             complement(298412..298723)
                     /locus_tag="ERVG_00332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16207.1"
                     /translation="MAEFSPTAIVIIVVAVILAIPAAGIWAWIIRDRIKERRSRMPDI
                     AMSRGFAGTIPGLSRRSSVASNAAPNYSVHGTASNPFMTNRYSSGYYTNLGTVARNQT
                     T"
     gene            complement(298767..299816)
                     /locus_tag="ERVG_00333"
     CDS             complement(298767..299816)
                     /locus_tag="ERVG_00333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16208.1"
                     /translation="MRVYYIGIYKHHIRCMLKLKLLVIICTVVVIIGLILLIYAFSIL
                     NNTPYCTGVLVSDQWVLTAAHCSGANPASPGDVIRYGTQDSLSKKTPTTTAVVKKVYT
                     HPGYMGITKGGIDLALLKLDKRITTISPMSFLDDQSGYVVGTTLKQAGWGSKDIDARH
                     NMFSITSGLNTYRRILRSNEAPVTSQKQYNSINEYENTKYIVNFEENKGTNKGDSGSP
                     LFLTTADNNKNVVVGILSSGFPPQVRFQKVTQQDLSWIHDITEDAILNRVDHSTLDGN
                     VKKPNANEEDDYDSNDGVVSLQLSANGILHRLTREYAIYFIPYVVAMAVCVAVATRGT
                     FVLRRKSPHRFYQVR"
     gene            299781..301541
                     /locus_tag="ERVG_00334"
     CDS             299781..301541
                     /locus_tag="ERVG_00334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16209.1"
                     /translation="MMFIYTYIINTHLMKFTSILAYTFAVFAILYLPVTPTYLIARNL
                     ISPNNPTLIPGKYACTPSILKDITVIVSVKDTCSQSPIFIESLKKITTKYTPLIYTYP
                     AYKGCEAMKPPLKYWRNVRTIPVDLRDSPMSGWVKGSKYVKTKYTYLVHNDGYALRCD
                     FLCELYGALSSRGEDYVVAAPMLYENKEGGGLGAHATQANLQIVPGGNKYGINAFHQH
                     SFIKSLNRGEDLSEDDQTEFLEDHGFLIKSSYILDVIDDKASFTLEYLDMILNLRNIN
                     KKVVFVPSAALEFRVTQFMLQDIPYFAYKRSEEIAHKTRDYISTKWQVGVPNTGFWTY
                     IKYTILEQHVYCGNALASLSWREQLMTVFGFFELSGYNRYKWSSPRYIPLTKVVYLLD
                     GTRMPPAKRYVAYRNIHRPMLKPKHINNISKLVGRGDGRVMEMTYEYNAFIVFNAQYK
                     CINKASIMHICNVIIESDSDICICWGHVPIFKRGNVVSAYSKMIASLLKIPSRIATYL
                     EMLTYKSQDISHMIGHIPPNISSAGIESQDLNLTLYACGADQHDCYVPFEFGKHMRLS
                     QFYGGPISLYEFARYISKII"
     gene            complement(301547..302122)
                     /locus_tag="ERVG_00335"
     CDS             complement(301547..302122)
                     /locus_tag="ERVG_00335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16210.1"
                     /translation="MKINNSKIAKYVLPELFIVLIMALFSRPLGALGDGTLVSTRSPP
                     SQFTQWTFFVYILQRTVMQRLLLLALAAALNVRAYTVSSTEKVLPDAHDFGYDGYDSN
                     SGYDFPYNYDLPLQNDNTIGTDTYTYTPTPTRSFWDVYMYTSRVQTLETTRDDARLQG
                     ILIQMRALARSYLDILYYKYLQHVPPLTSAE"
     gap             302387..302486
                     /estimated_length=unknown
     gene            complement(316938..318068)
                     /locus_tag="ERVG_00336"
     CDS             complement(316938..318068)
                     /locus_tag="ERVG_00336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16211.1"
                     /translation="MRFLIVLLWTCVVYSQRPPSSPPHVPINENCMSAILDIDICNSF
                     DGGNAIFPSPTGSYIENTVSGNVLCVTSQYNVLIYESLGHMTSGTANPLFDASEYTGW
                     DSTGTDGYVWYHPITGMFESKTSRDGTDKLNWAWSMLSGNPNLDIFGQFILSPGIQNP
                     IGCRGDSVSGGSFDCTGTKTCPPPSPPPPSPPPPSSPPSLPPSPQPPPILPNWSPFPP
                     LPSPPPPRPPPSPPPSPPPPTPPPPSPPPSPPPPPPPTPPPFPPPSPPPSPPPLFPPP
                     PPPTSPPPPTPSQPPPQQPSPSPPPSPPNLIPAFVPIVSVTAGFIICITLGIVGTLSY
                     QTYYTGNMEQSTLIPQTRHDIAKIQEISRPTNKRSFRRDVID"
     gene            complement(318152..318481)
                     /locus_tag="ERVG_00337"
     CDS             complement(318152..318481)
                     /locus_tag="ERVG_00337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16212.1"
                     /translation="MSSDGPKLSPTNVEDSTLASASGSGSDSVGAGAAVGVVILVLVL
                     YAVFVLYMAVSNKGLCRWTNGNGIGMYLLKSIANGFTGGILGIVMFFMYDECEGPVRR
                     VSQRQMM"
     gene            318654..319955
                     /locus_tag="ERVG_00338"
     CDS             318654..319955
                     /locus_tag="ERVG_00338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16213.1"
                     /translation="MFSAALGGIPIQGTRTHVLRNNTYIISLSNDYHRSIKVSKAQQS
                     IRDRQRISKSFESNATRDLVQYYMDEIDNVSSKYENIGLTNISPILHKGTMYSTSELY
                     MYVTLLIAIYLKVLQTFVHLRMTNIRSHEIDNEIDNEIKYCYDRLEGLLRSVDYSVAP
                     NVLSTAAALNCMSIRSQIDEAVDAYGADVPLTMQCTHNITTLVLLFAHAKHYSRDLPS
                     YPASDKDVINKVVDSLYDFRIGDTPRSMFAVRHYIDTLEQQRKDDKWHYDKFAGAALE
                     LALDNNSQDAVNLYHHTQAGGSVAFLPYALVRQSSTDSLTSMEEFFSGIIPADIVNPR
                     PANTPSQTHTPYFQPSIPPRDSVDYPPQPIPIDPQDLHDYQIPLYDNIVNPPPANIVN
                     PPPANIVNPPPANIVNPFSETELYDRYGNNEGHFDGMYAYM"
     gene            complement(320058..320588)
                     /locus_tag="ERVG_00339"
     CDS             complement(320058..320588)
                     /locus_tag="ERVG_00339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16214.1"
                     /translation="MNTAMNMFHELRNLHPYDRSMVLTSAWIGIAGLYTNTSTWFGVL
                     RFMLMMLMTVVSIHSWMNWDDDNNRKRDRIVCRSVFLWHFLLLVFHTQNYAFVMPWLS
                     LSMTCYLFDMLYYNSRTRSKKDGYKMYHVLPHTMFRASAYWFVLGVNGNENFDVDVIT
                     YQVLTTLVCAYPYSAI"
     gene            complement(320614..321231)
                     /locus_tag="ERVG_00340"
     CDS             complement(320614..321231)
                     /locus_tag="ERVG_00340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16215.1"
                     /translation="MIGTIALIGIIGVVLFGIYIYMRSKNLPKDTSRKPLDAHTALGI
                     PHVAKKGATHRASSIQPSHLDWYVGSAREPYKSDETEKTVPTVPWGRTPEPVPTPEST
                     VFDNDVLRGHIFKRLSKIHNDEFYKHSTKVYDEEYNLRELELELMDAIDNDEISPETY
                     KRRKKNLLSQKKQNRAEWKKVKKHNAGKVWYPAHDGIGGVTRINS"
     gene            complement(321253..322545)
                     /locus_tag="ERVG_00341"
     CDS             complement(321253..322545)
                     /locus_tag="ERVG_00341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16216.1"
                     /translation="MSSDYLYVCCQITPTILDHLIEYYKTTPFKRVYFAIPPFNMHYY
                     DSKSEMMEHVKSTMSYYGIKYYFIDQPCYNGAVVSDIAKLISSFVPSLPITKNDFLID
                     KVEEKTALLYKYDIRTGTQISDKVYHSMWSSYRVNKEVDWDHNPLKFKWSEYEQYWLE
                     QFIDSHVDEIPPIAGPPPQTFMNILTDLYRETSNSPNWKCKIQWWQETVENVLIRNGK
                     NAVNMNDGFNVNKVFGDSQILDTVMLNEDNIWCLSRLSWQQNGRYFEWISKMVSEAFG
                     YSGAKSDLVNLISVMLHESGMSTLSFNTDKIADVTRQDMVRYKMNVITDRTRKNLSLP
                     FAMYHDFEFDDTLSIEYLRHIMKKNSMSSDHLTLFAQMPSEYALEKLCLNNSDATYLR
                     EFNDRLRDGVEQLSFGMPIEDDSCKNLSKVCNNIMINV"
     gene            complement(323352..323585)
                     /locus_tag="ERVG_00342"
     CDS             complement(323352..323585)
                     /locus_tag="ERVG_00342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16217.1"
                     /translation="MVVEMARRKGAAETVRMKGVAGMGRVKGAVGMGRVKEAVEMGRV
                     KEAAASAAAARAVETVDTVETVETVETVARECR"
     gap             324915..325014
                     /estimated_length=unknown
     gene            325447..326049
                     /locus_tag="ERVG_00343"
     CDS             325447..326049
                     /locus_tag="ERVG_00343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16218.1"
                     /translation="MEYIDNLKHMYTSSCNTVDIRRCVNIQRMHAEKAVINAYKDIFM
                     EVLSIKYNNHPGISKNPLDIDKYLHDSYDRLVKRQNAIRQYEHCAGTDLTLVPGVYEN
                     EQLIVKKMWYYNEATLIRLERFVDYNQYDVANFIQLSREMIYNDPAYIRFKKTYAMGV
                     LRAFIPKTKWFWNVLENAYHPKNNLGKMAIDTFDTHGIYV"
     gene            complement(326140..326502)
                     /locus_tag="ERVG_00344"
     CDS             complement(326140..326502)
                     /locus_tag="ERVG_00344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16219.1"
                     /translation="MDCTTIKIVLWVLNIFLLILLIRRNTQNISNLNDSAITRMDMAD
                     PQNRAVIDAVTHGKADTVPVEMLMKSADIVSRRASAMSRKSGASAAQSAVQLDKLNDI
                     LVRKIKNKTNHPGLSRRG"
     gene            326548..326739
                     /locus_tag="ERVG_00345"
     CDS             326548..326739
                     /locus_tag="ERVG_00345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16220.1"
                     /translation="MSEEHTTPCSDDSFYLSSKAVNVMHGTLLGISMTVLMFSFYGSD
                     YRPPRVTKVKSAIYTKKSD"
     gene            326774..327673
                     /locus_tag="ERVG_00346"
     CDS             326774..327673
                     /locus_tag="ERVG_00346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16221.1"
                     /translation="MATPPSMPSPSLPSPPMPPFEIYDWCGTTSVYLAFMSPNTYYTS
                     AGELVSTVPYLTSPDPQQSLFRVLVPSVLLPVTLLAFFLGRKYFWPIFSLAAAGVGSA
                     IAYGIMYSRPDFIPIETQCGVQWAGTAGGAGLGLIVGIFVIRFLPKFSAIFIGGFLSF
                     AVFQQFPQLDLLITGFPIVDQYNTLFLGWGLWPMWAVTLICAVVSLVIFCFGILEYWR
                     KVLFIAVCGGWAITHSIRLIARNQTDYHDGIATGWSAAILAISMLALVILQPVFDMVS
                     PFKDARPSSVLPTRANTVRMVGR"
     gene            complement(327724..328452)
                     /locus_tag="ERVG_00347"
     CDS             complement(327724..328452)
                     /locus_tag="ERVG_00347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16222.1"
                     /translation="MSVGFCAVCFEDKPLIALSCTHSFCQECIANFLPNLKFKNGTCP
                     LCRHDITFDATTELGKDVCKTTQAIGFNPNKYWNNNPNDINLQPTDVYKYIKKSLPSL
                     QQFIHRYNQKLTNHILIEIEWKQLDPFIRRMTRVSSPRHEKNVTMTLWFGPGIVDDLP
                     FNYNNNRIEIATSDNGDNYSIIFTKQVDDAINTIMKGLLTPSAEGVTITENITLRSIH
                     PGMTISLYDGKGFMHTEVLRVHVE"
     gene            complement(328489..328749)
                     /locus_tag="ERVG_00348"
     CDS             complement(328489..328749)
                     /locus_tag="ERVG_00348"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16223.1"
                     /translation="MLPPIRCCTCNDLIKFREYDEQLRNKSSQSDALSNIGVKMYCCR
                     RMYLGIQIGLTDILSTTECTGFEDGLNKLDIGVSTDRVIHLS"
     gene            328817..329329
                     /locus_tag="ERVG_00349"
     CDS             328817..329329
                     /locus_tag="ERVG_00349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16224.1"
                     /translation="METNTLLLIFGVVIFALAFYISLRNNIMGARDRFVKYFPSFKET
                     FKRWKWTGAAAAGAAAPSAADVIYKRELEKNSALMEMVKSTMGAGELEVARQTRVDPL
                     YEVDCSHLKGSGGSTRPYGPQPAGSDSSTGKTVKQANCDKLSIIINDKAPNKHIGLLS
                     WIAFAHKHGS"
     gene            complement(329326..330267)
                     /locus_tag="ERVG_00350"
     CDS             complement(329326..330267)
                     /locus_tag="ERVG_00350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16225.1"
                     /translation="MDVQAFVNSQRTLSKIRKEAKDHKKELREASALAKDDLMDSMDA
                     AGVTSIKTGESEWFLIVETKKVVKLSPELITEIICNVTNEELRHVMQGTDMTLIEAMR
                     KYVCNKVATATDEDDEPKRNFRIQNHCPRNFVHLPDDSVDIVNDAVTAFKNAEIDRKA
                     YAGRVKELMDEATATHTAATDIAVFDFVSSTNVGELEVAGGHFTDDGGVRFRSAPIRL
                     AEDEEPPEGPLYIKAERKYKPRNMPKKKFIGLVDQSLHTILSRRFGDASTLTEERVGE
                     VVHTSDQVVECLTDLMNQSSPPEETTKISLTNKRPRV"
     gene            330344..331333
                     /locus_tag="ERVG_00351"
     CDS             330344..331333
                     /locus_tag="ERVG_00351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16226.1"
                     /translation="MLVIVIIWLFVLMTYMLLSITPGTGQTIISAYDYGHRCYKNPSL
                     TRIHYTSTMILFIEAHETSCYDRYDNGNMIALRSFNDGKTWSTPMSLRSKCKHTHSPQ
                     SFIYNNHTYIMYVCDNYGIAWRKMGNKTVSREYYQKNLSNGLPIHIHSSGIVNPHTTA
                     VNMPITIGEQFMTLYSDDLVTWKTGAKVPMIMSGTFEYSDNKTMLLQTQTIFKFNAII
                     NSYDNGKTWSDIQTVYPFRRNKPAMIKHNDIIYSISTDGLITGSGLTIFIYKISEQIW
                     LHYYTIDTGASYDASVVVMHDGNLMICYEKGWRSSIHCSVVAPYHGLMAPIDV"
     gene            complement(331536..332861)
                     /locus_tag="ERVG_00352"
     CDS             complement(331536..332861)
                     /locus_tag="ERVG_00352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16227.1"
                     /translation="MATATTAQDNVENIQAIHVDIAPPPGQSASEATMAEMAASLEET
                     DAQRKQVLIDLVAEISNALVGFGQTIKYIDQRIKNKQAPKTSKKCIKALKCIQKALQK
                     SIYKDPNVYKNLSKPDGNWRDEYTTKHTTLYENIKECMKSNFDYTTEDNQLLFDFRQI
                     CLQLKIDGKEIITDADATAIERLINALNNIETEYIESSIELLQIMAMASGDSENGIKS
                     MAYLMQWSTLWKTLLFAGGIGACIGLQSVLEPALITSNRAAGLYFEGGIDPYKKETIY
                     YVFDTATKQFKKVIGELPLGARGITCPENIGYAFFSGISNSPYTFSPYICTAGKIVMY
                     MPWLNVVRDMLHTTLTMPARLLPYLETMPITTNYAVAGVVAVAGMIGIGFNAHTYFKK
                     RKRPNELEEIVTTGLSEGTAVAQQLAASQAQASSSTNRQQSKRPRVARS"
     gene            332906..333331
                     /locus_tag="ERVG_00353"
     CDS             332906..333331
                     /locus_tag="ERVG_00353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16228.1"
                     /translation="MDKIIIGLVCISILGIILAINIAPSSKILLTIIVFGMFGSVLFG
                     DDSANSSTIAATPHRRPPASLAARQAAAITSSHVPDTLSPGMQNLNAMREDGAQSFRE
                     NKQNGTDGISLSSKKSVAYTTVTSAWMLLTAAIAVKSAF"
     gene            333356..335023
                     /locus_tag="ERVG_00354"
     CDS             333356..335023
                     /locus_tag="ERVG_00354"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16229.1"
                     /translation="MAIPNWQDYNYLLNNPTDQINDGDNVSVRFSEFGSKNNYVTVQN
                     FLVCTNDVLNTVRTAMENISNGNLYLSDDCKRLIMTLLEIITLDILANRDATPIKRKL
                     SRNGVNARNARNDCSTSTGLVTAIENWVHEYEKINSGSISNVARRSVRYGINSVRNTS
                     KRTIGAFVAHLLILIGIIPVITTLSVLIDHGKLHSTGISSINGPYSGYVTAHDKVQVQ
                     QQLNVNAILSYLKEVDNKHGAEMFGLHGNNGATHYNTGQHQARVQAGVSAGLHRPMDD
                     LALIHARGALEQGLHEISTRAGDYYIMSLSHYAQESTREIVRIYHQHLRVDVSDKIAK
                     YIGETVKEVDCMTHDVMLHDLYKFIEAREDKFSSLGSVMLSYADATIETLDILNNADA
                     PILTVMKGINSCNVQLYEQGLSRLFMQYSSYIDWNINEIQKVLISIPKDNRYSEITKQ
                     YGKENKGAISIIWNRHVWPYLSYLIAHRTFGEDSEITKYENFKLSFYNYPISTVVASL
                     TTGAGALGTGAFFGANMAGMGGLFAAGTMAARLGASAFAAYYDMPAN"
     gene            complement(335020..336234)
                     /locus_tag="ERVG_00355"
     CDS             complement(335020..336234)
                     /locus_tag="ERVG_00355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16230.1"
                     /translation="MNSYPQSLIKLLKISVNQSQMTNNMFTPILSHTETSYGMLTSPP
                     ITTATVLSGDSTTLVQVLKTRINDIMEKNPWLGGVLCKNNHGDVIILPGVYQCFQHLP
                     DHNTISYEYNLQTFIRQCSWYAVQTGWTSIDTEEILFRVSLIPDANVLHQHILIVSMN
                     HLLGDGALYYQIYNMINSASEVTQLSPHRPIHLDEQIKVHQGDGVKWFNSWSFMCGIV
                     YTLFFASAAKVTASDVNTNKINAIKKNHTGFISTNDILTSCFFNSSGCTHGIMPVNLR
                     TRISNDTDMSNNACNCVGVTIHDLDVLQTPLDIREKLQASQLIPTTQKLPSFYKSCCG
                     KFAAVTNWSTFYKKITIGTHETIFHVPIADLTNTPMHSVMIIYNNSKCLSTIRVTRDT
                     FNQRLSDAYNVF"
     gene            336506..337567
                     /locus_tag="ERVG_00356"
     CDS             336506..337567
                     /locus_tag="ERVG_00356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16231.1"
                     /translation="MEKEESLTAVVSGNNNLPTVKEMKSAADVCAKSLFQFIATPVNE
                     SGDYELIDTVSGARTMFALTTNLGVGSYGAVYGMEGGPFDNYVLKLFTDIKEEEQLSS
                     HVAEAAAGIIFGNDRQVSVSVHPKIPMMTIRFEDGDCSAMVSERYDMDLFKLLLSFKE
                     YPLRRAELYRNYEMITYTVGRMYWIMVHSGFICLDRRPPNILVKMNGDKIKDIRLSDM
                     DLGLCCTIYGSIARYALGKHYIKAIDKKKREIHRIPWSTYTTAPGTIEVPDNISGVQC
                     KLNDIHLDMIIELQLAFTLIPLGIYPQRKMEYILRYFEDIFNNPRNPDDEKIRKIMDN
                     DFMRTMMLFQEKLNEPPEF"
     gene            complement(337568..338863)
                     /locus_tag="ERVG_00357"
     CDS             complement(337568..338863)
                     /locus_tag="ERVG_00357"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16232.1"
                     /translation="MLSFYYILGKNTHRRHIMLSKFIHMFCIGVSIAGYPAGYYNRLT
                     PNAPNVGTFHGTCTCPDGSVYIVGDNVNQCGSLACYGGVSGTCHKSNVAVDHIQGLMV
                     ECNVVAPSPPPSPPPSSPPSPSPPPSPLSPGYDYVEMFTSDISTSFIIAEPDLIDPGS
                     GSAIGSDEGRRLLETAAISPLVFEYAIYTAFRIMYNVPRFHPDCGLIESTSNKCIDIM
                     YDEDTTNSTVKVYISPNMNSGDTSITDALSTESGADPIEAIVDIFNKIIIGEDVGSSF
                     FEVSTIDVPAYLYAAFIATDDNNTLIYNISTFTNRYNTEPDDLDDPDVTITFINPTST
                     QIVNKPADDDDDDDDDGLSDGDVAGIIIAAIIGLMFILIIAFVAWPKNSRVCVRRDPE
                     VISTTPTPGLETVSPPTEREIAVATQPSAEVTEITMTEP"
     gene            complement(338868..339245)
                     /locus_tag="ERVG_00358"
     CDS             complement(338868..339245)
                     /locus_tag="ERVG_00358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16233.1"
                     /translation="MITDTDCIICMDRPPVNDERISCSHSNQFCKECLDSCIYYNLIE
                     CPICKARMNNVTHVYPHAQLIVPDYHSHGIVIHIRPNRRQYREISEFALFILLSFSFC
                     IFIRFMIYPMIYHIYTLELHQFR"
     gene            complement(339242..340261)
                     /locus_tag="ERVG_00359"
     CDS             complement(339242..340261)
                     /locus_tag="ERVG_00359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16234.1"
                     /translation="MKLSNITKPVASILFDRVLRFTVIKIIDGTIKDSACVPYDAIWS
                     VDDVVSKSNKTRILRVYGGIDAFICLLKEIQWKDASGNIRQFIRDDDIQTEVTYGKNS
                     NYEKKRTEEELLVGAYPLSMRPPRLYANWWMMFIGIVLTYETTLRGIFADGLTAAGYG
                     DQVVRWIISGEEEPLYDALYDANIICPVNNIKYTAVEAFISLASFISIPVDFLKLKKD
                     KPKHWKPKIYDRRGNEIDIPHKPVANSNDSILAFDISEPPDTIKINDIEYELVAGFVD
                     NKFALVKRGKYWMSFDETSACGICPVLHMTTQPWLDNYKWMIPNSSPRDFKHSTWIFI
                     QTKSK"
     gene            340296..341921
                     /locus_tag="ERVG_00360"
     CDS             340296..341921
                     /locus_tag="ERVG_00360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16235.1"
                     /translation="MYKRVPVHPTFIDMSTHTNIIRNAYVVLCACVSAMWASMVLPNA
                     LYDGMQSTSTWSLAQVALIYTIQIFTIFLTGPVWGIIATKISGRILLTIGLVVAGFLN
                     CMVAASTSSYVGVFLIHIIKGIFLAPCQIITRSMVSKYYKLDERSTKYGQLELAAGIG
                     GLIGVVFGASSFIGGAEGYYGDFPKWGVPFLLLGFSYFPLAYCVYKFVIDPDHDIRFV
                     ERKFGISNQAALFPGMVDGDINLTRSAVRKLCTNKTWFVISIQGVTGATPWPALGMLL
                     YYFQLMGINDFLAIFISSAVAIGAAFGGLIGGRLGDYAYKKSPKYGRIVVSQVSVIVG
                     IPLLAIFFFAIPNQSNRWWLYAVYGIFSGSLISWSAPCNIAMLSDVFDQLTFPFAFGV
                     EQMFEGAIAAWAPTVVAGIATAFGVGELKNFDQKTPEERESDLSGLGSALYTICAIGW
                     GLCAISMCGMYYVYPNDSISLNKKESPATTSSESSEGEPNVPVIIPFPAAPPPTEAGT
                     ESSNTIINNEMFSVSVVTHNSHPSTPSSTQYRV"
     gene            341957..342211
                     /locus_tag="ERVG_00361"
     CDS             341957..342211
                     /locus_tag="ERVG_00361"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16236.1"
                     /translation="MPDRNQNFDAQEYETMKYALGLVTILLLSVYFTSQARNRYERMH
                     TVMWSAAVVGGVLAWYLATDWIIPEYLNDDTGLVDDLYTP"
     gene            342254..342913
                     /locus_tag="ERVG_00362"
     CDS             342254..342913
                     /locus_tag="ERVG_00362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16237.1"
                     /translation="MNVFLILYVISTPPSSSPSPPPSPPPSSPSPPMMPSPPMMPPTS
                     SALSTGAIIGIAVGAAALVCVFFVCLYMYCRRKKSAQAEQMVDEEINMVEDARIASAI
                     PPSRDGFPDAGKPNGWDDNRVSIKPVDPPVPEMADQPVSNAPVNRKKRPPPPKKAVVV
                     GQETPTLPPVVYEKPPPEPMGKKFANFPVTAVATLASIVINSKSASKEEEQTTALRPR
                     K"
     gene            complement(342940..343545)
                     /locus_tag="ERVG_00363"
     CDS             complement(342940..343545)
                     /locus_tag="ERVG_00363"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16238.1"
                     /translation="MSALNYNPRIYPAAYPSQYLPQPKYGMKYDEESSSPARKMFMTG
                     LVVIIIMLLILFVVYQHPYLNAVTFTPPPGAKNQRAELCGRIKSGDRFVVGDFIINNQ
                     GKLLLISEKDVTIHNSGGIIEFSLVRDTEYLKEISYPEIVDLKYNCSHVFKMSVNNKD
                     NPTSEADEVTISKIEQIEQFISDSGAKSTCMFEADRSGQCA"
     gene            343691..344482
                     /locus_tag="ERVG_00364"
     CDS             343691..344482
                     /locus_tag="ERVG_00364"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16239.1"
                     /translation="MAVSRRSRYGTVRRRRRTVRKSTASRSTKVGRVAKLSNMSAGCR
                     RYVKSKLGSRKLSRATRASIIRSSVKSWKRMSKTRKAAYSKRGRVSTRSRRRSTKRSR
                     RTRTKRRRSTKRSRRSKRTKRRSSTLKRPKTSTMSKSLKKYIRTKSGKKNLSKVSTKM
                     LRKLIAMWRRMSAKSKARYSVRSTRKRSTRKRSTRKRSTRKRSTRKRSTRKRSTRKRS
                     TRKRSTRRRRRTTRKRRRSRPRTRRVRRTRRTRRTRRTRRTVRRR"
     gene            complement(344740..345414)
                     /locus_tag="ERVG_00365"
     CDS             complement(344740..345414)
                     /locus_tag="ERVG_00365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16240.1"
                     /translation="MCGLVGDSCARVGSVECAPPPSPPPSTPPPPPPPTPPPPSSPPP
                     SLPPPPPPPLPPPPSPPPPHPPLPPPPSPPPPTPPPPSSPPPSLPPPPPPPLPPPPSP
                     PPPHPPLPPPPSPPPPHPPLPPPPSPPPSQPPSLENASQSLVPIFVSVGCIVIIIVLI
                     GFGYWLKCKYYKSPLQIQPEAELEDEPIQVERHQPHPVYVPVPAQSVSRFNRPTRFNR
                     PSRFYS"
     gap             345588..345687
                     /estimated_length=unknown
     gene            <345688..345847
                     /locus_tag="ERVG_00366"
     CDS             <345688..345847
                     /locus_tag="ERVG_00366"
                     /codon_start=2
                     /product="hypothetical protein"
                     /protein_id="AEP16241.1"
                     /translation="FPVSVMIATILVPTGDTRAARAYKNKYIKRVHSMQSNIPKTGPM
                     QATMARAW"
     gene            345885..346406
                     /locus_tag="ERVG_00367"
     CDS             345885..346406
                     /locus_tag="ERVG_00367"
                     /codon_start=1
                     /product="deoxycytidylate deaminase"
                     /protein_id="AEP16242.1"
                     /translation="MDFTKCMSCTEEKRADYISWDQYFMGVAKLSAMRSKDPSTQVGS
                     CIIESTTNKIISIGYNGMPRGCNDDDFPWGKKEKNSNILNTKYPFVVHSEANAILNAT
                     GTSVNGCTMYVTLFPCNECTKLIIQSGICEIVYLDDYNDITTKTASLRMLQSAGVTIR
                     KYKQTYRLLTFLL"
     gene            346651..347941
                     /locus_tag="ERVG_00368"
                     /note="phosphoglycerate mutase; frameshift"
                     /pseudo
     gene            complement(347926..349170)
                     /locus_tag="ERVG_00369"
     CDS             complement(347926..349170)
                     /locus_tag="ERVG_00369"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16243.1"
                     /translation="MHSRVLVVGGSVLLVIVTIVLLILVQTNTLFGAKASIPTQKSII
                     GGQNVASYNDTNGVVSLARYSHDTYHSHYCGGTLIHPKYVLTAAHCPVRVDDSVRIGS
                     IYSYGNNNNDNNSYDYSVKRSIRHPSYNEKTAQHDLMLVELKEEVPAHIATPMIVNSD
                     QGDDDPHFTPTNAAINHEYMTATGWGKTRDGNPLILKSAKLRVELNTNTCVNTSSMHS
                     LDNFPGQIGLSYTNICATGNENDAICNGDSGGPLFKTYDGKKTVVGVSSFVMLPCGLK
                     GEPDAFVRVGIYTDWIKHYIQTASGTISTEDSTPSINDIGAPSANNSDDDPNDGKNTQ
                     TAIIIILVSCVIIAGAGIAYSRSSKSRTLSTNHIQEMASRISRLPSLNMSRRSSLNMS
                     RRSSLNMSRRSSLDTSQHYSRF"
     gene            349219..349998
                     /locus_tag="ERVG_00370"
     CDS             349219..349998
                     /locus_tag="ERVG_00370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16244.1"
                     /translation="MFECKGNAGLLRRVIECIAELIIECRFDCSENGMVVQAMDSTHV
                     CLAAINLLRDGFLHYDCSQPLVIDIPIDKFKKILACSGPEDTFTLRFNGGSVLLIMFE
                     TPTRDRITDFELNLLDIEQDAMSVPELESHLHIQMNSIDLKRIVKDYQTFGDVITISG
                     TKDGVTYSVNGDFGKGNILIKPVDPETLPANDPLRNNKMDITEPVVQKFSLKYFSNFM
                     KNTASDIVVLDLVNDMPMCLTYPLGVRGSVKFYLAPKIDDL"
     gene            350004..351779
                     /locus_tag="ERVG_00371"
     CDS             350004..351779
                     /locus_tag="ERVG_00371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16245.1"
                     /translation="MFENSDIVSVLITEMFNTYNDTRYGIGSPYYKLLHTLNCVNKTF
                     KENTKFGIEQSALNKSNIYNKIVNNGAETMIYDQINGKRKLMKQYKPPSESHGLSRQY
                     VNSVLLNRLFDSHPAILTMDASLTYLNKNAIIYNLPVDSVYDVIKYGSLGPCPEIIIV
                     HMMRSILSALATLHSHNVTHGYVTVSTIYMTTFSESGLPSFYLSYFDKSLILNNPHTT
                     NDIVNVAEIALAFLQNDMEVIPTYNAMINEGVTFNDFYEHTCNVSVFCNNIKTTDTKY
                     VHRNRSLMRVLYKILCSRYSDTITAHSILTDLVVFDHTVVKIPSAPGRILASYTVDFV
                     GDPFIRHGFTTALDKTGRSMWTYASELLIKFGHFVEVSFHITLMQQAVQIMYNFMHTV
                     DVITLDNVPNLCNGHSTEEAKILLISTIALSCLSLSSKINNVHATWIYKACNAEWAHK
                     AFGMNLEITPEDICKMEGVILNNIDSYVYLHKLPISVICYTLKKHYADNNPRIWTRGS
                     AALLKHVSTAVMVYTPIVDFSTTSPIIAELTNICTNIGYNKKTHAPITHAALSSSYKH
                     PYVISTSENSIHTSVSWLLTRLTKD"
     gene            351789..352865
                     /locus_tag="ERVG_00372"
     CDS             351789..352865
                     /locus_tag="ERVG_00372"
                     /codon_start=1
                     /product="flap endonuclease 1"
                     /protein_id="AEP16246.1"
                     /translation="MGINGLSRLINNKAHNGTSNKDLDLLSGKVIMIDASMQIYQCLI
                     AIRQGPSGQLAASEGEVTSHLTGIFYRTIRLIEAGIKPVYVFDGKPPVLKKKELDKRN
                     ERQAQALSELKLTDDATEVEKQEKRSVRATREHSEEVKKMLTLMGIPVVQSPCEAEAT
                     CAAYVKTGKAYATATEDMDSLTFGSTYVIRHINSTDQKKQPTVEYSLPNILNDMGITM
                     DQFIEICILSGCDYTKTIKGIGPTRAYQLIQEHSTIENVLDVLKKKHGEEQFSTMVPD
                     DYPIEAVRDLFNNPEVDITQELTWNTINRDALIAFLVEEKKFSADRVNKGCDRILAAK
                     AKGTQHRINHFFKVKQTPVGQKRK"
     gene            352876..355178
                     /locus_tag="ERVG_00373"
                     /note="hypothetical protein; frameshift"
                     /pseudo
     gene            complement(355180..355416)
                     /locus_tag="ERVG_00374"
     CDS             complement(355180..355416)
                     /locus_tag="ERVG_00374"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16247.1"
                     /translation="MTRGSYFVLLFGVCVILLVNFFVLFDFKTNTIHTMTTTRIIGLV
                     CSNLVGFGGLWLIHKNYLDMTDFADLSLMFATID"
     gene            complement(355441..355809)
                     /locus_tag="ERVG_00375"
     CDS             complement(355441..355809)
                     /locus_tag="ERVG_00375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16248.1"
                     /translation="MSSPIMASSYDDRVSEMKREHNQSIMWAGIGFAVFIVIVGVLMF
                     YSYKYGNKKYNEWQDEAADKKEELIKPYRDIILDPNASPSDKRQAQERITDIELRIYH
                     AKQRNRHMHNYHSNSRHSFN"
     gene            complement(355865..356731)
                     /locus_tag="ERVG_00376"
     CDS             complement(355865..356731)
                     /locus_tag="ERVG_00376"
                     /codon_start=1
                     /product="longevity-assurance family protein"
                     /protein_id="AEP16249.1"
                     /translation="MFCGTSGLRDFMYADIMEMAQFSVIMFSFATILRTFVMIYILDP
                     LSEIMVRPERVLKFQQSAWRFVLYSIATISSIIVFMTDDTVDFKESSFFENWPLYNPG
                     SGIKFMYALYAGFYIHQTVYIFGDERLDDFNEHVFHHAITLVLVYVSWVFNFTRIGFF
                     IMTLHDGSDVFLELAKCMNYAKEIRPRLSIISDVSFIIFASSFFYLRLYLYPVYAIGS
                     VINPYDACAHVSCALDEGGVSYSYCASKPIYAVAIAALTSLYILQVMWAGRIINVIAK
                     VIAGNPLEDSRE"
     gene            357119..357337
                     /locus_tag="ERVG_00377"
     CDS             357119..357337
                     /locus_tag="ERVG_00377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16250.1"
                     /translation="MSSNITDIQRREMMKNSLKTRRLNKVRRLMKSAISLCNEIGESP
                     KALFEEVLTVEHIDIPEWLENAAEILQS"
     gene            complement(357340..357867)
                     /locus_tag="ERVG_00378"
     CDS             complement(357340..357867)
                     /locus_tag="ERVG_00378"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16251.1"
                     /translation="MDPKDIKMKTGYGLDIDSDDEEKQHFIATTMGLMQVFSEEALKT
                     AAEYVIGSGRKNVTDDDILKGLKFQARMFFQRVDDLEGRVEDAAKELWENVCSDDSDS
                     GSQSDEYDSDSESMQSDDADSSDSDMELDADEEEQCKRIVPQVNAIVKSWDKYEPTDP
                     VLIFIKNAIDKTDAN"
     gene            357924..358301
                     /locus_tag="ERVG_00379"
     CDS             357924..358301
                     /locus_tag="ERVG_00379"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16252.1"
                     /translation="MEFHLPTAGITAGIMIVLFAILYYIVRYLLGGQMWPFSSSDEDE
                     NKMKKDIKNNDDSHIIAMHAFDVAKYDMTDNFYKTYNRHPTPTEEQEILLKAMKERDM
                     VLVYELKRHNLEPDENDGLLEYP"
     gene            358306..359394
                     /locus_tag="ERVG_00380"
     CDS             358306..359394
                     /locus_tag="ERVG_00380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16253.1"
                     /translation="MYNYIPSSNLPIINGTTLEAQQENYDAIWNTISEHSCCIVRVID
                     DESILSEYATQVDELHHKLCQDKTTPNGSRSMGGILKRFGAGSHPYAVEWRLNPIVRS
                     LFAVLYDSTSSDMTVSNDAVCILGEDAKRGPWSRNVHTKEAEFFRQTGGKLPGHVDVN
                     PINGSPGSYIANDLKTRGKYFLQSSLSLLPVPAGGATFVYADIPMEEVYRPRTTSLHD
                     AYNIKYGDYVTLKEDGYGMVDGKWRQVDNIPAGCLILFCGIHANKLADRTASTNKRAA
                     IYICWLPRSFFNYEQWIWDTLKEKKMKALIEGKTMDHNPINYNFVSYGGSHYSNGKGR
                     TKVIYGTSENQSRPVYDESLYARILQAL"
     gene            359417..359905
                     /locus_tag="ERVG_00381"
     CDS             359417..359905
                     /locus_tag="ERVG_00381"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16254.1"
                     /translation="MITLVTPTIQGMPVPPRPEPPPPLGTSSRTSGPIPQSSRSDTLF
                     EEPPADHRWGDSAMYAGLFGGVGMGMYGVGSAAVGVKRSVSNTMGTMQNSINSTAQRV
                     TRTVDAGVRQGLPVLLESAEKVKSSAKILSFVITIMFGIMVLFLLLEIYKINTNRKRY
                     YY"
     gene            359925..361295
                     /locus_tag="ERVG_00382"
     CDS             359925..361295
                     /locus_tag="ERVG_00382"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16255.1"
                     /translation="MFQHLQSCNNKLQELILEIGNIDSVVTKTMVESMIHQAVKVKEN
                     LKTCSISQINAQIIDNLKLEFKNREVYTALETEYSLYKLDEPHRIATAVSHETSSLKH
                     ENDTLKYQLGALTREKDAAVDAFKTSVEFDQYVMALPQERIPALHNFPLAVESTTSSM
                     QKQIDKLHSEIYSRDITIQTYQQNQSIAADAASRAADMVQANLVSTLTTKVSDLEYQL
                     EKSRSEASWQRNLDTLQNGSKSGTSMEHYVIDSINSLYKSTLIAERTGSDGKSLDIRL
                     KSTECDIAGIEVKNNKEVSKPEEYRTFEQVATKLCKEANITIFAFMQFTDNPRFTPIE
                     IIDQISFKIIKLTIFRQDRLLIEAGVSNMITLIVQLHARNIAGDNNDELDKQTDEYII
                     DTDNAFNIGDAISTRMLDLSKELDQMNKVMRNKCDDIKRIRGIKRKVDKVKSNTVVPK
                     SSVLPT"
     gene            complement(361364..361711)
                     /locus_tag="ERVG_00383"
     CDS             complement(361364..361711)
                     /locus_tag="ERVG_00383"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16256.1"
                     /translation="MNIYLSLLFIKIVAGVSVVCQTTDTTKQVPTVVLYPCSTNNSYV
                     SDNILSTWPFDESKSTEIVTTVFVALTAGLLICIGSAGVVYIRRQSKAYQHLQSTLSR
                     RTLAAVPASRISA"
     gene            complement(361784..362401)
                     /locus_tag="ERVG_00384"
     CDS             complement(361784..362401)
                     /locus_tag="ERVG_00384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16257.1"
                     /translation="MLKHFYKNHKEALNTISEQKNDIECNNGICKRSLSIPDGVYNNW
                     YSNMQSITETDNQEAIQRKFSVLCSRLFENKEDYYLSHGSAEESIVRDRGNHLYISYE
                     NIDHKKVKQQFKDAFIIFRKHMQHTDKLSLIVDTRTLTMYATAKYLINTSYIDHILGY
                     LLMETLEKPIYSIEIYSTNMLVKSCIRKIINASSITSNTEHFIIH"
     gene            362423..362890
                     /locus_tag="ERVG_00385"
     CDS             362423..362890
                     /locus_tag="ERVG_00385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16258.1"
                     /translation="MGCVTIDQMTGNLKCIVASILAASFYWFAPPKNKWILVIVLYVM
                     YLMIAWYDYSYECKRNELGPSPLMHFYDWAKPRNTSQHQQYQNLCKDTYNIILVIDIV
                     VLSVIVALIPMFLRWNPSVEGYPQYLHYHESSRLHPIRYQDTPEFAYTKIKNM"
     gap             363459..363558
                     /estimated_length=unknown
     gene            363885..364151
                     /locus_tag="ERVG_00386"
     CDS             363885..364151
                     /locus_tag="ERVG_00386"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16259.1"
                     /translation="MHPPMHPPFLPPTTSTGLNKTQITFISIGSVIATLVLISIIAGC
                     KLAYMAFTRAAHPPVPSVSHAVAPAPEMPETSTAPVVTVEHLDV"
     gene            364181..364444
                     /locus_tag="ERVG_00387"
     CDS             364181..364444
                     /locus_tag="ERVG_00387"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16260.1"
                     /translation="MDRNPTAALENEYDIYKIGAAFGEKYEVPYHSLIRNIFIIGSVV
                     LILVLAGTGNYQSASIAFVSAGLLYVIFSSVSKTHVARLKAAE"
     gene            364487..364717
                     /locus_tag="ERVG_00388"
     CDS             364487..364717
                     /locus_tag="ERVG_00388"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16261.1"
                     /translation="MLTTLTITAVSTSLILLEDVQSDADTTIFGEVSWLYKKRHAETP
                     LQKWIYKYRWWQTMLRLQLRLRWLIWPFVGSF"
     gene            364916..366907
                     /locus_tag="ERVG_00389"
     CDS             364916..366907
                     /locus_tag="ERVG_00389"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16262.1"
                     /translation="MPSIAFSGISTKPGELEFHVPSVLSKHNRAGLLKSIDFPYSQRT
                     IESSWNKLHYMESIRITPESRSVSVLLTDKESGDRVEMLAMVPLTTNKIIEISTATTD
                     GTLILVTEEPHGFFAPGCFGKEVRNVISSYKSIFPHGTPPFILIHGSNGSVQVDPALF
                     EYNDEYSVKIKYTAIRTEFKLFGKGDHGWMVTPEFPTISMLCQVITNAMNSAIIFNHD
                     DPAARTRMYPGTCSNTHVIESVSGDSLAKALLGYDGVYAGWEEITIPAGMYCYGELDL
                     SKMIAAKMNRWHIDRESSIIFRGVSGYTWNVTLPSGNYGTPEKLAHCIQHMMNMTAKN
                     RKNPYCVRFTLNEGSSHRGKFVFVAAEPFDLLFGDDESIDPSILGFEPVDHIGRNSYM
                     SENDLGAPLMKPNCNVYDVDEIPGTHQIRIGRRTRLAVDGKIRGYSGGILRLNTVNRT
                     TGAPECHGMNKGDVVTLTTVMPAPDGATGTKREGFTFRAKNKIMGVVVADENENPDAS
                     SLHVSIPSMSWTLGIGSYITIDSQAAPISVALFDPGKNQFFRDSIGASRLGFSNGVST
                     GQHGVVVSQCAVNLEPRTVDVSFIEGSMTSASTEMYNQNGKSLITQIPSDRSSGPAPQ
                     GMVKFNNALQQFKLEFTNPDGSPYHFNHASLSLLMEFDD"
     gene            366945..367874
                     /locus_tag="ERVG_00390"
     CDS             366945..367874
                     /locus_tag="ERVG_00390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16263.1"
                     /translation="MAPKEKKNKTVATKGATSTFWTSHKRKIIIAIIATVIILVGIIL
                     YIYRDDIISPAASSLPSEEEQEVEFEEISDDVDLPQEPVAKMSDSSHDPIANTLSEQN
                     TVSGMGGDLVSDTPEVGEPIVHSTDVDGIQTEQVPVNLTFMNLAQNYADIKASHVHYL
                     THGKHICVNNKSYKVMAVSASETTARVSVSPYWPRNQTSAEFTLGDCPGNPWLPPTQM
                     MATTNTNYMKVAAFHPFHKSNGYDDNFVGVNKSDINRISVGDKVCINSVTFTVKRVNP
                     NVSPSVGYIVLDELMRNRGIKIMVNDNVHVGEC"
     gene            367893..368576
                     /locus_tag="ERVG_00391"
     CDS             367893..368576
                     /locus_tag="ERVG_00391"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16264.1"
                     /translation="MANSGIRWIQVILILGFIILQIILINNKQYTTAMIASVIYIPCA
                     YFIKRFLFASSATAAIIHRQKLLKANTNDTILRDTSTSQSTESPIEEHTLYSALRKPG
                     TTPIPGRRVQFTNIAPLKQNPGEMLSSVAQLARIGPVTITNREDIQIPLPILTENGPI
                     MTPFQPVPRPQVRETPTPESIASDQERVRQRLNARFGEFKSRSSAFKRMERPTLPDFV
                     PDPSKPQIW"
     gene            complement(368557..368901)
                     /locus_tag="ERVG_00392"
     CDS             complement(368557..368901)
                     /locus_tag="ERVG_00392"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16265.1"
                     /translation="MFSEYIINQISEHTKLATVTQIQLECLYASWKELGNVPTSMTPI
                     GEIVNETGITTWKRVQIVKNKKTTNGRDLRNLHRALIGNKLKDHYAYNGLCDFVKHVD
                     DLGDIVTTISAV"
     gene            complement(368906..369691)
                     /locus_tag="ERVG_00393"
     CDS             complement(368906..369691)
                     /locus_tag="ERVG_00393"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16266.1"
                     /translation="MDVKHMYTLEMYAYVMDTYGSHHSLAILGIGDSETHSIVTESQL
                     HDLYREWCTRRGYKWHATKASVYCFFATLYATTMVTFFGKDDTMFTRTRECPPRIRFN
                     HKYMIALRGCIYSSPVKLDTGAKLLQNLAIQGKTVTDILKNREINEHPVLRLLCTRAR
                     LIKQKKERQLYLANYSVSSIPMDNLKITDFMNFTEKMKRIDIWKKAFASNNPPDVIEI
                     HREFTNITQTVHLVDVTLAVDGKYIRVEQLPANILPSTKRACT"
     gene            complement(369703..370299)
                     /locus_tag="ERVG_00394"
     CDS             complement(369703..370299)
                     /locus_tag="ERVG_00394"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16267.1"
                     /translation="MNTSLYLPAEMTVGSIIFLIIYVIFMTDFIIKSKDYSISEGNLL
                     HQDDGYNLELPSPLGLPETWQIEFSYSSTNQVQLFGIASDDTLQPNQHRESLNYITLE
                     RKDTNTVWLTVMHDGKHKIQIDIGDVTGDIKFSFSRDKIIYWKDGAIQEEHDINNTSP
                     LAEYTFIRTHKINDVKITTGDGDVLFHARKNLFSRLFS"
     gene            370362..370964
                     /locus_tag="ERVG_00395"
     CDS             370362..370964
                     /locus_tag="ERVG_00395"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16268.1"
                     /translation="MTDNFQTGKVPRNVAQFNLPVGNDQSWNFGIRANSQNFDYLPLL
                     IGFSVGLLIVGFFSYNSYDIEDSYMMFGILGGLLFTYGIYEAVNRSKNQYNVQRRINS
                     NQFVAIPGTDAYGNPIIQRNDPTYQRFQRSIARLNASDQQSIRQSVAQNRSSTGIVGA
                     RYGPGSRMAVGADGNPFSAMNLSIAERPGLAGSMRRMPVY"
     gene            370986..371222
                     /locus_tag="ERVG_00396"
     CDS             370986..371222
                     /locus_tag="ERVG_00396"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16269.1"
                     /translation="MTDYKSLQACRMAPKGAKNTTVNGQRINCETVFNRAAGVTACQT
                     GPDGNEQICERALQKRGFSNTVNSSSPFTNTHSR"
     gene            complement(371214..372620)
                     /locus_tag="ERVG_00397"
     CDS             complement(371214..372620)
                     /locus_tag="ERVG_00397"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16270.1"
                     /translation="MKVFVILLTLICIYASSPPPSPPPSPPPLSPPLSPRPPVSPISF
                     PSRGVYIKRGGLAVTTSEYVCITDQDADSTYGENGASPVPNMPIATQCCDPSSGVECR
                     RRATSIGGISYSNDYCVSGVYDTTNFILPIRRTWREANILCQTLGLQLCDDNSCTNAG
                     CSYNNIYTWQLTECPMSPSPPPLPPMPPPFPPPPSPPMPSQPPPSPPPSPPPSPLAPC
                     TEVWDRIVVDDCGDYNTECYLYVTVHKLYVYGDYGTYIMCGFPTDNGTCIDDGLSPRC
                     NTSNFNPPSPPLLPPLSPPLPPIAPSIAFVYLTADAYPGDTILQVTDSNKWSPGDTIE
                     IGANTDNSETNVLKELRPFTVDRPIKYFHSSGTPVVHLFSMEPLSAFYIFTPIGALLV
                     GIVFAFIVFAVKYKQSEREREILRNARRGQSVDMETTAIIMEQKGPVKKDLKQNLGYG
                     KSRFNKPSRFAKRGHRLP"
     gene            complement(372661..374835)
                     /locus_tag="ERVG_00398"
     CDS             complement(372661..374835)
                     /locus_tag="ERVG_00398"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16271.1"
                     /translation="MQLSGAAAPTAFSNLGEVFLGTLRVTSISNGDTFVTGQILSMQA
                     VRTLNCNIGAAEPPTCLTSTTDPQIVAGSGVIRVGASTTLTNTQYNTLSSSIVYASRR
                     LSECDPCGNEADRVAGDVNADCKLLSSDASALQAFILARQDFENTGIGDDPLESYAPN
                     GQNCDWLKQQLNPDLNKFTEEDGYDGNAIGKPKIDALDVISLIRTEVGFYRYMVYRSG
                     LSAIDEEIKSTCTNPTGHFNLTINSLKQSDGIGGMVDADPDYVDVIVELRIEPSRNSV
                     FAIVGTIIEDSENFPPSFPPYPYGTEDQTPLVVSAASLGNGAFGITISVEYSAIETSF
                     YAAVLVETKNAQFEKTNPTSYQSHLGSSLKPYSDSGIEFNPLIGSYQSIRLNASQTCI
                     PDTPLPPPPSPPPPSPPPPPSPPPSPPPPSPPPSPPPPSPPPYPPCHEFDDETRIVGY
                     DVPGSSIIVASSAYDCSIQCENEHGSVSGYFTHHKTDGDCECKTWPPPEAFELNVNYI
                     SGQTCIKPPSPPPPSPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSP
                     PPSPPPPSPPPPSPPPPSPTPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPAPSPPPPS
                     PLPPPSPPPPSPPDRTSTSGTKATIGSVAGGMSGIIILATIFAYRKIRSKKYRDFGST
                     ADHMEQGTYRITTKRGGRGKMRDDSLPIAHQPSRFLSRGRFH"
     gap             374888..374987
                     /estimated_length=unknown
     gene            375424..376104
                     /locus_tag="ERVG_00399"
     CDS             375424..376104
                     /locus_tag="ERVG_00399"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16272.1"
                     /translation="MFQTLKVHAIYFSINKIISLQLHPSQKLINMSQTTAVPQMPADV
                     MAPDTLTSTTEAINTANTVDNMTTDTATKDMSEPVPQKEPEPEQTVFDCDDNDTKLSV
                     TNDIRTATEALTNLKKKLVEVKKRDAYLKKHKSVGDKPARGVKKPKKTRAPGTKRRAL
                     SPYICFVKTLSAGPDRVPFAEIGSKWKAMSDEEKAPFVKLSKDDDLLAEEEAANERTA
                     LETTTTTE"
     gene            376169..377359
                     /locus_tag="ERVG_00400"
     CDS             376169..377359
                     /locus_tag="ERVG_00400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16273.1"
                     /translation="MLSRNITRFGIQKDAILVSLLFASAAMFGSAVYAEYRYNTAVYD
                     IGEGVHKRIRHSMVGDIKEPFATPTNVCHVATTFTLTVFTYYHGKPLHPGVYVSFGLT
                     LVLAALSWGHHSIGSVTGTWQHNGDKYGMFAVFAWLTCFNGFTLYTTFSPSKNNVLYT
                     IAGCIVFIIGQFAVMYCIVNQRKYDVTTILITLGFTAFTPTVIVSWRQTYTAFRSYRV
                     LKSFVYAVYTTMTPVLLIGLGFMYQLYAEDRKQCDDERCYNDIYNDMFIERRSQYDMF
                     HGVWHYFSALTVALLICLQADQVQGKHLSIIYKKSIVFQHVLLWLTAGVYLVLFFTLN
                     TSKQLRTAILVYNPFLILCLSILLYVRIKDTQKPQTIQPTTAIPDDTSTNGSDSAMIE
                     ISTQ"
     gene            complement(377348..377635)
                     /locus_tag="ERVG_00401"
     CDS             complement(377348..377635)
                     /locus_tag="ERVG_00401"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16274.1"
                     /translation="MQHESAVPQTKRVHFMTTEYAHDNMCRGQIQSVANNLSIIETFG
                     VFVFPLSGTDVSTMEKKLSAVMVADVSCGIRAAAIHQMNRLCDIKHRYSLS"
     gene            377727..378605
                     /locus_tag="ERVG_00402"
     CDS             377727..378605
                     /locus_tag="ERVG_00402"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16275.1"
                     /translation="MGDHNEINVLKRKVTDMEQEIANFPMITQMFLDEQTELQDENRR
                     LHQRLENANREKIAVVNDIARLTHTTCCNHNIVSLMACGIEVSACEEEYAFCQECVDK
                     HITEALENDDKMMIPFKCGRNCTCDMENDSVYTKMAGDRLVALKQKRQELTYKNSLIL
                     RSTCDTIVQRPCCCNPMAHEFENCMAVFCDTCPAGRNYFCGLCFEYVGGYNDTHSHVT
                     NCKHNTQRPRSFYATTSKQKKICELLWMRYHIRKTIGDSAYAESGLDTADSTLLKNTL
                     SLVGLPICKYGLCDAN"
     gene            378646..378912
                     /locus_tag="ERVG_00403"
     CDS             378646..378912
                     /locus_tag="ERVG_00403"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16276.1"
                     /translation="MVCCWDTNRDVVESQTNTKVSDAPIIKFACEYADCHEEFDTQTT
                     LYNHSRAHMDKCRYTCQVCKKIYMYRINLENHECTIQELTSHYS"
     gene            complement(378893..379369)
                     /locus_tag="ERVG_00404"
     CDS             complement(378893..379369)
                     /locus_tag="ERVG_00404"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16277.1"
                     /translation="MVKKIAKQVKGLAKALPDDQIIHKKTIDKHTRKDMEKYAWDVVN
                     KMMTRHSCRYSELLDRRNFPELYKEKIRHIIRTKFNRFLDKNGDFTLHTVDDTNFDFF
                     HSEIKQLYEQWYKDIEADSNIPYTDEQLRVLRKSLCAKLERDIENAHNILVSYNVM"
     gene            complement(379463..380407)
                     /locus_tag="ERVG_00405"
     CDS             complement(379463..380407)
                     /locus_tag="ERVG_00405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16278.1"
                     /translation="MDAHTMTFYTDMLYDMIEFVIDPIDQSNILTKLARIRTGPPVDM
                     IVFDYNLYLTCEIISAVIQPDETWNRVRDLLTMEHDIDEMQRRATKFAYYATRVARAH
                     EAFEPPAKKWRRINVTQKYKRDIANQVVGVKRQAEDEVDQDPKRRAVRAELVEIVKRR
                     VNGKEILPEHTKELDTWPEYIGRNFELSDIYSFILGTDFHICQGTQNVYNRTKSAYEV
                     EMRGNPIVLNTKLGEWGIVEKKIKRSNGNVCTNYEYIFPKCLAQRGLQERGQQVGGVS
                     SRKAAGANCIIFDEIASRIPDLEMAIERAEFAYNSNSH"
     gene            complement(380494..381681)
                     /locus_tag="ERVG_00406"
     CDS             complement(380494..381681)
                     /locus_tag="ERVG_00406"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16279.1"
                     /translation="MSTEQITDQWIINTPAMEVVRTATEYGMSGPDIIALENMLAATG
                     NLVDEYRQAQATSSSVVALAKSQKRMLVQAGNVAKSVRTARRATNGNERRRKEADADA
                     TAVVRYAQGGDRRVEPRIKRSKEKKREVSKMLTGEIDRLTAINSRMHDANYIIPTVDA
                     PGAPGPSSVNETPAQAELRRIDDRIAVVKRQIYDNVKSKRSRADAGLDPSYQVGDDAN
                     PFTMNLVHRRRQRMGLLPAPDGSYFVEFPHLLTMEKPSMDVYLKDYPPGSIKDDVSYA
                     MSISPLQYYLETGVVLPAPMPERSARLQAKIDRAIARRDAGIGGTTVRRSTPSSFGPV
                     YESTPKHNREFYPDQTNINQFHVSKPEQDIEQELDAKLRGVGQTLYNKQDMLSRVQAF
                     DTL"
     gene            381922..382230
                     /locus_tag="ERVG_00407"
     CDS             381922..382230
                     /locus_tag="ERVG_00407"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16280.1"
                     /translation="MRQKRGNWNMTVDANDKSSYAHNFRHKRSHSEPPNNMFTDIMNE
                     PFITWFYKKWYFSDAAGPITSQELLDMYNNKILTDSSTCWRAEMYAPKTIYKITDIVI
                     "
     gene            382317..382796
                     /locus_tag="ERVG_00408"
     CDS             382317..382796
                     /locus_tag="ERVG_00408"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16281.1"
                     /translation="MNSISSLNTDAYINKFTNIVESTDLRVKIYLLYNTMHCKLITSQ
                     RIQQELEMSKIICEVIRDASNGHMLNAEYDDFCKDIDWWYDMAIDALETKKDYSYMLM
                     AMRFTDLLRNKLLHLLVIMFHRVDPVYAQQFSDNIAQNIDPTHILSQSVINFLFSYL"
     gene            complement(382783..383337)
                     /locus_tag="ERVG_00409"
     CDS             complement(382783..383337)
                     /locus_tag="ERVG_00409"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16282.1"
                     /translation="MITVLVIFGIIIVGLWFYMKRTSPHTSVDEDDKKRVKLQERLQS
                     ESTKRELAEHDELAAIQQKIKDVDKPVEPMVSYDAAAYEKTRETDDATRMKNIKEAMG
                     VDDTVHTPTEVKKRSEARNAQLQWQQLSENNDIYDNKGYDKKTGKLTWVFDGDTLDPA
                     RGNGPRYANNDDIFQQELSDFINS"
     gene            complement(383359..383601)
                     /locus_tag="ERVG_00410"
     CDS             complement(383359..383601)
                     /locus_tag="ERVG_00410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16283.1"
                     /translation="MLGAIILSIIAIVVITVAWRRNKKAPEVTASEIKNKTQAYKKRK
                     TAAFQTAIRAHINATSPAVPSDFDRKSSFTPHLLKK"
     gap             383662..383761
                     /estimated_length=unknown
     gene            complement(383946..384239)
                     /locus_tag="ERVG_00411"
     CDS             complement(383946..384239)
                     /locus_tag="ERVG_00411"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16284.1"
                     /translation="MNSLAIVHAINEFLSIDTPTASGHVIINALQTGFRLETELLTFR
                     DSGIVMPAFYTQMSDEIAIKLGEMSAKMRARKTQKRVRNMRRAMVTAGVIRVM"
     gene            384388..384876
                     /locus_tag="ERVG_00412"
     CDS             384388..384876
                     /locus_tag="ERVG_00412"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16285.1"
                     /translation="MTTTVAVPQMPFWMRETPPENVPGILGDDMMYCIMKHVIGNKAK
                     CESKRQALCDNLIGDYELIRNVMQPYFQRFNVTIVALRDENRLDANSIHAANDELLDI
                     SYSFFSEYERLLDFFKTNPDVINDTFNYDAPLAIFQALGNESVSRLESLSEGLFAIYM
                     DY"
     gene            complement(385441..385866)
                     /locus_tag="ERVG_00413"
     CDS             complement(385441..385866)
                     /locus_tag="ERVG_00413"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16286.1"
                     /translation="MLPNQMNQEIIDEIFETHRKRASAYYTNPDLNMSKNNHCGYDFV
                     SEAIPMLTESDTTRALYFADVANRMNVYQDAVLDDLGNNPQDRILDTEARLLADQQKV
                     VTYLSSTRYPELTYRKLTEMGYTNAGDAYRSVVGLYCDM"
     gene            complement(386223..386528)
                     /locus_tag="ERVG_00414"
     CDS             complement(386223..386528)
                     /locus_tag="ERVG_00414"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16287.1"
                     /translation="MAIFKQTFMPLPMLDEDSEMSQNTLDFLERVRGHEKKYRVVVRA
                     CVDSRKKRRALMDTAHIKLSEFTNNAVAIGEHYYETSSEDIDDTLFSLTSAVIEKYG"
     gene            387268..387765
                     /locus_tag="ERVG_00415"
     CDS             387268..387765
                     /locus_tag="ERVG_00415"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16288.1"
                     /translation="MATVGQKRTRAEVGYPLSWLKDKHPIEEPDLEYSLKWFKKHEYD
                     LETSKLQEVSEKVGDAYDTLWETTQEVVKAVGYSVISDIQGEHVFDRIDWRYACDKCV
                     DFGELIDEIYYELTIAMINTKLENADIDPDMVDEMASDLARDIQSSEMSEIDYNRRIQ
                     EMIDA"
     gene            388337..388726
                     /locus_tag="ERVG_00416"
     CDS             388337..388726
                     /locus_tag="ERVG_00416"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16289.1"
                     /translation="MTTASNMNLTGTFVTMPIDETVEKKKNFARDTMLIAHADFRSWV
                     RDMEDYMRDIIISAQSHNEFEYVTRSALNEVFFITNIVTSETDIRYNAADATTDYTDL
                     CEIQSDRIKLMRDTVQSKADEIAISQE"
     gap             389007..389106
                     /estimated_length=unknown
     gene            complement(389190..389807)
                     /locus_tag="ERVG_00417"
     CDS             complement(389190..389807)
                     /locus_tag="ERVG_00417"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16290.1"
                     /translation="MDKYNAATIIQGHFSEFYDPTVKYDNGQQFYKIINDKVQHEVYT
                     LIKNNCEWIMLCDFDPQSDWEKYCPTLSIDGAFNTTEEFANYREGKLSFGTWAYSARH
                     EYTKLVAIEFSIKLLPSWLMWALNTKKSLVTRTMAWRALTRVVTMLFMEKETTSDKYS
                     YVHDISVPVFGCLTIENWTDSEYLHNYVNCEGNAFSALYLLYHNE"
     gene            389880..389952
                     /locus_tag="ERVG_01006"
     tRNA            389880..389952
                     /locus_tag="ERVG_01006"
                     /product="tRNA-Arg"
     gene            complement(390011..390400)
                     /locus_tag="ERVG_00418"
     CDS             complement(390011..390400)
                     /locus_tag="ERVG_00418"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16291.1"
                     /translation="MSGHQSRFPNYSRANVCLAYVVINGKKVYMSDSFLKWSGLVHIE
                     YNEMHVMPCDISRRLLIYHSITSPHGGSFKLNATLRNEPSDMVALNTGVFVKINNHPL
                     SITSRVTHMTDYTTTGFVERLTEILEC"
     gene            complement(390452..391183)
                     /locus_tag="ERVG_00419"
     CDS             complement(390452..391183)
                     /locus_tag="ERVG_00419"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16292.1"
                     /translation="MQTVAVPQMPYNGKRKMIHNDNVMVNPIVVTAERPTKRICAHST
                     SLRAVDVLANTISVIKTTGQLARMNTNSVRVYLKDKLRPAIDEIEHILPDTGGKLEED
                     LNDALKQAWECEKFSVIHIAEETPVPVVATVVESITDVTDCPDDASDTEQDYYEVDVN
                     FDDLCGDLDPFDVDEIADAISEYIETETGMDVKPILVTVTLPDWLHIDIWDDMLRELI
                     TRYTEVDIDHFSSSDDCSVFTIVCM"
     gene            391304..391639
                     /locus_tag="ERVG_00420"
     CDS             391304..391639
                     /locus_tag="ERVG_00420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16293.1"
                     /translation="MSGEDTIKKTITMTLNYDTLIKELGESGDKDSTDIHDLSSQALM
                     DKLDRFVDYRYDKKKYGMHQVNLTIHGVPTGFEPADFCELIKDHCDDISSFTSIEGGF
                     SVSLFLDVN"
     gene            complement(391668..392036)
                     /locus_tag="ERVG_00421"
     CDS             complement(391668..392036)
                     /locus_tag="ERVG_00421"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16294.1"
                     /translation="MVFFSDRNGFSTNDMYAAICKDVNMHLISTTYELKRLDDTTLQL
                     ILPGLSKTMYDLENLIYSVPLEDNELQHYLNNMLLELKLRHQFIVGRIEYIINARNIF
                     SDSFEYTPLGPSVNGIVLGM"
     gene            complement(392039..393307)
                     /locus_tag="ERVG_00422"
     CDS             complement(392039..393307)
                     /locus_tag="ERVG_00422"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16295.1"
                     /translation="MLCSLNSIVGAPSPPPSHPPIWPHQSPPPPSNPPPPLSPPPSLP
                     PPPPSPPPPSPPSLPPWWPNVSPSPPPPTTPSPSPPPPSPPQSPPPPSPPPPSPPPSF
                     PPSVPPPSNPPNVPPSIPSPSPVPSPPPPPSPFAPEPSPPPPMPPPPTPPPPSPSPPP
                     FPPPPWSPDPSPPPPPSPYMPPPSPPQSPPNQPPPPFPPSQPPPVLPPSSPPPFSPPP
                     SPVPSAPPSAPPPTQPPPSPVPSAPPSAPPPTQPPPSPVPSTPPSPQPVSPPPSPEPP
                     LPPPPNVPYPYAPPPGSPPTSPFVEEDSTDMLPYIAVGAGAGGIAVLALCVYVWTKRR
                     TVCSCMYTRPRQRPATHSVQPHQPHHPQHQQHESTLNHTDQTVETGRYAETPPAEFAF
                     DYDAAVAEIDSVYDNAPPPTENPFLGDMSV"
     gene            complement(393330..393632)
                     /locus_tag="ERVG_00423"
     CDS             complement(393330..393632)
                     /locus_tag="ERVG_00423"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16296.1"
                     /translation="MEINKPVASVIMLTIIAVLFIVYSLVTSRNNDNNNNMQHIKNRI
                     SEHILEVDAENRVIRSKIIAMNESSIDNLKKARAKLNKSMRNKSSKGPKRPKRRKR"
     gene            complement(393666..>393990)
                     /locus_tag="ERVG_00424"
     CDS             complement(393666..>393990)
                     /locus_tag="ERVG_00424"
                     /codon_start=2
                     /product="hypothetical protein"
                     /protein_id="AEP16297.1"
                     /translation="VPRAIRSRNDFGADTVNLPENVLSNASVRARMDNPQFAIDRGTT
                     FKTEKMTPIGDLSERIAAHQFSANQTPISTYKHLKLDGNEQRVAAAEYELDRKKILYN
                     INNRA"
     gap             393991..394090
                     /estimated_length=unknown
     gene            <394091..394219
                     /locus_tag="ERVG_00425"
     CDS             <394091..394219
                     /locus_tag="ERVG_00425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16298.1"
                     /translation="SSENMAIMEKLNSDADISSELAHKTRAKLIEMNRILQSMCEE"
     gene            complement(394300..394911)
                     /locus_tag="ERVG_00426"
     CDS             complement(394300..394911)
                     /locus_tag="ERVG_00426"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16299.1"
                     /translation="MTAFLSNLRDNLRNKFNSLSKPKKFLLFLVIVCIVIGVLIAMGV
                     IEPPQVGRPTQMTPTTTPPQTPPTTPTTTPTQGQFVYEFIVNVPAGPIHLNEVTVDGN
                     LLPPGSFVLANAPDRNNTGPDSSLSDGTNSGINYQNSPNAGDLFMTVTLDTRPTKFTM
                     TYSRPTYAPGWIIKENDVAVITENSNRGASPTPVHVQYDYILP"
     gene            395010..395324
                     /locus_tag="ERVG_00427"
     CDS             395010..395324
                     /locus_tag="ERVG_00427"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16300.1"
                     /translation="MTGYATVTATVVEFLNASTVATTEIDREIQIKSDRKKGLQLLGD
                     LIVFKLINDVSPGFVDKLELKVNEKVNELEDAARLCRKMRAHVRRELEDVTAMRVAIS
                     GA"
     gene            395725..395943
                     /locus_tag="ERVG_00428"
     CDS             395725..395943
                     /locus_tag="ERVG_00428"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16301.1"
                     /translation="MPVEHVPTIEELQLINNSLIETMLRINKERDTETARFERVTRQM
                     ESIIRGLKSENARLFKELEPMAFLSQEE"
     gene            395948..397063
                     /locus_tag="ERVG_00429"
     CDS             395948..397063
                     /locus_tag="ERVG_00429"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16302.1"
                     /translation="MDPYFDENLRPAHGTPVIDINDPYTDFLQQFIMAAPTTSDISFP
                     IKQQGPVCYLFSAALCIYYSHLRPKIDKILQGYDPGINQMLLEYAGPALRAEMLNNNR
                     KNTLDTCNTIYHFIHSHVVKFDQLPNWVKMAYRAFLNEQYKLDEDGKNGGYIEIALWT
                     LINSCGIPCMKENLIILDYDELEEEYDSSSNSNNNKYINFGINPYQPVILHLLSEQQT
                     LGVQKYRRDPDAVVTIINLLLNKIVAIGDLIRSYYVEYKDYRISNLALGMMYHSWTHG
                     TDKLHRHCIFVSYTYNNIFVIDGNIGEIMGLEEYIHYMFSNMCYDMFITSLSVLVIPI
                     NHENAVNDFFDEMDTEGEFDEAIGNAFDMLDTDSIFD"
     gene            complement(397089..397511)
                     /locus_tag="ERVG_00430"
     CDS             complement(397089..397511)
                     /locus_tag="ERVG_00430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16303.1"
                     /translation="MAHKRVRDEFSPELANLYKRRREINVEIEALEKNAAKVYYESMQ
                     REVDNIMNGIANIEMNKELDFYYNSYNNSPDATFELMKRGMQQHMLAYEIFDKIPYEK
                     WDKYCEAIYEQCDLLLDSSIEQDEFDGNRWDIIDEANE"
     gene            397672..398199
                     /locus_tag="ERVG_00431"
     CDS             397672..398199
                     /locus_tag="ERVG_00431"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16304.1"
                     /translation="MPAIAKNRKKTTKKTTNPEIVLANLSVEERQANLVKYAIRATSK
                     KFNIKGLRAEGNFERIREDTDPDVVAPHYKITVTINIRAKDPEFKFASASVRNDFETL
                     FRQNVMALGKWMVRPVDRMVITLTGFYDIEYDIPSMNHYFAGRGRFNDTVASIGRSSF
                     TMGNEIASAGGWGIC"
     gene            398436..>398901
                     /locus_tag="ERVG_00432"
     CDS             398436..>398901
                     /locus_tag="ERVG_00432"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16305.1"
                     /translation="MEATKRTIDELRIINDALVQDIKRLKKENADLAPAKITAVSVGT
                     QTDMYPTDPIDNKHAAFINGLGRINQLYSTGFVTKYACVYATTEFQREYEHRRNRETF
                     TVEKINTLCDTMLSIADTITVIQEAGVDVNTYKDEVTSFVEQLTVDSPKHSAA"
     gap             398902..399001
                     /estimated_length=unknown
     gene            complement(399045..400106)
                     /locus_tag="ERVG_00433"
     CDS             complement(399045..400106)
                     /locus_tag="ERVG_00433"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16306.1"
                     /translation="MSKRAVDAILPPELSNKKFKTTHSMEEAVVLAHVRSMLGFSDTV
                     ATIMDILMAGDDAGRFDGRFPIDYHEILNDFYYEYDGGHYHKDNRIEKDITKTKTKLA
                     ERSGNFIVRIRTAGASQFDYTHPRLKVIQVDGTCTEFVHAQYVASAIHELTGVPINLL
                     ARANSQLITDIKIYLSKTADIAWEAVTAFTSNDKLQKTLMMTHGFPARSRVPKFMENL
                     TRVRGYVTTDTEFREFICGGLMPLLHHTPDLLWKCLDTLTTKYHIKSLQTFMCGGVAS
                     LMAADPDKLWECLDKLITKYHIKSLQTFMCGGVASLMAADPDKLWECLDKLITKYHDQ
                     VTPNIHVQWRRVTHGGGSR"
     gene            complement(400188..400541)
                     /locus_tag="ERVG_00434"
     CDS             complement(400188..400541)
                     /locus_tag="ERVG_00434"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16307.1"
                     /translation="MVTQVNALFDKYLLELYEDARKYYDFLDDLNTCDANHPEDSSEF
                     TGPIIQKAIVLRHALEIELVKTNPDQILKFSEQCTAAYTDLYHEIEPESAENVVKSFQ
                     AFYSRCLTWFYKMNN"
     gene            400643..401083
                     /locus_tag="ERVG_00435"
     CDS             400643..401083
                     /locus_tag="ERVG_00435"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16308.1"
                     /translation="MLSRVKNAITKINSLSAPKKLLILLVVAIIIVAVLVALDIIPKE
                     TVFPSSASQVSIPELQPEPEVIYEPEPAEPKPLVYLGSGACVGGQQEIPEGHCDENPE
                     CTAIGRQINGCWHILSGDEPDEDARAKYKWGLFKKTAAGYESLL"
     gene            401153..401737
                     /locus_tag="ERVG_00436"
     CDS             401153..401737
                     /locus_tag="ERVG_00436"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16309.1"
                     /translation="MAIQYITTNGQISGASPRFWRWVQMINLHRGGLPVGHPSPNDDG
                     IVAMHLLAYVAIKYPEQYCPTVVGSVNGRAFGRIDFKKDGDEFYMIYTSARTGEREQV
                     TLMFNGKKYCSIEMMNMVTKIISEPQIVKDGDSKTTIEKDDNVASAFNKYAAYSVPMG
                     SPVGSPSSSPGSCDACYCNSNDMSHVNKHTCGRC"
     gene            401765..402181
                     /locus_tag="ERVG_00437"
     CDS             401765..402181
                     /locus_tag="ERVG_00437"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16310.1"
                     /translation="MLLNFLYCKVYMKMDNKDIAIAVLAILNVVTFAVLIYLMITRNR
                     NTAGGQFGPGYLPDELRTANAAYFTDDMADMVVRHQNELNTIIERDRRRVFPDLQPTW
                     WDIFTGPFSEDLDQAAARQTREIRELQQKNLIARKN"
     gene            402201..402386
                     /locus_tag="ERVG_00438"
     CDS             402201..402386
                     /locus_tag="ERVG_00438"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16311.1"
                     /translation="MTNTTQIRVGDLIQCTVSQNLGHVFIGRVSEINADRYMKLRGFI
                     GQIGVHQVLRVNGVLIK"
     gene            complement(402502..402999)
                     /locus_tag="ERVG_00439"
     CDS             complement(402502..402999)
                     /locus_tag="ERVG_00439"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16312.1"
                     /translation="MLTKLYLSSKFTQSYIAFHGITDAVKVYNNPQKIPSLILSYVIP
                     QASIFITPVHVTHILFSIMSAYHFRHNIRSTAISFLFISVVSIFRLLPIIEVFLLYHS
                     TVHYIEHWDIIKKNKVLFCSASALTYILIEIASIKQLIGIATGHILFNELKIQMHKDT
                     GPGLT"
     gene            complement(403125..403274)
                     /locus_tag="ERVG_00440"
     CDS             complement(403125..403274)
                     /locus_tag="ERVG_00440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16313.1"
                     /translation="MNICLQFVDSYVSGVIDEISGGLFRIRGYDDVWYTGHGIYEVNG
                     VFLFQ"
     gene            complement(403326..403682)
                     /locus_tag="ERVG_00441"
     CDS             complement(403326..403682)
                     /locus_tag="ERVG_00441"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16314.1"
                     /translation="MQFIFFALAHSHAHSHAHHSTTALLMTASRSSSRSPPSPSPPPF
                     PPYSPPSPPSPPLPPSPPMPPPSPPLPPFAPPNVKDHRLFLLFVMVIMVWPCYMFMLG
                     LCDCADAHRQVLPICV"
     gap             403689..403788
                     /estimated_length=unknown
     gene            403820..404176
                     /locus_tag="ERVG_00442"
     CDS             403820..404176
                     /locus_tag="ERVG_00442"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16315.1"
                     /translation="MQFIFFALAHSHAHSHAHHSTTALLMTASRSSSRSPPSPSPPPF
                     PPYSPPSPPSPPLPPSPPMPPPSPPLPPFAPPNVKDHRLFLLFVMVIMVWPCYMFMLG
                     LCDCADAHRQVLPICV"
     gene            complement(404371..404847)
                     /locus_tag="ERVG_00443"
     CDS             complement(404371..404847)
                     /locus_tag="ERVG_00443"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16316.1"
                     /translation="MEFHWPTAFLTAGVLLLLVIVISVAMYLFNKGQAQQNAFTVVDH
                     NAALGPITIGEYMRSHGVRFAPPPNPAAFQTASPVEQSYAIIGNRGIVRPNGTVDFRS
                     HPPPQGADPETFEVIKDFLPEPARFIRGRNRSRPDPEYEYTESGNRFLKKQRTDNY"
     gene            complement(404883..405068)
                     /locus_tag="ERVG_00444"
     CDS             complement(404883..405068)
                     /locus_tag="ERVG_00444"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16317.1"
                     /translation="MTNTTQIRVGDLIQCTVSQNLGHVFIGRVSEINADRYMKLRGFI
                     GQIGVHQVLRVNGVLIK"
     gene            complement(405088..405513)
                     /locus_tag="ERVG_00445"
     CDS             complement(405088..405513)
                     /locus_tag="ERVG_00445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16318.1"
                     /translation="MEGKDIAIEMDKRDIAIAVLAILNVVTFAVLMYLMITRNRNTAG
                     GQFGPGSSPSYYGYLPDELRTANAAYFTDDMADMVVRHQNELNTIAERDRRRVFPDLQ
                     PTWWDIFTGPFSEDLDQAAARQTREVRELQQKNLIARKN"
     gene            complement(405592..406176)
                     /locus_tag="ERVG_00446"
     CDS             complement(405592..406176)
                     /locus_tag="ERVG_00446"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16319.1"
                     /translation="MAIQYITTNGQISGASPRFWRWVQMINLHRGGLSVGHPSPNDDG
                     IVAMHLLAYVAIKYPEQYCPTVVGSVNGRAFGQIDFKKDGDEFYMIYTSARTGEREQV
                     TLMFNGKKYCSIEMMNMVTKIITEPQIVKDGDSKTTIEKDDNVASAFNKYVAYSVPMG
                     SPVGSPPSSPGLCDACYCNSNDMSHVNKHTCKRC"
     gene            complement(406254..406700)
                     /locus_tag="ERVG_00447"
     CDS             complement(406254..406700)
                     /locus_tag="ERVG_00447"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16320.1"
                     /translation="MLSRVQNAIAKINSLSTSKKLLILLVVAIIIVAVLISLDIIPKE
                     TVFPSSISPPIPELQPEPEPEYEQQFKEFESEPLVYLGSGACVGDNQEIPEGHCDENP
                     ECTAIGRQHNGCWHLLKGDAEPDEDARAKYKWGLFKKTAAGYESLL"
     gene            406800..407150
                     /locus_tag="ERVG_00448"
     CDS             406800..407150
                     /locus_tag="ERVG_00448"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16321.1"
                     /translation="MVTQVNALFDKYLLELYEDARKYYDFLDDLNTCDANSENSSEFT
                     GPILQKAIVLRHALEIKLVKTNPDQILKFSEQCTAAYTDLYHEIEPESAENVVKSFQT
                     FYSRCLTWFYKMNN"
     gene            complement(407388..407681)
                     /locus_tag="ERVG_00449"
     CDS             complement(407388..407681)
                     /locus_tag="ERVG_00449"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16322.1"
                     /translation="MNSLAIVHAINEFLSIDTPTASGHVIINALQTGFRLETELLTFR
                     DSGIVMPAFYTQMSDEIAIKLGEMSAKMRARKTQKRVRNMRRAMVTAGVIRVM"
     gap             407684..407783
                     /estimated_length=unknown
     gene            complement(408302..408664)
                     /locus_tag="ERVG_00450"
     CDS             complement(408302..408664)
                     /locus_tag="ERVG_00450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16323.1"
                     /translation="MPASIIQKKYNTKVTARCSSYMTKFNAKFNEILDLNNNASNAST
                     ETLQQHVKNGQRIMNFMVKLHAEIRTMSRVPSRFLVFEKVLSDEHRRSQEIISQCRAI
                     SRAEKAAIKASGCSVLAN"
     gene            complement(409017..409379)
                     /locus_tag="ERVG_00451"
     CDS             complement(409017..409379)
                     /locus_tag="ERVG_00451"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16324.1"
                     /translation="MPASIIQKKYNTKVTARCSSYMTKFNAKFNEISDLNNKAPNAST
                     ETLQQHVKNGQRIMNLIVKLHEDIRYMTRVPVKYLVFQKVLASEYRRSQELISECRAI
                     SRAEKAAIKASGCSVLAN"
     gene            complement(409638..410267)
                     /locus_tag="ERVG_00452"
     CDS             complement(409638..410267)
                     /locus_tag="ERVG_00452"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16325.1"
                     /translation="MAFVDNTFSFEEFDLEDEIGQTPSPVVDEPPSPVVDEPPSPVVD
                     ETVIDETQPAIDETDETMIDETDMPDLVGSLAEKISSNLGPEIEAAVRDATKLLGLLR
                     TKQRAIKKKEKKTAVVQKPRGKYGQGIPTAAQLFAKANRSFAVTWYSNGGRIADFNPA
                     KAQQISKYLAIMWKELPSVSRAEFDDMRNGIIAQKEEAIAAAAGIPIAM"
     gene            complement(410624..410884)
                     /locus_tag="ERVG_00453"
     CDS             complement(410624..410884)
                     /locus_tag="ERVG_00453"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEP16326.1"
                     /translation="MFQYDSKKRDFVKALTKAVRERMEPFMGPTDRLVIQIPGITTPA
                     IEGSARLYAKNAGAPLELAPVVFGKGIRLASDPTSKKLPLPF"
BASE COUNT       121878 a        81627 c        83870 g       122028 t
ORIGIN      
        1 ataaatctta ttgtgtacat ctttgcgaga aatacggata tcatcatcca tacactttac
       61 gatatcatat gtacgacgca gtgtattctt ttgttcgagg taaatcttac gcacattgtt
      121 cttgtactcg agtggcgcga gttcgttctg atcaagtgcg gcacgtgtgg tgtctttgtc
      181 cattgcagta cgagcaacct cgggtggtag atctaggtag atgatatgat tcgcacgggg
      241 tagtccgagg atttcattct cgaacaactc ggtctgtttt gccacgtact cgcgattccg
      301 atattcatgt gcgccctggt gtgcaatgtt ggaaataatg taacggtcca aaatgatgtt
      361 gtatccacgt gtaatccaaa agtttagaat gtgtttcacc gaccaacggt tctgtgcata
      421 taatgaagca aacaaaaatg gatccagatt tttaatatct ccatgtgatc ctgcaagaat
      481 ctcacgaata agcataccgt gctgacgttc attgttggga aaatcaattg tttttactgg
      541 ataatcttct tgttccaggc gacgacggag gagtgttgct tgagtttgtt ttccgcatcc
      601 atcgccgcct tcaataacaa aaatacgtcc acggcgttct ggcttggcaa aaaattcatg
      661 aattttatat ttgtctccca taacgacatg ctcctcgttc catagatgag gtacaggtat
      721 gtcgtcgtga atcataatat acatcggttt ctttagtaca tgaatggcgt atgtcacacg
      781 tgcaatacgg ttataatcat cgttcgtgtc atgatttaca ataatgcatt ctgcgtgttt
      841 catctctgca tgagttagat catacatctt gtataaattt gtataaaact cataatttag
      901 aggatcggga agaatacata cggatttgta tggggtgctg tacatattga tagttatcga
      961 attaacaaca cgttgttaat tgcactcgac tacactaata atataatgat gagtccgtgt
     1021 acatacggaa gaaaaattat gaatacgaca ccttacatta ctatacccca catctattgg
     1081 aaatgttgta ctttgtgata gtatatcgtt tgttaacagt gacatatgat cccagtatac
     1141 cttaccatct tggagatttt tgatttcttg taatgtcata tttttatatt taacgggtgt
     1201 taccgttggt tccgatacga gttgacgtac ccccgcgtgc ataaattgtt caggatcgat
     1261 atcttcatta tctaaaataa tgtgcatcga ctgttcatcg tcacttttat taattacgaa
     1321 ctgttgtacc atcttaaaca ttccaacacg atatagtttt tctggctcag atgaaccaag
     1381 ttcatcatat tttctttttg cactattcat taaatttaga tatagccctt ctggcatttc
     1441 atccttatgt gattcaataa tatccaatgt agtatgtaaa gacatatgta ttacttaacg
     1501 agtattgtat acaacccagg tgacacaaca caaaattaaa caattatttt actagtttat
     1561 gccccgcatg cctcgcactc attattacca gaagtatcta ccgtaaactt gatggcatca
     1621 acggcagggc ggctacggat atagtaactt ccgtataggt ttgtataaaa ctaataattt
     1681 aaaggatcgg ggagaatata tacggatttg tatgaggtgc tatacatatt gatagttatc
     1741 aaatacacaa tacgttgttt attgtttcag tcggtatttc tagtttattt ccattttcaa
     1801 ttatgtcatt gaatgatatg ttgcctgtat aaaaaggttt agtttgtgta aagtaccaag
     1861 ctttcttgtt attgaaaata ggtacaaacg aaggcaaaaa cacatgtgca ccatgaagtc
     1921 cagtatgagc actgtccttc aatataaatt ttccatgttt tttaagttca agtatttcga
     1981 gttcccatat atgtacacat tttaattccg catctatata tgttacacat agtatgtcaa
     2041 aatcaccttc actatatggc tgtcgcattc ttggttgtcc tgaccgtcga cctgcagatc
     2101 gagtagtttg tacaacgaat ccattttgac acaaggaata atttgctgtc ttcatttgta
     2161 ttttttttcg atacaccagt gcgtttgcat atttttaaca cgtcaacaac atctccatgt
     2221 gagtctggaa acttataact aatagatgac tttaaataat agcaatatac tgcaaataaa
     2281 cgaatcagct cattgtttga tttgttattt tcaaaatcga acatgcattt ccccatggtt
     2341 gttttatttc ctccatggat aataatttct ctgatattgt cttgagctgt aaacgttctt
     2401 atgtagtagt tctttgtatg tacagtattc attgatatta taagaccatc acttaaatgt
     2461 gaactaagat attcgtttag tttagatcca tcaactaaaa tgccaaattt aacagatgac
     2521 aagttaatcc acagaatgac aagcatgttt gaatatccct tgcagtgacc aaagcaatac
     2581 atgtctttga tattgttata tacacgtgat gtagttttaa cctgtatggc atacccagta
     2641 tattccatgt tactgaatat aaactggtta ttgcataaaa tattgtgttc ggcctcgttt
     2701 tctgcaagaa aaccatccgc tcgtgtaaat tcatttaata gtttaaatcc aagatgcgaa
     2761 acaacttcgt tttcaagtat agtagtattg ccatatagtg ctttattacg ttgtcgatat
     2821 tccaaattat tcatatttaa tatgtttttt ttatgatata ttttatactt tctgtagtat
     2881 gatgatgcaa tagatgcacg tatgaatcca taaaatgttc ctttaaactt tttgtactta
     2941 tcagtataca aaacagtctt atacccatcg ccgcatttca tcacatacga catgtgttta
     3001 cataaaatac taattacatt atgtggcaaa atttccatac atattcttaa gtttatgccc
     3061 cgcatgcctc gcagtcggta ttttcagaag tatcaatggt gaatttaatc gcatctgcag
     3121 ccgggcgcgt acgaagataa tacataccta tttaaatcat aacatgttaa gatatataat
     3181 gcgtatactg tatgtgataa attgcaaggg cacctgtctt aagaccggat ttccaaccgt
     3241 agaaatgcat ggatgtaagc ttggcagagg ttggctgagt catgaatacg ttaaacgact
     3301 ggctctggca aataaaagca cctcggtccg ccgacatgtc aatgagtgtt cgcatggaaa
     3361 tttcccatac tgttttgtaa atcggcttta aatcttctgg aaatcctgga atgttctgca
     3421 cagaaccatt agcggcgatg atatagttct tcatgttgtc accccacagt ccgcgatcgg
     3481 aaagatcctt gactaggtac ttattaacta ccggaaattc tcctgaaaga acgcgtcgtg
     3541 aataaagatt actagtaaag ggttcgaaac attcgttaaa accaaggatc tgtgcagtag
     3601 aagccgtggg catgggcgct gtaagcaatg agttacgagc accatacttc ttaacgttgg
     3661 aacggagtgt gttccagtcc catcggtcag atggcgtgac attccacata tcaaactgga
     3721 actttccatt ggacagaggc gatccttcat aagtagagta cctccccttg gtctttgcaa
     3781 tgtcacacga agcagtcatg gcggcaaaat acattgtttc aaagatctcc ttatttagaa
     3841 cacgagcgtc aggcgaatca aatgccatct tgagcatcat aaaaacgtca gcgaggccct
     3901 gtacaccaag accaatcggg cgatgacgca tgttagaacg ctcggcttca ggaattggat
     3961 aataattctt gtcgataacc ttatcgagat tacatgtagc atgataggtt acgtcataaa
     4021 gatgctggtg atcaaaagaa ccatctttta caaacgccgg aagcgcgatc gacgcaaggt
     4081 tgcatacggc agtctcgtcg ggagcggtat attcaataat ttcggtgcag aggttgctct
     4141 gctgaattgt accaaggtgc tgctggttgg acttgcggtt gcacgaatct ttgtacaaca
     4201 tatatggggt tcctgtctca atctgcgaat ccatgatggc aaaccatagc ttctgtgcgg
     4261 gaattgtctt acgagccttt ccctccgatt catacttttc gtatagagca acatagtcgt
     4321 caccccatac atcggaaaga cctggacatt cgtgtgggca aaagagtgac caattcttac
     4381 ctgcctccac gcgcttcata aaatggtcag aaacccaaag tgcatagaac agatcacgcg
     4441 cacgcaattc ctcctttccc gtgtttttcc ggagctcaag aaactcaaaa atatcggcat
     4501 gatgaggctc gagatacata gcaaacgccc ctttgcgccg accaccacct atatattaaa
     4561 gaatacatgt gagaatcaat aacatacaaa ctaatatttt ctataaatac cttgatcaac
     4621 atatcgagca gtagagtcaa acaccctaag cattggtact aaaccattcg aatatccacc
     4681 agtaccacta atgtaactgt tctgtgcgcg aacattgtga attgaaacac cgattccacc
     4741 ggcattcttg gaaataagtg cacagttttt aatcgtatca aagataccct caattgaatc
     4801 atccttcatc ttcaaaagga agcaagagga catctgtgga ttctttgtac cagcgttgta
     4861 catcgttgga gtggcatggg taaatttctt ctgacttaga agcttatatg tttcaatagc
     4921 tgcatcaaca tccgggcaat ggataccaat agcaacacgc attaacatat gctgcgggcg
     4981 ttcaacaata tcaccattga tacgagatag gtaggatttc tccatcgtct tatatccgaa
     5041 aatatcatac tcgagatcct tctcgtaatt gatgacgtca tctaaaacta ccgcattaga
     5101 acggatacat tcaataatgt catcggcaat gagtggtgac cactgaccgg tctttgtatt
     5161 gacatagttg tacagacttt ccatgacact ggaaaactta tttgatgtca ttttatgaag
     5221 agacgaaact gcaattcgag cagccagttt ggaataatcg gggtgggtca tggtcagata
     5281 agttgcagtt tctacggcaa gattgtctag ctgaacagtt gtaacaccat catatagacc
     5341 ctgaacaacc ttgatggata caactgccgg atcaacatga tccagtccat agctaaggtt
     5401 cttaagacgc ttcataatct tatcgagctg aaccgactca gatgttccat tgcgcttaat
     5461 gacttccatg atacctatta aaaaaattat gagttaatat ataaatacta aacatataga
     5521 tagaaaatgt gttgttagct caccgatatt ctataaatgt tattgattgc gtgcatgttc
     5581 ctggactgat ttagaaataa cataattagc taaacagata tttccgataa cacaaaatat
     5641 ttcatttata gatgttgcca ttcttaacgt actgtccgtt atcttgatca tttccattat
     5701 taaaaacatt ccccaattta atgagaatat aagaagccac tttccgtttg ttgctggtaa
     5761 cccagtccat atataaatac accacgacag cacggtatgt agtctggaat attgcgtaag
     5821 agtgccgttt atttctatac taaaacttac cgttataaac atgagcatgg atgttatcat
     5881 tctggatgta tttaccgcag atattctcat ctttggtgag atgtttacat atgcaactga
     5941 aaatgcatga tgactcatgc acatatatgc catgttgcaa atatttataa gaattacatg
     6001 taagatcatc acatctacaa gatggaacaa aaacctagct acgaaatata tcaagataca
     6061 atggaccgtt aattgagcac tccttaatgg ggtatgaagt ggaaatacgt ttattagaga
     6121 aaatatcagt acgaacccaa acaaattaag catggggcca aatccccgat ctattacata
     6181 cactgcagat ggatgtatca caattgacat tctttataag attacataca aaataatcag
     6241 atttactatt ttatatccac tataaataaa cgactagaat gtttactgac ctcactaatc
     6301 agatcttaga actcgccggt cttccgccaa ctacgcttgg tgatgaacca cttctactat
     6361 catggaagga tgcacttgat ctagagacat ccggttcatg gaccgccgcg gttctccgca
     6421 ttaccggtta tgacaagaca accggatacc atgcagtcgg gtataccgat atcaatgcac
     6481 tactcccatg cctcaatgca tttgccccat ttccagagga gtttagcgag gaactccttg
     6541 atacactcac ggtccagaag ttttctcgta atccagtggt ctggcgtgca ctaaagagta
     6601 tgacaaagat tgtcacagac acacaggagg actttactgt ccatgttccc gatgttgatg
     6661 aaatccgcac gaacattgct gattttcgcg cgagcaaact cgttgctgct gcaaaaccaa
     6721 atcttgccaa tatcccggag ccagaaatta cagacacgaa tgcttccatc ccaaaagctg
     6781 ttcgtcaggt ctttaccaat ctaatcaagg aagtttccgc ggattccact gcgggtaaga
     6841 agtttgttgc atacaccaag accatgactg gtgaatttat cctagcaaaa ctgcaggagc
     6901 ttcatgctac atacggtgag gatttcgagg aggcgtgtga taactccgat accggatacc
     6961 tctgcgatac cgtcgactgg tcgccactat tccccgacga aaagcgtcgc aattacttcg
     7021 tcaccaagat tgatcaggcc gacgacgagc aactaaaacg tattcgtacc cagctcaatc
     7081 acatgaattc atttacccgc gtacagggcc atctcccaac cggaatgatg tccaagattg
     7141 aagaatacac atcgggtctc ctcactaagc taaaaaataa ggagatgaaa ttcagtgatc
     7201 tcaatattga agaaatcggt cgtgatgtag tcgagtcgag cgccgaggct gatgtggatg
     7261 cgatgggtga gaatatcaac gagctcattc cagtaattca gcgcagtggt ttatttgatc
     7321 agatcatgaa gcagcacatg tcttaatttg atggtgctat tttgtgtcca caaaaatcga
     7381 ataatgcagt aagaaacaat acaccaaata aagaaaatcc agttactaca atagatccta
     7441 ttatttttgc acttccagta ttccatgtat ctagtgtatc taccattact tccactagtg
     7501 cgtctgccca tgttagtact atagatatag caaacgctgt aaataaacta tttctaaata
     7561 ataaaattaa tggatcattt ggattccaat tttttatgta ttcaccagtt gtcattggtg
     7621 cagttggtgc gatcccggaa cgggaggcgg gaggtatcat ttgatattag cgatatatat
     7681 ttatattata tcaatgaatg tgtgaaattg aaaacttggt tagatctaca tgtgaacata
     7741 catccgctac tcgtttggcg cgttcgttcg tttcttttat agtatattta tctattccat
     7801 tatgcgcaat accttcggtc ataattttta atgcaggcat gtatgaatac agtaaattta
     7861 ccaaagtctt gcatgatgat ttcttaccgt gacattccat cgaaattaca tttacatatg
     7921 acaataaacc ttgtttttcc atttcataaa taatagaatg ttcggcacct tcgatgtcca
     7981 tttttaaaat aatatagtca ttcttcgaaa atgatttctt aaaccatgtt acaaagtcaa
     8041 tactccttac tacaaatgat ccaatgccat ttggtggaat agcgcctcct cgaattacct
     8101 gacgcgcatc accacttaaa tgcaaccaac cagttgatgt agacactgca gctggtataa
     8161 atgtatatct atcataatta ttattatatg acgctgtttt ccgcaggcgt gaatcaatta
     8221 atgctgtatc attaaaccgc gggtcattcg ttagtgcatt tagtgcatta cttaatttat
     8281 tccacataca tgaacgcata ttgtccagtg gtttgtttgg gcaattgtaa tacttggcat
     8341 attcagacaa atgcttggat gatccacttc gagggaggca tgtttctggt tcttcatttg
     8401 tttccccatt taaccattta aagtatttat ctgcaaatgg gtgaatcagt ggactggctt
     8461 caaatccata aacatcaaac gacgatcgat tgtcaaactc tttaaacatt cgaatagtgt
     8521 tgcaccaatt tacaccaaga tcaatatata ctgaacgcat tgcataagat cctacaaatt
     8581 gcaggagcat aaaaaacata ttgataactg caagtcgata tcgttgatag ttcgctctaa
     8641 tcttaatttt tatacaatac agtagtttgc atactccatt aaatattatt gatatattta
     8701 taaatgaact ggacacattg gttatctgta tgtaatactc gatgtaattc atggaactat
     8761 tacgttcata tggcacatcg agtacatact tcactccaaa cgtttgatgt taacccaaaa
     8821 tatccatatg atacatacga gccactatgg aattgcaata cacgtgaacg cataccagca
     8881 gcaactgggg atggtgcaaa atttgcatgt ggggtagacg catataatac aaaaaagaat
     8941 gtaaccatat actcaattgg aagcaatggg aatacgatgt ttgaagaagg aatacatgca
     9001 cgtataccac attcaaaaat cataacattt gatccaacat tatcagaaac tgcacgtaag
     9061 aatgtactta aacatagtta tatcacactt aaagaagttg gtatcggttc aggaagacct
     9121 ttttatgcaa aagaacatgc atataataca atggtattaa caacagcatt ttatatacac
     9181 ggcattccaa atattcttaa aattgacatc gaaggctcag aatatggtct atttaatatg
     9241 attacatgca ataagattaa acacgttgat caaattctaa tagaagtaca tggcaagaat
     9301 ccagaaccta tattccaatg gtttgataaa tgcaattttt taatgtttaa caaggaacca
     9361 aatatctggg gatgtcatgg gattttgtgc ggggaatata gttttattaa cgcacatttt
     9421 gcgtacactg tttttaagtt ttttcgttag tagtttatat tttactgtac agatatttgg
     9481 gtataatctg tatgtattat ggattctatt acatttctga cgtttgcatt taatagtatt
     9541 ttttataaat cacatcacgg aatggcatgt ccattatgtg ttgcattgca cactcttagg
     9601 acatatcatc cagatgacaa tataatacta atgcatacac ccgaagtaca ttccaatgag
     9661 ttgaaattat tgaatgacga ctacagtgtt attctgaaaa aagtcagcaa tataccaatg
     9721 ccgcgttcat gcaaaaatgg ttctttacac aaatctaacg tttttatgaa actcaacatg
     9781 tggaaattga ataagtacac taatatattg gcatttgatg cggacgtcat gtttgtaaat
     9841 agagttagtt tatcgccttg caaatacacg tactgtggtt cgccccgagg cgtccagtat
     9901 gtaccgcatt ttttacaaag actgattcca agtaagtaca gatccatcaa tcatggggtt
     9961 gtccagtttt caccgtcaca ttcggtattt cataagctat tgcgtcaact tgctaatctg
    10021 tctgggtgtg gaaatggcga aggttatgaa caacgattat acaaagttgc attggaaaat
    10081 gattataaca acaaaatgcc aatttttact aaagacgtcg gaacgttcag tagtgcgttt
    10141 aattgtagat catttggatc atggactgga tgtggtatgg cagatctaca aaaaacaacg
    10201 atatatcact ggtcaagtgg gtcaggtaaa ccatggttgt cattacataa tcggtatgaa
    10261 gataatatgt ggcataaaat acacaaaata gttttggtta aaattagcat atagtttgct
    10321 actttcttgt aactgtgcat atgttttgca tcattacact ctcatatcta acagcatgca
    10381 ataatatgtt tctagattta ggggcaaatg ttggagtgaa tgcattattt ttatatgcaa
    10441 acaatagcta ttttcataaa agcaaaggca tgagaccgct tatggataaa gtattcggac
    10501 aatcacgtaa agatgtttgt tacagaggat tcgaaccaaa tccgttacat agaaaaagac
    10561 tagagagttt cgaaaacatg cataagaaat acaacattaa gttttttcca tatgcagttg
    10621 gcgtaaaaaa tacaactgaa acattctaca aaaaacatga tacatatacg aatatggtcg
    10681 gatttggcaa aacgtataga ctgggttata ctccgtacaa tgttagtgtt attaacattg
    10741 caaactacat aacgaacaat ttacacaaac aagctacggt attcgtaaag atggatattg
    10801 aaggttatga gtacgaagtg ttattctatc taattacaca aggaatacta tgcgagttcg
    10861 tcgattatct atcgattgag ttccatgcaa ggtattgtaa cggaccactt tgtaaacttg
    10921 aaagtgatat taaacatata ctagctcatt taaagtatat gaaatgtaat actgtcgtta
    10981 agtttatgga cgacgaaaca tatcttcgta ttacagagaa agactacaac atactaaatt
    11041 aaggatgttg tcatgtacaa caattaacgt atatatacta accatatgtg tctcacatac
    11101 tacagcatca ttaactacat ttgattactg ctcgcagttt atatcactgg tagaagatcg
    11161 tatttggagg gccgattttt ggaattcagt taaaataaat accaccaata tacttaaaac
    11221 ttcctccatt gtatctgcta gcaatggtag aatcaacaca aacaacactc ttgaaataag
    11281 cttacgtaat caaggaaaat ggaatggtac gttccatatt gaacttatca cagatcaacc
    11341 cgagaatgct ttttatagtt cgcgaaaagc aaaactctcg tcatttgata caatgttttc
    11401 actggggttt tctcgagtat tgtacgttga tggagacatt attgtattga aatcaataat
    11461 ggactcaaca ttggctccat atttagacac atcgtcgggt atatgggaca aaaaatgcga
    11521 tatttacgta caaagaccgt cttcttctcc ttatattttg aatggcggtg ttattattgg
    11581 tgacaaaaaa agatccaaac atatcataca taaatggatg caacagacgt tatctggaaa
    11641 gtttacaacc gatcaagacg catttaaaca cattggactt gtagatggaa tgaaaaaaac
    11701 tagacgagaa aataatcaat ctacatactg ctatttacca aatgatgttg ggtacgtaaa
    11761 ttcgtttaac tcaaaatttg gtaaaatgtc gatttttggt gaaaatatgt gtacatttct
    11821 tcactttaag ggtactcgtc aaaagaaaat tcttgaaaaa gcgtgtgtaa aacgagaatg
    11881 gccatgtaat atgtattctt aatatgaagt tgaaaacttg ttgttgttaa cattcgggtg
    11941 agtactccaa tcgtaatgta tatgtcttta ctttttatgc aactctcagc tgcaaattac
    12001 acaaatgttg caatatgtgt cataggggca cctcgtacat tatcacatac agcaaataat
    12061 atagcaaaat catttgcaca aactaaagta cgttctgatt atttcatatt attgcgcaaa
    12121 acacagtatt cagaacacaa ttctaaagaa caaatatcac attatgacaa actttcgtgg
    12181 ctcgaattgt cgcgtgctat tgcgcaccta acaccattaa tttccatcag aaatagcagt
    12241 acaaaatttt ccataaatcc gaattgcgaa ttgccgcgtg atgcaatgaa actatgtgac
    12301 aaaacgaatc aaccatcata ccaaagattg tgggaaacaa tgattgggtt tacggaatgt
    12361 tttgctgatt taaagaaaca tgaatataaa ataaaaaaac aatatactac aataatacga
    12421 ctacgaccag atacattttt ctacgataca attaatccaa tgttattgtc ccccactgtc
    12481 ccaatatttc cgtatggcca tatcagctgt acaagcacaa aaaatgatca tgtgtgtgtc
    12541 aatgatcata ttgcatttct tccgcgtatc tttgccgaca gatatctaga aatggcagat
    12601 cgttatacac actgcaacac aaagaatgat acaatagatc aacataaatt ttggaaacag
    12661 tatgtatcaa ataaatggac acttgcccgt acgattgtgt tggagatgat gactacacca
    12721 aaaataacat ggagacgtga aaaggtacca tatattattt tacggtcaag taatccaccg
    12781 tttttatcat gtaaacgtgc cgcgataaca catgaatatg ttacatctaa taattggaat
    12841 acgtcagaat gtattaagtg tgtaaagtac ataagaacat actttcataa tgcatctaca
    12901 gatgggtata ccaaaatatg tagcactata actggtgttg tttaatacta aaattgcatg
    12961 aacaaattat tttaacaaca attaagtttt ctatacatgt actgcgaaac tattttatac
    13021 ccatactatt aaagcatgtc ataccaagcc agtgttgaat ccgatctcca gggcggggat
    13081 ctcggagaag tctatgctag caatacaatc gatcacatga cacacagaga gattgattcc
    13141 gagattaaaa acagtgacgg acatgtcgtg ggacatactg tacgaaatgc atttccagat
    13201 gcaaacgccg actattcaaa taagcaaatt ggggcaaatc gtctaatcac tcacctaggt
    13261 cataatccgt atgagacacg aacccgtaga gaaaccatga atgacatgcc agaacgtggc
    13321 ccagatgaac tcaaggtgca gcggtcactt gctactcgta acgcaagtaa tgctcatcgt
    13381 aataacatcc agatgcacca aggtggaaat gtcctcggtg aaaagatcat ggacagtggt
    13441 caccaatctt acaatatggg cggccaggat cgcagagatt acaaggaccg ggtatatgtg
    13501 gcgccaatta ttcgcaaggc tggtgttgca aaaccaattg atgtaaatcc aagttctcat
    13561 gttaacccag tttcgcaaca gtctagattg ggacacatta cagtaggtaa tcgcaccgag
    13621 accccacaga tgcgtgctgt cgcgcgctcc gccaaagatg ccacggaaaa gaattatatg
    13681 ggaagtatcc gtgttcctga tattaactcg aaacgcgcac agaccacatt gtctgatcac
    13741 aacgtaaaaa atgacgttac attggaagcg cgacgtcaga gtgattacac ccacgagggt
    13801 gtagtaaacc gccatcatga tgtttcatat ctaccatcag ttcgcaatat ggacgaaaat
    13861 ccagtgaatg gtacatttga tgtacgtaat acatctcacg aacgcgttga taatctacca
    13921 ccagagtatg attatgcaaa cataaattcc cgcaatgcac gtgaatcgat ggcaccaggt
    13981 ggcatgaact ttacatcggg cgagacccgt cccacaccaa atcgtgctga ttatgaagac
    14041 aacaagacca catttatcaa gcgcagtgag ctcgaaaagg caaacccagt tggtattaac
    14101 gataagaaga cagtcaagaa aacaccaggc ggtgctcgtt cttacacgtt cgaggcgatc
    14161 gttcacgacc gtgccccagg tacaatcaca aatccaggcc aggacgattc acttcattca
    14221 tacattaatg gaccaaccaa tgtggataac cgatcgctta atatccacaa ccggttcaat
    14281 tatgacgtca aacagtcggt tgctggtcgt cgcatgattg ttccaactgc tacacttggt
    14341 aagcaagaaa agtggagaaa gcaggtttat gaaccaaccc ccgggaataa tacagttcgt
    14401 ccagcaccag cgaattatac gaatcgtatg attggaccag attagaccgt tttataaaaa
    14461 tattatactt agtataaaga acaatgttag aaggcattgc accaatcgtg gtacttttaa
    14521 ttggcacagc cgctggaatg ggaacatgtc tagttactat gctatgtttt tatctatcgt
    14581 gctgtggtag aatactatgc agttcatgta gctgcataaa aaattgtgtg gaccgtgatg
    14641 gtcaaaaccg ggtttaaata tacactattt tttacgcatt gttttcaaga acggcaccgg
    14701 atgcatttga cgcaacattc tcatcaatct gcgcaagaag ttcatctggt gacatgtcac
    14761 gattcatgag gtcattgagg cgcttgtcgc gataagtacg tggtgcaaac tttgtatctg
    14821 tcactggaaa cacccactca ccagagtcca ccacgtaaat attatgatca agtacgttac
    14881 gcgacgcgac gttacgaaca tagccatctg cctccgcttc atcacggcat gtgcgataaa
    14941 tataaaacag aaattcgggt acatcttcga ccggatcatc attgattata gaaatacaat
    15001 agacagactg attgattggg atacaatcag atgttaatac agggaggtta ttctcgacaa
    15061 tctcttcaat tacgggctca gttggagtcg cgtcctccat tttttcggca gtaattggct
    15121 tttcatcctt gataattgta gcattacgca gctcttcttg atgctgttta aaccgcgctt
    15181 cgcgtacaga gttttcaaca tcggcacgtt tcatgagttt ctcggtcttt gtcttgatat
    15241 agtccgcatc ctgtagatag ttcatattgc ttgcagcaag agtccaacta tgtgtctcac
    15301 aaataccaag atgacaagtt gggtcgactg tcatgattat cttaccataa tgagcagcgg
    15361 cagcagcgga tccaaatgta ccatagatac gaattcctgg atttgttggg tccgtcgcaa
    15421 tcggcgggac acccacatga ctgatactaa atagaacgtg tgtttgtttc gtatccttga
    15481 atggtagcct ggaccctgat ccagacgttt tttcaaaatt acgagaaatc atagaattat
    15541 cggatagctc agcagagaag tctgtcattt cgttgtttat ctaacggatc taaaaaatac
    15601 aatctgataa caatttaaaa tgctctattt agcaacactt tggatagcta caaacgaaat
    15661 aacgccaaag acgattgtaa acactccaac tctcatcata tcaagtggcg ggtcttcata
    15721 tctggataca tttgctccga gtacaaatga cgggcgtagt gttacaagtg tgacaagtac
    15781 aactaccata ccaactaaaa tagcaatgta tgaatctttt gcggcataca tagcacgctt
    15841 caaatatcca gggacactgt tcttttctga aattttttga ctaattatac cattccaaat
    15901 cgaccaccca ccgccctctg ctcggtccca attggaaatc tgcggtgcgt ctttaactgg
    15961 taatgcagaa gatgcaaccg tggacgcgac atctgtacgt ttatcttctt ttgcattttc
    16021 ttcaaaaaca gagggtggtg catttgataa tgcgacaaca gagtgatcag gcgaagatgt
    16081 ttctggggga gccgatggtg catatgaagt tgcagatttc ttactcttta ctgacgtggc
    16141 agttgaatat gcagtactct ttcctccttt tgatattttg gtggatgcac tactgattgc
    16201 actagatttg gctgttttag cctttgatac ttttgatacc tttgatacct ttgatggttt
    16261 tgatacagaa gtagatgcag atttagacat gctcgtagac acaccagaat cactatactc
    16321 gtccgatcca taacttccag acgacgagct ctcacttggt gggcgtttct tgcccatgtt
    16381 tgcttcttta tatatcgcat atatttttta aagtcaagtt attatatgtg acatagtgaa
    16441 agcaaatgca atactctaca tttttcattt ttacttacat atttccaata accttattat
    16501 ttaacctatt ttgtgtgtat ggtctaccgt ctatactaca gtttttcaca tcatttgcgt
    16561 taataatggt attaaccgga acagcaatga gtgcgacatt acataggtat ttctcgcatt
    16621 ccgcatataa aacaagcaga ttatttcaat gcgtacttgg attgttttca acattggcat
    16681 atcagggtgg cccgatttgg tgggcaagta aacatagaag acatcataaa cattgtgaca
    16741 acccacatga tccacatagt gtggtgcaaa ctaatttctt ttattcattt gttggatgga
    16801 ctattatgaa aaaagaacaa tcgatagaca ccgagtttgt ccagaaattc atgacatttc
    16861 cagagttggt ccttatcgat cgtttttggt atatgatccc atggacaatc tggacaattt
    16921 cttacatgta tattggatca tatactacat gtgtattatt tgttgcgcca atgttgggtt
    16981 gtagatttat tacattatta tttaatgttg aataccatac tcctaatcgt cattcaatcc
    17041 ccggaaaatg tctggcattg gatactgcta gatttctagg agattgtgtt ggagaaagtg
    17101 gacatgctag acatcacatt catccatccg aactagcaag gccatcgctg ggtataccat
    17161 actttgacct accatattat atatatctaa aaccacttat atacactggt ttaatttggt
    17221 aagtaagtta ctttttctca tcgggtggct gactcttgct aatattagca aaaataccac
    17281 caatgagctt cttcatggcg tcttcctttg tagtcttacc ggaaagaatg tcatcgtgtg
    17341 cagcgaataa attacagagt gcctgtgtct gcataccgcc gcctgccatc ttggcaagag
    17401 ttgggtgata ttttttgaac tctttaattt cgtcgtcatc ctcctcacca ttacgaatac
    17461 gttccatgca cgcatcaatc ttgtcacgtg gccatggggt aaattctaaa gaaaatgtat
    17521 tttcataaac acgagcccct tccttttttg ccttcttcat aagttcttct ggacgcatct
    17581 gaacaagttc agtcttgaca tctgggttat caagggggtt cattgttagt gtctttctat
    17641 agtataaata taattctaaa tctgattaat tttatattgt gaatataaag tatttatgga
    17701 acagcaggca attgacaatc atagaatcac cgtattggaa gaacgagtaa aagcacttga
    17761 gactctaata agaagtcgcc ttggtgccac attaaacact gcagttgaaa caagcggtct
    17821 ccactggatt catgtaggtg cagatgaagt aaatgaagat ataattgaag caatcacaag
    17881 catgtatatt ggtcgtaatt tcgaaggttt tcgcgatcat gttcaaggac aattccccgc
    17941 atcagtttta ctgctaggag aaaacggaaa cgttagtcgc cccgctgcgg caattatcat
    18001 taaaaagcat ccatgtggta atcatataaa gttgaatatc cacaaacacc ggtcactcgt
    18061 aacatctcac attgcaccaa aatatattga actcctcaca ggtgatactc cacattttac
    18121 cgagattagt tctggtacac ttgaagatgc aattcgtgac tcaggcgtta acaatgtcac
    18181 agatccaaac actgtaacat ttattgccca gataggtagc tctcgtattg tacttgacgc
    18241 agcagacagt aaatgtagaa tgcatcctct tgccaatggt gaaccatgtc cagtcgggtc
    18301 gtatattaca cagagcggaa aacgtatggc tctatatgga actccaagag ttctataaat
    18361 aatttataaa cagtatatta aatatggaca gttcacaaat attatattca cttgtagtga
    18421 acataataaa actggcaata atggtatttg tcttttatat cgtgaagaat caatttgagc
    18481 tacaaacggg aaaaacatta acttgggaca tgattttagg caaagagcca atgtttgata
    18541 caaagggtga cggttgttca gaatctattg aatccggtgc aactgttgta aaacgtactc
    18601 agcggtttca tgatacggaa catggcaatg gtctattgtg ttttacagat gatggaattt
    18661 tgaaaaaatc acaaactggc gaagttatac acacaacaag taagcaggag tttactgtga
    18721 acgaatacaa tgatcttatt gttgaaaaca aatcatttta atgtttcgcg tgattcgcca
    18781 aacgtgccgc ttcgagtgaa ccaaccttta cacccgcttc aaacgctgtt acgtgattgg
    18841 ttaaaccatg atatgtacgt ttggatgctt tttttcgttc aaaactaatt cctacatact
    18901 gttcaaaatc tttaaatgta cgcgctgtac caacggttgc agttttggac atggaacgtt
    18961 tacttgaatg tgcccaatta gaatcttctg gacgagaggc ccatgccata gtaattggaa
    19021 gggaataaaa gttaaatccg tttgtccata gttttatggt atttaatgta atatccatat
    19081 catcagatga gataatattg ccatctacaa attcagtgta tgctggggcc ggggcaaaac
    19141 tgagagccgg cgaccaaaag atgctgggaa ctggatcttc tggaacttca tgaactgctg
    19201 atgatcctat aaccattttt ccacctttta atgcatccag tttaaaatat gtcgggcgga
    19261 tatttgattg catatttttt ggcattactg cacttgtaaa tatagtatga cgatttttga
    19321 ttggttttat catgtcgatg agaatcttgt cccaatcctt gcatatttct gcattgctct
    19381 gcaatgtcat cacataccgt tccccacgat agagatgttt cattaaatac gcgcgcgcgt
    19441 cagacgcaga cgaatgtttt gattgtatgg ttttcatatt tcgcgcaact cgtacacttg
    19501 gttgtaactg taccggcagc tgatttttta gatgatcatt catgtcatat gcagccacca
    19561 taacacgaga tggttcatat gcgttattat acagtccctc tattgtattc aatatgggtg
    19621 gttttgttgt tgttgcaatc gcggtatccc gattcgcagg agacacaacc aataccagta
    19681 ttgtatcgtc taaatcaact ggatttacca catgattgtt tcgatcgtta atagaccgga
    19741 tgtgatacaa acaaacacag ataatagacg ctattaatac accaattgct agtcgaaact
    19801 gtttccgatc aatgtccttt tcagtctctt tgtcggtctc tgtttgttgt ggcttatcca
    19861 tttatatatt ccatatatta aaatgaaaga catagaacga cgtttacttg cagcacaacg
    19921 atcactaatg tttgccgaag cagaagccgg tgattttata gtacttcaca gtgagctgga
    19981 tccacggcgg tcaattccca aatttaggaa atgcggaacc atacttaaaa agaatgatac
    20041 aatgctttac ataaaaccag atggtaatga cgaactgttt agtataaaaa agaatgatgc
    20101 aaaggcgcca tcatttgatc tgccacgatt tcatcggttc gataagacgg accaatctac
    20161 tcatatcata aaaacaacca atgttacata tattattaca gtattggcga ctggagcggt
    20221 tacaattcgt gataatatgc acaaaattat tttggaatta cattcgctga ctgcattacc
    20281 aattggaaca caggcgatat tgtttcaact tgatgaaaaa atatatattt caatctcaga
    20341 caagatccaa atattcaaga cacacatcac tgatgtgtca atccaagatg acattgtttc
    20401 atataaagca tccgataatt cagactggtg cacggattcg atcatattgc atgattccaa
    20461 agatggtgat atcactgaag atgtacaaag gtttatgtat aaaaccataa agaagttagc
    20521 cccacaccga cgctagtcct ggggtggcct tgcaactgtt ataagaaggt accccctgtg
    20581 tatgtagatc attggtgatt ttattaatct tatctcgtag catgacagca cttggcgcat
    20641 tttcagcatg tgaaatatca cgggtcattg cagtcgttcc ttttgacgac gaattatatg
    20701 ttactttttt agccgccttt tgaacagcac cattccatgt ctgacggacg gtgatatatt
    20761 ccatgcatat acaagttaat atatacaaag tataaaaata tatgtcatta aagtaaacaa
    20821 gtgttctatg tttcggaaca gaaggggaaa tttaccattt caaatcgcag gcattgagat
    20881 gtatatctac ccggtagatg atgacgcaat caagtttcat gatttacaag aaggtgatat
    20941 tattgcaatg gaaggcaagc gtgttaccag ttttgtgatt gcagcagcgt ccggtaaagt
    21001 ttcccatgtt ggccaaatga tgaaattggg aggaaagcta tggcttgtgg aaagtgttga
    21061 taatattaat tcgagtatta caaggtggga taatgaagga tgttgtcccg ttcgttcggg
    21121 tgtatctgca tctgcattac caacactcat gtttttgtat aaacgaagcg gtgtatatcg
    21181 cccaacacct gctcttactg aaaaagaact tgatattatg cgtacggaat tcttaaaatt
    21241 atatggaaat ccatatgaaa caaacttatt gatgtttctt aatgcattta ctggcatgcc
    21301 tacattgtgg aagcgtaaga atttctactg ttcacaatta actgcatatt tatttagaaa
    21361 agcaggtagg cttaactcac aatataattt aattcggtac aaaacaggga actatcggcc
    21421 aaacgacctt gttaattcta taaaatgtaa ctacaagggg aaactgccag gtacaaaacc
    21481 catcgtattt aaacgtcatg ttcacaccga cgaacctacg acatcttaat gtactcatct
    21541 ggttttgatt gaacatttgc agcaatctca tcgtgccatg gattttttag cgacgatacg
    21601 ggaactgccg ggttaaatct gtttataata tgcgcgtcac gttccatgga tgattctgct
    21661 gcgcgttggg acatactttt tagttctgct gcacctactt gcgtcgaaga cggtaccata
    21721 accgcatttt cgtcgtcctt gcttacaatt tctaattttt tggcctcttg aacattttca
    21781 acggggatca ttacagattc ggtagttggt cccgatggtg ttgggtcatc aagtacaacc
    21841 acactatgtg taaccgtttt ggtggaatcc actttggtca tgccatgctc ggccatgaaa
    21901 cgcataacac gctcctcaca acttggccaa ataaatagtc gtacaattag atatacgaga
    21961 tatgcaataa gcataccggt taggaaagaa tcactgtcca tatcttttat atatattgat
    22021 acaaaaaata atgtatgata atatacctaa ttgtcatgac ggtccatttt ttgctgatct
    22081 gcctttactg catttgcaaa cgcagccctg gatgctggga tcgacatccc agggtttgag
    22141 gtaggttcct cttcttgttg tgcacaacat ccgcatgggc acccacaact aaaacatcca
    22201 cataaattta acgagcacgc gaatccaaaa cccattttat ttattgcgat acaaaaaatt
    22261 atgatatatc aagttattca ataatttatt tatttagtta ttacggcgcc gaccataaat
    22321 agacgcaaat attccacgag agactggcag gtagctgcga ccagtcttag atgatatgat
    22381 catccgtgta tcagtattga tggtttccgt ttttactaca accggagatg tgagtggggc
    22441 ggaaatctcc tcatcttccg ttacttcaat ggggacagaa acacgtgggg atgtctctaa
    22501 cttttcaaca cgttcaagaa tctcacgaaa cttatcattc agatccgcaa tagaatatgg
    22561 agcaggcggt ggggacgatg gtttatcagt atcgtctacg gttggatccg tagacgagtt
    22621 gttatcggct ccggcggacg attcttctgg gatagtatca gttggctgat ctactggtgt
    22681 atcgattggt tgttcctcac caagtgctgc acttgcacgc tttagccatg ctggctcgga
    22741 aattggcgcg gttcgtacgg tacccgggga atccgggcga tctgggaggg gtgatgatgt
    22801 tccagacata attaatagtt cgttctttac tttatactat aaatataaaa aattaaaccc
    22861 ggtaatacaa gcagtcacgt cccatatttt cggtataatc tataatctat tcaaaacgca
    22921 tttcccctgg gaaaatgcca ctgtatgcat caaccgaacg attcgcaaca cgcgaatcac
    22981 ttactggacg atcatccgat gggatgataa acgcctgtgc aaggcgccac ccaacaccaa
    23041 gtgctggatc cttgcgtgcc caaacaccaa catcttcgag aatggcgata atcttggcgt
    23101 tacgaagctg gccatttcca ccatcctgtg gggataggag atcggtagtt gtaatattct
    23161 tccaggtata accggtatcg tccttgccag tcgccatgcg aagggtaggg gcatttggga
    23221 gaccagttgg gacaaccttt acgcgcatga aatgatagtc atgttgacgc tgtagacgaa
    23281 gggacgcttg ggtaacaaag ataatgttgt cacgtgtgat ttcttccgcg ttgtcatcga
    23341 accatacctt ttcctttgca acatctgcaa tattgttatg gagttcgccg aaaaacttct
    23401 tatagtcatc cacatcgtga ttgattcgga tgtccattgt gtatgtaagt ggtccaagat
    23461 cacctgggtt tttaatagcc tgttcaacct tggcaagaaa ttcttgggca gtcgtcggct
    23521 ttccgccttg accaaatggt gtgtttaggt accatgggac agttgcccac ttttcgtatg
    23581 aaccgatacg aagtgcgata cccggattaa tgtatacttt tgtgacggcc tttttgttcc
    23641 aatcaaaatc ggaaaacttg acctcggatg gcttggttgt agtgaaatca taagttgtgg
    23701 aagacatatg tatagctgtt atgtatttgt gtagtgttta tatagagata tcgagttgta
    23761 tatgtggcca gaagcaggag ctcccaaata ggttatacta tatgcattac aaaataacaa
    23821 tctgacaact tataaactat tatgactgtt atgactatta taaaacttat tgtgccgcat
    23881 tggcttttcc tattcttgac tttagtacac gctcaagtac atcatcacgc ggtgcctttg
    23941 cgtaatatgt ttgaagtaga ccagcggcag ttgtaagtac cccaaagatt atttgattcc
    24001 gggcctcttt tcgttgcaac acaacctgtc tatatgaatt atatgcataa aacgaaccaa
    24061 caagtaacat acataagaat aagaaagtat tcacatatgg caaatattct tccattttgt
    24121 atacaaatga tatgtctatt cagcagttga cttcggcatg gtcatcttct cgggcatatc
    24181 acctggccaa tcccattcca tctcgttata aattttcttc ataactgcat cctgtggtgg
    24241 gatctttcca gtacctgaaa gaagtgacaa tgttggtaat aaatcatcgg cacccattag
    24301 ttcataaatc cgataaatgc aataactata tgataaaaag ttcttacgat cagctggcat
    24361 gtatttatta aatggctctt gaatggcaat aaagattaat ccagcaagct gatccatttc
    24421 cgacgttagt cgtggcggag gtacgccggt acacttcatt gtaatctgag ccgtgtagcg
    24481 atatgtcttt gacttcattt tattcttctt gagtatatca agtacaatat gctgatccac
    24541 ctcatctgga tgtacattac gaatagcaag tccttccatc acttttttaa ttacatcatc
    24601 gggcaccaca tatgtttctt ttgcttgtgt acgtataagc cattctgtaa aatgattaga
    24661 tcgtttgtat gaaaatgact ggttaaatac tacttcgtct ccaaatgata cagcggatgc
    24721 cgtcgcatct aacacagcgg ccgaatatcc acattcttgg caattaagca gtgaacgagc
    24781 agcttgcatc aacacgggac caccgcattt aatacacttg gaatcatcat tgttaatttt
    24841 tacaataggg gcgactccat taacgattgc gttatattca tgtgttaatt tgtgtttatc
    24901 tggacaggta tcaattgctg tagtcgttgt gctgtgttta ggttttttat ttgcaattgc
    24961 aatggccgta tccattctat tttggctaat agtatacttt gaagttagta gctcaagtcg
    25021 ttctacgtat atatcatttt ttattttata tacttcatct actaattgtt tacgtgtatt
    25081 tgttataact ttccgtttta atatattgaa tctgtcgttt gatagttttg atagttcatg
    25141 gtcaatgtca ccaatctttt gattaatatc gtcaatagaa ttgctcatat actttacgtc
    25201 attttctgct ttctcaatta cagacgaaag agttactact tccaccggtt gacgagtacg
    25261 cttaattggc atagaactgg tatactatat atgtggaaaa aactataaat ctgattgtga
    25321 tataaaaata ttttatgtat ataaagatca aatgggacga acaaaaaagc gtattggtaa
    25381 acgcaataat cttaatgatc ggttttataa atccaagggc ttgtttgaca atcttaaatc
    25441 aaccgctgca atcatggaag catcggtgga agaatcagtc gaacaactca aggaggtaag
    25501 tatacagatt gataaggtta atcgtgttgg tcacatgaca atctatggag tggatacacc
    25561 gtttcgcatt gggaagaaac ttggtgaagg ttcatttggg gcagtttatg aactatccgg
    25621 ttcactcgat ggaactgtat taaaagtagt tggttatgat ccacgtgatc cagacaatgc
    25681 tagttatgaa gactgggtta tacgcattgt atctgaagca gcactcacac gaatttttag
    25741 tgcagtaaag gctggaccaa ctacgccacc gatatcactg ggtatgtctc ctgataaaaa
    25801 agtagcatac ttctttatgg aaagcatggc tgggtctgga tttgatttaa tggaagcaat
    25861 tctatacaat ggtgatttta ataaatttaa aagtacactt acaaaacaaa taagacatca
    25921 tattacagta gcggtcaagc tcggaattgt ttgcaccgac atgaaacccg ataatatgct
    25981 ttatcgtatc acagataaac acaaactcaa gattgttctt gctgatttcg atagtctgtt
    26041 ttgctgtgct cttgcagaat catatgcaag aaagcattta catggtgtaa aaatggcagt
    26101 tccggaccgc aaaaacgatg gtcattggac aaatattaac ggtacacttc tacatgatcg
    26161 cattcccgaa acgggcgcac catgtccaac caaacgaaac aaatacacac gacaaattat
    26221 caaggtaaca cttggtttga ttggatctat gatgaatcta tttccagagg agcgtagata
    26281 tactcgtaaa tatcttggtg atcgtcgcaa tcgcggtgaa tatgtcttcg atctgtttaa
    26341 aattagatgg gatcactaca aaccactttt cattgtgtaa actttttaat tggagaatat
    26401 gaataccgat gcacaaatgg aattggtcca tttttttcaa ttgcagccat gtgtgcctgt
    26461 gtaccatatc ccatgtgatt ctcaaaccca tattctggat aagtcttact tagctcctcc
    26521 atatataggt cacgagaaac ctttgcaatt acagatgcac atgaaattga atacattcga
    26581 gaatctccct tgataaatgt ctgaatctct gatgtatcta caaacatctt tggggtcttg
    26641 tcgccgtcaa caagtgaaag gttagcaccg gactcattaa taacatttcc catcgctttc
    26701 attgttgcct tcaggatgtt aatatcatca atctcatatg gttcaatgaa gctagaataa
    26761 catttgatat ttgaattaag tgtcagatat tcaaatgctt ccatacgttg cttttctgtc
    26821 atctttttac tatctttgat tagtggatga attggctcat tttctggcac aaagcatgcg
    26881 ccagccacaa ctggtcccgc aagacagcca cgaccagctt catcaactcc aactacaata
    26941 ttatcaccga aactaccgaa tgtgttacat atagttagaa gttcttcatc acggttcatg
    27001 gtataactcg agttgtacaa caattaagga gtgtgtgaga tatcttacat gtgaattaat
    27061 tttgttcata tatagtaaat gccgggacta aaaccaacac gtggaaaaaa ctcacttgga
    27121 tattattcat cctcaagtga cgatgatgac agctccgtta ctatacgcaa aaaaatcctt
    27181 cccgttgata aagtagatct aaattcttat atgggaaaat ggtatcaggt atatacatca
    27241 ctatcgccat tacttacgtt tgaacttggt ggaagaaaca caactgcggt gtatactaaa
    27301 acagatagac ccgacgttat tgcagtttta aatcgcaatg aaccatccta tttaccagca
    27361 caggagattc gtgggtgggc gcgcgcgtct gggaatcgcc ctggtgtatt tcacgtaacg
    27421 cttggtgcag gtgcagcatc tgatgccgag catgcagtat tccgtgcgcc aggtaactat
    27481 tggatcgttg cgcttgggcc aaaagatggt aatttatacc aatggtctgt tgttacaaat
    27541 tcatcaaagt ctcaactcta tatcctatgt cgcaatccac aagtatttaa ggaaacatat
    27601 gaaaaggaag tattaaaact tactacggaa atggggttta caaccacatg gaaccgtcca
    27661 cgtgcaactg agcaatcgca ttattaaata tcagattcat ttttttgaac caacgagtta
    27721 agaatgatct ctgaagcata tgtatttggc aatgagtgca cgattaaatt ttcaccagaa
    27781 gtacctcata cgatggtaaa tacaatccgt cgcactctca tgttagatct agcagaactc
    27841 gcaccgactg acgtaacgat tcataaaaat actagtgttt atccatgtga gctacttgca
    27901 catcgcatcg gtttggttcc tatcatttca gaatgtacaa acatatctct acagtcagtt
    27961 gggccatgta cattatattc cgattccatt gtttgcaaag atacaggtaa accggttacg
    28021 gaaccgggca ttatgttatt tccgcttgga acaggtcatg agattaactt ttcatgcaag
    28081 gtaacaaaag aaaccggcag aaaacatgct cggtttgttc actgctcatc catatctatg
    28141 aagaagtgta gtgttggtaa cacactacta gaaaaagaat gttggtgtgg tgcaaatttc
    28201 aaaccaaaag aaaccgaacc atcattttgc gctaggtgta actacaaaaa gtatagcaca
    28261 ggtaaagatc atgatgtcca ttatgtactg tcatacaaaa caattaaccc aaccgttcat
    28321 ccaattacat acaccatgcg agcaattgat gtagtgtata aaaaaatagg aaagctcaag
    28381 gaagttgctt cttcactgat ggaatgttct tagcattgtt tagaccaggt gggtatgtca
    28441 agtcgcgctc tggtttcata cgtacataca cgcgttttgg tattcttaca ttatttttat
    28501 tacgttctcc atctttagta acatatttac aaattaattt tgcaattata caaaagtatg
    28561 gacgtataga tacacctggc attccatttc ctccattttt tgctgccact tcaagttcag
    28621 aaagtggcca gtattttatc tgcccctttt caatatgctc gtcttttaca tgtacagata
    28681 ggagcgatcc atctttattg tatttgatat caactgccgg atgaggaaat tgtatttcca
    28741 ctggagggtt atttatcatt tcggttgctt gtgtatgtat acgatcaaat gcattactat
    28801 catttgattt cacacgcgtc catccgtcgt caatctcctc atcacgcata ttattacgat
    28861 tcgttgactt tgttaaagtt tttaaacgat tacctacttt tgatagttca actaaataat
    28921 taatagcagt tccaaaccgt acaggaagat ccggatccca tggaacatac ttaacatatg
    28981 tcacatgagt tcgagtacct cccatcgttt ttacggcaat ctgggcgatg taattctttg
    29041 tttctaacat gttgacaaga ctatttttat cagaaaatat catgcctagc gattcttcta
    29101 tcatttcacg cgccgcgttt aatgatgcac tctcagctcc tatattacca ccttcaaaac
    29161 ctgaccattt taacgacgaa ctccaatttt ttacatattt ttctcgacca agtaatgcat
    29221 atacaactcc attgggtgca gtacttatcg gaacgattcc tgcaccggag atgttatatt
    29281 cttcaggtga ttcattatca ctatgctcca tgtttgcttc ttatctttga caacataaaa
    29341 ttcaaattct ataataatat acaatgtcct caaccactac caatctatat gtttctcgtc
    29401 ttaccgacga tgctaagctt cccactaagg gcacgacact gtctgccggt tatgatctat
    29461 attcgtcgga ggacgtccag attcccccat ggtcaaaaaa gatggtatcg acggggctat
    29521 caatgactgt tccagatggt acatatggcc gcattgctcc acgaagcggc cttgctcaca
    29581 agaactcaat tgatgtccta gccggcgtaa ttgatcgggg gtacatcgga gaagtcaagg
    29641 ttatccttat gaatctttca aacgaaacac agacgtttcc taaacatact cgcattgcac
    29701 agcttgtact cgaaaagatt gagtatgctg aagttaaaga agtagttgat atcacaactt
    29761 ctgttgtatc tgatcgcggc actagtggtt ttggtagtac cggtatgtaa ttttatttta
    29821 taataagaaa gaatgaaact atctgaagtc agtgactcaa cacgtaaatt gttattttgg
    29881 ttgatatgta taccatcaag aattggtatt gcattaatta cagcacttgc atttccaaat
    29941 gcagtacccg aagtgaaata tatattcgga attgtttatc tgttaccagt attggtatgg
    30001 gctatttata ttcttggaat aaaacataga acagcgggga cttttaaaca aaccgcattt
    30061 tgggcaaacg cccgtcccat acatgcgaca ctatggctaa ctgcttctat acttacattt
    30121 attggaacaa ctgattcatt tagatgggcc ggtggggtat ttggtgcaga cattatggta
    30181 ggaattgcac tatggttggt aaactatgat gtggcatttc gtaaaccaga tctacctaca
    30241 taagtgcatt tcgaatatcg accatctcct tgattaatgc atcggacatt acttttttta
    30301 aagctcctgg tagtggttgt gcttcatttg aatatccaga aattaatttc accttggagg
    30361 caacgatcgg atcaagtaca ggtcggatta aactccagat tgcttgtgca aatgacggcg
    30421 ttgagaatac atataatttg tttaaccgcc cggggtaaaa atgcgtaatt gtagcagcaa
    30481 tgtgttttaa aatatgaagc atttgtagaa cttttacatt tggccatcct acttttggtc
    30541 gaatgtcgac ataaatgttt acagaatcag cagaatctcg cgatagattt gtctgtatac
    30601 aatttgcaat tgctaatgta tattgttcag gtgtaaattc atacctatcc attcgtgaag
    30661 aaaagaagaa tgcatttcga acaccaggcg tatcaatgat actagaaaag acaataaact
    30721 cgggcatgcc gttaccaaaa tgtggatgcg tggtagatag tgggaaatgt ttgtttctcc
    30781 atgatagata tttctcataa cgttgctgtc ccaatttttt attgggtgca gtatccataa
    30841 agcggttata ttctaacata tcattagtgg ttccggttac cattagatgt atgctaaaaa
    30901 gttatacctt ggaaagtact taaccgttga actatcatta tatacaattg tttcacgtgt
    30961 atcgccgata ggaagtgcta ccgaaaacac tgtaatataa aaactccgaa tgccagaatg
    31021 caaaaatact ggttctttaa ccagcagttc ttcatttgaa aattcaatat ttgtacgaac
    31081 cgaccaaaat gttttaaatt cacatcccgg gttattggta ctgtcgctca ttattccacg
    31141 ttccattgcg tagcgaatag tcacttgtct tccagataga cgtcgcaatt cttcacaaaa
    31201 caattgttga atcgtttgat gcatatttac atacattgaa gcaaaacatt gactatgctg
    31261 taatgcatca gatacatttg gcattgattc aaattttgac acaagttcta aattcttttt
    31321 atatgattca acttcttcat tgtctcttgg ataaacatac tctttaatta aattattaag
    31381 cacattcatt ttttatggac acttaagtaa acatgcagta catcacacaa agtgtaccaa
    31441 aaccaagccg tattgatgaa caaaagcgta tcatagcaga aatattagca gccataacaa
    31501 tatgggaagt tctcgggttg ccaaatgaat ctagaatggt gaatccttcg ttaaaaggaa
    31561 tccgctcgga atatttaaaa cgaagtcttt taattcaccc agataaatgt tcattagatg
    31621 attcagaacg agcatctcgt ctattaaata ctgcatacag tgacattgta aataaaacga
    31681 atacattttg tccacataac tataccgaag gatcttcgag caacacaaaa tcaactcgca
    31741 atccatctcc tgaaccaaaa cgcccttctt ataatgaaaa gcgtaaaatt cgcagagagt
    31801 acgaggcact atacaataca tacaagcgtt ccaaggcaga tgaactaata ttgtttcgca
    31861 aaaaagtaga gcgggaatct gaaattacag tattagaaga acagttggag caagcaaata
    31921 ttgctgcagt tcaacaacga ctacagcgcg ctcgtgctgc atatatcagg atgatgattg
    31981 atactcgttt gttaaaacta tctgttgatt taataattaa gctgtctaag gagattaatg
    32041 ttgagccatc aaccgacaat attagaacat gggcaacatg tggtcaagaa aatacgattc
    32101 atcgaccata ttatgtcaat aaatttatcg tcgaaaatgt acagaatcgt ccacgagctc
    32161 ttgtgagaaa agacaagaac gatttgataa cacgcgcgtc cgaactaaac aaggactctg
    32221 cgggcgaaag gcatgaccaa attcgcataa ttcacatcac gtcaaccatc agaacggcaa
    32281 ctactgttcg cgacgacttt caatcaaagt acgaacagca agtcaacgaa acaagcaagt
    32341 tgcacgcaaa attaatggat atgcaagaca agattggtaa gaataacaca tccaataaac
    32401 gcaattggtt ttggttcata taaagaatat gtataaacac ttggcaacac taaagaccga
    32461 agcaaacaag tcaaaaacgt atcgacaacg aaatagcgga gttatcacaa aaaagcaaaa
    32521 aacacaaaca acaacgttac cagagactat tttgaatgat atcacaaccc atgtattgtc
    32581 aaccggtcta gaccaccaag aaatctacac aagtttactt gcaatcgcca caaccaaata
    32641 tacaatcaag aaacacaaag caccagttat tgatgttgac attaaagacg tgcagtgtaa
    32701 taaatgcttg cacaagtaca aatatgaacg tagaaaggga gatggtggca atacctgccc
    32761 cgggtgcggg catgctcctg gtatagatat atacgaagga gacccattcc cacactatga
    32821 aaatgtgatc ccacagtggt cacttgtata ctcttcaaac gagttgacta caattgaaaa
    32881 cgcaatgaca ccatatacga atttactaca tcttacacct gatcaacttg agtatgcgaa
    32941 acgtattgta agagcaaaga catctattaa tgatccaaat ccacatgtta ttgttgcggc
    33001 aattctctat gtaaccaacc ctgacatgtt agaaacaaaa cgcattatta cacacactcc
    33061 cacgcgtggc aagtttaatt gtagcaaatg ttccaagtcc tggcactcac gaaagtgtgc
    33121 acttatgtgt tgtaagtatg gtccaatggc agacagttat attccaatca ataaagggat
    33181 tatataattt tatattttag taataaaaga actatgcaag atattctaat tgggcaactt
    33241 gccatgaaca taagcactat cattttacat gcaatgaaaa acgcggcgtc tgatgaacaa
    33301 gtgtcccctg acacatgtaa tccagatgac ggtggagcgg ttgatgaagt aatgaatcaa
    33361 ttatccgaac atattatggt cgaactaaca aaatcactag tagaacgagc aaagcgggta
    33421 aagtcagaag aagtcccgtc tgcagctgct gttgatacag ttaaaagatt aggtgttgct
    33481 gcgtcagagc gcatcaccaa atcgatggat aactcaacga ttgatacagc acgaaaaata
    33541 agtgatgcca aattaattat acaggatatg caaatgtggg gaaagaaaca gtggagtggt
    33601 acaaaaaaga atgagtttct tacatacacg gcacaactct ataatatatt agatcaatag
    33661 caacatcatt taacggcgac aagaaacgcg actgccatca gttaataccg tcatcgtagc
    33721 gtgttgcagt tctttttttg tgatgttacc atctcccttt gatatttttt gtaaattata
    33781 tggtatacca atactgctgt cgatctgatt taatatcatc aaagtaaggt ttcgatacga
    33841 cccatcaaaa tcagtcatat cagtcgctgt ttttcgcata cgctcaaaaa ccaaacagaa
    33901 ctgcgttaat gtatctacct gtgtttgttt ttctacggaa cacgacatcg tcgctgcctt
    33961 catcgcagag ttcatccgca ataaatattt tgcctttttc atatggttcg atgtttcaag
    34021 gtgaattaac gaatcggcta aattttcagc aattacaata tctaataatt ttttgtttgt
    34081 aattttagtc ggatgcaaat aaaacatcaa tgtaggtatc gcgacataac cttcaatttt
    34141 tacactgttg aagtaaaaca atgtttcaag tgttttttgt ttcatatagt tgattgcgcg
    34201 gtcaaagtac tctgaatata actcatcttc agcgcgtagc aatgactttg ttgtctttct
    34261 aatactactt tgcttgtcaa actttctata caattttgac gtttgtttat ttgtgttttt
    34321 gctcacgagg cgatctgttt cgcgaacacc aatgcaaccg tgtcgatata gctttagata
    34381 aatcccatca cgatatcgtt caatgtcttt cattgttgca ttctgcaata atttgatgta
    34441 tgtagcgtcg tcgtcttcta cataaatatt acaatccagt tcctttgata ctgaaatgcc
    34501 cttactatga atagctcgaa ttagcttttg aatataatcc agcagtggtt ttggattttc
    34561 tggtagaaag aaagttgtat ctaaatcact atttatagtt tttgtatatt tgtttttgta
    34621 tatttctttg ttgtcagtga ccacagccga gattgttatc tgttcgcatt caaatggtgt
    34681 caatgtatgc gatctacggt gtttttcaat gaatttctta agcattttat tgtatccgga
    34741 cacggaatat ttttttcgtc cgcatagtat ttgtgtattt tttttggcaa atttagttat
    34801 aacatcggca accagttgtg tgcgggtaaa ataatgtttt acctcgacca tgtttactat
    34861 aacgaaatat tattgtatac ttcgtacgta gagaacacca atttgtagtg aaactattat
    34921 tttatatgca ttactacaaa gaagactact tatattaaca tgccacgtaa gaccaagact
    34981 ctactaaatg aactagacga acttaagcta gattatgatc caggtgaact accggcgcgc
    35041 cgttccaccc ggggtgtacg caagacaacc tatctcgagg aaattctatc gagtgaagaa
    35101 aatacacgca ttcgtaacga tatactagat ggtgcggacg aacttcccga ttcggacgat
    35161 gacgacgatt gggtggataa tggcgatgga gcagacaata gttccgaata tgattccgga
    35221 ccagattcgg acgatgatga tccggattgg gacgaatcgg tggaggagaa ggaggatgat
    35281 actgaaattt cgtctgaaga cgatgaggaa gatgttgacg acgaggaaga cgatacggac
    35341 atggcacagg acgaatcgga gactgaattt gaagaggaag acaatgacat tgaatctgtt
    35401 gttattcacg tacccgtcat cgaatcgtct gataaaaaaa atgtagagcc aatggaagtt
    35461 gagtatgatg aagattaaat tcttatttat tttttacata aattcacata gattgatagt
    35521 atgaactctg ttactattat aataggaacg aatattatac tgcatgcatt atatgtagtt
    35581 gtagatgcat tcatttttcc taggatatga tatggccaat atggagataa tatagattgt
    35641 tcacgataaa ttattggtat acccatatta tatctggcca ggatatacat gtgcacaata
    35701 ttaaatacga tcaatggtac atgcatagtg tagtcactgc acacaacatt gtcaatgtaa
    35761 tacaggccgg atggcacaat gaagtgatga gcaccttgtt ttgaaatcat ggtattactt
    35821 gtcacagtag ttataccatg tagtgtattt acaatatcac cgctcttaat tagagaagga
    35881 tctgtcaacg tgccatcaat aggaatcgca tgatgcctgg atactgtaat tatttcatta
    35941 ttttccaatg caatttcata atattccgca gttttgttat tatttttatc aaagaatcca
    36001 ataattggtt cgtacccact tggtgtatat acatgatcac caatatttaa atgctgtatg
    36061 gcgacttggc cgtgttttgt agatatcata caatcatttg ggtgacaacc gttatcaacg
    36121 tcctttgatt tcattgaccc agaataacca ttgtagttac ctgttatttt gggtggcttt
    36181 tcttctacga taccttccca tacacgataa tctttcgtgg atccatttac cgggccacaa
    36241 tctgttcgga ctggatgtgt accttcgtgt tgacaacccg aatgatgttc gataaacgca
    36301 tcacctggtt ttgcacccat tacgcgacac tccgcgacga tacggggtag atgccatgcc
    36361 acataatgac catggtccct gcatgggcca gattttaaat tataacaacg agtgaatgac
    36421 ggtttgccac ggattgttcg cctttgatga ggtacaatat gatgatttac tgtatcaaat
    36481 tgcatacaat tattcttgtc acatgtcgag tttggtacag attttacaat attagacttg
    36541 acataagttt gctccttgtc gtttggtgta tatttcttct tgtcttccat catatttgca
    36601 ggggtgacat ctgttacgac acatccggac gaaaacccag acaatgaagg aataaagtcg
    36661 agaaaatcaa cattaacatt atgaactact ctatataact tgttaaatcc aacccgaatg
    36721 tccgaatatg gtggcataac aatcaatttt gtatttgtaa agttctgtgc tttacctggg
    36781 tcagtaaatt tgaacatgta atttttgtct cccttattaa actccgcaaa ctggttttca
    36841 ttaacctcaa ccgcaccgtc tgtatatgct ttgttgtaaa tcttcacagt tagtgtcaat
    36901 tgtaagaatt gaattcctat atatggatta tatattggcg gagaactatg tggaaacatc
    36961 aaccgtggga caagtgtcca ttttacagta acatccatat tttttgctgc attttgtgca
    37021 tagtgcctgt acttgcccct tgcatggtca cggtctagcg cagcaatgca tcctgcattg
    37081 tctctattac ccccgtcact atacgacgga aattgttgcc gcgcggcatc gagtgcaaag
    37141 ttattcaaat gaacatcagc atacccaatt gtacagaatc caccgtcaaa tttatttggc
    37201 gcagacgtac caagttgaca gattgctgga ccatatgatt ctgcatttag agtggatatg
    37261 tatgcgaaat tcttaaactg tttccatgta ttggatccag ttgccatttg cgtattggta
    37321 tcattatcat tctttatcga tccagttgca agattacaat atgcaggctg ggcagttgga
    37381 tttgtccttc cggtatcacg tgcagctttt acaattcttc gatatagctg agcattcttc
    37441 ataccatcct cgatggaata ctttccagat ctccccttgt cgtcattcac aaacggtcct
    37501 tcaaatatgt catttatatt tttatgtgat ggcactgcat ttttcaatat tcgacgattc
    37561 gcatctgtcc atattttacc tgtatttgtt ttcaccataa gacgaccaat ttgacagttt
    37621 ccacatggac tgtcgtcaat cttatcattt cgagtggcca tgccatgttc agtagaagac
    37681 atgtaacatg taccacatct tccctgttgg ccaaaaccac atccaattaa tatggtatta
    37741 tctggacata catcgcgctc acgtacctgg cacgataaac aattatcggg agttgctgtg
    37801 tttttaacat aatatgtata cattgtgttt gagtcgggtt taaacgtatg accctgcatt
    37861 gtaccagatg gggcatgtac aagtaaccac acgtctctgg ttgagctatc tacccaatta
    37921 ataacttgtt caatctttaa agtaccataa tggaataaac ttggatcacc atgtgcctgg
    37981 ttgtatgtaa cctgtggata tattggtatt gccgacaaat tgtcaattga tgattcaatc
    38041 gccatacgat taataaatac ataatatttg gtattgtgtt caaacattac catttcatca
    38101 ggggattctg tcatttttct atcggcaaca cgcacatctt tatgtttatc tgtataaaac
    38161 gaatattcat cgatatccat gtttgtaatt ttgccagttc ttgcatcgcg aagtacagca
    38221 cattgtatta tactttgcca atcgtaccat attccattaa tacgagcacg agaatatgat
    38281 gcattgttac tcttatgacc gattggtggc gtgccggaat atactagtcc gagtctgaaa
    38341 tttgcagtaa gacgcatact attcttaaat accgtatact gtgttccaaa tgacacaccc
    38401 gctggtgtac cataaactaa tgaaccagta tctaattcat tattgcgacg tttatacatc
    38461 aatttttttg ttcctgtatc gaaccagata tgaatcaatg tattattaat cagagaatcc
    38521 gtagcatgat attgatgata tccatacata ttcttcgacg ctgcagtatt gcatgtcttt
    38581 gtgacaacag atgtttgtga tgatcgttgt ggtgcgcatg cagcgggatt agaacaatca
    38641 ttcgaaattt cttctgtgac attagataaa taagcaattt tacttatact atacatatca
    38701 gccgccagtt ttactttatt ttggactttg taacattgac atgatggtag tgtcattgca
    38761 cgtagtggtg aaattgcagc aacatttgca gaaagtgatt tgcatgattt tatgcaataa
    38821 tccatgttgt gtgctgcacg ttgattcaac tttgcgggag ctacaccata tgccgacgac
    38881 gcaatcggag tttctccaag tactatcatg tttctagctc cgtctttaaa taaccacaca
    38941 ggttttggtt tttcaatcgg ttttggaggc tcgtttggtc ttgttataat tggtgctggt
    39001 gtatcatccg tatcatccgt atcatcttct tggatggtac caattacttc agatgtacca
    39061 ccaatttgag caggatcata atcaccattg taatagtaat agtaatagta ataaccaata
    39121 ccaatgataa tcagtcctat taaaatatag gtaaatgtat catcacttga ttttttctta
    39181 ttagatgtct tacctgattt ctttgccatc tttatatcta tcagataaaa aaccagcttg
    39241 tgctttttct attggttata gtaactaaaa gacatgaatc taaaagatta tgcaaatatg
    39301 cttcttcgtg gcgacgacgg caagagcgtc gttgatttaa tgctcgaaga gatcgaacat
    39361 aaatgttctg tacgtgttgc aatgactagt gttcgtaata ttattctcca aggttcggat
    39421 ccaagacgat ttcatccaaa acacgctgca agcatcaagg cacttaaaga acttggaaaa
    39481 acaacaactg tggccgcaaa acaaaagtta aaaacattca taagcggtga tctcaagtac
    39541 aaatacaacg ccaagcgtaa ggtgcgcaaa caggggtatt attttgatga cgaagaaatg
    39601 gatactatac taaaaggcat tgaaatcttc ccggataaca tgaagacatt tgttctaccc
    39661 aaagagattg caagggaatg tatacaaatt gcgcaacaca atttacaagt ggcaaacgaa
    39721 aatattaaaa taataaaaaa cactacaatt aatatcaata tatgtattga ctatattgaa
    39781 tttgcaataa aagagtcggc aaagcgtaac ccagaatata ttgtatctga taagaaactt
    39841 ggcacatgtc tgcttgcaat gagtggtcgt cgtacctccg agatattcaa tggaaaaagt
    39901 cgttttaaaa aggggaaaac ccaaacgaca gtgatatttg atggtcagtt gaaaaggaac
    39961 aatgcagggc aagaatcaat agacaaatca tacgaaattc cattgctatg ttattctgac
    40021 atttttatca aaggatttaa tacacttaga aaattacaaa attatcaaga atttacaaac
    40081 aaggaagtaa atgcaaaata ttcaactaat gtgaaatact ggtcatcaaa gttatttcca
    40141 attgtaccag gaagaaaaag tactgacgaa gaagtaacgc cacatgatct ccgtcgtatt
    40201 tatgtcgttg caatatttga aatgtacaac tatgaagatg ttcgtattgg tataaattcg
    40261 gtagctaaaa aaatattagg acatacatca attgacacat cgataaatta tctaagtatc
    40321 cgcctaaatg gtttaactgc gtcattccca gatgagtata gattggactt gtctagcggt
    40381 aatcgtaaaa ttaaaaagag acgcatttaa atatacattg gcgaagggta acccatgccc
    40441 atatatgggg tttgatgcat cggatatcta ttttgattca tcatatgcgg atttccatat
    40501 tccatataac gaatcatatt ttccatatga gatacccgtg cacgcatcct ataatcaaga
    40561 tacacaagga ttactataat aaccaatagc atcataatta catactctgc agttactggg
    40621 tatatttttt caccgactgg tgcggtcgtt tcatttgttg tcgtaacggt ttctactgca
    40681 gtaggcacga attgtttaat tggaccagat gggggtggtg gtggtgtatt atttgtcggt
    40741 ggcggtggtg gttgtggtgt atctgcgata ccattacgag taatggttgg tttatcacga
    40801 ttatcagaca taaatgaata aatttccccg attgcacctt tcattgcatc aacctgtgcg
    40861 ggggtaaatt ccctaccaaa atatgtagaa ttcttaggag gtttttcctg tgtcacttga
    40921 ccagtttcga cattattacc agagatggat ccagatgggg cgcgatttgg tgcgtacatg
    40981 ctttaatact ataattataa aaaatattta acatattgtt aatttaatct ttcttgttac
    41041 tgtttaatgt ctgttggttc agtagagcgg caattaatac cttacgcgtt gctggcaatt
    41101 ttacataaac cttgtgtgta gaacacatac acataagttc gggcttggac tttttttgca
    41161 aatcagcttc ggttagttcg gggatgggtg actcgggtac aaccgcgggt acggccgcag
    41221 gtacaaccgc gggtacaacc gcgggtacat ccacaggtac atccacaggt acaactgcat
    41281 cgacaatggg tgaagtattt gttacacgta ctggttcggg ggaatgtttt ttctcaagtt
    41341 gttccaactt gctcatcatc atatttacaa caggagttat cttagacatt gattcaactg
    41401 ttgaatcaat atacttaatt tctgcgggcg cagctgacat agctaccgga gaatgaatcg
    41461 gtgacggcgt tggggcactt acactctttc ttgtatccgt gggtagttta tgtgttttat
    41521 tgtacttttc aactgcagtc gcgcgcttct tgattaggga cccgggtagt ttcatggttg
    41581 ctttacatat acaacataaa aaatataaat cagtttaaat tctatttacg ccggtgcagc
    41641 cttttgttcc gtgaatgtag acgggagttc ttcctcctcg tcgtcggtct cttcaacatt
    41701 ctttgtcgac ttacggcgac tttcacgtcg tgcggcagat tcaattttct tgttacgaga
    41761 cttgatatga aaggaaattg cagaactccc aagtaggaat gcaagttccg cctctggttg
    41821 gagcacggat gtgcgcatgt atttttgttt tagacgcaca agagttgggt catatctacg
    41881 actatcggca gaaacctcat tcgaccatcc atcaagggat agaagtccaa gacgagagtt
    41941 tgccatttca acacctgcag taagggcaag taggccttcc cgcataataa caatcataga
    42001 cgcatcggac acttgctgcc gatgcatatt aagctcgcgc tcaatgtcat caatatgatc
    42061 actaattgta aaatgacgac ttagcgtaac attatgcgtt tctacgaacc ggtctagttc
    42121 atataacata tcctgcttac ttggacgatc atattttatc gtagattccg ccgtggatga
    42181 tacagttgtt tctgcgggtg cacttgatac tttagatgca gccattgtac gcgctctgcg
    42241 agatgtactt ccatcgctag aattagaata gtcactatac gaatccgaat cggatccaga
    42301 attactcatg gctttctttg ctgtcgttgg tgcacttgca gttgaacggg taggacgaac
    42361 tgtacgttct gacttttgtg gcttctttac ttctggcttc tttccaccaa caatgcgact
    42421 gctaataggt tcaccttcac ttgacgatga atcatattcc gtaccacctt caccaatacg
    42481 aggcaatgca cccgcgccac gctgttgctg tgccgaaagt gtaaatggtt ccatgccatc
    42541 ctgtggcttc ggtgcaggca tacgtggtgc agacgatgat aatgttggtt caactttagc
    42601 atttacatca atttgttccg ggttcccaat cgccatgaaa tgacgcacat cagtttcgct
    42661 aaatgttgat cctggaccgc ccattttgta ttgttcgttt ctttatagaa caattataaa
    42721 aaaatagaac cagtataact atctataacc cgcgtgattg cggtgcaatc gccccacgat
    42781 aacgttcaat gtcaacatgc gtcatttctc ttgatcgtgg tacatgcgta tttcgtgcca
    42841 tgtcagccgc ccgttgttgt ggttttacaa caagtaaaaa tacagcaagt gccgctgcaa
    42901 taatagaaaa gagtgtcaca aataaagcag cgattaattt ttgcaatgga attgcccatg
    42961 tagttaacca atggcttgca gtgcttacaa ttacatcgga ccatgcactt gctatcgcga
    43021 atgcaagacc gattaacaca gattcaagta taatattgaa gaatctcata tgcatcacat
    43081 catcttccat ccgtttgaat aaacgtacag cctgtgggtc gttattcatc atatactttg
    43141 tattatagta cacaaaaatt atgaattgcg atttgcttga gcgagggcaa ttccttccct
    43201 tttatctatt ggcagtttgg gaaacattac attcaattca tccaaatgct ccaaatagcg
    43261 cgcgtcacgc ttttttagtt cgcgtttacg cattatagta ttttgtaaat acaccgcaat
    43321 tgttgaaaat atacttaatg gaattgcaaa atataatgca agtttaatgt caattttcaa
    43381 agacatggca aatataccaa caagaaatgc aacaatacca ccaatcacag aattaattaa
    43441 tgtacacttt aacgatttag aatcgtcatc ttgtaaatga taaggtaacc tgcaatattg
    43501 cacaaagcta tacatgttta atatactata aatatttttg tagtagatat accacgagta
    43561 acaatataat aacaacaagt accaatactt ttattattag atgcaatttc ttatttgcaa
    43621 tttttttact aaactcgtcc aaatcaccac ccgattgatc ggaggatatc aacaatgcaa
    43681 tcctggcatc aattctatca ttgcattctt ttacaaatgt ggtggctgat tcggttggtg
    43741 tatccatttc tattgtagtg atattatatt tgaaatcgtt atattcagat caatgcgtct
    43801 attttatata caacaaatcc agtaaatgta cacaataagg taccatatgt tagatcaaat
    43861 attattgcag tatttctcca atctttacga acagcagctt cggtgaaatt ccatgtacta
    43921 tatgcgatta acccaacata cataccaaag attgccgcat cttttccgct cgaaacgtcc
    43981 ccacaactca acagagttgc aatactcatc catgcaagaa ttgcaaacag tatgtgcgta
    44041 tcatctaatt taggataaaa ttccatataa gttgaaaatg gtaaccatat tgcatccatt
    44101 agtacaatca caatataccc aagacaagct tttaaaatat ttggcaaacc aatcgatatc
    44161 atttatttat gtatttcaaa aaacaagtaa tgtacttaat catttaatgg aataatacga
    44221 gacagaagaa ttacaaacgc tagattaata acaatccaca tagccacagc aatcccgcga
    44281 attgctgcag ggttccagtc atctggtgta aattcatcta caaatattgg tatggaatcc
    44341 gatattataa atataactga gaaagctgaa ccagtataaa taccaacata gaatagttcc
    44401 atcatagaac gacgctgtac gagataggtt gtagcaccac ccgcctgcac ttgtgtaata
    44461 tttatgcgat ttccattcgc atccacccca gttgcgggcg gattgatatc ttgataacga
    44521 cgggttggcg gagccatttt atttatacaa tctaaaatta tttacatgat aataaaatca
    44581 tcaacatttg tcactgtgat ttccccattt cctacaattg ctgaacgaat ttcagcattt
    44641 aattgagtga attcaggcac gtcgtctggc aacttgagtt gtacattacg agtatcgccc
    44701 acgattatgt gtttcttacc catctttcca accgagacat tcatgagatg tacacgacaa
    44761 ccaggggtca tactatgaat tcgatcaaca gtcacattta aaccatgaga agtaattgtc
    44821 ttgggttttg tagttgactt tgtagtatgc caccattcat ggagttctgt gtcattcact
    44881 acaatcggtg gttcattatt aatccatccg gtaaccttgt cattatatgt acttaacttc
    44941 acccgtttga tggaaaccac gtcaccttct tcaagtacag tttctgcatt ctcaccacac
    45001 attgtaatat taatatgcga ctcggtgaca gatttatcaa cggcagtaaa tgaacgtttc
    45061 cagttgttat tcctatcaac ggattttccg tcctcgattg tatcaacaac aatgtgtttc
    45121 atcgcaacaa ctgggttctt ttgcatatca tagtttagtg catcatgtac ggacagacgt
    45181 gtttgggatg gaatgaagaa aacgctattt tttgaatacc attcattaaa attgacattt
    45241 ggcgtggttt ccacttgcat tggcattgta tttacgttaa gtgatcggtt ttcgttaaaa
    45301 atattcaccc gtccaaaaga aatcttaatc aatttcccaa cttcgatttc ttttgtcgca
    45361 tcatcgccaa atacttttat atagaattgc tcgacttcat tgtcacgcaa tgaaagtgat
    45421 cgcattggtt tatcattctt tgaaaatgca agcgggtata cgtcacgtac aacagcatat
    45481 agatccttca caaccgtacc attttccgac gtattggcat ctgagagcgt agagattgtt
    45541 tttacgacag gatcggcggc gctgtattta tcctttacat tttcccacag tgtattcaac
    45601 cgaactgcaa ttgacgaatc tgccaatttc attgcaaaat taagattcag tgattttctt
    45661 ccgttccatt cattcacgga cccggggatc agtacacact tacctgcttc aataagtggc
    45721 tgattcgccg catcacccca tgcctttact gtaattggcg tctcttttgt cgtatcgtca
    45781 attaccataa atgaccgact tcccttgccg gaatcgtttt tggggaatac ctttacaata
    45841 agggcatttg tcttaaaaac ggcacggtta tcagacatat ggatagcatc gagcgtcttg
    45901 ctcataatat accgttccca ctgtttatta tatacagatt aaaatacaat aagtgttcac
    45961 tgttatgaaa ttttacgtgt ttccataata tttaagttac gttttgtatt attttttatt
    46021 agaaatatta tatattgtaa aaggaaatcg gaaacaccgg atgagttcag aagatgttca
    46081 tacactatta ctatttttca ttctggtaac actcaacacg tacacattta tgccatggaa
    46141 aggaatcgac aagggatcag cggcaaaact tgccaaacag tggtttggat ggttaatcgt
    46201 aacaatgata ataatattaa ctatcacaac aataaatggg gcaatctcct ctgcattcta
    46261 ttaagcgatc tggaaaaaaa taacacatat attaatccaa tgtgccctgg gttccattaa
    46321 actgtgtaac atctggtcca ttgtatccaa actcgtcacc gacagtctca ttttttccac
    46381 ttgtttgtgc ccggaaaatc tgcactgcgc catttacact tcccatgaga cgttgtggaa
    46441 ttgcattatt tgactcacga atcgtgtcca tctcggggcg cgacgtcatt gcaagtacct
    46501 cactatctat gctctttggt gggttttcga aatcaatggg accttctgct tcggcgggga
    46561 cggcatcggt atcctcatca aaagcaagat ccggctcatc tgttacttta gattcttgtg
    46621 gtatactgga cgcagaaaaa cttacctctt cgggggaacg aaagagacgg aattcatttg
    46681 gtagaataga aggttttact gcctgaataa tgatgtatgc aagcaatcct gcgacgagaa
    46741 tagttagaaa tatcacccga atgcgccgat tcggcgtagg aggagtcatc atcatgctgt
    46801 ccattgttgt ttactcttac attataaaat aatttcacca ctttaattgc tcttgttcaa
    46861 acaactcttt tgcaactacc ccaactactg cccacgttgt tgtaataata cccacgcgct
    46921 gtgcagcatc cattactgca ccctgtgaac ttccaggcaa cgacgttgtc attggcataa
    46981 caacagcacc cattcccatt gccagagacg ttactcgtac ctttgtattt ttagacatca
    47041 taccagcagc tgccattgcc acagatacca atacatttac gcggaaaata ccataaccat
    47101 cttttacttt tacttcatcc acccaatcac gatcacgctt aatctcatta ataaatataa
    47161 atagtggcat gaagaaggta atccccatga gaggatgacg tattacttgt tcaacaccga
    47221 ttgcaccatt aaatattgca acgtaagtga gtgcccctgc tgcatatgtc ataaatatat
    47281 ccaatggaat ccgaaaatca gcgccaccat ctggtgtatg ttttattgca acaagtcgtg
    47341 catgtagaca aatgtaaata catataacaa tacttgcaat tagaaccttt tgatcaaggt
    47401 ccatcttgca tcttattata tatcactcaa aatattttat ttgcattaat ataaatgaca
    47461 acagttgacc tcacatacct tcttgtaatt ggtattccat tacttattat actgtgtgtt
    47521 attatgttta ttatcggaag acagtcgggt aaaaagcagg tttatcgcat gatgaatggt
    47581 ggtcaagtgc acgactatcc ctctcccgtc gtcgggagtg caatcaacgg aggagtaaaa
    47641 ttcgataaga aaacatgggc tgcgataaat cattacgaca ccctgtcccc agtagaaatt
    47701 gcaagaatat tgcgagagcg acatggagaa ccaaaaaatg atcagtaccc ttcaccttat
    47761 ggagatatgt gagttccaca aatttcgcta ggacgagaag tcgggtggaa cagaagcaca
    47821 tgcaagtaaa tatgcctaat acatatgtaa tggagtcgga ggaatctttc cttaatgatc
    47881 ataatgtacg atgtgtttcc ttatcattca aacattctca acacacaaat aaaaaagcaa
    47941 aacagtccat tcttttatca aaacagcaat acatcgatgt gctaaacgat attaaagcat
    48001 ggaaatatat tgtgtttaat catccattga tgagtcaaga cactaaaata aaaatgcgaa
    48061 tcacaccaga tggcgtgatt ctcgatgaca caccatttaa atatggttca gactatcgag
    48121 gatttcgtaa ttacatgagc tattttttac aaccacctac ctttccatat gatgaagatg
    48181 acgacgtttg gtttcttctt gaaactgcac ataaaggcac gattgatttg ggtggctcag
    48241 atataattat taaacaaaga ttagatttcc tcaagtacag agagacaacc tacaacaacc
    48301 gaattaataa tccacttaca ccagaagatg acaaatgcgg taaattttca tggaaattaa
    48361 taggtagccg tgaggaaatt caccccggag aagaagttgc atctcgtatc atctcgtatg
    48421 atgaaaacga agaacttctt ttttgggcga aacgtccacg tcttatggaa taggaatttt
    48481 attagtatca tagtaaagca aacatggacg cgaagctctt attggttggt gtgtttgtct
    48541 tgtgtttcat cgcatgggtt acgcacgtaa aaacattatc atacacagaa gaacatcaaa
    48601 caatggtacg aaatgcagta aaacaatgta aagactggca taatgttgca gagaccacca
    48661 aaaaggcgtt taatgcatct ctggctgcaa ctcgcgcggc agtatattta gatgcagttc
    48721 gtttatcagt cccggacaca gacattgaaa aaataacagg tgttgatata agtaaactta
    48781 ttgtagacgt tgaaaagaca caggttgaaa aaattaaaac ggttgatcca agtacagagc
    48841 aaagtgcaat tgcaaatgtt attcgatgat ttactcctgg atatcatcaa gtgacggttt
    48901 cactccggaa agaatgtcga ctacttgctg acttttttta ccatgaatac ccttggatgg
    48961 tggcgaccac gtctcttttt tggtgtatct gggatggtcg caggaacggt atcgggtacg
    49021 gtatcgggaa cggtatcggg aacggtatcg ggtatgactt catccgagtc agacgacgca
    49081 tattcgtctg taaccggttc tgtaattgag tctactacag gatcgagtgg cgcttccact
    49141 tcttcggttg catcatatat ttcttcaatt gcagcatgaa cgactttgcg tgtttccttc
    49201 aattcatcgt actgatcttc tgtcattaca atcggtggga ctttgtctcc taccgtcgcc
    49261 attgcctctg tcatgaaact tggaacaccg aatgcacgaa gcgccttttc aattgaaggt
    49321 acatcggggg ttgtatcgtc gagatcaccg agatcaacca tatcgggggc agcttcgtca
    49381 tcttctggaa ttgagacggg ggtcgtaaac atgtttgatt cactaacaac tggttcagtt
    49441 ggggtattgt ttacatttgg ttcgggtgga ggtggtggca caacatttgt gttttcagca
    49501 caaccgccct tcccacatgg tccggatgga acggcggctg gcttggatga atcaataaat
    49561 agatacatta caatgcacag aaagatgcac atcacgaccg caacaattaa ataacgagta
    49621 gatgttttca tggttcttat ttatattagt aaatataaaa ttatttcatc cgtaacacta
    49681 acaaatatcc aacttaattt tagtccccac actgatattt tcatgatctt ctattttttc
    49741 tgttatgtaa atataggcat gtgtgtctga actgtgtgga tctattctac gtatggtata
    49801 tagtttgtta ttaatgcaaa tatgtgtcac attttcaaaa tattttaacg tttcacggcg
    49861 tactccaata taatcagcgc cataaccaga tgtcttgtgc tttgggtcaa atgcacttac
    49921 acggatgtta tgttttccta ccatgtcagc atcatcacca tgtgcagatg catactgata
    49981 atcttgccga tttcgattat attcatttcc aactctatca tttggtaaag aaggcaaatg
    50041 atcatttcgc gaatgacgta tttcttctat cacttcgtct gtttcttctt tttcctgtgt
    50101 gggtttcgta tgcaattcat caatgtcctc ttgttctggc tcacgttcca ataatttgac
    50161 aacagatgac ctcgctgggt tatcttgttt cattggtttt agagacaaga caactacaat
    50221 gcatagtagc attactgaca ttataattaa caaactagcc gcattcgttg ccatttcttc
    50281 ttatatgtta aaaaatataa tccaattaca acaagtattc aaataaacat gtacactata
    50341 aaacattaca tgacagcatg aatcacatac gattacacag ggggaattcc agacatgtca
    50401 gttgggacaa tcacagaggg gccagttggg gtaactacgg gatcatgagt aagtgttggg
    50461 atgtccgaag gcacatcggt cgcctccttg gacttcttga gtagtttaat tgtcttgtat
    50521 acaattacag caacaagaac aaatccaaga attgacatta ccgatgcaag tgcaatttca
    50581 gaatcggtaa tcttctcgtc cttttcatat acggttgcaa tatccgttgg tgcagaaaac
    50641 gttgtgccga aatactcact taggagagat acatactgag ttgcaaattc atccgccgaa
    50701 ttctcacccg agatatatgt tagtgttacc ttgatgtata catcaccaat gcttagaatt
    50761 ggagaagtca taggtaccat aaatgatggt agttcatgca tcggaactgt tgtaccagtg
    50821 atgtcgcgtg tcatacgata ttcatttgta ttgacataca gaacacggca gtttgtctga
    50881 cacccagagt cacgcaggag tgcaaaaagc tgagccgtgg ttgtatctga ctccactgta
    50941 aaatcagtat actgctcgac tagaatcgac tgaagaattg cttcatccat gcgacgacca
    51001 tggccaatat tgccattctg aagtagggta aatagatctt ccgctgtatt agaagccagt
    51061 gttactttac cggatgtagt aattgtatga gttgcatcca caccagctgg ggaaaatggc
    51121 ggcgcagatg gtggtggtgg agatggtggt ggtggagatg gtggtggtgg tgatggtggt
    51181 ggcgatggtg gtggtgggga aggcggtggt ggcgatggtg gtggtgggaa ggcggtggtg
    51241 gcgaggtggt ggtggtgggg aaggcggtgg tggcgatggt ggtggtgggg agggcggtgg
    51301 tggcgacggt ggtggtgggg aaggcggtgg tggcgacggt ggtggcgggg aaggcggtgg
    51361 tggcgatggc ggtggtgggg aaggtggtgg tggtgaggtg gtggtggtgg cgacggtggc
    51421 ggcgacggtg gtggcgggga aggcggtggt ggcgatggtg gtggtgggga aggcggtggt
    51481 ggcgacggtg gtggcgacgg tggtggtggg gaaggcggtg gtggtgatgg tggcggtggc
    51541 gacggtggtg cagtgcatgg aagcacgtgc gcaccagggt gcttcgtaat ccagtaccca
    51601 atataatcat gaacaggatc ctgcacagtt ggaacgtttt taaatgcatg attacaatca
    51661 ccaacagtga agcataggcg gactgacgag tcgtaattta catgtagtcc agtatcattg
    51721 ttatcataga aacatccggt atcagttccg atgttaatac cattggaata tggatattcc
    51781 gatgtagtac atgcacactg atcagatcca tccgggattg gtggagcagg cggtggtggc
    51841 gatggtggtg gcgatggtgg tggtggtgat ggtggtggcg gcgatggtgg tggtggcgat
    51901 ggtggcggtg gcgatggtgg cggtggagat ggcgatggtg gtggtgggga gggtggtggg
    51961 ggcgacggtg gtggtggagt tggcgacggt ggaggtggcg atggtggagg tggcgatggt
    52021 ggaggcggcg acggtggagg tgtcgacggc ggtggggatg ggggtggcgg tgagggtggt
    52081 ggtggagacg gtggaggtgg cgacggtgga ggtggcgacg gtggtgcggt gcatcgtgtc
    52141 atgtaagcac caggatactt aacaagccag tacgaaatat attctagtgg ttccgacgta
    52201 gcgtcggtgt atgcatgcgg acatgcacca gcggtaaagc acaactgaga atctgataga
    52261 ggtggtcctg ggagattgcg gtaatcatgg aaacagcctg cattgtcacc gagatggaca
    52321 ccattcgaat atggatattc accagaagaa caatcgcatt cggtaccaac tggaactggt
    52381 ggcgctggtg gcgacgacgg cggtggtgtc gatggtgggt tgagtggtgg tggtgatggt
    52441 gggttgagtg gtggtggtga tggtgggttg agtggtggtg gtgtcgatgg tggcgacgac
    52501 ggtggtgtcg acgggggcat tggtgatgtc gatgggagtg ttggtggtgc aaatggtagg
    52561 ggtgttacta ctgcgtttgc ggaagatccc ataaaccaga ttagggaaca tatcgataac
    52621 ttggacattg ttgatatatg ataaggagtc gttctttata ctagtgtatc caaaaacatt
    52681 atattcatta caattttatg acatgtatat atcacataaa tattataaaa attataaaaa
    52741 aatattaaaa ttgttataat tacacttcat cataatcgat tggacgatac gcatccattt
    52801 cttgcaattg tcgagcgtgg cgctcggaaa atatctgacg atcgagatcc tgtgacccgg
    52861 gaatatcata catcttgtca tattcacgga ctgcctgtac attcttcgtt ggcatcatct
    52921 taagatgcag acgctgctgt tcgcgctcct tcattacttc catacggttg gcatatgatt
    52981 ctccacgtcg aaccgccgcg ttgtgaattt cttgacttac ggtcgcatcg tcatgtggat
    53041 catttacctg acagattgtt ttaattgcgt cgcgaccgtc ggtgtcaaat acgtagtctg
    53101 ggcgaccatt cttacgcaca atcccctggt aatacgcggc gccgtaatgc gtgcaccatt
    53161 tactcacagt atcgtgaacc attatgactg ttatattctt ttacatgata aaaaaacaag
    53221 acccgtaaga atctcaagaa tagtatccag tactacgaat tggtgggggt ggcggtggtg
    53281 gtggtggtgg tggtggatat tgtgcagggg gtggtggttg tggtggatgg tgtgacggtg
    53341 gtgtatacac agcagacttt ggtggaaact ggaggggcgg tgacattttt atctgtgttg
    53401 gttcagatgt atgtgaccta ttgtctgtcg atgcaaacac ctgacttaca ctatccatcg
    53461 gttttatagt atcgtccaca tcaccccaat catcttcatc gacatcgtct tcttgtatat
    53521 cgtgatcatt aatagaaggt gctgcatggc ttacacttga taccacagac acttcactgc
    53581 gtgctcggcg agacttttta tttctctttc gcttggatac cgcggtagat gcctcggatt
    53641 ctacatctga agttgcatca tctgggttct ctacccgaat aaattcatct gcaatacccc
    53701 atagacaatc tcgcgcgttt gtttgagtaa caagtgcgca ttcaacagtt tgatttggat
    53761 caaagaatct accggatcga acagaatcgg acgcagccat tgcaataaga aatcgtttaa
    53821 caaacacctt accaaccacg tcctcagtgc cctccaatac aacccgatat ccatcctttt
    53881 catgtcgttc cgatgccatt tgtttaatta cagtacataa caatgcttta aaatctctat
    53941 tacggttaca gatttgacgt gtgtattttt catacatttc ttctgtaaat tgcgcgggta
    54001 ccgcctccat acatgcggtc ataatttctg catctttacc gcatctaaga tagactggct
    54061 tataaacgtc aattaccaac tttaatacat tattgcataa gagagcggcg gtttctgatt
    54121 ttaaaaagat accattgtat ggcgtctgca tgtgtttgct atttgatatt aacaacatat
    54181 aattatttta tgcattagat catcactccg ccgtaacaca gcacttttta tactttttcc
    54241 cagacccaca cggacattgg tcgttcctac caaccttttt cggttgagat tttgttgttt
    54301 tatcgataaa tacgttgatt gtcttcttaa caccttcgtc tggatcggat tcatattgag
    54361 gaatatcatc ttctagtttc tttctatcat cttcatggtt taatttcgct gtgccaaatc
    54421 cccttttatg ccacgcctcc atgagatcct tacagtcatc taaatcatct ggcaatttgt
    54481 tatatggaac aactgcatct accatacaat gtggacagat tgcagtaaga tctgcatctg
    54541 cccaatcttc aacacctgaa tacttgaact catgaaaaca agagtaacac tgaccaccat
    54601 cgctcttttt tagattttca cgatttttgt atgactccct atagaagtct acatctgaac
    54661 cagacatatg gattgattaa atatattttt cttatgtaaa gtataaatat gatcaagtcg
    54721 ctcattgtag ttggcgtcgc tgttgtatta attatagtca ccgcaaccca aaatacaaaa
    54781 tcatcaatcg gagtttccat aatcacatcg tcactcctcc ttgcatacat tgttggcatt
    54841 gtatatgata gtgcttatga tacgcctaca tcacttggaa atgttgcccc aatggcagca
    54901 ccacccgatc ctgtccgtcg atcgtcgtcg acaagtgatt ttctacattc tctaccatta
    54961 ccaaccactg acccaggtga acacacacca accggtaaac gactcacacc aagaaggcgt
    55021 cggaaaatca tgagatcaat caagtctgct gcaaaagagc atactgcact tcttagtaaa
    55081 tctccagaaa tccaatccat tgctagagaa tctggaatta caccaaaaca agtgctacac
    55141 cgaatgacat catatatgcc atccctaccg tctgctcgta ctacgggagc agtgactctt
    55201 ggtatgttaa ccgcaggtgc agtgcatcat ttaaatggac atggcaattc acaatcggtt
    55261 gcgacgggtg gatctacact ggggccattc atgtccgcgg caaatcatag taatattccc
    55321 cgtgttgtta tgcaagagcc tcaatttagc catcgaaaca tgccacaata tgtcagaagt
    55381 caaggactat ttggatgatt acattccatt attttttgga tacagtataa tatagaatgc
    55441 ttcataaatt tgaaacccat cggtataaac tggaatacat tgaggaaaat cggtttgaat
    55501 cggatcatgt attattattt atacatggat ttttaggaac aaaggaaaca tgggataaag
    55561 tcacgcgatt gattggtaca aatcatcatt acattacaat tgatttgccc gggtcgggga
    55621 attcttcaaa cgttgaaaat ttctcatata ctctctcgga actcgcagaa atcatgtatg
    55681 aattcgttga acatctcaat ttaaagtcaa tcatacttgt tggacatggt actggtgcag
    55741 ttgttgcaag tatgttgtat gagcacattc atgcatatgt catcggtatg gtgcagttgt
    55801 gcccgggatt tcatatgcaa ccatcaagta catttcagcg actcccaaga tgcatgacgg
    55861 actttgttgc cgggaaaatg tgtgaataca caaaacgata cactttccta aaacaatctc
    55921 atcacgaagc gcacaatgcc agctattata tcgaacattt tagtaaatca gcgcggcctg
    55981 atgtagtgtc taaattctta cagggaaagg atccaccata tgaaacattc ataaatatta
    56041 ttgatcgacc tgtgattgtt attgttggtc gcggtgatac aatatcacca ccagatactg
    56101 tgattaactt gactaaaatc aatcgcaatt ttgaatatcg ccaagttgaa acaacatctc
    56161 attatttaca acacgagttt ccacaagttg ttgcaaactt aatcaaagaa cacattatca
    56221 agtgctagcg ttaagctgcg ttccctaaat gacaactata gatgcgatgc ttccagttgt
    56281 aattatcgta ttttttattt tctgggccac tgtagcctgg tgtcaatgga atagtaagcg
    56341 tcagatgcga aatcgcattg ctcagcaacg agccgctgca ttgcaaacta tttcaatttc
    56401 tactacatct cgtacacatg cccctgtgta tgaatctgta cctggtcaag tggcggtggc
    56461 gatgccagtt gttgttgctg aaattgttac accaacaaat gagtaaatta gtagatgagt
    56521 ttataaataa tatttgtgtt ataataaata tgaagtttac tcgcacaaag gcagtcgcct
    56581 ccaaagcact acgtggcgcg aaacttatta gattacaaat ttatcagagg tccaaatata
    56641 tactggccgc acttgttata ttacttgttt tgattacagc aactcttgcg gttatgacac
    56701 aaacacacga cttgtttgga ttaagaatta aagcatctgt taaaaaacca agtgcaatgc
    56761 gagcaattat ttcgggtgac ctcgcagata catatgacga cgcggagggg attgtgtcac
    56821 tttcatatag tgacccggat agtgcgtcaa atagtccaca ttattgtggt ggtaccctta
    56881 taaacaacag gtgggtactt accgccgcgc actgcatata tggccatggt cgagaagaca
    56941 cacttgaaga tagtattaaa tatattaaag aatatcacca cgcacgaatc ggtgcaaaga
    57001 agtcacatga ggaaaatata agcggggatg aatttggtat tcgtaatgtt attgtatatc
    57061 caaattacaa taaaaataca ttggaaaatg atatcgcatt gttagaatta gatagagagg
    57121 tgggtactga tattgcaaaa ccaatgaaag taaactcaag taaaagttgg agtagtcaaa
    57181 ctgaagatgt cgtaactgat gtacaacaac caccaaagag tcaaatattc actgatggaa
    57241 atattatgat acggaattca tccgttattg cagctggatg gggcaagaca aaaatgtccg
    57301 atacacatgc ggcgactgta ttaaagacca ccgatcttac cctggttgct acggatgcag
    57361 ggcagtgtgt accaatctca agtttcggtg ctccgggtac ccggtctggt attcatttaa
    57421 ccgatcagtg catctgcgcg agtggtggta actctaaccg tggcatatgc caaggagaca
    57481 gtggtgggcc attgtttgtt catgacgggg atacaaacgt attaatcggc atcagtagtt
    57541 tcgttgctat gccatgtggc acaccaaata ctcccgatgt atttacacgc acagatacat
    57601 ataccgactg gattacatgg tatgctgatc gtgaaaaaat cgacccggtt gtagaacaga
    57661 tggtcttgga aaacggtgac gatgctccat tttccgtaga gcccgtctta actccatatg
    57721 acgacaaggg agatatcatg gttggtataa ttgccgcagc agttgctgtt gttgcaattg
    57781 gaacaattac atcgattgca agaacactga gattgcgaaa atctgttgat aatataaatg
    57841 aagcttcata agtggctaaa atacagtcta accaaagaac tggtcgatta cataaagacg
    57901 ggtaaactcc cagaatggat tgaacgcgcg ccatccacta gtaagtggaa ggatcgatgt
    57961 gataaattag aaggtgtttt atatgacatt gcgaggacgg tagattataa attgtccgaa
    58021 cggtaccaga cttttataaa acttgcaaat tcatcatctg aagaatatca tagttatgtt
    58081 acaaacaaag catgtccggt cattgaagat gtttcaacat atgcacatcg actaaaaaag
    58141 gcgttatttg atcgtcattc atatataaga aaagaataca aatctcacca agatgaaata
    58201 cttgaagcac ttgaagacgg ttcacatcga tataaagcag catccgagat acttaatgaa
    58261 gaaactatgt acattgaaac aaaactacaa caagaagtag cagagtatat taaaaagttc
    58321 gaacagtact gtataaataa attagtaccg ttgatatctg caatagaatt acttcctttg
    58381 attacaattc cacgcaatta ccacaaaaca tttgaagaat atattaaatc aaaacgctca
    58441 tataccgatg ctactgttat taaaacgata aaaaatcaac tataacttta tcaacaaacc
    58501 cattaacatg ttatagcaaa gtatatatac tgtgaaaata tacaaacgat aaacgcaata
    58561 tttataaata taagttttgc attgtcagag aatagttttg cattgtcaga caatagtttt
    58621 gcattgtcag acaatagttt tgcattgtca gacaatagtt ttgcattgtc agactttagt
    58681 gctattattt caagatcatg ttttcttact aatactgtaa ttttatctaa atcgacacga
    58741 agtgatacat tgtcaataca cattggtgca aatgcgttct tatatagaga agaatcacac
    58801 tcggtaataa tttgtttata attcgcattt cgaattatat taatataatt ctctgcaagt
    58861 acgtctgcat tgtcttgatt ttccatgtcg gttagtatag atattgttga ctcaaataca
    58921 tattctttat aataacgggc caagttctgg atatttgaca ttgtttcatt tccgtttacc
    58981 atataaaata gatgtagatt ggaatttata gcggtccacg tttttttgtt tcgtataagt
    59041 aaatcaacga ataaacaatg gagctcagca tgaagatggt tatgggactc ggtgccctca
    59101 ttctagcact tgttgcagtc attggatatc ttatctatga taaattttgg ggaagcacgc
    59161 ctgctccgag taaggtggaa caacaggaca aaccacatga atttaaaatt aagaatgagg
    59221 aaattctcat taatagcgcg gatgaactca acacacttgt taaagaatcc gatgatgctg
    59281 gtgtaactgt attctttggt catccaggtt gtggccattg tatttccagc atcggtgcat
    59341 atgaagaggg tgcgggtgaa aatgccggga agactgcgtt tgtcgcgcag tacaatgttg
    59401 ttggtgatgc cgtagatgca ttcggtgtgg agggcttccc caccattctc aaatttaagg
    59461 atggtggaaa taccaagcag gagtatgagg gggatcgttc ggcggatagt tttaaggagt
    59521 ttattgagaa gtaatcaatg tattgtgcca atgtacaggg atatttattt tttgtactag
    59581 tattataaag caatgggtga acactcatcc gcttcggacc atgttaaaca aatcgatgac
    59641 aaatttactc gcgcgctcgg gcacgcgtcc aagacagtaa aaaagaatca gatcgtgttt
    59701 gaaacaccga aaaataaacg aggatccaaa cagtttacag aagagtatcg tcatgtgtca
    59761 aaaatagaag aagagttacc gccacatgac agtgaactat gggcaaaccc atatgaaaca
    59821 atggaatact tccatgcgta cctaggcgag cactttaata tagaagacaa tgaaaagaat
    59881 ataacatgtg cctcgcgtga accaacgatt gacatgtggc aacttgccgc aaccatacct
    59941 ctgttgcgtg tagatgaatt actagtgatt gccggcacag gcacgggaaa gtcatgggta
    60001 atgagtcagg ccgcgagaat gtttatgata aaacaatatt tgaaacagca gtcagatata
    60061 accgatattg ttagtagaga cccatcacat gtaatttacg tattgcgtga tgacaaagcc
    60121 aagcagcaac agtatgttga attcatgaag aatcccagta ttattggggc tgcggaaaaa
    60181 tattttacag aagcagataa aattaaattt cgacgtggcc aatcggatcc atcccaaaac
    60241 ccggtcgttg atacgcgctt ctcgccacgt cgcggtcttg taaaaatagt aacattcatg
    60301 agttatgcac aggcaggaaa ttttctagaa ctccatggag aatctgcatt caacgatgca
    60361 attttaattg ttgatgagat ccatgaaata cagatagcag cggaagcggc aggggcaacg
    60421 tggaaagaaa gcgtagagcg atttgagcag tatctgtcaa accgagttga atccgaaaac
    60481 aagggactat tgcttgcgtt aaccgcaaca ccatataaaa gtcttgatgg ttttgtgagg
    60541 ctcatgaatt atttttcacc gattggaaca gaacccctct caatggaaga gttttcagag
    60601 caagaaattg acccagtcct gggggaacaa atgaaattgt gtggtattga tagaacattt
    60661 tacaatgaca tctcaacggg tcgtctaaat gggtttcggt ttgtgtttta cagtattgaa
    60721 ctaagtgacc aagtgtatgc ccaatggttt gcacaaccag aaatcataaa aatccatgta
    60781 cctaccgatc gatcggaagc ggacgtttct tggatcatgg gaattgcaaa cgtgaaaaat
    60841 aatagatatc tcgcaggaca taaaaacatt ggtatggatc aaaaaaagaa atggacgcca
    60901 cgagggctga actggagtgg aagacagcgc tcgattgcca taacaacggc ggattatgta
    60961 aacattaaaa ttcaagaaga tggcattgaa aagacaatta tattcttccc aaccgatgtt
    61021 ggtgcaaagg cattttccaa atttattagt gcataccaac caaacattga tgtgatttac
    61081 atttcaaacg aagatacaaa gaacgatgtc gaaacgaaaa aaagtatgtt tgacattagt
    61141 gatgataaca caatgctagt aacaaactca gacaagtttg gtacaggtca cacctttgct
    61201 gacccggtca tgctttcaaa tgggctgtcg atggggccga aacacattta ctacattcaa
    61261 ccatccacat acgctggaat gatacagata gaaggtcgtg ctagacgcag atgtttacat
    61321 gcaggatggg gtgacatact tccaaaaata aaacgatcga ttattctacc ggtcgcaacg
    61381 gtagataatc aagagatgga aacgtgttat agcataatga aacaagttac ggatttggaa
    61441 aaaccgtttg tggaaagcat cgatccggcc atatttaatg catcatatac aaagcacgca
    61501 ttttggtcaa gaagaccgct tgggttgcta tatgcagaaa aagaagatcc atctccaaat
    61561 aaaaaatata agataggaaa aagaaacaaa caaatgaata tttgggatat cattgcacat
    61621 tatcttggca tttcataaat tagaattatt ttttacgtta ccgtttccag ccagttgaca
    61681 tgttaaatgt aacacgcgtg ggatttcctt ccaaatttac agatccacaa tgaagaagaa
    61741 gagggtgcat aattaacaca tcacctgctg ttccggttgc ttccgttaca cacatattat
    61801 ttaaatatga cttgtttgga tgatgtgccc atcgaacagt tcgttcaata aacttgggta
    61861 gcttggattc taccttttct ggtgacttgt tgtacataaa acccatcatg gcattgtgtg
    61921 acccagggag caccgcagta cctccgccgc cgtttccaac atcagtaaga aacggaagca
    61981 tcacgagaga tttactagta aactgccgat cggtgtcgcc gtcaatgtgc cacccattat
    62041 actcatccgg tggttcccat tcaccagtat caccaactgg atatctaaga tgaacccatc
    62101 ccatgccaaa tttggcacca tctgtccatt cccaattcga tccaccgtgt gcataatcta
    62161 gaaaagaatt caaaacaggt gactcgaaaa aatatggcca cttgtcttga tgtaatggaa
    62221 tcggatgtcc attatcctcc cctgtaatta ccgcgccagt gtcgtcatcc catgccttgt
    62281 attcttcact ttgttcaata cacccgtcaa caacaccgtg acgttcaagc gcaggcatga
    62341 tgatatcact taaaaaatta tcacatgcct ctttcgacat tacattttta agaatcgtat
    62401 aaccattatt gcataattca ttataataca tatgattagt catatcgaga tggatcaaag
    62461 tcggtctttg gttggtagaa ctgaaatgca atggctgaga tacgacgatg tccttttacg
    62521 gttggtaatc caattgcgtc cataagcggc agttgaggaa gatctccact gagtggccat
    62581 gcaagtccgg ttctatgaag tgtgtttaca attactgcgt cgtttccacc tgcagaatca
    62641 cccacctgtt ctcttccatc attgcatgga atcaatgata acacatgact acgacgctgc
    62701 tttcgtggat ttacatatga tatattagca cccacaaagt acacatcgtt atacgcagaa
    62761 ataccagagc gttctgccat atcactttca taatttgata atatggccgc tccaagttga
    62821 cccatgtgta atatccactc aaacattggc tttgcgagta tgttatatgc acgcttgtca
    62881 acctttaagc gtatagtatg aagaatatca ccatcctcac ccgtatatgc attaatcgcc
    62941 gcgtttagga aaaactcttg cataagtgta tttggaattt ggttaatatt aatagcacca
    63001 tgctcaaaca aactttgcgt aaacactaaa cgagtaccgg aatttgcaag taaacacatt
    63061 agaaaatcat gcgcttttcc tccccgttct attacgcgtt gccggggaac aacattatga
    63121 tttgatataa aagttttacc attaaagtct tcacgtcctg gtagtaattc atgaattaca
    63181 acacttgaga gtctattagt aaactgtggt accgtttcaa ttgtaagtat ggatggagga
    63241 tttggtgaat ttgaaagaac tgatgtagat ggttttgtag tgttaataac ctcatataac
    63301 ccccatgctt gtgttgggat tcttgcacat gtataatttg catcgtttct tacactcgta
    63361 tcaccccctg ccataaacgc attaattgga attgtaccct ttaaatattc atcaattctc
    63421 atatcataat tatttccaga aaatttatca agttttttag ctaacattgg aaacttcatc
    63481 accatattag caagtaaatt tgtagcagat gccataaaac aaccacttgg gtattggcga
    63541 tttgacatga cataggcaca gtcactttca tatctggtca cacctagatc tttaaaatat
    63601 tccaatacat cacgttgcca ttctgctttt tcttcggtaa gtgcattcaa tacttgctgt
    63661 ttttttgtat ttacacgtcg ctgactgagc ggcatctcat catctgacga ttcgtcattt
    63721 tttgtaacag ttgttgacgc gatgcgacga tccttgagtg gcctttcctc atccgatgaa
    63781 tagtcatcgt ggattacgtt attaatcttt ttattcgttt tcccaatatc tttcataaca
    63841 ttttctacgg gtttatcaat catttgtgga gatggagtat tggcaagttc ttcaagcatt
    63901 tgttcggcgg ttttctcctt tgatttttcc cgggaacgct gccttttgtt acctgtattt
    63961 gacggcgctg gtgccggtgc ataataagcg ttcgcgactg gaggcgcata ataagcgttc
    64021 gcgactggag gtgcataagc gttcgcgact ggaggtgcat aaacgttcac gactggaggc
    64081 gtatacgcgt tcgcaactgg taaaactgac gcattagaat ttgagatttg atatgcattt
    64141 gtatatggaa tacctggatg atatccacca tatggtgaat actgcgcgta tgacattgga
    64201 aatgcccttg atgacacagg tgcttgttgt acattttgag cagcagtctg gttccacaac
    64261 tcactaaatc caagttggtc ccaacgcctc tgatccattt acatttacca atataaaatc
    64321 gatatataca acaaattata ttttcccaag ttccctaaat aatccatatg tatatcgaca
    64381 tgattgacca aaacaagttg actgattcaa ataagctcag ttttcaccta gcaaccgcag
    64441 agtaccgtgg taaggttgta tgctctgcgc ctaaccgagc gggtacccat gcggaagtca
    64501 gcttgttgcg caagcatacg atgcagcggt atcgtaataa gaatataaca gtctatgtga
    64561 cgcgactgtc taagaatgga catgcaatgt ctcgaccgtg tgtttcatgc tcccggtata
    64621 tcaaggcata ttggccactt gctaccgtgt attacacaaa tgccgaggga aactgggtgc
    64681 gtgacaataa cctagatacc aatcacttgt gtttgtctga tcgcatgaat ctggcaactg
    64741 cggccacccg ggaaaagaaa cgtcgtcccc gttcacattc ggataccggg tctagttcat
    64801 cgggtaccga gtcgactgag ttatgcagtg agtgtgagta aaaaataatt ttttattttt
    64861 atcttatata ttaatttacg aatttacgaa attacttggc tacattcgca cccttcgcag
    64921 ccgcacccga cgaatccgtc gctggggcag ccatacccgc cgagcgcgat ggtggcgccg
    64981 ttgccgtaac ctcaaactgt acctctggtg tcttcttgga aaaccactgc cagaacttgg
    65041 ccgcgcgaac aagacgtttg gtacgtgtca tctcattctt ggccgccgca cgcttcgcct
    65101 tgcggtcggc tttaaccttc tttgactgaa caaccttctt ggaatccttg gaatccttga
    65161 ttccatcagc ctttactgca tcgtactttg ggcaatttcc accggcatta ttacattcga
    65221 cctcgtcggt gtttagggtc atgagtcact ttacatatac tatagaaaat attttgcgaa
    65281 catctcaaaa atatttgata taaataaaga atggactata taacatcaac acacaacgat
    65341 catatgaaaa agttagccgt attgaaatca cagattgact gtgatggaga tgtttgcaag
    65401 cgggtaaaac tcgtcccgcc aaaagtatac gataaatggg taaatacagt caaactatct
    65461 gggcattata aagatgagat ggacgttgcc caacgacgat tcaatgtgct atgtaatttg
    65521 ttatttaaag accggggtga ttttatggtt acgtcatcaa atcacgaccc gaatgatgtt
    65581 gtatttgtta aagaaaacaa tatatattgt gattttggta aaatggacat ctcaaagatt
    65641 acagaatcac agaaaaattc attctttgtt gttcgtaatt ttctggagaa tgcagtatct
    65701 aacgagtttg acattatcgc agattgcact gaattaacac tttcacaaac attttcatat
    65761 tatcgacatg ccaatcagga tcaacacatc gccgcatatc ttcttgtgga gacatttgaa
    65821 aagttaccaa gttcacttgt tataaaaact ccgaatattg catacaaggc aattgcaaaa
    65881 ctcattagtc gactatttga ttcaaaaatt aaaattcgta tcgaataact tgcaacgcca
    65941 aataaaacga caacttgaat acagttccct aatcatatgt atagtcacaa gacgaccata
    66001 ccagttgtac atgcgatacc aattattaat ccacgaaaga gaagtgcaat tatgaatgag
    66061 tttcttacag agacggaaga cttgccgtta cacaagcgaa aaaaagcaaa ggatgccttg
    66121 caacagatat ttaatcagct tgatcgtgag ttttatgatc aacgaaatga ttttgtttca
    66181 aaaaccgaag aattaaatga aaaaatgaat gcatttcaaa caaccgctga catttgtatg
    66241 gaggtggaaa aacaattgac gcatgaaaat gaaaaactca cggaagaaat tactacgctt
    66301 aataaaatta tccaggaaac tccaagtctt aaatgcagcg tatgcatgga agacttgcat
    66361 tctctaattc gcgatggtat agaaatgata tcatgtgaaa gcaatcatat tttttgtgca
    66421 gaatgtttga atgcaaaaac agaggggtca attattaatg cacctgcaaa tggtgttctc
    66481 cgatgcgacc atgataaatg caagcataat ttatgtgatc acttcaactt taatacaatt
    66541 gtctcaaaat ctacccgtcg aaagtttgaa aatgcatgca tggaagctcg tgtcagaaaa
    66601 gaagttgaag aaaataatac gcaagttgca catggaattg ttcctggggc atttgtatgc
    66661 aagcgaccgt gttgtggcaa gccaatgcca attaacttca atggatgcat gtcatttgat
    66721 tgcccggatt gcaatgcatg tttttgcgga ctatgtatga aagtattcaa accaaagggg
    66781 aataatcttg ctgaaaataa tgtactgttt cggtgtcatg aacatgtgtc tacatgcaag
    66841 cacaatgtac aggcaaaaaa tgaggacggt gttgcgtcgt attatattaa tgaacaagca
    66901 caaacaagcg tcacgcgggc attatggcaa aaatattttt taacacagag aatgctcatc
    66961 gatcacaatc cagcaactgt tcggaaatta ctaggattaa agccatccat tcaaaaaatg
    67021 acagcgtttt gtgcatcact gggtctccca atcgggccat atgggtttgt tgggacactg
    67081 ggggaagatc gtcacaatgt accggcagat gaagttatta ttttggattg aaattatatg
    67141 tatagtataa aacatggagt atgcgcataa taaatgtttt ataccaaaat cacgcaggaa
    67201 gtttacttca gctacaaaca cgacacatcg tcaccagttc cctaaaccaa acgatatgtc
    67261 tctgcgcagc tccgctcgtt tgactggtat tacaaagcca aactatcgtg aagtttccac
    67321 catctcatct cttgtatcgt cgtttgactt taatgcaatg caatatcaaa tggcaccagt
    67381 taccaagaag tcgccgctgg atcttatgat ccctgcaatg cgaaaacgcg tgaccaggtc
    67441 acagatgcta aaaaatgcac ttgcatcaca tggtctggaa aagaaatcat cccccgggga
    67501 tggaaactgt ttgtatcata gtctgaccga tcaaatcaat gcaacggggt tgtattccga
    67561 atgcaatcac atctcgatga ggagatcaat tgtggcacac atttatcgca actatgactt
    67621 ttatgggaac tttcttgaag aaaagcttgt taccaaacta cgtcttggta agtggggatc
    67681 acatgttgac gtctctgcgg ctgctgatct gtttaatatc aaaatcaccg ttattaaata
    67741 taacggcgat gatgtaattc tccctcgtca taataatcca gatagtgttg tcggtagcat
    67801 ttttctgtgt tttcaaagtg agcttcacta cgattccacc gctcgtgtag agtattgaat
    67861 ttatctatag ttccctaaat ggatttcaaa gaaatgtttg aaaacgaaca atatcaagtc
    67921 attaacttgg aacatgattg cgaaatcata aaaggaagaa tgcgtgcaga tctgatgcca
    67981 actccagacg aacttacggg gttatgggac tcgcgaccca aaacacgtga tacatattca
    68041 atttatggaa aagtagtgaa cgtccctcga tattttacat tttacagcaa gcggatgcta
    68101 ttaaccgcat ttggtggcca gacattttgt gcagacatgg tgaaggatgc atcgtacact
    68161 tcacgtgtta tggagcagtg cccagataaa tacaattata attcggtgct cgtaaattgg
    68221 tacatgactg gcaacgatta tgtatcattg catggagatc gtgaacgtgg tcttgtgcaa
    68281 agcacgccaa ttgtttcgat atctcttggt gggtcacgaa catttcaagt aaaaaagaac
    68341 gatacaaaag aactcgtgta ccaggaaatg ctcaatgatg gcgattgtat catcatgaaa
    68401 ggaactgatt ttcagcataa atacaagcat tgtataccaa agatgattgc taaaaaacac
    68461 ggaacggtac tgccacgtat taaccttacg atacgttcgt attatatata gtctaccact
    68521 cttcttcatc accttctgct atggcagaca ttctcgcact tgcacgttgt tgatgatctg
    68581 ggtcacgttt caattcttct gccacttgct ccaaacgagc aattgcgggt ggttttttcg
    68641 cttcatcact tgggtgtatg ttattaaccg cgttgtgttg ttcgagcatt ttttgatccc
    68701 gttcatggtc ttgtaattgt gttgcgacgt ccggtgctcc aatgggctgt tgaatagcgc
    68761 cattactata tcctcgtttt tctaatttag tagctaatga ttctctgcgt ataaacattt
    68821 tccaaaacat atatatccca gctacgatag cgagaccgag tacaaaccgt gcagtcacac
    68881 tattatcttc cgccatattt aatctatatg ttagaaaatc taccattaac aattgaccaa
    68941 cagtttcatg atttagactg taagtacatt cttccatcta acctaccatc tctcgattcc
    69001 actctatttc cacaaactcc agatgaacca cgacgtaaaa gccgtggtat ttcaccagaa
    69061 gaaccaatta atacactccc accgctatgt gtactggcat ggtatggcgc aacatttgat
    69121 cttttgcaaa aagtgattct atcacatccg cgtctactta ctccaaaagt tgtactatat
    69181 tgtctaaaat ataaagactt tgaaatggtt gcatacttta cagaagaact caggatctta
    69241 gaagaatatc agccaaaagc gattcttttt agaaattcgg cattgatcgc acaggcattc
    69301 aacgatcgat catcccttag actcattcac tatctctcat atgttatcaa taaacttaac
    69361 ccatccacaa tccatggtca gaatcaccca cttttaatgt aaatatgaaa tttattatac
    69421 attttaaaaa taaaatattt tttgtatata aagggtgagt aaaaaatatg gggtattcgt
    69481 ggatgtcata tgcatccgcg gcaaaacaca taccagaagc aaaacgcctt cgtgtatcaa
    69541 ctgtggcacg tagttcagga ggatttatgg gtaattataa acgcgcaggt agctcaagta
    69601 aaatgaataa acgccctctt gggcgtaaca cagttggtgg taaaacttgg ggacaaaaaa
    69661 gagaagcttt tattaaacgt catttggcac agtataaaaa gaataagaca gaacggcgat
    69721 ggtatgcatt agtcatgtgg gcgtacaagc caggtacaaa accatcagtg aaaaataaaa
    69781 agagcaaacg caagaccact aaacgcagta tgacaaagaa tcgcccccgt tcaactcgta
    69841 gatagattgt atacaatagg taattctgag ataaacggac atgttccatt gcgtttcata
    69901 ttaaacgcat atgaaacaat ttttacacct ttattttttg caacaattag ctctttatga
    69961 aatgttggac atgttcggta atccggcata aacgccgttg catcgtttcg aactaccata
    70021 aatacaatgg ccgtctttaa ctttggatac cgtgggtctt ggttttcttg tgttgcaatt
    70081 ttagttaatt cgcggacatg cttaatcgca cgacttgata caactttatt acctgtaaga
    70141 tcgtcttttt gacgcggctt gccccatgga aaaattgaaa gaccatcgac atagcttttc
    70201 ggagacttgt ccctgtccaa atcaactatt gtttttactt ctacgagagt atacgttcca
    70261 tctgcatgct tcaccaaaaa gtcagaccgc atgtcacatc cagcgacgtt tgcaacttca
    70321 gcttggattg atacaacgtc ttggaaaccg ggaagatgat tgcgtgaggc ataaaagttg
    70381 aacagttttt caccctgaga tggatgagca ccaatccaaa tgtcggagta tgtgcattta
    70441 attagttgag taatatacat cgtcgctggc gtgccgtatt ttttagaata ctcttgtttg
    70501 acatggtggc cgcgtttgtc cattttttgt gttacgcaaa tggcggcacc aggcgtgcat
    70561 tttccaccaa gatccaaact cggcatgtgt gtgattccat tatctttttc cgagtgtata
    70621 tcaccaacat acggtgattt attatacacg gatggccttg ccgttactgt ggactcaatg
    70681 tattcatgtg ggtgtatgta tattggtata catatccttt ttccatttag ggaactgtgg
    70741 tgatcacagg ctgtgggcat gcttatcgag ttaaatgtat cagtcttata atgcattgta
    70801 tatacttaaa caaatttata tttttaaata caatcacgaa atagatgaac acatggtaca
    70861 ttgaatttca ctgcatactc acgagtagtg aacggatatc cgcagtcttt atcgggacat
    70921 gcaccatacc atagcatggc ctcaatcttt ccgagattct ttgcccccat gtaattatca
    70981 gatactgcat aacggagcat aacacttaga tcatcccaag aactggatgg tacggtcgtt
    71041 ttccatgttg tatatacatt gatattaaaa taaatcgaaa gccatgaaat aacttctgcg
    71101 cgagacaggt gcttgatacc atcgttttgt aaaatggtat ctaggcaatt atgcttctga
    71161 tacttgattg cataaaaaat aattggtttt cgagtacccc ccttgataat cgaaggattt
    71221 gtctttagca taaaatcaag tgttttaaaa tcattccgac gaattgcttt gattgcccga
    71281 ttcacatgaa gaagattctt gccacaaaag gtatatgtag aatagggaac tcccgtcggt
    71341 ggataaactt tatgagcagg tgcagacata tagttaagga gatgtaccag tcgaggttgt
    71401 cgatgttgca gcgactgtcg attttgaaga cccgccgtat acggatcgtg ttatgaagaa
    71461 tgtcccaacc ccagtaagta ttgtcgcaaa tgttaatcca atggtgctac caatgaagtc
    71521 acgtgtttta cgagcgagtg catcttctgt gtcgtctaat tcggtttcaa gtgtagaaat
    71581 cctaccctcc aatctctctt tgtgtccttc cagtattaca atctcgcctt ttaatgtgtt
    71641 aatttctgcc tgttcggcgg cacaacttgg attttcgcaa ataggacacc ccaccacacc
    71701 atcattatca attataccag aatcccttgt tgtaaagtaa tatacaagac caagtacgat
    71761 accaactaca atcacggtga ttatgacttt cttatattca attgctcgtt tttttatctt
    71821 ttcaagtata cttggtccat cctctggatt ttttatacta gacattcttt aaataacaag
    71881 gtataaaaaa tcaaagttaa ttttattttt tatatataaa agatgaagaa cttttcatct
    71941 gacatatctg cacctcgaca gaaagttgca tcatctaaca cagtaagatg gtggctatct
    72001 gttgcaatcg gtgttcttgt tggtaatcta atattcctgg ggatcgttgc tttaattatt
    72061 cggaatacca attttgaaga aaagatattt aaaccgattg gcaaagcaat tggagaagga
    72121 atggaacctg gtatgatacg tgcatcaaag attgccgtga cgtctgcaca gaaaactgta
    72181 tatgaaaccg tcgatggtgt acaggatcaa gcaattgaag gaacgagtca gcgtgtcgtt
    72241 gaagccgtta gtaacacgcg agatgatatt ataaatgatg cacgtgaagt cgcgtctagt
    72301 tatttggatc agtatcaata attaattgcg tagtgtgttc caatttcgtt cagtggcgcg
    72361 tccagtggcg cgtccagtgt acctacgacg gctcagatag ttataattgt cgttctctaa
    72421 tttttcctgt acatattctg gcaaggcaaa atacggctct aaataaacaa tacgtccagg
    72481 tgggtttaaa taatgattta ccatatccat aactgcttcg aaaagaggtt gctcgtatgt
    72541 atttacattg tcaccattgg aattatatat tgaaacataa ttgtatggat aatctgcaac
    72601 ttcggatccc cgaccggaca tgatcataat accagaaact gcaagtttat caaaatccga
    72661 taaatcaaca ttaaactgtg aattctgaaa tgatgttaat atattattat cacgtgaaag
    72721 tacacctcga taattaccat gtgcgctcat atttaatagt atttgtatca tatcatctgg
    72781 actgcatgtg tcatgaccca ctgttgacat gtcggtaata tatgtattac cttgtaagtt
    72841 cgcagtagca catggttttt cacttagggt attgtatgat ttatcatacg tatctacata
    72901 cttggtacat gatacaagat cattcttcgc ggaacatttg ggtaaatcaa taattattat
    72961 gtgataatga cgatttgtat acttgttcaa tgctttttcc aaaatctctc tttttttatt
    73021 ataatgccaa acaatacttt ctagttttgt tacgagaata aactcatccg catcatctaa
    73081 aaattcgtta tttttaggat ttgataatat attcggtaaa tctacaataa cacggttatg
    73141 tgcatctgtt actgacgaat tgtctatata ttttattaca cgttccccga gtgaatccat
    73201 ttatataatg catataaaat caataaaatc caggaaaaag gttattaatg gactctgcag
    73261 taaaacacgc gaaatcttcg gcgcgctcgt ttagatccgt ctttgactga gacgaaatat
    73321 gcttggaata ttcctgctgc atgtcaatcg tctccttctt tgcaaactcg gacattgggt
    73381 gtacctgtgc atcttcgagt acctggaaat acttcttgta tgtacggtcc atatgcgtcg
    73441 tgtaccagtc aggtggcttt agtgccgcct ttgccgcatt tgccttgcga cgttcaccgc
    73501 caactgtcgc aagtaggttg ctaatgattg cattcttttc tgcgagtttc tgattttgct
    73561 tgagtagctc agcagcatgg gctgagcact gtgtgtccat acgtccttcc gcttcgatgt
    73621 aatcggcttc aataccctgt gcttcaagca tccatgtgtc aactgccgca tgagttgcat
    73681 caagctccag ccgcagcttc ttgatctcct tcttcagagc agagttttca tcacgaatgc
    73741 gatactgatt gtccataaga tcatccgcaa aagtgcgctt aacgtttttg cgagattggg
    73801 gaactgtaga catatgctta aagattgtgt tggttgtgat gcgctgatat ataattcgtg
    73861 ttggatatta taccaagttt tatatattgg agtcggtatt attatatatg cataatataa
    73921 atgtcaactc gcccaagggc aaattcattt agtagatata ccggagttag tcgccaactt
    73981 cccggtgatt gggccataaa tttcagagca caggagtacg atgtagatgc acattttccc
    74041 aggataccaa ccggtaacgg atacgtaccc ccacttgata ttgccgatgc atatggtaat
    74101 gttgtattgc cacagtatta aatagataat gaattgagta ctgaacagaa caacctgttg
    74161 ctttctcaga tgtatccggt actctatgct cgtgcagaag aagctgcaaa aaatgaatgg
    74221 agacttcgcg aatatgaaca gcaccgtagg cgcgaaaatg cacgacttaa tttaaaaaaa
    74281 ttaaagcgtt tgtataacca caaagacacg atgtattact ggaacagttt ggtacatgtt
    74341 ccaacggaac agtatataac gcgattacat aatgaataca tggatgacaa ttcggtgtaa
    74401 acgtacacag aaatttgata aagttgttac gataaggata tgtcttcctc tcagcaaaat
    74461 ctggtaaatg atatggcatt gtcatatacc cgtatgaact tttattactc ggagtttatt
    74521 cgtgaagttg gagtctttcg tgcactcgcc atgcgaatgc gtcattacta tccaattcgc
    74581 gactcttgta ccaacaatgg tataaatcgc acaatccaag atgttatcaa tctctcatca
    74641 attgatacaa attttgttgg aaatcgctta agcgtgttta acacccttgt cagtaaactc
    74701 actcgtgata tcggtaagta aaaataagga gtgatgcaaa actattgtta tgggatttca
    74761 tacagacatc ataaacacaa aaatcagatt tacattatag tatgtataaa gtaagaacaa
    74821 catccggcag agcaagagct cacaaacaga actgaagtag actagctagt tagaaagtaa
    74881 tttctccggt ttgacaaccg agaataaggt gtaggggtgt tttgcatcac ttttatatta
    74941 ttcatatatt aaatatggat cgtatcaact ctggaattgc atattcacaa gagtttgtga
    75001 agccattaaa tggtagttat attgcaacaa cagtaggact cgggtttatt gtttatcttt
    75061 tactatgggg tatgttattt actagcattg gcatgctggc aacgaagggc aacaaaccat
    75121 tatatggaag cttacttggt gcatctataa tatgtattat atcgtttcat gtatgggggt
    75181 atcgtcataa taaaaaactg ggcataacaa cattttcaac ccaggattcg tcactgcctt
    75241 caattcctgt acctgatcgt acaataacca tacgcactcc acctgaacta cgacgacagg
    75301 attcaatgac tacacatacg aacgagcatg atagatttga aaaagaaaaa tatttagaaa
    75361 caatgaatca cgatcctgaa cgttataata tgtcctatat tgacggttac atattttata
    75421 ccgtgactgg cccagatgga aaaccacgta aaatgtttga acgcgcaaca ccccaatccc
    75481 tatgggcacg cacaaaagat aaaataaaaa actaccgtaa aaagaaaaga taaaaatgtc
    75541 agattataaa tatataatag tatatagata gactatggca aacgttaccc ttattaataa
    75601 attagaagtt ctacatgcga aactagatat tgttgttagt tcatatacaa caaaaggcga
    75661 aaaaatcagt gcactatctg aactcaaaga ttataatgca attctcatgt ttcaaaaaaa
    75721 tcaaaatgat gctgcaattt atgcacaggg tggaattact cttattaaaa tgatgaaaaa
    75781 tatgacaaac gtaaacaagc atacaattgc tcaccttaag gactcagtgg aaagcaagtt
    75841 tttccacaca ctactactac tcgataaaga cgcgggtgcg tatattaaaa tgccacaaat
    75901 atatgacaag gacattgtat ttccaagtcc agatttactt acatactatc ttggtgtaaa
    75961 aaatactctg tctttaattg aaccatgtat agtgtaagta ttattaaata aattagtaat
    76021 tattttttac ggctcaattt ttgagccaag ccccattcta cgcatcgttc taccgagcct
    76081 actctccgca cctaacacgg cacttgctcg cggatttaca ttgggaaatg cacgatctct
    76141 catccattta ttgaacttat tatctggatc acggaccgag ttggccgcat tgccaattgc
    76201 agtgcctgta tcttttagcc gctgtactgc agcgacgtcg tacccctttg cggtcataaa
    76261 ctgaccaaat acatagagta tcataaacgt actcgcaaca atggataccc aaatcattga
    76321 tggatcattt agagaaaatg ccattacttg gatggcaata aaaccaacaa ctagcattat
    76381 gtgaaacggt gtattcattc tcctttgtat ttataataca cattataaaa ttatttacag
    76441 aatattttac gaggttcaca tgtttttaca gaatccgcca tcgccgtatc acacgatgca
    76501 tatccgtctg tatgtctctg gtaatatgca ccacatggat cgctccgtgg cacgtttcta
    76561 catgcatcta ctaattttaa atttttaatc aagtccgtac acttgtttga tgcatgctgt
    76621 tctttgttct tctcggacaa ttcaatatga tcaagagtta tgaaattccc atttaaatcg
    76681 gtatttactt ggtcgatact cgcccccgta aatatctcaa taatatcact cttatcgcta
    76741 acacgcaccc accataaaat tatgagtata tttatgacaa tcccacatag aattccacca
    76801 acaacaaggg cagttttcca ctgcatcttt atataacaac aacattttct gtgcgttccc
    76861 caaatgtcca ctgacgagta cattaagaaa agtcttacta acatcctaaa agccattaaa
    76921 aataacgacg aatccagatt ggttgctcat gtcaacgctc ttaagttttt gattcatctc
    76981 atggacaatg catcgattac tacaatcctt ccggatatta tgagtctggt aacttcaccg
    77041 tcacgtgagg tccagcgacg tgggatcaag attattatgg atctagggat ctccccgggt
    77101 gaatttgcct ctcaattggt agtgacaatg ggcaatgttg attcgacaaa gaacgaacct
    77161 tctccaaaga ggtcacataa tgaacttcta ctggaaaatg aaccaaagtc aaaacgccac
    77221 gtcccagcac gtattggtgc agttgcaccc gtttcgcgcg cggcagggtc gcatccacca
    77281 atcccggcgg ttgtagatga tgaggaaaca gacaatgaag actgattgtg ttattttgga
    77341 tggtagagta taaacaaaca tggacgtctt atttagtaag ttaatgttta cactcggtcg
    77401 taagcgtatt atttatgatc gtgacagtga cgaaccttat cttgaacgtt attatatctt
    77461 tctaaaagaa cgaacctggt tcccatttaa tatcttttta cataagtttc ttaaatccga
    77521 tccggatgat atgcattcgc atccatggtc ctttgcaaca cttatcttat ggggtggata
    77581 ttatgaacag acattaaatg gtgtaacgtg gcatggaccg ggatcatttc gcgtggccga
    77641 tgcggataca tatcaccgag tcgagttgta taacaaacag ccatgttgga cactctttgt
    77701 tccattgaaa aagaaacaaa attggggatt tttaacacca aatgggtggg tgtcacatgt
    77761 taattacaga aaagataaag ttgaataaaa atattatatt acaaggaaaa cgacattaat
    77821 gtacgtcgta tatgactgat tgataccatc aacgaagtat catacccacc ttttgttgca
    77881 ataattgcat gatactttaa agacatgaaa tatgcttgtt cgtgataaat aggtggtata
    77941 ttttttcggt atccgacttc aatgatgtgt gtgcctgttt gacaaaatac catgtttgat
    78001 aaaccagcac cgtgtgcggc aaatacaact cgtgcgcgat taaactcaca tgcatcggca
    78061 tgtacagaca ttttacctgg aagtaatgga acaaactcta atccagaatt ttctgaaaaa
    78121 ttcgaaagta cgttacgtat cgattcatga ttttcaaatg atctggattt cttatcactt
    78181 cgtaaaacat ataaaagact cggttttgta tttgcacaat actttggtga aagagaatcc
    78241 tttagtaaca taaagtcatc atatgagcga accgtcagtg gacgttttct ggatggtcca
    78301 ttccaccgtg gatatggtcg ccatgtgtat aaagtatcgg cacgaacgtg caagttttga
    78361 gtacttacaa atcttgttgt attgtatcca atcatcgaca aatagttaat aaatctaaca
    78421 tgtagtcttg tgtttgcaaa gtgaattggt acatctggca aatacattaa gaatcgtaac
    78481 catgatggta cggtttcttg catgaaatgt ccatttcctt ttgtataata aacagttgaa
    78541 acgacagcaa gtctatcaaa atatgcgaat gaatttactg attttttaca ccgattgtcc
    78601 cagtgcatta actgtaaatt acatttgtca ttgaatatgc cacacattgg tggaccgtcc
    78661 aatttggtgc tgccgttttt tatagaaatc aaaatatcat cggtcacgta gttgtattta
    78721 tttccaatat tcatgccaca atgatgtttg cagctttcaa aatggttata tggagatgaa
    78781 tgattgcaac acaaatctag acctgttact gaacgtggtt tagatggtac agaagttggt
    78841 gtacgacgaa tagacttcat tatgtgtacg ccgcatgttg atgctcgttt aagatcagtt
    78901 tgagttgtaa cataacacga agcatagtat agcaacatat acataacaga caggacagtc
    78961 gtttatacac ttacactgta ataacactgg tcatatcgac cgcaactggc tgtcgacgaa
    79021 ctgcataatg gggagcacaa aacactgtat gtggcttgac tgcagcaatg acgtaccgga
    79081 taggaggcaa ttcaaactta aattcatacc aataaagaag atttgcctgc aagtaaacaa
    79141 ccgtaaaaat accaaaatgc cagaatgcat gcaatgagat tccttgttca aatagccatg
    79201 tcgggcaccc tcctgcttcc acttgctgtg aatagtatgc tccaccgaga agtccaatta
    79261 cactgacata gaacatcaaa catatgaacg gcgaatcagt gcatataaac tgacagatac
    79321 caacaatacc atgaagaccg atcattacaa atgcaagagg aagttccgct tttcggagcg
    79381 tatctgcatc gtttgcaaaa taaatcagca ttacgtaaat accggtactc aaaattgcaa
    79441 ataaccaaaa gtacgaaacc ttaaccatga cgatttgcgt aagaaatacc tttgttacgt
    79501 gaacaacaat ggtagcgaat agtgcataga ccggaattaa atccgcggga tgagtgtgtt
    79561 gagcataaat tggtgcagca tgaaatgcaa ccgaccctac cccagcatat attaataata
    79621 cagcagtaac cgtatgaaag ttgaatggaa ttggtctgtt ttgccatagc ataataatac
    79681 catacacaat tgcaaaaaat gcggtagcta catttgccgg ttgaaaccga gtggggtgat
    79741 caatattatg catttcttcg caccagataa ccatttaggg aactgtaata aactatatta
    79801 tgtatacgag ttaccataga cgaacagcct tttccataac ctcaggtgga ggtgaccact
    79861 ccacacgacg tacaatatta tcatacataa tgagagtggg aagctcactt agttcttttt
    79921 taatatcttc cttttgctga tcaatgacac gacgcgctga gaaaatctca gatacgacac
    79981 cgggcatgag tgcggtattg gcgtttgcat catcaagacg cttcttgtat acggattcca
    80041 tgacgcgaac atcatcaagt acgggtttgg cagttgggac aacaagttga cgatctcctg
    80101 aaaaatactt gcgatacgac tcaaacacga tgtctggcat ataaaaaact ggtccaggaa
    80161 aggatccgac tttgttagtg tcctcatttg ggtgcatatc atctggatca tacttgttat
    80221 tgtttcgctt aaacatacgc ttaaaattag ggaacttcat gatcaattta gttgcagatg
    80281 gttaacaatg tggggtagtc tttttcgctg cctacatgat gcaatgaata tgtattcaat
    80341 gtcatgttat caagaccgtc ataaatccaa tatggagcta gcgcatcaaa ttattacaac
    80401 aacgcgcaaa tcatttcacg atgtcatcaa aattcatgat attaatccaa gtcatctaac
    80461 acgatcggca acattcaata atatgtgttt taccgtttca aatctaaagc aggatccaac
    80521 aatgatgcag tgtggtatat gtggggacat tagggtggtc aggtacaata gtatttgccc
    80581 atgtagaagg gtatgtactg gttgtactgg atatgattgt atttattgtt agtcaggtgt
    80641 tatcattttt tgtattgtta taattaaata atggaaacca gaagaattat ccaaatagtg
    80701 ctcgtagtaa ttttactact tggtgcattc attgtcagta tcctttattc atttacaagc
    80761 ctccttggta aatttgcaag cgttgcgtcg atcgaggtag ttgaccgcga ccaagctgaa
    80821 atagataatg atgacagttt gcccgaaaag attgatgagc atgaagatga tgtaaagacc
    80881 acgggtgcga atccacccgg ggaaaatctc ctacctggtc cggatactac aatttcgaat
    80941 ggaaatgccc cacttgaagc accaaatgtc tttacaatta atgcggtcaa tggaaataca
    81001 aaactgttcc ggatcgacaa ggttaaattt atgaaatacg ttaacgacac caaccaacaa
    81061 gacagtggca ataataacta caaacttcgt gcggttcgta tcgtaaaaaa taacaagatt
    81121 gagaatcagg gatgggattt atacaagagt gatgcattta atgtagaaat atttaatgcg
    81181 cccggtactg gtcaattctc accaaataca agcaaggcac aagttcatgg atcatctgac
    81241 ccagcggatg ttatgtggga tgttggtgat aaaattgcat ttgttactgc aactgttatt
    81301 gcataattca ctgcatacat ggcacacgtt ccccggatac cgtgtttggc tgttccttca
    81361 taataaccca gtcgccattg gctggaagtg catcactact ctcagtgata aactggtata
    81421 caacaccctc tcgtgcaact cggtcggtcg tgtacgcttg ccacgctgta ccattataag
    81481 taagcacttg tgttggctgt cgtggatttc gcatatactt ttcccgatca gggaccttgt
    81541 gatacacttc tgtacctagc ttataacaat ttttttcaac ttgatccgcg acatacccgg
    81601 gatcggtcac tgtatttgat tcgggtaatg atgcttgtcc aggtaatgca ttcttacttc
    81661 caaggatagc aaatacaata ccaacaattg cgaggacaac agtaaaacca atcgcaatat
    81721 atccaagtct attcatttta tattactgtc ataaaatttt ataaaatgta tataaatgat
    81781 ggatatccca taccgagaaa ttcaggggtg taaatttagg gcagggcatc aattgggggg
    81841 aacatgttat atggcagcag caaatgcagt ctttgcaaca agttatgcat ttgaacatag
    81901 cacaaataac ccagacatta ttaattacat agctggttat tcagatagtc atctccccag
    81961 tgtatatgga agcacaacgt gtcccatggt accaagttat attggagatt tgtataatga
    82021 catggcattg ttatttaacg atagcggtgc aacgttacaa acagtttatt tattttccac
    82081 tgtcataaca ctcgctcaaa ctaccaatcc aaatctttcg tctgtgttgt tatatgatac
    82141 aaccgcggat atcggtgaaa aacatgtaaa agtaccaaaa gaaaatattg ataatgacta
    82201 ttttaaaata tatcaaattt gggacatttt tggtagacat tcaaatatga ataacgacgg
    82261 ctttgatgag gtacagcctt ttgataaaaa ttcagctatg gtgggtggtg gttttcctca
    82321 tttgcatttg ctagcattat tattagcatc tggttctact cctacatatt cacgcgcaaa
    82381 agctgccgct gtcgatcatg caattgatac ttatgtgaca actaattttc ctactgtatt
    82441 ggcattgaat atgagacatt cgaaaaatgt tacatccggt caatctagcc agttacaaaa
    82501 tatacaagac agatacttct tttgggagtt gtataaagtt tcggacaaaa tcgcatcacg
    82561 ttcaaattgt ttaatttccg ggattatact cagtgtatca ggtgaaaatg gtcttgtaca
    82621 tgcatttcaa ttaattccat gtaaaaaaga ctttatcatt tgttcataca ataagtgtta
    82681 taatacatca gacccaagtc atcatttgat taccaaacta tactccaaga tacttatggt
    82741 tacatttctc ctagaataaa aggccagcta tatatagcta tatatatgtt tgacattacg
    82801 gtactaattc ccgtcccaat tattttttta agcatcttta cgtgtgaact gtgtatagat
    82861 cgcgtatgtt gtcctgaaaa aaaaagagtg atacgtgtcc caagagatga acgaataaga
    82921 ttggcaccaa ttccagaaga ataattttat tttttaaata taaatacaca atgccaactt
    82981 ggttaaaaaa attaataccg tatataattc tagttgttgt ccttataatt gttgcagttg
    83041 ctacgtaaac aagaaaacgc taatatcgca attttttcag tgacatttcg cacacaagat
    83101 gcaaaagtag aaaacgctaa tatcgcaatt tttcagtgac atttcgcaca caagatgcaa
    83161 aagtagaaaa cgctaatgat ttatttttta attacatatt tattttaatt aattaattgc
    83221 ccgccaccac aacacggcgt ctcattcaaa cccggcggcg tctcattcaa acccggcggc
    83281 gtctcaccca aacccggcgg cgtctcaccc aattccggcg gcgtctcacc gtgtttcatc
    83341 caattccggc ggcgtctcac cgtgtttatg atgattttcg ccaagtcata aaatgcgatc
    83401 agggaactgc ccgtgtatag tgttgttatg gcagcgtgta cggcgtgtta tgacttgtgt
    83461 tatttttgtt gttatgatgt ttatgtcgta attcttatta ccaaacggga cgaccaacaa
    83521 aagcacgagc agaggcctcg ataacaaccg aactcttgat gatgtcacgc acatcagccg
    83581 ccgtgtacac ctctgacttg tgtgtgaaca gcgtgtcgca aatgagggtc acggcggatg
    83641 ttgtgtttgt actatggacg cgcttgcatt catccgaaaa catggtgcgg atgtcggcgt
    83701 gttgcacagg gacgcccagc attcgaacca aagcggtcac gcgcgacagt ggctcggtat
    83761 caatgagctg ctcgttacga cgggcttggg aacgttggcg acgggcacga cggctgagcg
    83821 tggcagcaga catttaggga actggtggcg tgtgtggtag agtcagaaga cgcggtgagg
    83881 cgaattgcca atgtaagatg tcataattaa tgagcatctc actcgagcac agcgcatcgc
    83941 aacgcatcca gaaactccac agctttcgct ccgttcccta aatggccacc caatcggttc
    84001 cccaaatgcc cattgccctc gcggtgccca tgttgcccgt cgcgtccgtc acccccgtga
    84061 acggcgcatc gaaacgcaag cttgacgaaa tcgtcatgac cgccgttgaa aatgcaccgc
    84121 ttgccaagcg caccgcgttt cgcgaggcgt ttgacacagt cgccgtgcca atcacggcgt
    84181 atctcgccga ttccaggatt ccatgcaccg aaaccgtaaa ccggctttcg gcggagattt
    84241 ccgagctcaa gcatcagcgc gacgaccaag acgccgcgct cgcaaaggaa atgtccgata
    84301 agtacaatct cgagggggag atcgaacgcc ttaaggagga cgatctccga tcggaggttg
    84361 aggatctccg atccgagctc gagactgcga ccaccaggac gcaagaacgc gagcgcgaga
    84421 ttgccgacat tcgcaatgac tttgatcaat tgcggcgcaa tttcgacgat gcggaggcgg
    84481 cgaatgcatc gattactcaa gatctgcaag atgcaattac tgcgcgtgac aacgccgatg
    84541 ctgcacttcg cgagcaccgc gaaaacacgg cgacaaacac ggcgacgcag ccaggtgccg
    84601 taccgcagtg cgttgtttgc tacaccgaca ttttctcgat cgccaaagtc ggtggacttg
    84661 tcaagtgcga caacgacgag tgctcggaat ttctctgcaa gacgtgcgtt tctcccaaga
    84721 tcgagtctga cctcccgaca ttgaccgacg agggaattaa atgcacaaat aagaaatgca
    84781 acagccccat ctgcgaggcg agcttcatgt cgtttttgac gcccgacgtt agcacaaagt
    84841 acgtgcgaaa gatgggcgaa attaccgccg caaaggagtc ggggacgtgc tcggatttcg
    84901 tcaagacacc gtgcggatgc ggtgacgcga tgcgtccgta tttcgacggg tgcgcgacaa
    84961 tcaagtgcaa caagtgcccg gcttattggg atgcgattac atttactcca ttcattctcg
    85021 gtgagaatga ccccaacgaa acggcggatg agttgtacca acgcgcgcat ggtgcgacgt
    85081 ctcgcattgt cagggagcat aacatgggag attcgtattt cattaacaac cgcgctgcgc
    85141 gcaacgtaaa cgagattgag cgaatctgga tgaaatactt catcacaaac aaggcgggtc
    85201 gcgatcaagt gctcgcagtc tttcccaaat ttgagacctc aacgaaaaag aaactccagg
    85261 agatgcttac gctcatgggt cttcccactg tcggatatgg aatgtcgtag aactgtgtcg
    85321 taattgtgtc ttttgtaatt aaatctgacc aattaatccc gcaaaaaaag aaaacataat
    85381 atcgagccgc cgtcggtctt taatctaggt ctttaatctc ggtctttaat ctcggtcttt
    85441 aatctcggtc tttaatctcg gtctttaatc tcggtcttta atctcggtct ttaatctcgg
    85501 tctttcggtc cacgtgaacg gcgttttagg acttggtgga atttcatgtc agtgtaagat
    85561 gacgtttcat cttgagatac aatctctcga cccgtgtacg gtcgcgaccc tcaactcatc
    85621 aactcgcagc cagttcccta aatggacctt ggtgcttccc tcacgatcag cccaccgtcg
    85681 tcgccgaaac acgacacgtc gccacccgaa gagtacgacg cactatggta cttgaccaag
    85741 tgtgtcttta tcgaccacgg tgaccgcagt tacttgaagg cgtccgatct caaggtacag
    85801 atcttgaaac agacactgct cgatattctc gatgcgcacc gtcagtccat ccatggaaaa
    85861 cacgagcgcc gcgttannnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    85921 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnntcgt
    85981 tcagcaccag gcgcacctcc agcaggtctc gtccaacaac gtcaccgcgc gcctcaactt
    86041 caacttccca gttcttgagt tctactactt cctccgccgt aaggcgaaca aggacgcggg
    86101 tgatcatttt aatttctcgg gcattggtgg tcgcgatcca gtcgtatcgg cggagcttct
    86161 atttaacaac acggcgcgtg tcacgcagaa gccggcggta tggtggcgtg cggtacaggc
    86221 gcttcagttc cactcgtctg cgcccctcac caacatctac tcgtactcgt tctcgctctc
    86281 gccagaggac ccaattaccc catcgggttc ggccaatttc tcgcgtctag attccgtcga
    86341 gcttgcgcta accctacagg acgatttcgg tgccgcgcat gacgcgaact ccgagctctt
    86401 cgtctttgct cgctcgtaca acattcttaa atttacaaat ggtcttgctg gtctattata
    86461 tagcaactga aatggcctcg ctggttggat acttctacaa tgggtacggg ggttgtatat
    86521 atgcaaaatt aattataaca atgtgttata taaacaaaaa aataattttt ttacaatact
    86581 aatataaatc aagagcatat atacagaaaa atatttttta cgctcacaac ttaccattcg
    86641 aatacaacgg atcacaattt atagtttact ataagtaagg atggacgcca tggactacga
    86701 acaacgaaga caaaatgtga tggaaaggtt ccaattattg ggtccaccgc ccagtgccat
    86761 ggccgtagat gcagatacga acgcccgaat atacgaattg gtggcgcgca atttcaatac
    86821 aaatttggcg tatgaaaaag tcccatatct taataagcga cgttcgagtg cagttgattt
    86881 tgacgtagac ttattgttac gaatgcaagc tggtaaatca tgttacttgt ttgtagcagt
    86941 gttgatgata tatacgtctt atttaaggta catactggaa aaacggttaa agtatctcca
    87001 atatatagcc aatcatacag ggtcaatgac tggtgcacaa caaaggcaac ttgagtctct
    87061 tttatggtta aaaaagacca ctaaaaattc tgaggtatgt gacacaacgc ttccacgtga
    87121 catagttgat ctatatacca gtacagcagt ccgaacaaat gagatggccc agcaaggcaa
    87181 tacatggaga ccgtttactg tagggattac tttagagcat ggcggtgacc cggatcatat
    87241 gttgttttca gtgttaaatt catgtggaat gagcgtaccc gaaaataact ttgtgggctt
    87301 gatattaaaa aatataccga atgaagttcg tgtagatcat gtgtatacaa ttaggaaggg
    87361 ttttacatac tcagatatga ctatgccaga tattgtaaat gtaacaaccc atgatgttta
    87421 ttcgcgtggc acattgttaa ctcatccgtt tattgcttca tttgatactt caaccaagcc
    87481 agaagcaatt gatgatcacg gactgcgtgt tgatggtaat aaagcagaag aaagtttcat
    87541 tgcagtactc aagtctgtca tgttgtatgt agaattgttc aagcaaaagt ataattatag
    87601 tgaaataaca cgcactcatt tttcaatggt tgtaattcaa gtaagttacg gacacgatgg
    87661 tgagccgtta tatgccgatg acgcacatgc ggtgctagta gatatggatg aggatgaaaa
    87721 tgtatttgtt tttgatggaa atgaagggaa atcgtaccca ctgcacgtgt ggtatgcatg
    87781 gtttactgaa aggtatatcg aaattgaaaa tatatcagtt gctatgatac ctgtcactga
    87841 tcagtcggct atcagcgtga tttaattagt tctgactact tgaccaatat tactagatgt
    87901 attctgcttc aaaataatgt tcatatggat acattatctt atttggtgca ttgtcaatta
    87961 gaacttgagg atttgttaaa ttcctaatct cgttgagatc cacaaaagat gcacgcatgt
    88021 ccgcgtaagg tctatataat ctcctggaat ctactctaaa tgcttcccgt tgaatcatat
    88081 ttagtttatc attataattc atatcgaggt caattgatgc actatatgga agttttaata
    88141 cgtcagttat ttcattcaat acgacgttca tctggttgtt attaactgcg gttataatag
    88201 tcgaaatgtc ttcatcatgt atacgaaaat ccccatctaa acctctaaat aatttattta
    88261 ataaaatgtc tggatcttgt acattattat tagtcacagc cctagcaaat gtcataaaat
    88321 ctgctgcagg aatatgttct gaaaatgttg aagttggtgc aagtatcatg agtatgatat
    88381 acgaaatgtt taacaccttg ttacaattac gttgtaactg cagtgcattt atacgaagct
    88441 ggttaatacg attaattact tcagcaatcg ttatattaaa ggcgtattga aaaatttctg
    88501 gattatatcc atacccaaaa atttgctcaa tggttggaaa tcttgataca aactccaatg
    88561 cttcggttgc atcagtaagc atcagtcttg caatgcaaat atttaatata gcattatagt
    88621 tttctttgtc aataggatcc tccaaatctg tagttattcc ttctgaaatc caatcataaa
    88681 tatggcgatc ttcttttaaa cggttaacgt ctcccattta tataacacat ataaaacaga
    88741 agtacgaaat tcacgttata acaatatgct agctttaacc gtatgtattg cgactagctt
    88801 tatcggatcg actcgttata tgcatacaac gcatacaacg catgtgcgtc catatgcatt
    88861 tgttcctgat ttattcgaag tatcttcgct gtctgtgttg caaaaagaca tgtcggacgt
    88921 atatctaccg gcaattacag gtcttactca catttttaat ttttacgcaa tttttttact
    88981 atttgatcta tacattattc cattctacaa gaacaatggt ctactttccc catcaaagga
    89041 ggagattctg gcacataaca tgtttctcgc actagacgat ccgttattta ctccaatcac
    89101 cgcggaacag tacccactaa aggaagattt ggatgaagat gaactgtatt atgtcggtac
    89161 aggtgcacat gccaagcaat atattacaat tacagatgac gaatatctca agtatgattt
    89221 agtcgtacgt agtcgtgaat tttcagcgca ttatgacatg gatattatga tttgtaagat
    89281 tgttgacaat tagaatactt gcattgtacc gcattgaatt aaaaaaaata ttattcttat
    89341 ataaagaaat agtttaaaat atggagacac gagattatat tatcgttgga ttatccgttg
    89401 cactcacact aacattagtt gcagtaatta ttgtgcttgt taatggaaaa gcccaacaac
    89461 tggagaaccc acggtatcac agtggcgata ttatggacga ggtaaacgcc gcgataaata
    89521 ggggagaagt agttgctcct aatgtaattg gtatcgatgc cgaagtgaga cgacgtcaag
    89581 aggaagccgc gaaatcgaga ttatccgatg ctgtggtgaa taatatggca gctgattacc
    89641 tggaattgta attctatcca tgtgtagacg atctggcttt tacaattgca gatattatca
    89701 ttgtaagtag accaattcct ccagctgtca tcaaaacaat accagatttt tgggtatcac
    89761 cgttttgata catgagtgct gcaactgcaa gtgcagaaat gattccaata acaacaataa
    89821 taacaaatag tttacgaata ccaaaattgg gcgtatattc tattttttgc gacggagcac
    89881 ttggtaagtg aattgtatcg gatggtatgg tgaagacaga cattatataa tttaatataa
    89941 taccaaagaa aatatagttg cagctcatgg tactaaatat tattcgtatg tttttacaat
    90001 gtgaatatgt tatgcctatg atttatgtga ttatgatggc atgtatcccc ttgacattta
    90061 ttataaatga agagatggta ccatatcaaa ccataacaat taatggagaa acacatctca
    90121 ttaaagattt tagatatgat catcctctta ttgaagaaac cgtgacgaca agtcttcttg
    90181 ccgtaattaa ttcatttggt acctttgtaa ttattgcagt aacttggttt ggtgcatatg
    90241 ccgagttgta taaatggaag tctgctgttc atacgttagt ggcatatgga cttgcatata
    90301 tgattcaaga tttcattgtt gcgtttggga agtattatat cggagcattt tgtccgaatt
    90361 tttatgacgg atgtggttgg gacaatgatc ttggcatttg tacggttaat tttgaaaaag
    90421 gccggcgatc atttccatcg ggtcattctt cgagtgctgc tgtagtcttt gtctatctta
    90481 ttttatcgat gaatgacatt cgtacagttc tgcgcaccca gaataacgtc ccgataatta
    90541 tcgacaagtt gctatttctt gtaacacttc tatctgcttt tgtattttta ttcgtgggtg
    90601 caagtcgaat tcacgatttc tggaatcatc cacctgatgt gattgcagga tttttaattg
    90661 gcgggttaag tgcgtgtgcg tgtcgttata cgttgtagta atcaggctaa atcaatgaca
    90721 tcacatgtgg tatttgaatc aattacaccc gcgtcaaaat tctcaagtgt aatccccccg
    90781 gcaagtagat tgattccaag ggttgctttt gcaaagaacg atagaaatat aaagatgtat
    90841 tcgccacgta caaatttaga cggtgggttt tttagttgat aaagttgtgg tataacaaac
    90901 agtgaaaatt gaataaattg tcccatgata atgatccaca cccatgttgg cgcagcacat
    90961 gttccaccgc caccaaagaa ggaatataga atcataaacc atgcaaacat gtatggtaca
    91021 taaccaagaa agtgtggtat cgatctctta agaaacgtag tacgttccca tgcatcaaca
    91081 ttttccattg gtcgattgta gagttcagac atgaaaccaa ataacattgt tgacgcaatg
    91141 agaccacata caccaacaat gacaagaacc gatcgtgctc cagtcaaata tgcaattgta
    91201 catgacatga gggacgccgt tataaagtat tcgatccaac gagttggtgt aaaacacagt
    91261 tcaagtgatg aaatgtatat atcatttaaa aaggttgcgt tggctaaatg gaagaatgca
    91321 gtaatgacaa agaatactaa tgtcaatgca gtaattggat atccaccata tgaaacataa
    91381 tatggatcta ggtaaaatcc agtatcgcta ctgttatatg taaatgttac ctttgtatta
    91441 taaatgggcg gtgaaagatg aatatttcca accgtacccg ttacgattgc aagtataaga
    91501 tgaagtacaa atgcaatcat attaagttta tatagaatgg actgtctggt gatactgagg
    91561 tctggcatag ttctactctt atacctataa aataagttta ttcatatgtt tggtaagtac
    91621 agggatctta ttcttaacaa tcagtctgat atttatcatt caacaacatg ccattatcac
    91681 aattggtcaa ccctaattca tactccgatt aatgaactac tatttccgtc tctgccacgt
    91741 gattgtgatt ttggatatga cattccgcag tttaagaagc atatcgatat ttttgatgga
    91801 tggcgtatga ttcattttac ttcatcaaat tggtgcattc caattacatt ttgtctgtgc
    91861 tatttattga tgattgccgg tacaaagaag tatatgggac caaaagacgg cggtcgcgcg
    91921 ccaattcgct ccaacaagta cattattgca tggaatctct ttctttcttt cttttcattt
    91981 atcggcgtat actttacact tccacatcat ctctttgatg aagaaaatgg tttgtttgtc
    92041 catgggtttt attccacggt atgcaatact ggggcgtatt atggaaatgg aaatgttggt
    92101 tttttcgtat ggctctttat ttattccaag atggttgaac tcgtagatac attctttctc
    92161 ctgattcgta agaatccagt aattttcctt cattggtatc atcatctaac ggttcttctt
    92221 tattgttggc atgcatattc cgttcgcatt ggtagtggta tctggttcgc aactatgaat
    92281 tattttgttc attcactgat gtatctttat tttgcaatga cacaatatag tcctgctaca
    92341 aagaagtttg ccaagaagtt ctccaagttt attacaacaa ttcagatctt acagatggtg
    92401 attggtctta ttgtaacact tgcagcaatg ctatatgtta catttgacgt gccatgttat
    92461 acgagtttag taaactcaat cctgggcctt gtgatgtatg cttcttattt tgttctgttt
    92521 gttcagttgt atgtgtcaca ttacgtttcc ccaaaacgtg taaagaaggc ataatataca
    92581 agtatataag tatgcaaatt aacgatatgt cttccgctga ttatgaacac attgatgttt
    92641 cttttaaaaa cgatgcatat gacctatata acgtacacat tacagacaat ccggtattca
    92701 acacaattga ttctctttat gtaattacaa tggccaactc aaagcgccgc gccgggttaa
    92761 ttactcagct caagaatgcg cgtttaacaa aaacagccaa aattcttatt aatcatggat
    92821 ataaaacggg aaaaaaggaa ggtattgtca atacaactgc tgatttgctt catgccaata
    92881 agatgatttg tatgttggag caggagaatg acaatccagt tgttattctc gaagatgatt
    92941 gtgaattttg tgcatcacca ctggagcttg catatgtcga agtacttgcg ctaagtggta
    93001 aggccgatgg tgtaagtcta ggtgctctta tgcatttaag ctgtcctggt ccacttggta
    93061 cactacgtgt aatttcgggt ggactcacgc acgccatgat ttactccaag aagacacgtg
    93121 cggcacttat gcgcatgcca tattccgttg gtgcacatga caccgtcgta tacactcaga
    93181 cgagtatgat tgcgccacgt atgccgcttg cggtacagcg tcactatcgt accgagaata
    93241 gtcttactta cgatccatat ggaattgcgt ctggaattct atggattcta ggcgcggatc
    93301 gttacccaat tcgtacgtat cgtatgtttc acttaattgg tctgtttggt ggaattgtac
    93361 cgcttgcgtt ttttacactt gcattttttg tatatatgtg ctttttctaa ttttgttacg
    93421 tatatataaa atgtcaatct tctttataat cttaatcgca cttgctgcaa tgtttgctgt
    93481 gtatttactt ggcggatatt tgaatatccg tgataaacgt gcagataatg agatatatat
    93541 acaacagatt agtccatatc tcaccataga gccaggtgct gatcctgtaa aaccaataga
    93601 accagagaaa ttcgtactaa atccgaaagc atatggtgaa cagtttcagc tgtccagtgc
    93661 ggaacaatca tcaagagcaa gagcgagtgt tgttaaactg gaagcattga gacaaagact
    93721 agcgagtagc gcaagaggat ccgaacggga atcgcgtaaa tattacacaa gtgaagacgg
    93781 gtggcacgca tgagatactt agggattgta catcttgtta ccaaaaaact attttatcct
    93841 acataatgta aacaagagaa cctacctgtg ggtgctgcgc catatcaaca accagaacaa
    93901 ccagaacaac atgtgctttc gatctccatt tctaaacttt ctcctcgcgt tctttgtgat
    93961 atcttcggca acggtgggta gttgtgcaat aacttttcct ggaataatgt caagtatgta
    94021 tgggtattta gttacacctt cacaagatat taacataatt gcccctggct tacaggtaag
    94081 tggaaaggcg gccgaatata tagctagtgc tactaacact cgggcttcta ttgcttactt
    94141 gcatgaactc aggggcatgg tgaaggatgt aggattcatc agtgcaagtc ttttactaac
    94201 gtcatgtgtg catccaattg taggtgttgg ggtacttgca atgacagtca cttctccaat
    94261 tactatactc cccccaacaa ataatgaatg ggaagtagta agagaggtag atgcgttgca
    94321 agtaccccat attgtttcac atgacagtcc cattcttgcg gacgcgtggt actgataaaa
    94381 cgtatgtttc tgagcttaaa gtactgtcaa taattagttc tctattgcct acccttatag
    94441 cagaactaaa cgacagcgac gacagctgca cggccgatat gtatgcattg gcacaccata
    94501 tcattttcaa tagagcacag gatctggttt tgaagtattc taaaaaattt gatagagcgc
    94561 aattgaacga tattgtccaa aataaacaga cgattgacgc gattcaacgt aattataatg
    94621 atggtgatca taccactcgt cgtgaagcaa gtaaaaggta tctttataaa ttcaagatgg
    94681 aattaattgc tgttcatctt gaaaaaaaga attccattcg ggggactttg acttcaaaga
    94741 tatgcatagc gcttcatgac atcacggaac gtgaaattac gttacattag tacttttatt
    94801 aaaatgttat tttttattgt gttataacaa tgttacacat tatatcccat ttttaagtgc
    94861 acataaataa acgaggaata atgaatatgt cttgcaggtg ccatacttgt aacaaaaaac
    94921 ttcccttatc ggcaacaatc ggtgctatgt gtaaatgtgg atatgtatat tgcaacggac
    94981 atttaattaa tcacgtatgt ggttataaac attttgaaaa aaatcaggaa cggctaaagg
    95041 ataccataat taagattgtc ccatctaaac taaacactac ttaaaaacta cttaatacaa
    95101 tttttgcatt tgggtcacca ttacgagcat ttactgccgt atgaacttgt ctaatttttt
    95161 cgccgcgctg ttttgctgtc tcaacaagtt tctgtttccg ttcttcgtca atcttctttt
    95221 cctttagcat cataacttcc ctttgtgatt tcttaatctg ttcccatatc ttgacatact
    95281 ttctggaaat gcatacaaat ttaggaagat caatctgggc cttgtagtga taaataacct
    95341 ttgtaaggtc agtagactgt acagtttgat caacaagaag tgcaccgtaa ttctgtgtaa
    95401 atgccatgaa taatctctca aaatcatgcc agctagggat aactccaaag aatgcatcgt
    95461 gtaaacgtct ccgatttgcc acttggttct cttttaatgc aacgacaatg tcaatttgca
    95521 tacgcatatc gggttttagg gccattggtg tctgtagcgc acatagaaat gtaatatatt
    95581 tgtgtcgtcc gttcataaaa agttctttca tcggggcact attcatagat tttgtatcaa
    95641 acccacaatc atctaatagt aaaaataccg accgtggttt tttccgtgcc atcattaatt
    95701 cttgttcatc aagaagcgtt ttaatgcgat caacattaaa ttccgtaaag atacacccac
    95761 gtggcataat ttcagcaagt gcctccgcca ttggtgtggt tgtagtaaat gcaatgccca
    95821 aatcaaatct gtctcttaag ttatacataa catctaaaat aagtctagac ttaccgcatg
    95881 cgcgtctacc gattgcagca aatgttccgt gtcgtggaaa ctgacttgcg aaatcataac
    95941 gagtaattgg aactgcatcc atgtttgcta tttactatag agaatataaa aatatttaat
    96001 gtatagtaaa catgagctat cgtttgtata ttgggcatgc aaagcacgac aacggcaagt
    96061 tgtgcccggg atcggaacag tgcatgcgta ttataaataa caactccgat cttgaaaaaa
    96121 tggtacgtgt agaaaatctc aataccattc tggcgaatgg tagtcctgtc ccacagtggt
    96181 tagatggtac gccggttcta gtcgcggtgg atacaaagaa gatttactat ggttcgtctg
    96241 caatcgatac tctaaaagat atacaaccac ccgttccagt ttcccatcgc aactcacaga
    96301 aaccacctgg gattccttta gccgaagcaa acgtcgatcc atcctcattg catcaattta
    96361 gtgcttctca tgaagcagat cccgatgctg tagttgaaca gcatgacgag tttgactggg
    96421 atcctggtga caagtcacgt accgaaactc gtggtaagaa attcgatcaa aaggaacttg
    96481 aaaaaatgat gaaggaacgt gcagcacgta ctgaacaact tgcaggtcct cgtccggctg
    96541 gttctgatcg ttaagtaaat taagtatatg tcatggattg ttacagtgca gttattatgt
    96601 agacaattac caattgaaat tgtcaaccta ataactgatc ctattttttg cgaaaaggtg
    96661 catgtattac aaacacatgc acggcgtatg ttgaaacata acgcagaacg atcagaacga
    96721 attgcaattc gttattatga aactatactg aacaatagga gagagcccgt cataattata
    96781 aatggaaaac ggaaatggat ctttaataaa aacatagatt acgcaaaacg cgtcaatcac
    96841 gttatagaac atcaagttga ccgcttacca tttaagaacc cagtgtatga taacacatac
    96901 atgtacccgt ttgcaaaaaa acgtaaactt ccttcaataa ataggcatta ttactttacg
    96961 gattgacata cttctttaga tccggatcat ataccataac ttcccccttt gaattttttg
    97021 gttttggacc aggccttccc tttttctttg gtttaccgtc atctggtggt cgtgttttct
    97081 ttggacgccc aaccggacgt gctgcgtttc cgtccttttt aatacccatg ttatgtgcac
    97141 caccctttcc tttaccaatg tgttcgtttt taccgccctt ctttcccttt cttcctccat
    97201 ttttgggggc taacccggct ttctgtcttc ccacatcaac tgcaacatcc catgcatcgc
    97261 ctgcgacatt ctctgcaata cccaatccat atccaccaat cgcctttgcg gcaccaaatc
    97321 ctgcacctcc aactgcacca acaacctctc ccgcctggac tgccttgtca taccaatagt
    97381 ctctgcgatc ttgtgtgtta tatgttgggc gttttccttt gcgtatgctt ccttgttcat
    97441 atttaggatt aaatgcatat gcataattgg ggattgcaac gttgtcgtga tgtagaactt
    97501 ttgcttctaa tgcaacttta tcctcattgc attcatttaa acgttgtgct aatatataat
    97561 ttacaacctc tagatcattg cgtgcatgat gtatcatgtt ttcctcgcct ggtagggacg
    97621 ggattggtgc agaatatgca cctccagtta atgcggcata ccgtagtgta atccatagtg
    97681 taaggaatac aagtaaagat gttaacagta ttgaaaatgg atgtgctcca ttaagtacaa
    97741 ctgatgttag gatatatgac acgataaacc ccgtgattaa atatacccat ttcataacaa
    97801 tggatgttta atatactatt tataaaaaac aaataatatg acgaccgaag taccggaact
    97861 tatgtatatg tttgatgaaa aaactgagtt ggcacggtat acatatccgt caccgacaga
    97921 tacaccattc cgtgactacc caactacttt tggtgaagaa tatgtactac cacaacatcg
    97981 tgataagttt ctaacaacaa agaatccaat tccatatttt gatgacaata ttgttatgta
    98041 tgaaggtcca catgtgtatg tgtgttttgg gcgagtatca tctggatccg tttccggtgt
    98101 tctgaagcca tatctgaaac catttaatgc aaccgatgtt attatggtaa tgaaacgtaa
    98161 acattggcca cggtataatt acgttcatgc tgcacgtgaa gtttctgaag ataatccagt
    98221 aattgaaagt gactctgtta ttgtacatga catggaaacc gacaaaacaa cattttccgg
    98281 ttggtatggg gacattcaag atgtaaagga cactgaaaag atttttacgt atgatagggt
    98341 tatgacagat gaagaaattg tacaactttg gagtgaccca tgtgctcgta acttaggaac
    98401 agaaggtcat cttatgatgg aaaacttctt taatggtgaa gtcatatatg gatcccctga
    98461 agtacatgct ggaatgcatt tcgtacgtga tcaaatgcaa aaaattggcg caaaaggata
    98521 tcgttgtgaa cttgaaattt atggcccaga ggaggatctc gcaggttcca ttgatttctt
    98581 aggttattct gaaagtacga acaagtattg gattttcgac tggaaacgcg caaaaaagtt
    98641 acaggaaatc aaaggatata ataacattaa attcttttcc catgtaactg aatctgatgt
    98701 tggtaaatac tcatttcagc taggtattta cgcatacatc atacagaaat acaccgacat
    98761 gaagattgac ggccttgcat tggttagtat tcttcccgat accaattggt ggacatggtg
    98821 tccatattta aaatatgaag ttgaatatct tatgcgtaaa cgccgagagc ttgttgctgc
    98881 tagattagca cttgcatacc tccggccaga tttacctagg tgttgtcatt cacatgatgt
    98941 tgcatatgat gcagtagttg acgctgaagg taaaatatgg aacgacaagg tacataagat
    99001 caacggtact tctgctgcaa caactgattt caaaagtaaa aataaagttt ataatgaatt
    99061 aaacaagatc tgtccaatgc gacggtctgt agaagaagaa aatttgaaaa aagtaaagaa
    99121 atttctagat atggtaccat tagatggtgt tcgtgagtat aaatcatgtt atgactttta
    99181 agtatatata gtttattatt cactatcact gtcacttaaa actggtctaa atgctacagc
    99241 gtcgtcggtc gtcgttcctt gaaacgcagt ttcgccagaa aatatgtcat tggaagacga
    99301 tgcagcattg gaagacgatg cagcattgga agaatatgca gcattggaag aagatgcagc
    99361 attggaagaa gataatgacg aacgagggcg ttttccagaa ggggtaccgc catcatttgc
    99421 ccgcttgact acttctgttg gaataattgg gacttgtctg ttttccgaaa gcgttggtgc
    99481 atgtggtact gcaagcggaa caggcgaggc acctccctcg ggtggttgga ctgtaggtaa
    99541 gtaggcatat gctgaacgtg gtaccatgga cctcatatta acgtcatatg acataaggga
    99601 attcaataat ctatcatctt tactaaattc ggcataattc atcattttac taaggttgtt
    99661 ctctgtgccg tttctccctg atcctaattt tagatttttt atgactgtct tttcacatag
    99721 attcataacg gtaggaatgt attcatttaa atgagctggt accacaaata ctggaaaagt
    99781 cttgcttttt gttggatcat gtggatttgg tagattaaac ataatacttt tatgaccttt
    99841 gatgcgagca gctgggttgt ttgtttgtag tactagttca gtaaatccag cagcagcttt
    99901 cgctaaacct tcctgaacta cttgtgtttc tacattaaat tccctcgcaa catctactgg
    99961 agtcatataa cgtggattag cgccttgctt tatgtcgccg ttcattctta gcccatggat
   100021 aaatgggtca tcgtgttgac tgccagtaac ggttaatctt ttaaacattg tagcggcatt
   100081 tacaaacgaa taaaacccag acggtcttcc ctttgtacca ggtggtaata caaggtttaa
   100141 ctctttactg ttttgtctaa gcggtctacc cacgtatgca tctgttaata aatgacgtgc
   100201 agtttctgct ggtattataa gttcgttatt tctttcttca attacaggaa gtttttttcc
   100261 gtgatacgca gcaccaatac ctatgcgcga gcgcatacca ccctttggtg gaattccctt
   100321 aaacacggtt ggattcgctg aatatgacat aagggaatca tgataaaata cgggcagtgg
   100381 ggcggccatt gtctttatat tattaatata taaaaaatta ttgtgtaaat ataaaatgtc
   100441 aaagtgtttt gatacacact tatctatact tgttgtggta ttggtgatac aagcagcaat
   100501 tattgttaaa acatccggca attctaatta aattaatcac gaaagaatgg tggaattggg
   100561 ataagattaa atgcccacca tgctggatta aatctagttt catccaacca caatacattc
   100621 cattccccgc atgcaaaacc tctaacccga ggatcccgac gaaaccatga attttttaca
   100681 gtaataaaat catgatatgt attgtatggt gttttgtgta ctgtgatgcg atgttgattt
   100741 ttaaggatta tgtctcgttc atatcgtact ggatgtctat tcgataaact tccaaaattc
   100801 ataccaaatg tatgaatgtg gttcttatac cgatcaagtg atcccagaat aacaatacca
   100861 ccggaagata gtcgttccgg atgatatatt gttccatatt tggacattgt acgaaccgca
   100921 tgttctggaa atgtactgac ttttgttgga cagccacttg tggtattata aaagtccgca
   100981 tcggtagtat ctgcgaataa catttcaatt gtatgtgcat catttactcg ataacattgg
   101041 ctacgcttgg atagttcgtg actccatggg ttatatagtt tatcgagaag atgtgagact
   101101 tgatttggtg gttgtagccc atgaaaatca ccaactccaa ttgaaggtgc agaattatct
   101161 ttgatcttgc gaacaaacaa gttcccgact ggttcatctg gatatagagt actcatacca
   101221 ttaaaccgat ggatttgtgt gtgatctaat gtcatgataa tactgcgctg ttccattgta
   101281 attgggccat ttccaatgac aacgatatca gatgatgtaa tattgtgttt atgatttggt
   101341 acaatgggtg caacattatc caaatactga ccttttgcaa tgttggaaat aaacggcccc
   101401 cagaaaataa ggttgagtgc aatcgggatt agaataataa tataacatct gcgcagaatt
   101461 ttttccggct gcgtaagatt ttgtgttgta taaaccgtga aaattccatg tattattgat
   101521 atgcaaaaga gtgcaaagta aaacaagatt gcaatattgg tataatgcca tggaagataa
   101581 ccattgttgt tatcacaatc ggtaatcgca catccagcaa tgtctaatgt aataaagaat
   101641 gcccatccga aaaagatgac gagccaccaa cttaacgagt atgctatgat gttatacaga
   101701 tcatatctga tacgatcata aaatggttct ttcattgaag atgatatctc tttatattcg
   101761 gaatagataa acatacagtt agtcagattg tattttggta ttatactaga caagcatgtc
   101821 cgtatgtaag attaccaacg atggcattga tcttgccaat aatgtagacg ttgacactct
   101881 ttataagaga gaagaagttg taattcaacc accagcatct tcacttagga tttgcctata
   101941 tacattagat aaaccgggta cgccagtgaa gcaatcgact ttactttctt atgacctacc
   102001 tcctccattt gacaactatt tatacaattc tccggtttac atgcagttta tcggaggaac
   102061 aattacatca gtttcacaag caacgcagtt aattaaacta ctgggagaaa tttttgtgca
   102121 cactgatgat agtgtaagtg attcaaatac tctggtttat gaaaaggtag aagatgtcga
   102181 gtcagaagaa gaagaagatg acgttccaga agaatattat gatcataatg aaggatcaga
   102241 atatgaagaa gatgaagatg ttgcatattc tgatgacgag gacgatgacg aatctaaagt
   102301 agaagatagt agtactgtgt atgaggacga tagttcactt aagtgataca caaatcagat
   102361 ttgtatttcg ggacacataa agtatatgta taatgatccc cgtacatggt ttatctacaa
   102421 atgctaaagt tgttaaaaag gtaaactttt ccgtatatgg ttctgatact atccgtcaaa
   102481 atgcggtgac tcgtgtaaat gaaattgcgt tatatacccg tgggatccct actcacaatg
   102541 gcgtaaactc acttgcaatg ggatcttctg atcgtcggat tcgttgtaca acttgcaatg
   102601 aacttatgca aaaatgccca ggtcacaatg gtgaaattcg tctcccattg ccagtatacc
   102661 aggcactgta tatcgaccat accctcaagg ttcttcgttc tgtttgcttt ttttgttctg
   102721 aaatctgtct tacggatgaa gacaaggtag cattgatgga aaaatatacg gacgacaaga
   102781 cacgtttcaa tcatacgtat gcaattgcac gtacacgtaa aaagtgcccg cactgtaagg
   102841 gcatccgtcc gagttatgta cgcggacccc tcggaataaa gacagaatgg gttgataaaa
   102901 gttttgattc cgaggaagaa caagagtatg caatgcaaaa gtttacaccc gcacttgcat
   102961 attcaattct agacaatatc aaagacatcg acgccaagaa tttctttgga aaaggtcttc
   103021 atccacgtga tttgattgca acaagtgtac ttgttcctcc gccgattatt cgtcctgcaa
   103081 tttctacggc agagggatca cgtacaaaag gccaggatga cattacacta cgtctccagg
   103141 aaattaaccg tcgcgggaat gaactgcgtt tatgcatgaa caaacaagaa gactcgggat
   103201 tgccgacctt tttatgtgac gcaaacaaag ttcttccacc aaaaacagat accattacat
   103261 atacggttgt tgatcgtctt ttaaatgtcg atgcattgac gccggatcta attgatcgat
   103321 ggaatcggct ccaggcagat gtatttggtc tcgtaaatcc cgccgcaatt cgaggtggta
   103381 tgccggcgtc catggcaaac aacaatcgaa atagtgcgaa tggcaagtat atcattgatc
   103441 gaattcgtgg aaaaaacggg cgattccgta attgtttaat gggtaagcgc gtaaatttta
   103501 gcggtcggtc tgtaattaca cctgattcga caattgatgt cgatcaactt ggtgtaccat
   103561 acgaacttgc aatgattcta actgttccag aaaaggtgac accaagtaat attgccgatc
   103621 ttcgtacgcg tattctaaat ggtccaactg aactcattgg ggcacagtct gtgattaaca
   103681 ccgaaggtga tttgatctca ctcaagtcgt gtaaaaatcg cgcagacatt gttttgcgca
   103741 ttgggtggat cgttgaacgt catctaaaga atggggattg ggttattttc aatcgtcagc
   103801 caacactaca tcgcatgggg tttaatggcc accgtgttgt tctaaccaag ggaaagacgt
   103861 ttcgtcttaa tttgtctgta tgtgcagtgt acaatgcaga tttcgacggt gacgagatga
   103921 atattcatgt ctgtcagtct gcatgcgcaa cgtcggaagt atcaacactc atggcaatta
   103981 atcgcaacat tattagtgca caaaacaaca aaccatgttt tggtatcgtt caggattctc
   104041 ttgttggtgc atggctaatg acagatccaa gtgtatttct tacacgtgct gatatgcttc
   104101 ggtttcgtat ttatgtcaag tttgcaaaca atggaacaac catgctccca ccgcctgcaa
   104161 tttccaaacc aaaagaattg tggacaggat ctcagttaat ttcattcgta tttccatata
   104221 ctctaatgta ccaacgtggt tcaatttcgg gtattacgtc atatgatacc aaagatctgc
   104281 taattcaaaa tggtcaaatc ctctttggac ggttatctaa atctacactt ggtgcaactg
   104341 ccggtgcaat ttctgacatt attcaccatg aacatggcgg tccaaagaag gctgttgaat
   104401 ttttgagtga tgtacagcgc gttgtaaatc agtggctcct atataagaat tcattttcga
   104461 ttggtgcatc tgattgtgtt acaaacgaac agagtcataa cgaagttgtc gaatgcatta
   104521 aatctgcggt taataattca aagatgattc tgacatcaaa ggtaccaaag tcacttaaag
   104581 aaatggcaga aggagcaacg acacgtattc tttcggatgt catcatgaaa actgcaacca
   104641 tcattaaaaa caatgcaccg ccagataatt caatcatcac ctgcgtaaca gcaggttcaa
   104701 aggggtctcc gctaaatatt gctcaagtat gtggtcaagt tggccagcag attgttggcg
   104761 gtgagcgcat tttaaatggt acatctggac gcactctgcc atgtttcaag cacggtgaac
   104821 atgcgactgt aaacgcaaat ggttacattc aaaattcgtt tatgcttggt ctacagccga
   104881 ctgagttttt cttttctgca atgtccgggc gtgaaggtct cgttgatacc gcggtaaaaa
   104941 ctgcaaacag tggttacatc cagcgttgtc ttgtaaaggc aagtgaagat aatatgtgca
   105001 attatgacgg aacgattcgt aacgcacagg gaatggtcgt gcagtttaag tatgccgata
   105061 attttgaccc atgcaaagtt gaacgaatta aagttgaacc acttttgatg acatccgaag
   105121 agattaagcg aaatgcagga cctcttgaat acgatgtaat catgtcgctg cgtgaaaatg
   105181 cacaaaaagt attatctcag tcaaacaagc cactaatgga cgtggtctta cttccaatta
   105241 atatttctcg gatgtttgaa agtgccacgt ggaataacga tgtgccacat gagtttgacg
   105301 aagagtcctt gctcactgcc gtatcggaag ttgttcatga aattgtaaag aaacatccgg
   105361 tatgtaagta tgtggtccca ctctacattc aatggtgcat gcgcattgga aatattccag
   105421 aacacttgaa tgttaaggca tttctatgtg aagtaaaaca tcgttgtttg tcgtcggttg
   105481 ttgcaggcgg tgatgcggtt ggaaatactg ctgcacttag tattggcgaa ccttcaactc
   105541 aggcatatat atagttatac acttaattca cataatattc attatagcta accaacaatt
   105601 ctcttgtttg tagatgacac tcaacagttt ccatactgct ggcaccggtc atgccggtgt
   105661 aacaatggga atccctcgcc taaaggaagt tatgggttat tcaaagcagc ttcgcacccc
   105721 acaaacaacg cttgagttct cggacaaaac gccagaagag ttaaaggcaa tcgccgcaaa
   105781 actaacacgt ctaacgttgt cacatgttac cgagaatatg aatgttgtac ttgaaccacc
   105841 cggagtaatt gacgaatcgt atccagagga cgtaaagttt gcactaaaga tggatacgta
   105901 ttttgcgccg gatttgtcag atccatcgat gcatgttgga gtacttgaat taaataagca
   105961 cctcctgaac gattacaatc ttaccccagc taagattgca ccaattatta agtcgcttgc
   106021 atgtaacatt attgatactg atgtacatgt gtcatactcg gaggtcaaca caattgactg
   106081 gtgggtgcgc attcgtatct tggatgtatc gaaacatttc ccggaagtta tttccaacaa
   106141 ggaaatgtgt gaacgaggaa cagtccttcg atttgtgaag cttttgtgtc atgaaatcaa
   106201 gttgggcggc tttaatggaa tcgaagcatc tgctgttgat agcatcgaac gatggaatgg
   106261 agagaaaaac gaaattgtga atgtgattca aacgcgttct accattcttc atcgagcata
   106321 tgcgattcct ggcgtggatt ggaccaaggt tatgacaaac gatatccata atgtcgtaaa
   106381 cactcttgga atcgaagctg cgctcactgt gatttttaat gaactccact ctacattgac
   106441 tgcggatgga tcatacattg acccacggca catcgaactt actgcaagta cgatgacact
   106501 tcgtggttat gttatgccac tgaaccgaca tggtcttaat aatattaaga ctggtccact
   106561 tactcgttcg tcatttgaag aaacaagtga agtgctaaag gatgctgcaa tttttgcaga
   106621 atcggaagat gtaagtggtt cggtatctgc ttccattatg atgggacagt tgtctgcaat
   106681 cggaacagga cgatttgatg ttcgtattcc aaaacctgaa tcaatttcgg tgaaggaaac
   106741 atcacgtatc atcaaaacaa atggtaccgc aacactaatt cacaacaagg aagatacatg
   106801 gtttattcca cgagagtccg catcgtttaa agatagaatc ccatatgtcc catatagtcc
   106861 caagcgttag atattgtaaa gtgtatatta aatgaagtca tatttactca tttcgttcct
   106921 tgtaaaagta tgcgtatgtt ttacaccgat taagaatcca tcatacacta atcttcaact
   106981 tgcacatgca cgtatattta atcaacttat tgcacccgcg ctcaatgggt cttcgtataa
   107041 gaaattccgc aaagcgatga ataattatgg tctttcgtat agtgaaactt catgcaccgt
   107101 tggacattgt attcctgcaa gtaaaggagg cgcaaatctc ggatataatc tatttgcaca
   107161 atttgaagat gacaatcgca aacttggtcc aaaaaaagta aactgcggtg aattatttta
   107221 ttattatcgc accggaccac catgtacatg cacaaacgaa aatggtgatt ttgatgaaga
   107281 atgtccatta tggatggaac actaaacaat tgtcataaac ggattctctg tatttctcgt
   107341 atcagtcggt tgcatatccg ctaaatttac gactcttgtt gtagattgag taagcggtgt
   107401 tcgtggtgta atcggttgtg taattccgtt actgtctgtt gtacttataa tatttacatt
   107461 agatgcgggt tgtgtaccaa gaggtggtat tgtattatat accgttggca tttccacatt
   107521 ttgtggcaca gtttgtacga ccggctgtgg cggttctctc tttttccaac agaataagta
   107581 cagagcaaca agaatacctc ctataaacat aattggtatt attacatcga ttgcatagat
   107641 gtaataaatt gcatcgtcat cggatgatgg tgacaatggt ggtgggttga ttggagatgg
   107701 tggtgacaat ggtggtgggt tgattggaga tggtggaggc aatgatggtg gaggtggata
   107761 tggtggaggc aaggatggtg gaggtggaga tggtggaggc aatgatggtg gaggtggata
   107821 tggtggaggc aaggatggtg gcaatggtgg agttgcatat gatactgatg aatatataat
   107881 aagtagtatg aatacgatgt tgttgagtga aaacatttga tatcttttta tatttgtaaa
   107941 acatttttgt gtatacaaca ataactaata aagcatatgt ctcgttccga ttatatttgg
   108001 gtaaatgagg ataaggttgc cgattggcat gctgaacgta agcaaaaaat tctaaaagat
   108061 cacccagaag taaaaacact tatgggcgtt gaaccaatta caaagtatct tgcagttctt
   108121 atgactgttt ctcaacttgt tactgcaatt tattccgtaa acctaagttg gtttatgtat
   108181 ttactgtctg catactttgt gggtgcgaca ttaatgcaaa cgtcttttct ctttacacat
   108241 gagattacac ataatacagt cttcaaatcg gtactttaca accgaatttt tgcctacgtt
   108301 atccaaacac cggcaatcgt tgcttatcac gagagttttc ggttttatca cacgtcccat
   108361 catcttgaac tcactcgcga aggaggtgat ccggacattc cttccgtcat ggaagctacg
   108421 tttacacgcc agggagtact tgcaaaaatg atttggctac aaaccaatct aattacgtat
   108481 cttctccgcc cgatgtttgt caaaaatctg ccattttctt ggtatcttct tgcaaattgg
   108541 accgttcaaa tgacatttaa tattggattc tttatgatgt atggtattgc cccgtttctt
   108601 tatctaatgt tatctgcatt ccttgctggt ggaattcacc ccctcgctgc tcattttatt
   108661 accgaacatt acaatttccc aggaatgcct gaagatcagg aaacaagttc ttattatgga
   108721 ccattcaata tgtttatttg gaacgcgggt tatcatgtag aacatcatga tttcaagtcc
   108781 attccatgga ccagacttcc tgaccttcgc aaaacggccc ctgaatatta tgattcacta
   108841 tatcagtttg atagttatgt tagtacaatt tattcgttta tcactgatgc acgtattaat
   108901 gggttttgtc gggttcgtcg tgtcgcaaaa gtagagtaaa tattgttgtg ttacacacag
   108961 tgttttttta tctataatac gtaaagaata gatgctttca tttattgcac tgttatttat
   109021 tgcggtagta aatgcagatg ttatacttgt tcaacaatcg aatcggcaag cctttaatgg
   109081 gtacgtaact tctagaaatc caggtgggaa tccgacggat ggtttactat gtgatgtaac
   109141 cccaaatggt tatattgaaa tgaaaaacac atgtggccaa aatttttggg gatttgccat
   109201 aaattccgat gcatataaat taagcataaa actacgcaat gttggcacgt cgcaacaatt
   109261 tcaatattgg ttgtatggta ttggcggggc gtttgctggt cgagaaacat ttgttgcgac
   109321 tactgacact tctgctggta cttactatta ttatattcca ttgacagcac agatagtatt
   109381 tccgaatgag ttagtcattc agattaacga cggtgataac gcaaatgggc atgaaattca
   109441 gttaatgaca gcagaaacat gtcgcgatga taataccgca ttatctatag tcggtggacc
   109501 atctacatgt tctagtttag cgtcaaatca gtgtgattct tctaatgtat atggaatgca
   109561 ctgtcctgtg agatgtggag tatgtagcaa accaccatca cctccacctc cacctccatc
   109621 accatttccg cccagcccac cgcctttgcc tccatcgcca ccaccaccag ttgggattgg
   109681 ttctccgttg atacggtatg aatttgcaaa aactaaactt ggaacagatg ttagtgaagg
   109741 aactcaatat ttcgatggga acttgcttaa tgatggccaa actggatata tttcatcggc
   109801 agccggtggt acacttcaat ataaattaac aggagtcacc gatggaaaaa ccctggaatt
   109861 tggaaacact ggctatttgc aatatatatc aaattctgga aataatataa atttacttcg
   109921 aacagtagat ttcacgtttt ggttatatct aaaaatatca agttcgttaa cgtcggattg
   109981 tacacttgta gaggtagatg accaatatag atttggacta caatattcat ccggagtata
   110041 ttatgtaact cttgcatcgt ccggttcaaa cccggcaaca actgttgtta cagatactcc
   110101 attgtctcct ggagtatggt acgatattac gtttacaaat actgcgacaa cgactgacaa
   110161 cgttatagcc gatgcaatac aaatgtttat tgatggatca tttacagcaa cgcatgatgt
   110221 cacaccaacg gtaattggca gtggtacgtt tcggattggc ggtggttccg ttggaatatt
   110281 caaaggagtc attgacaaac ttggatattg ggatggcaca ctgtctgttg caaacattca
   110341 gtcattgacg acaccaaaag tagcaccatc accaccgcca ccgcttcctc cgccaccccc
   110401 accttctcca cctccacctt cttcaccaaa tccatcacct ccacccagac ccccaccatt
   110461 gccaccacca ccaccacctc catcaccacc accaccatcg acaccaccac cccccttgcc
   110521 agatggagga tgggctgata atactgttaa cattttccca cgggatgcga attcatggcc
   110581 cccaacaacg attactactg aatgtggtat atataaagta cttggtggtt atgagaaaat
   110641 tggtccatct gctccacatc gtaccattgg taggacattt aatggactga ctgagaatca
   110701 tatttcatta ttgatccaat ttgacttttt aaagattgat acgtgggctg caactgcacc
   110761 tgccatactc acgattgata gcactgaagt gtggcgaaaa atatatgcag atgagtcggg
   110821 tacggatcaa tgtggaggtg cgggagttga ggtatatgaa acgattgtat taaacgtacc
   110881 acatactgca acgattacat cgtttaattt cgccacgggc gaaattggta atgatggata
   110941 ctggggtatt cagaatcttg ttattactcc attgtatgag tcaccatctc ctccccctcc
   111001 tccatcgcca cctccatcgc cacctccatc accacctcca tcgccacctc ccccaccatc
   111061 gcccccacca ccgtcccttc cgccatcgcc tccaccacca tatccaccac ttgagtccgg
   111121 tgtattgtcg ataagtggtt gtgatgcagc tagtgtgtta tgtagacctg cttcgtttga
   111181 tacatttagt gtgcgttgtt gccaatttgg tggtgcaggt ggtatttcaa tttgtccaaa
   111241 tacatcacct gatctcgaag atcgacttgg ttttagtggc caggaggacg caacattgta
   111301 tcaagtacaa caggcttgta ttgatgcagg atatcggtta tgtacggcta ccgaattatc
   111361 agtgggtttg accctaggtg gtgcatgtga aagccctgga tgtacttatg ataatacacg
   111421 ctttatattt gcaagttcca ctgcatgttc tccaccatca ccgccaccac caagtcctcc
   111481 tccaccccca ccaccaaact ccccaccgcc gccatcatcg ccacctccac caccatcgcc
   111541 attgaccggt gagttattat ccgatggaaa aaaacgtaca tggcaagatg ccaaggagtt
   111601 ttgtgaatca tatccaggtg gatcacttcc gtcattattt aatatacagg gtcaaattgc
   111661 gatgcagtca tcactttcta acacgggtga gactggtgct tggcttgcag gaacgcgagt
   111721 aacaacgggt acatggaaat gggtaccaga agaagatatt ttctggcaaa atggtgaaat
   111781 tgtggatgga aaatttgcaa attgggagga aggtgcccca tatgccggat ctccgccatg
   111841 tttacttttt caaaacaccg gtttttggac aaatgcagtt tcttgtacac aggcccaaat
   111901 tacaatatgt gagggtataa gcgaatatct atccccacca cccccctcac ccccaccacc
   111961 tccaccatct ccaccacccg gtgcaccccc gccaagtgca ccacctcttc cggctccgtc
   112021 gccaacagtt gaatgtggtc cttataaaat tcgccagggc acggcaccaa ttcctggtgc
   112081 gctttttggt gcattggaca acttaaatgg tggtatgaca acatgttttt atgcagaaaa
   112141 tccaacaaat cagtatattg aagtattgga cataccatcg gaaacacctg gtggagatag
   112201 catatacaac attgtcgtcg aacgggaacg tcttgtagtt accattcaat caattaaaga
   112261 tgcatcacgt attcaagaat tcagtataaa ctttgaatct cgtcgtcata tttgtatttt
   112321 gcatcaggag ggtgcgggtg gccaagtaac agcatatcga gatggaacaa gtgcaggtac
   112381 ggtattcaat gtcgattttg tacaacgtgc tccattacat gctccagtaa acgttggttc
   112441 gccaaaaggg ttagattggc cagagggcga gtatgcatac cttgagaatg taaacatata
   112501 cagaaagtta ctgacaaata cacagcgcaa tgaagatgca aataatggtc ttgcgacaag
   112561 tggaagccct acttatatct tgcatgcatt gtatacatgc agtccgccac cacccccacc
   112621 gccatcgcca ccgccatccc cgccaccgcc atccccgcca ccatccccac caccgccagt
   112681 tccaccgcca ccatctccgc caccaccatc tccgccacca ccaagttcac caccaccaag
   112741 ttcaccacca ggtgcaccgc caccatcacc tccgccacca atcccattac cagatggttc
   112801 ctttgatatg acatcatctt ccgatttccc cggtagcgaa ttcttatggt catcaaatac
   112861 accactttca acaaccctat gtaaaaaata cattgtattg ggtggatata atgtatttgg
   112921 tgcaaatgca tatatcgaac gctattatca aaatttccaa gtacactccc atttatatat
   112981 tcagtttgat ttccttaaaa ttgatcaatg gacttctggt gacgatgcaa ttgttactgt
   113041 tgatggtgaa gttgtttgga gacaagtgtt taatggaggc aatggtgacc aattatgtgg
   113101 tttgcccggt gatcaagcac tcgaagagtt tgtgacgatt caagtcattg ttccacatac
   113161 tgccaatgat gcaagggttc gatttactac acgtttgggt gtacaggcaa atgaagcatc
   113221 ttggggagtt aatcatatta tagtcatttc acagttccca tcaccgtccc cacctccatc
   113281 tccacctcca tctccaccac ccttgccacc accatcaccg tctccaccac cgccaccgcc
   113341 gcctttatca cctccaccat ctccaccacc cccgtctccg ccaccattac caagttttcc
   113401 tccattgtgt aacgaaggag gtgtgcaatc aattggattt agtggactcg gtgacgatct
   113461 atttggaatg actggtttgg aaaacattgg atccaatatc gatcgggggg ttacttattc
   113521 atttgaagtg cgtcgttttg aaattgataa taatgaagca tttatctttc ttgggggaaa
   113581 tccatataac ccattccaac gtgtagtgtt ttcgtttcaa aatgaactga catattcacc
   113641 aatgaagggt attgcaattc cacttggtgt cccccgaatt gatgtggaag attatgtaaa
   113701 ggtgattgtg caacattttg caggaagtgg tcttatatac acaagtatcg ataatagccc
   113761 gtttgaagtc gccgagggta gtacagaaac aatgcctgct gatgtatatc gaccatccct
   113821 acttttagga agtggtgatc cgactgaatt caattcattg tatgttgggc ggatgcgcaa
   113881 tatttatgtg tataatagca ttgttgatat tgctgacatt actggaggga atcgtccagt
   113941 attaaaggca tttactggcg gatgttaccc acctgcggct ccaccaccgc catcggaacc
   114001 gccacttcca ccatcaccac catcgccacc gccaccatca ccgccaccac cagcatcccc
   114061 accgttgcta ccacccgcac caccatcccc gcctccaccg cctgatcctg ctccaccacc
   114121 gccgcctgga ccggggttgg atgtcagtca attttccgca gtgattccaa ttgttattgc
   114181 agtggtcgta ttactccttg gctgttgtac tgtatatcta cgacgtcgat acggttacaa
   114241 tttcggatgg ttgctcacac tggtaaacct attcaagggt gatgttgcaa atattgcagc
   114301 agctcctgca gatcaacgcg gacgtgtcgc agctgaagct ggccagaggc aggcaacgga
   114361 tgctgctggt cgaaatggat tggatccagg acttgcaagt ggggcagctg gattatttac
   114421 tggcggtatg ggtgcaccaa gtgctccaag tgcaccgtct cccagacaaa gtgcggcggc
   114481 agcatcaact ccacgaccat ctgtaatgtc tgcaatattc ggtggaggtg cacctgctgg
   114541 taataataca cgtccaactt acgtacgacc taccgcagca tcagaaccaa ccggtcaaac
   114601 tggtggttcc atgttcggtg gtattttacc gtccgcacct tctgcaaata ccgtgcgtac
   114661 aggtagagga acatctggac gtgcttcacg tactgcgcga gttgccccta cgggacaaag
   114721 tagtggaaat ggaaatccat ttgccgattt tataaatacg ggtccatcca caagtggtcc
   114781 acggtcaaat atgagaaata ccggtccatc cacaagtggt ccacggtcaa atatgagaaa
   114841 taccggtcca tccacaagtg gaccaatgtc acaattcatg aatattggaa atgccgcatg
   114901 gggtgcacca aatgcacctg ctcaaaatac aagcggtcgt aatgctagaa caaatagacg
   114961 atagtaaaaa ataaatatat aaactatttt ttatattata ctttaaccaa gatacggatt
   115021 tttacgaagt gtacgactgc catttttttc ccgaatgata ctgagttgtc ttgctatatc
   115081 tctcgatgcg atttcatcgg ctggggttat ccatttggta gtactaccag tcagagtacc
   115141 atcaatcagt tgatcaatgg atacgtctgg tattagaata cgtgtatttt taccgcgtat
   115201 gctatccatt gggggtatcc atttggtagt actaccagtc ggagtaccat catcaatcag
   115261 ttgatcaatg gatacgtctg gtgttagaat acgtgtattt ttacggcgta tgctatccat
   115321 atttttggga ccatatcgtc gtgaccatat aaatgcccat acacatagta acacaaacaa
   115381 taccgaaaat gtaattgata caatactcgt agccttcatt tatattatat tgtttaaaaa
   115441 aaactataaa ataatttaca aatttaatac taacactata ctgtatgctc acgataatga
   115501 tttttaacat catccactgc acgatatggg atattaaatc ctaggatgga cgtaccgtcc
   115561 atttgcttaa gacgctgtag tggtgcatca acacgtacaa ttgatttaag ttcggagatt
   115621 tcgtcaacga ggatgtttcg taaaatatgc ttaacctcta cgccgcgatt ccaaacccgc
   115681 ctggcttcat ctacatgaac ttgatgatag ccataaaatg gaacattcga cggcacacat
   115741 tggcgcggtg cgatgcgcca tgtgactttt ccaaacgtga taagtgcgca tgcatttgtg
   115801 ttggcacgat ccatgtagaa cttggcattt ttattttcca actcactaaa aagattaatg
   115861 gattttacct ggatgaattc aatgtcattg cgaagtttgg taatcgtatg gattttgcat
   115921 acgggcttga ttggttttgt gtgtgttgac gtttcttgta ccctgcgtag ctgaattaca
   115981 aggtgtttgt aaagtgtctg ctgccattta actgataata gaagaatccg attgagaaat
   116041 tggcgcacac tgtgtgcacc gtttttatcc gtttccgaag catcgtgttc gtcatcatca
   116101 tcaccaaact tgcgtttgtt attatcaaca cgaatgcaat cgagtgcacc aacaatacga
   116161 agtcgttcta aggtttcgtc acaatataga cgaaattcat tatcactcat gcccatttcg
   116221 gcgcgaattt cttgcgtacg tagaccaacg cgatcctgta gatcgccaat aagacgaatg
   116281 catgcataca ctccgcgcat tgaatttaca tcttccattt cagatccaat tgcggaaatt
   116341 tcttgattac cgcgagtgag tgaacttgaa tttcttgaac ccgatgcatg tcgtccagta
   116401 actgtcagtt cacatagctg tgtatttacg atgtgaatga caatcggatt gctcgtttgg
   116461 cccgtgcgtg caacgcgcgc ctcaagttgt ttttcctgat cagcggacca tggctgctgt
   116521 gcaagaatca tgacacgttg cttgctgtgt gcatatagtg catggagatt gatgccttcg
   116581 ttggcagtac gtgaaataac ggcgaatggt ttacggtctt cctgaaagtc ggtgcgatca
   116641 atattaattt tatttttatt gcgtgttttc atgacccatt cgcccatttc atcacgtacc
   116701 caatacttgg aacggccagt aatatcggca acctgatcaa gaccaccaag actatcaatt
   116761 acaatatcaa ggatggattg atggggaaga tcgagattca tccattcatc attaagttcg
   116821 tcccattgat tatccccggg atacttttct ttcattgcat tgattagatt cattgcggta
   116881 tttgcaatac cctgaatttc cttgtcggca tatgactcgc cggtggattg aattgcaata
   116941 actaccgcgc ggttattttc ggcatgatga cgcgccgtct tgataatata atcaagacga
   117001 acaaataaca tcatttcgcg gaaaaatgca agcgatgtat tgtaaagacg agcagttagg
   117061 tgcatgcgct tttcgtctcc gctaattttg gcacggataa tacgcatcgt ttttgccatg
   117121 agttcagcgc atgtatcgta cacccgaata ctttcatcgg acatttcaat atgatcaata
   117181 atatgttctg ctgatgtttc ggtcgataat agacgactga tgtaccgccc attgcgaacc
   117241 aactgatttg aaatgtatgc aaaaaagtta cgtccattga gtgtttttgc aacatgctga
   117301 aatgaggact ttgtccatag accggttcgg atgccaacta aatagagatc ctttactgtc
   117361 gatgcacatg taccagacga atacataaat cgtgcgtgac gaaacacatc catcataata
   117421 ctagcggcag cggcagactg tgaattcatg tttttgagat gatgagattc atcgtggaaa
   117481 attgcctggg tgtgatgtgg ttccatccat tcgacaagac gattgacatg tgatccatat
   117541 ccgttatatg ttgcaagaac gattccatcc gtctggcgta caataaatgt atcatttgtc
   117601 ttggtgtaga tgtccttaat ttgtaaaaaa ttaagagtaa ttccaagaac cgttgcaatc
   117661 cgttgtacga tgtcactgag tggcttaaat agcgtgtctt ttggaataac aacaacgtga
   117721 cgaccaattc gttgatgtgt gatgtaatgt tcatatacgg tttgaacgag acttagtgca
   117781 atcacgtgcg tctttccaac tcccatttcg tcgccaagta caaatccagc gcgaaactca
   117841 tcttcaatat acacgtttgt ggattgcata aagcgacgtg ttgcgtcaat ttgaggtcca
   117901 gatgcaattc cattgaattt accaccatgc aatgtatacg tgagtggcgg cttgtcaata
   117961 tctgcatgtg ccattgactc ataaagtgtc gcaaggtgat catcacatcc gggcgttaat
   118021 gtcttatagg gaaccaagtc agacatattg ttaacgtcag tatctataac cgggtccata
   118081 tttgtcctct gcgaataatt cggtaaaccc tgggatgttt atgagaatta ttaaaagtat
   118141 aagtaaactt ataataatac caataataat tccccgtgat gttgattttg tgttatattt
   118201 atccgctaat ttcttgtcat atgtaatatg tttaacgtat ttagagtcaa cgtatgaata
   118261 atgtttggga ttggacaacg gcgacatttt aatatctatt tgatctatac tttataaaaa
   118321 tttaaggata tgtctctcag tttcgctgaa aaaatgagaa tgattaatgc acagcaagca
   118381 caagttccag ttcatatcag gtttgcatgg gatggagtca ggttggataa tggggaggtt
   118441 tcccatatga agaatacgcg cggagagcat gtgcacacgg gtgcatggta tgcacagcac
   118501 ctagatggtt ccattacagt acgtgctcat cataattcag attgggagga ttacgtcatt
   118561 gaaaaaagaa tggcaatgta tatgattcca tcaaactgtg tgaatctatt taagattggt
   118621 acaaaggtcc gttatatcaa aagtgaaggt gccataaaca attattatgg tcttcatacc
   118681 attgttgcaa ttaaaatgat tccggtacca cataaatccg aaatctatgc gctacatatg
   118741 gcatatgagt caatggacat gacgtactat accagtatgg ggcagcggag taagagtgaa
   118801 gaagaacatt acaagttact aaacgattca tttattacat catttaatct atgcaaaccc
   118861 ccgtggctat cggtttcagt tgattatgaa cgtattattc ttcaacctcc cgaaaactac
   118921 aatctcggat catatacacc agactttcgt ataatcatga caaaaaagtc atttatgcta
   118981 gggcgcattc atgtcatcgt agagagtaaa tcatcacgtg ctgggttatc cgagcccaaa
   119041 gtaaacgaaa aaattcaatt agtgaccgat tatcacaaca tgcatatact agtaatgttt
   119101 gggtcgccgc caatattcaa atacatccca aaatttacaa gcgactggaa gaccgctaac
   119161 cccgacatga atatggatga aactatacaa ttgcttctgc ggttagcaga gtgttaatat
   119221 ttttattcgg acgtaatgcc cataccataa cataattatc aatgtgagta tatgtgtcgt
   119281 gtatatacca gtcatttgtg taacagcatt tgttaatatc ttcccgaata tgtttcatgt
   119341 aattaagaac atatggttct cctgataaca ttgaccgtgg tgttctcatt ttgggatgca
   119401 tgtcaacaat aagaactcct cgttctgaaa tgcgcattgc attctcaatg attgcaatgc
   119461 gaccgtcctg tggtgcttcg tgaagtagaa agaagattgt cgaataatca aactcgtcat
   119521 cttccccata cgaaattgca tttccttttg caaatgtaca taatttgtct ttattgtttt
   119581 ttcgcgcaac tgccaacatt tcatcggatg tatcaattcc tatacttaaa atattgtccg
   119641 ttgtactttt accaactcca caacccatgt cacaaacacg cgcatggtat ggcatattgg
   119701 ataggatctc atcgcgaata ttacgttgat tatatgcata tttatcaata atatcagtgc
   119761 accatcccgc aacgtttgca tgaaacttgc caaacgaacc aatgtttcct aagttatgga
   119821 tacgcgaatc gtaccaccat ttaccatcag atggtggttt tcgaaaaata ccaagtgttg
   119881 ctattataat gccaaacatt taaactatgt caaataattt tttatattgt ataagatata
   119941 gaatactcgc ctgtttttaa aatatgatct tttccgataa gacacttaag cacctcctaa
   120001 tttggaactt tattgccggt acatgcaacc tcgctatggc gattgtcact ggtgtggtcg
   120061 gtaatctaaa cctccgcccc gacctttaca atgtccaggc cgagttcact ggcatgaccg
   120121 atgcgtacat gcttgcgcca acgaatcatg tttatggtac attcccaatt accgcgctta
   120181 tgatggcgac attcattatt tccgccgtat tcaactatgg taacattatg ctatggccaa
   120241 atgcttacta ttccaagctc gagaagggct gctcgccatt ccggtggacc gatgtcttct
   120301 tttccaccac tctcctaact ggttgtgttg cgtttgcgtc gggcatgcgt gatcttaatc
   120361 agctcgttct cgtatcgggc ctttctgtga cagtcaccag tcttctctac ctcactgatg
   120421 tctaccttaa gccaaaggat gatgttgatg cgtggaagga ggagagcttt gtcatgcgtg
   120481 ccaagcccca tctcatttcg gtcattccat ttacctttat gtgggtcatg cttttcatga
   120541 cattcttaaa tggtccatcg tgcgtggcgc caaactggct ttgggcgaca tttatcctct
   120601 tcttcatact ctccattgcc aacttcctcc cacaggtgta ccaggttgcg atgcccccat
   120661 ctctatacgt caagggtgag ttcaagtaca ttacactcac tacatttacc aaggttctta
   120721 ttggtatcct ccttgtatcc tcggcgcttg gcaagaccga ctttaactct gcggtcgtca
   120781 agtccgatcc atctggttgc cttgcgtacc caccgccacc atggtcgcca ccgtcaccac
   120841 cattgccacc accaccatcc acctcgccat cgccaccacc cggctcgcct taaataactt
   120901 attaaagaca cacactcgcc ccactttttt tgaacaacaa acataaaggc aatgactctt
   120961 gcatttctcg tagttctatc acaaagcata tgttttccca tggataaact ccaagtgcgt
   121021 atgcaatatc gacaagcaat ggcggcggcg gcggaacatc agaaaatgcc agcaaccgcg
   121081 ttaatgaatc ttggaattta tcgagtatat gctcgtcgtc ttcatgactg gagtaaagga
   121141 acgctttccg atgattttga ctcctgttca tttgacatcg aagacggcga tgttcaactg
   121201 gaagaatacg aagaacttct tcgcgaaaat gtaaaaaatg ttccggggct tgaacagtta
   121261 cttgatcgga caagcgcacc atcggatatg gagccggatg aaaatgtaga aacggaaaat
   121321 gtagaaaatg atgaaaccga tgtttagtta tatgcatgta aagttattgt acaatttaat
   121381 ttttattact aatatagtaa gacacatatg ccatacgttc cgcgtacgcg aaacggcgcg
   121441 aataaaacca cccgaacaat tgcacatgct aaaaattata gaaataacac acccgccatc
   121501 attgaaatgg gaaatctaga cgaagttcca aaaactccac tacaaaatat tagtctggta
   121561 cgcaagtaca tgccacctgg atgttgtacc ggtatgatgt cagaatctca tgacgtgcac
   121621 gtagaacaca agtttggtac ataccgatcg aggaattggt catgtttcac aatgaagatt
   121681 aaagatgcaa aatctaaatg gtgtgatatt tgcgtatgtt ggtactgttg ttgcatgcca
   121741 attgcgtgcg cgtgtttgtg taaaaaggat gcagaggggg cgaatgggaa ttattatgtc
   121801 ggttcatgtt gttctgaact tgtttgggca agtgatgatg ttatgtttgc acgaaagtgt
   121861 ctcgcgtggt cgtcgagtgg gtataataga atcagtccca ttcccggaac aatggtacgt
   121921 acgtaaaaaa tgactcattt attataagtt tatatgatgg catgttcatt tatattcaca
   121981 cttttttata tttcataaaa taaaatgcta cttagaacat tactattcac agatatattg
   122041 cgcgggaagg ttgtttatgt catctgaacc gagaacgtac aaggaacata ctaatattcg
   122101 cgtttagtta ttcatatgta taagacgtgc gtatgtgcta agttacgtga aatggaacgt
   122161 aagcattatg tatcttcgta tacttacggc agatgccctt cgtgtataac acgaattaat
   122221 gaagtcgtac cacgttgttt ttcttgcgat atgcaccccg ctccagcaag tggacgtgcg
   122281 tgtcgtggat gcattcgacg tacgcgtcgt gaattcgcca agtacgaaac gaattacaac
   122341 gatgcacttg tcgcgcatcg cgcatggact tctaatttaa atcaagatga atacacacgc
   122401 cttgctctaa aggaagattt ggatggatca actcaacttg attccccaaa acgaaaggat
   122461 tattatagta catacccatc tcccataaca aagtgggatg taacacagtt tcttacggac
   122521 aatccgaatt ttttgtgggg atagtgttat agaaggatgt acacggccgt attcatatgt
   122581 ttatgtatga ttgcattgcc gacatttgtt aacaaatatg ccaagtttat gacaattgta
   122641 tttgcattct cgaaaatttt cataaaaagc atctttcaag aactattttc aggaaattat
   122701 ctatccggga ataccggttt aactagtagt aagaatgaat tattttatag acacatcttt
   122761 acaccaatca aagattgttg gagtcgtcca attcatggcc atgcatcaac agtaattact
   122821 gttcaaccgg aaaatggtga taaaccatgt gaatgtatta acatgggatc gtacaactat
   122881 cttggatttg gtggtattga taaaacaatt acatcgcaag taaaacaagc aattgaaaca
   122941 tatggtgttg catctacatc ggttcgtgat ggatctgaaa atgatttaca atctgtactc
   123001 gaaacgaaaa ttgccacgtt tttaaacaaa gacgcagcag ttgtcattgg aatgggattt
   123061 gcaacaaata cgagtgttat tcctgtactt ttaacggatg gcgttgatcc aaaaaatgtt
   123121 ctggtattgt cggattcatt caatcatgca tcaattgttg aaggaattcg cctctctggt
   123181 gcaaaagtaa aggtgtttaa gcataacaat gcgcttgatc tagaagacat cctacttcgt
   123241 gaaacgtctt gttgtaattg ggacaagatt gttgtatttg ttgaaggtat ttattcaatg
   123301 gaaggagatt tttgcaatct caatgagatt gttcaagtaa aaaccaagta cggcgcgcat
   123361 ttatacctgg atgaagcaca ttctatcggc gcaactggac caacgggccg tggagttgct
   123421 gaacatttca atattaacac ttcaaatatt gatgtaatga tgggaacctt tacgaaatca
   123481 tttggatcag ttggtggtta tgtatgtgcg tcacagcctg ttattaattg catccgcgca
   123541 accgcaactg catgtgtata ttcgcctgga atgtcgcatg cagcagtgat gcaagcactt
   123601 gtaacactcg agattctaat tgcaggttca aaaaaaccaa tgcaacttcg tgaaaacgca
   123661 aattactttc gcaaatgcct catggaaatg aaatatccgg tacttggtga cgttgattcc
   123721 ccaattattc cgtttttaat tgaacgcccc gacaaactcg tcgagttttc gcgcaaatgt
   123781 cttgcgcgag gcgtcgccat tgtgattgtt ggatacccgg caacaccatt tttggaatct
   123841 cgcgcgcgtt tttgcatttc aagcgaacat acacgtgagc aacttgatta tgtactcatg
   123901 gtcatcgatg aaactagtcg agagttaaag ttacgaaaag tgtcgggcta cgccgagtca
   123961 aagaaaacgc atgattttca ctccgatgtt gttttaaatc caccatcgga tctggtgagc
   124021 aacttgtgga ataccgtttc ggtgaaaaag atcgaaacga caacggagtt tacaacgaca
   124081 agtttcttaa atatgcacaa acaccctgat gttattgttt cagcaaaaaa tgcaatcgac
   124141 gtttattcat gtggtacatg tggaccgcgt ggattttacg ggacgcttga cattcacatg
   124201 gatcttgaat ccacacttgc aacaaaactg aatgttgaaa aggcaattat atattcatat
   124261 ggtcttgttg tcgtgtcatc tgttgtaaaa gcgtttgcaa aaccaaacga ctttttgatt
   124321 tatgacgaac tcgtgtctac acccgtaaag tccggtatcg tcttgtcgcg tgcaagcaaa
   124381 ctttcgttta agcataacga catctcgtca ctcgttgagc aacttgaata tgcaaaacaa
   124441 cttgatccga acggtgatgc aaccgtttat gttttggttg aaggtgtata tgccaacatt
   124501 ggcgacattg ttaatcttcc atgtattatc gcattgcgtt ccagatataa gttttgtctg
   124561 atttgcgatg attcgtatgg gtttggtctt cttggtaagc accgactcgg tactcctgat
   124621 cactataatg ttccacattc tgaagttgat ttatacattg gttcgtttga acacgcaatt
   124681 ggatcagttg gtggattttg tgccggtgtt ggcgacatga tttcacacca agcactcaat
   124741 gggtcgggat attgcttttc tgcatcctta cctgcatatt gcacgtctgc aattcgtact
   124801 tctcttgatg taattgaacg cgattatgat gtgtatcacg aattaaataa tgtgatgcgg
   124861 tacacgtctg taatgcttgg taaactttcc aatttttcac gggtcgatgt ggatctttca
   124921 attacaccac tgtattgtat ttacatccgg gacaacgatg gtatgtataa catcgagtta
   124981 cttgaaaaaa taaagcacga tgttgcaaaa caacatggga ttcgtattga cgtagtgaaa
   125041 catccaaaac aaccgggtat tccaactgca aacccattca tcaaatttaa cgttgataat
   125101 gatcaagatc tgggaattaa tggaacacta aatgtttttg tcaagttcat gattgagtat
   125161 ctgtcatagt tctaaaaatt ctttcttata tacaaaccta gcatgtacac aaaacctact
   125221 gttatttaat ggcattaata caatttcgta atattttggt ttaatttttt taacaatata
   125281 ctctttttta ttaatgtaaa atcgattatt tgcatatgtc attcgtgccg ggacatataa
   125341 cattgaaaat gtgctatatg ttgctaacat aatgtcatat cgtcttgtat tcgattcaat
   125401 atgatcatcg ataacgtcgt tttgtacaat ttcggcttca ttgttatgaa gccagtcaag
   125461 ggtgttctta tgttgttcca tttattttat atagataaaa tgttttatat gtgatacgat
   125521 gcgacatgtg caaatgcaaa atacatcaat gcaataagaa caattctata cacataccat
   125581 tcgtcgccac attgcaatat gtcatatcca gaaacgtcgt ttaataaagt aagtggaaga
   125641 attccatctt tccaactgtc actacatgtc atttcactgc acgttgaaag agcgagacgc
   125701 gcaaagctag tacatgaatg tctgtcacca aataatttcg aacgaatagg tgaatattta
   125761 aattgatatt catttagttt ccataaacac ttgtgatcaa tatcaatgga tggacgaaat
   125821 aacttgataa ctttgtatgg tgttttttgt aaatacgcag atagtaagag tttacgattt
   125881 ccgataagtc cggattcaat aatgtacttg tttttatgtt catctattgt aactactaca
   125941 acatgaccgt aaccatcgac aagtccaacg tgaagatgga aaaacggcac accaaacttg
   126001 cgaacaaaca gtaaatctcc actttgtgcg ttgtttataa tcttagtaag ttctgatttg
   126061 cattttgtgt ttggatcaac aagtttttct aatatattca tcttttgtat atgacatata
   126121 aaagacttcc tcgtgtcaaa tatcaatccg tatgtatccg ttgttataca tctgacatga
   126181 aaccacataa tatagatgta tgtaacaact gcgcggcata ttcatgtgac aaatgcaagg
   126241 ggtgtgatcg gcattccatt tggggatgtt ggtgtcctgg tagaacggta tgctcatatg
   126301 aaacatgtag tcttatcggg tacaatgtac aaaacgacat tgacgactgt ctggtttgcg
   126361 aatgctggcc atttgcaccg gctctgcctg atctgtgtca aacttgtatt cgtaccgaca
   126421 cgacatgcat cgatcacacc ggagaacttg ttactgaaaa gacggaatat actcgatgca
   126481 aggagtgcat ggatgcatgc agtagcaaag tttgtttttc cgaggaagcg aatagtccag
   126541 actggtgtgg tccggaatac aactgtgctt attgtatgcg tatgacaaac cgaattgtac
   126601 ttggacaagc agcggcgcgc gctgctgcga tgcatgcgcg agtcaaattt ggacacgaag
   126661 tatctgatta tgaaaaaaag attgaaaatt atatcgccaa acacaagtat agtacagaaa
   126721 aagaaattga gtgtcgtagg ggagtacctt ttgtattaat ccctaattaa tgatgaactt
   126781 tgttataaga attacactat aaaatttatg acattatata acaaaaggta tatatggcac
   126841 ttcacatact tctaaattag atagttattt ccgatagccc agttggtttc gtgcaccgac
   126901 agtcactgag tgtctgctgg ttcgaaatca gaaatgctat cgcagttccc acgtagctca
   126961 attggtcaga gcatgcggct gttaaccgca aggttgtgtg ttcgattcac accgtgggag
   127021 cgtcctccta tagtctagcg gtaaggacaa tggttcttga taccatgagc atgtgttcga
   127081 atcacattag gaggttttaa ccttttttac atttatattt agagccatgt cttgtcgtaa
   127141 ttaaaaatag tatacaaata taaatgaata cactgagaat tattgtaatt gtggaatcaa
   127201 tactattagt agtagttgca ggtgtactta tgtatttgtt atatcgaatg tttatgggag
   127261 gtcaggcaaa cgatgaccga gatgacaaac ttactggggt tgagtttgat ctatttaagg
   127321 acctagatgg cggtaatgag tttctattaa aatcactaaa taaccattat acaacagggt
   127381 taaaaaatgc aacacaattt aaaggaaagg gaactacaaa tccagatgta agttctgctg
   127441 gggttgcatt ttcaccattt gctcgagtat ttgaggcgac agattatgga tcgagtatgt
   127501 atacagatac actgcataat catatactca catatggcaa aatattacaa aatggggata
   127561 cacactatcc caaactagct gatagaggat caataccgtt taatagtcgt aaaaacattc
   127621 tagtccatga ccccacaatt tataccgagc aacaagataa gccaatgtat catgccgatt
   127681 tgtagtgcta taatctgaga tttattttat tttttacata taaagatgga cacgaaggat
   127741 attatcataa tatgcgaggc ggtgttattg gccgtattgt taattgtact tatggcggtg
   127801 attgttaggg gaaatggaca attctttggt cgtaaaccaa agacaaaaga gcctaaattt
   127861 agtgaattgt tgggtgaaag aattgaaagg ggaagacaaa ttcaggcaga aaaggaagca
   127921 gccgcagaag caaaagcagc cgaagccgca gagcaggcac gaattgatgc cgaatttaga
   127981 gcgaatcgaa tggcacaaga agttcaatgg agatccacgc atcgtccacg tactagcaca
   128041 acgtcatcaa attggtgggt gtaaattcgg tctcaactaa tttttttgca ttgtaagtac
   128101 acttggtaac attaatattc tttatattaa gaaaaataaa actatttgct atttttatac
   128161 caaacgttag aaaactcctc atgtgacatg gcatggatac ggccgtattc aagcgaacga
   128221 taaatgtttg cttcgttgat cccatgtaaa cgaacgtaat tgtcagtggc agaaattctg
   128281 ttaacaattt cgtcaacgac aaaatttacg gcagaaaccg tgcgggacga gtctggcttt
   128341 ttgtggtcga atgattttcg ttcgacgcgc agaagcaacg cattctcaaa tttgcgaagg
   128401 tttttatgtt tgagtgccca ataactcaat aaattttagt attatcttca caatttccat
   128461 atttcccatc ggagttttat agactggctg gatcatttaa cccaaaaaat aattaacact
   128521 ttatcgtata cgtttgttgg agtttccttg attgcccctt gaacgtgaac gttttttgct
   128581 tgaaccataa cgtttattta atgtaggaaa attgtcccta aatgaccttg caaatgtttt
   128641 gaaataatgt aaaatatcat cgacataaat ctgctccggt aatttgttcg tagattcata
   128701 agattcttca atatactgga tatatttata gagttcacca acatatggtc gtaaaaatgc
   128761 gtcaccaaga gggtccggtg ttgtaaccgt tgcaatcatt ccaagagaaa gatttatgta
   128821 caatgatata tcatctttgc gtacgccaca tgctatatca ctcacattgt cctcaatacc
   128881 aagtgtatat aaaccatgcg tatacatacc atgtatgaac cccatgagac gacaacaatg
   128941 ttcaggatca aaatcggcaa gataaacatt atactcaaag tcaactccgt atggagtatt
   129001 cggttttgat acattcaaaa tatcctcgct agatagatct gaattcgttg ctgaagtaat
   129061 gccactataa ttacgtgtag cagtgtttgc gtcattcatc atagatgatg atataacaag
   129121 cacgttttgt ggcttatgat cggtgcatgt aataccaaac tgtaccattt tttcaatttt
   129181 tgttacaagt tggttttcaa ctccaatttg cagtggagtt gtgtctgatg taaaaagatt
   129241 gttgtataaa tcccatccaa tatctggact gtttacagat tgtaaatcac aactcattct
   129301 attcataata attacgacac caccagtatc attatcgcgc gctacaaaaa tgttagtctc
   129361 ccatccattg tcgagttgta caacgggtgt gatattacaa ggtacaccca caccaatatc
   129421 accaaggagt tttaatacgg tagcctctgc aagtaaattc gtaatatctt gatgtccttg
   129481 tgcatgtttg gtatgtttag ttacaataaa attttgccat agatccatat agtctgggta
   129541 tttccgaatt attgtttcgt cgttttggtc tataatttcc gatggcccca aataaatttg
   129601 tggatcatag gaattattat gtatgtataa tttgcgagtt cgtgaatccc atgttatgtt
   129661 agtaaattgt tcatatgcca acataaagta gtcccacaaa atacccatgc ggttttcagc
   129721 gcccattgat gaaattaatt tttcattaaa cttgccgttt gtataaaaat ctgggtgtgc
   129781 catttatatt cagcaaacat ttttttgtag tctataaagt gagaagttat ggtattcttg
   129841 gtctttactt atgctagaat gtgaaactat atatcgcaaa tataatacat ataatataac
   129901 aataccaaac atggctcagt tggtttagtg tatcgacagt catcgtgtga ctgcgtgttc
   129961 gaacccatgt gagtatattc cggtatgatc tagtggtcat gatattcggc tttcacccga
   130021 aaaacgaggg ttcaattccc tctatcggaa cgatgccctc gtagctcagt tggtagagcg
   130081 ctcgaccttt aatcgagtgg tcggcggatc gaaaccgccc gggggtaaaa tacattgtta
   130141 tacatttttg taaatacttt attatatgtc ggatggagag aaaaaatatt ttcgtaatat
   130201 aaatgaatat taaagactat gttattattg gtttgtcagt aacactactt gtgctagttg
   130261 cagtcattat ttatattaca tggggaagtg gtcagtggtt ttttaccaaa accataccac
   130321 aagaacaacc tgcacctatt gaaacatcac cattaccgta tactatactg gtagcaagta
   130381 cagtgaaaaa cacgaggagt ggttgaatgc gagacatgaa catgatagac aactagcgat
   130441 caaagcaagg gagtactttg acaaaataga agacgacaaa aagaattatc aggagatatc
   130501 agatgatttt aataattggc ggactaaact tgggcgtcgt gactcagtaa gacgttttaa
   130561 tttgattgat cccggtgatc gtgagtatgg cgacgactat aattgggaca cgtaattctg
   130621 tattattaaa tcttagtttt tttgttttct ataaagtgac aagttataag attcttgttg
   130681 tttgcttatt atagaatacg aaactatata tcgcagatag tatgtatatc ttatatcaac
   130741 accaagcata gctcagttgg tctagagcac cgacagccac cgagtggctg ccggatcgag
   130801 cccagcgggt gccacaggag gcccgctggt ggtatcgaaa gcgaccgagg gatgtgctag
   130861 gacttgttcc catcttctaa tctggtcagg aaggaggtct tatgagatca tatgatctaa
   130921 gatagcctct aatctgagtt caaatctcag tgggaatata tgtccaattg gacaaatact
   130981 acacacgtgg ccgaattggt aatggcgctt ccttcaagcg gaagtcctgt aacaaaggat
   131041 gcgggatcga gacccgtcgt gtgtatttta gttttttagt ttaagaaact aaacatatgt
   131101 ctggcatcat atattacatc caaagcccga gtggtaaggg atatattggc cagaccgata
   131161 actttgaaag acgaatgaaa gatcatcaaa aaaaatcatc aaactgcaca ttgttaaaac
   131221 gagcaatcaa taagtacggt tggagcaata tgaaaataac aatactatta aaatgcagtg
   131281 ttgacgacat gggtcattat gagcaactaa tggttaacac ttacgataca tttgcaccaa
   131341 acggttacaa ttgtacatcc ggtggagaag aatataaaca aatatctgaa tatacaaaat
   131401 ataatatttc aaatgcacta tacaaccaca acaaacacaa tatatgccac aatactggta
   131461 tattattgaa caattcaagt acatttggag ttcaaatccc tggctcatgg acaaattcaa
   131521 aaaaaagacg taaatttttc ggatttacaa cacaagaagc agctttggaa tttaagaatg
   131581 cgtattatga aaagtatgta caaaatcaag aaacaattat tgaagagtca acagatgaag
   131641 tatacaacgc tatcgccaac attaagcgca aacatattcg taaaccaaac acaggcagga
   131701 tatttaaaca acatagcgga tcaaaaaact atacaactgt aataccaaag catgctcaaa
   131761 aatattacca acaaaaaagt tacaagtttc cgacatacaa agaagcagaa gactttctcg
   131821 aaacgtgcac aacttgcttc atcaccgaag aaaacaactc atacaaattc acagtcccac
   131881 ccccatggtt agcgtctccg gacgcgcaaa aaacatacac agggtttaaa acccgtcaag
   131941 aggcacagtt gtttatggac aatttttata taatctacgt agagggatat gataagccat
   132001 taccatgtgt tacgtcgtct gtaccaaaca gtcagatgcc atacaatccg tattttatat
   132061 tttaatatac aaaaaataat atttatgtaa ataataaatg ccagaggcat attataatta
   132121 tgcaccagtg aaacgctgtt atagtgaaat aatttatacc gtaagtgtgc catacctgtc
   132181 agaagtagaa catgacggta tagtgcatcc ggtagttgat gtaaatatta agtttcatgt
   132241 aaatgcactc ggtgcggttc tcgcgattaa aaatgcgttt gcaaataaca ccaacatgtc
   132301 cgaaaaatat acggataggc catggaaaac tttaaactat gatagtagtt ataaacgatt
   132361 ctatggctta actggtatta cgtttcaagt atttggatta aatttttatc gctcgaatgc
   132421 tttacaacat gacgtcgata ttaatattca agaacggatt ggagaccaag agatagaatg
   132481 gtcccctcag tttattaaaa atgtccttaa tataccagca caccttcgag attacacaat
   132541 aaactactaa tacagaatat agctggagcg gcaccgaaat cgtcctgaat tattattaaa
   132601 aaataaaata tattaaataa aacaaatggc gtgtgcagta caatacaatt taattgcgtc
   132661 aaaagagatt acacttgaac aggcagaaac tactctaagt aatataactg ccgaaattgc
   132721 agacaaacga gcgtttttaa ctgtaaaaca acaggatttg gtagagttgg ataatgaagt
   132781 ggatgcattg ggtgcacaac ttggaaaaac acgtgatgag ttgaaaaaaa cacgtaaaag
   132841 tttaggtgga gttattggag gatttagtgc ctttgttgga atacctctcg ttattattgc
   132901 tgtaatactc attgtgagaa aaagaagagg tatgaaggag agagcggcaa atcaacctgt
   132961 tgtttgaaag ttttcgagtg ataattttaa ttgtataaaa taaatggcgt gtcttgcgga
   133021 aaagtcaatt attaaaagta aggaagccat aaaaaatgca aaaagtttag aattggattc
   133081 attgcaaact caaattatac gccttgatgg tgagttgtct agaaaaaaag aagaatggca
   133141 atcacttgaa aaccaaatcg atactctaac gattcaattg ggaaaaacac gcgatgacat
   133201 aaaaaagaca cgcaaaagtt taagtggtgt gattggtggt tttggtggaa tggtcggatt
   133261 aatcctagtt gtaatcggta taatattgta tatgaagcga cgaaaatcat ccccaactga
   133321 gaaaccggtt gatacatgga caatgccagt gtacacacca ccatccaatg atgaaccaaa
   133381 agttgaaacg aaaactgaga caaaatcgga agccatatca attccaaaat taaatctgtc
   133441 aaatacaggc ggtacaacgg aaaacactgg gaacattggt cgtgatataa agcgtcgtat
   133501 ggctagatat gaattggaaa cttttagata aattttataa caagtatatt aaaaagtatg
   133561 tcggaaaaca cgacaagtgt gtcagaaact aagacgagta cttttcaaaa agtaaaagat
   133621 tttgtgatta ctaacaaatt ttatgtgatt gctggtgtga ttacaatagg acttgcggtc
   133681 ggaatttatt attattcacg tactcctgat tccatcccac ccgttactaa cccaggtaca
   133741 acccaaactg tagaggattg tactacagaa gatcttgcaa ttgtagcgtt agacaactca
   133801 ataaaacagc taaatataag tattaataca agcaaaaata caaaagcgaa tttagagact
   133861 gatatactaa aagtagaggg tgatataaaa gaatcagaag cagatttagc ggaagcaaaa
   133921 cgtgagttgg gtgaagcaac agatgatcta agtgatgcaa aaaagagctt ggttggtgtg
   133981 agcagtgggt ttggtgtatt tggcgcgtta gtaattgttg ttggtggtat atatttatat
   134041 agaaaacgaa aagcaaaaaa agatgaataa acaagagcgt ttcgttattt ttttgataat
   134101 gttatagtaa aatgatggag accggggtac ttgtattgat tgtaaaccca gacaaacgcg
   134161 taaagtaaat tttgagaccc ttgataatta tcctgaacgc gttcgtaatg aaatcgaccc
   134221 aggtagacgg ttttcgaata gtgctgggtt tcagaaaaac gagaagcaga tttggtaaga
   134281 ttggggttca tttaaaccat gagtttggtg taattaaaat attatactaa tataaatatg
   134341 aatcgtaatc gcgtcggacg gtacaggcca aggacgtcag ttaataagtt actagatgta
   134401 aaacctgata gtatacttca atcacgcaaa acagcacgag agaaaaaggc atatatacag
   134461 gggcttattc gggacgcaga tacttattta cagcgggaag cggcggcaga tagtatagcg
   134521 aacgattcgt gctccgatta tttaattgcg aaacaaactg aaaaaggatg ttttatgtct
   134581 actgcaatta gtattctgta tcaggcatat cgaatgtttc ccacactcga gccagacgca
   134641 cgagtacctc aaaatgcatc gtataacaat aaaattatgc catatatcat gcagttttta
   134701 gacaatcgaa atgacatatg cccagcggta ccaacaacca tttatgcaat ttataataca
   134761 atcacagatc gtatgaatgg gtcaaataag aagggcggtg ttcccttcag tgaatcaatt
   134821 acatatcagg ttgcatacga tacaaatctc tttgatgagt ctgcgcctgc attttcatat
   134881 catcttttct taagaaatcc attaatcaat ccgattctgg aagtaaatga agttgattcg
   134941 ggcctgcgta ctatcccata ttcaatggac cagattaacg ttataaatca accccgcaaa
   135001 atagaaaagg gtggatatga acaattattc atcgccgcca tgttgatgaa ttccaatgca
   135061 tacgttgtat atagtgaaat atcatcacaa actgacataa acgacggttt acggtatata
   135121 tcatcgaaag tttactccga tgcatttcat attattgaaa aaacattcag tggtactgta
   135181 ttgccatata actcggacac attgcgatac ttacttgaga gtggacgcaa cgccgcgagt
   135241 atattatctc gacctaatat atcgaccgaa cttattgcgc ttacggtttc atacaaatat
   135301 ccaatatctg gacaacatgt tgtttccatc gtaccatgtg gtgaaacaaa tgcaatttta
   135361 tgtaacacgg atgcgtctgt ttcaagttgt gtatatttcg atgattatag ttatgccccg
   135421 acggataaag agtattatat gactatactt gacaggattg gacatacata tgaagaacaa
   135481 aaatgcacct tagagcgtgt gacgtattat ttatttaatg gagtgacgat gtcgtaaaat
   135541 gtgtacactt attgacaata tacacaaaat attttttgta ttacttattg taaatggcgg
   135601 caaagaagaa tacttctaca aaaacgaaag gtaaaaaaga cacacagccc gccggcaaaa
   135661 gcaacctaag atggtattta atgttaacat taaaaattat tattgcactt gctgtcgttt
   135721 tactatttat atacatgtat tggcgtaatc aaaacgaaga agcacgtatg tttgccaaaa
   135781 ttgaacagtt aaagaaggag atcggtgccc aagcggcatc actctcagat tcacatgccg
   135841 aattatccga attaaacgcc gaactcgaag cgaccgaact tgaactaaag gattccgagg
   135901 aggaatccgt aaatttggag aaaaatattg ccgaaaagac gaaagaaatg atggcacttc
   135961 aaaaacaaaa agaacttcaa cgcgaacaaa tgcgtaaagc gaattccgaa aagatgaaag
   136021 aaaaacaaaa agagattgat aacctaattg cagtgtatca gagtaatatc gatgcattat
   136081 ctgccaactc gccagaagag atgaagaaaa ttgcggctga gaaaaagata acacttgata
   136141 aactcaaaga atcaaacgct gcagaaatcg cggaaatgga acaatcatat tctaaattag
   136201 caacaacagt tgcgtctgat attgaaacac gtaagaatat tctttctggt gagttggaga
   136261 aagagttgtt aaagtatgac aaacaactcg aaacaataac agctgaactc gaaccacttg
   136321 ccgaaaagga cggagatgaa gtaaaagaaa agattaaact actaaatgac gaaattaaag
   136381 taattggtca aaaacgtgca acggcacaat ccgaacatgt tgctcagctt ctaagtatcg
   136441 aaacaaataa aaacaatgaa cttgcagata tgcaaaagac gaaacgtgca agtataaatg
   136501 cacgcaaggc ttcacaggca agttttattg caaaagaaga tgcgtcgtac aaggcaatgc
   136561 ttaaaaatga tgagaatgag cgtaatgcta tgattgataa acataaaaaa cagatggaac
   136621 agcttcaatt cgagaaggat agtgaaattg aagatttgga ggaacaaaac aatagtcttg
   136681 atagtgatct tagtaaactc gcagacgatt tgagtgtgat gaagacacaa aaagagatgc
   136741 ttattataca aaagtctgat ctacaacagg caattgaagt ccacaaaaaa cgtgatgtcg
   136801 agattaaaaa gctggcaggt gtatatggat gcgggagcaa aacatcaact gatttggcaa
   136861 attgtacaac caaggtaact gcgaacatta atgctaaaaa agtagaacgt gataatttga
   136921 ttagtacaat aacaaaaaag catgcaaatg gcgtagcatc attgaaattt cacaagggat
   136981 ggaaagctaa ctcaaaatat acaccatgcc caaacggagc tacattggtg ggaggtggac
   137041 caaacgatac ttatgcgtgt gtatatagtg taggtaagtt tcgttcgtct caatcaaccg
   137101 cttgtgtacc cggacatggt atcccaatga cggaaaagtt agtgttaccc cctggacaaa
   137161 tgaaacaatg gtttcctcgt ctcccatctt gcaactatga atctacaaat gtatggtata
   137221 ttccatggca ttttatgcga acatatgatg aacatataaa aatggcaaag cggtatctgg
   137281 tgcaacttgc aacatttaat acaacagaag aatggcatat gtttatgcat tttgaaagag
   137341 catatcgaac tggtcggtat tttgatcaac gaggtgcata tattgttggt acggaagttg
   137401 tttcagaaga tggtggtttt aagggaaatc cgagatcaag tgaatcgtgg aagaactatg
   137461 atgattctgt attctttaaa gatattcctg gaaacgcatc ggcgcaacca tttaaatctg
   137521 tagttattct acatgaacac cctattggat cccgagagaa taatgcaagt attggttatg
   137581 gagtggggaa atacaaccta ccaggtcatc tcaatgatcg tgtttcgtct atacttattc
   137641 atcgtggata ttctgtgcat gcatttgaac atcacgattt caaaggtcac tccgagaagt
   137701 tcactggaaa agtagacttg cgtggcaata ggttggaacg acggatatct tctgtaataa
   137761 tagaaaaggt cggtgatgat gtatatgata tgatccaaaa aactaaacaa aagggtatta
   137821 taggtgtagc tatacttgaa ggaaagggta ttgtacctgt accaagaaat gctcgtttgc
   137881 ctgcgatata taagataact gccccaactg cagctcttgc tgctgaggcc gcaaaattat
   137941 tcatgacaaa acacggtagg cagcgtccag atagtatatt tgcattagaa aggggtaatg
   138001 attttgatgt atatacggtt cataaagatc gtccattaat aagtgaaaat ggccgttatg
   138061 aacttattat caaggaccaa cgcgcacagg ttggtaaggt tggtggacca tatacagtta
   138121 tatcgcgcaa ttcgaaaaca gatatgatac aaatagacgt taatggcgtt cttcgtttcc
   138181 ttgattatgc aaagacccca aatcaaacaa caatgattgg aactaaatat ttacgccttt
   138241 ctaatttagg tgtattgtca acaaataaac atgttcttgg taacctaagc gaaaacaatg
   138301 cttctggtac attaggcaca gtaaatggga gtatagcacc aacaccagaa ccgaaaccgc
   138361 caccgaaacc gccaccaaaa ctaccgacac aaccacgtcc aatgccgtca ccgaaaccgc
   138421 caccgcccat agcacagctt aaacttgttg agattgtagc atttaattca tatcatcaga
   138481 aagaggggta tgatcaaaac tttatcggtg taccatcgta tgcagttcgt gacataagcc
   138541 gcgccaaagt attatgtatt ggaggcgtac gacattcagt aacacatatt atgcaaacca
   138601 aagaccccaa gattccgtac gtgtacctaa acccatattt aaaacgtaga gtaaaagtcg
   138661 ggacacctgt ggtgattggt gattgcaaca tcctcactaa gccggcgccg tcatcaaata
   138721 aaaagggatg tcatccaaat aattgtatgg tatctaccga acatggtgcg gttgcgatac
   138781 aacatctaaa tgttggagat cgtatatata caccaagtgg gtatgagccg attattggat
   138841 tctttgacaa ggatattaaa aagacggcag aatattatga aattacaatg gagaataagc
   138901 aacatataac tatttcaaaa catcatgcaa ttccaatcaa tggaagaatg acagatccat
   138961 ctctcattaa gagtggtgat gtgataaata cagtatctgg aataacatct gtggtaagta
   139021 ataacaaggt attacaacag ggtgctcatc atttcctcgt cccatctggc ttatactaca
   139081 ttgataatgt agtatgtagc gattatacaa tgcatttgcc acttgtaatg ttcaatctcg
   139141 tgcacatgta catccgcgcc agatataata ttggtttacc aataatatat cgtgaacaat
   139201 ctgtactttc gccatattgg ccatatcaca ttcttggtaa actaaatgca tctacaacta
   139261 tgtataatat ttgtagtgta ttatttgtcc cacttgtgat actaactgaa ttcattcttg
   139321 cagtctatgt aagtatgaat aaaaaataaa ttacattaca cactattgga agtactgtgt
   139381 gttataacaa ctatcaatat gtattatcat tggtggtatt tctgtattag ttcatttttt
   139441 tggctatttg taattacaac attcaaaaaa cgtatggtat gcgatcttca tgcgattcca
   139501 tgtgttattt tgtcaatttt gtcaatttat gacatcgtac cagatcaaat tacatgggca
   139561 tggtcacttg gatactttgt agttgacggt gttgatgtat ttgatcgggg tgagacgatt
   139621 atgacagttc atcatggtat cacgacgcta ctttgtattg gttcaattat ggaaccacag
   139681 atgacgtttg gtacacatac gacaccatac tttctacttg tggaaatttc cggcattgca
   139741 ctaagttatt gggaatacaa tcgccaatcg ttgattcgtt acatgatgtt aatcatctca
   139801 tactttttta atagagttgt atgggttgct tatctcatgt atttttcctt tatcagtcgt
   139861 ccagatacga cacttggtta tgcagtcgtt cttcttgctc gtctaatgca tattcttatg
   139921 tgtgtatggt acacaacact tttaaagaag gtaaagaatt atatcaacta gtatagtata
   139981 tgtatccgtt aatagtattt ctcgggtttg gtttattgtt ttggacaatt gcgatacatt
   140041 cggtcccata tgaatatatt tctgacattc atgctggtat ttcatttgta ttgtctgtaa
   140101 ttactgtatt gcgacttatt ccggattata ttttattttc atggtctatg acatatttta
   140161 tggtggatct aattgaactt atcatacaat gggacgtgac gtatattatc caccatacac
   140221 tgtcaatcat tgtaccaatt gctgggttat ttgacccggt attaacactt ggtacgaatg
   140281 caggtgcata tatcatgtta attgaatatt ctacagttat actcaatcat tggcaacgta
   140341 atcgcaacaa caaaaatata tattttgaat tacttatagt gtatttcgta aaccgaatcg
   140401 tataccttac ttatttatta tacttttcat tcatatctag acccaaaaac aagtatggtt
   140461 attttgcagt tagttgtttg cgaattttac atgtacttat gttcgtctgg ttttataagt
   140521 tacttaaaaa attaccacga tatagcgatt gaaataaagt tttaagaaat gacatccttt
   140581 gttacatact ctgttccatg tatcttgtct aaaataccaa ttgcgccgta attgtagtta
   140641 aaatgtttgt gatggagatc atgatatgtt ggttgttcat caataccaag tgcatatggc
   140701 atatgcatgc cactgtgatg aacttgtgtt gcaatgtttg ctgcaataat ccatgttagt
   140761 gcaaaatgag catgagctgc gtatggaaat agtagcccaa ccccaagtgg aagtaaatca
   140821 gagactaaaa attcaatctg agtgcaataa attgcaaccg caccaactgg tgatataaat
   140881 tcgtgatgct tcttgtggaa ttttgcatac agtttaggat gatgaagtgc tcggtgagaa
   140941 taataaaaga gtacttcatt tgttagaatg acagaaagta gagaccagaa tcgttcggta
   141001 aatgttggta atttatcaaa acgaagtcca ttagttgtct taaatgaata aagtacaatt
   141061 atacccataa acggataagc aagtgttaac aaattcttaa acattgtcgg cagtgcatcc
   141121 ataatttttt caaaaggaac atgtttgttt tcttgtactt ttgtcacatg aagttttgcg
   141181 cgttggttgt ttccaagtac atgcgaaaag aataaaagat acattccatg aagtgaatat
   141241 gttgcagtaa atgcaatact tgcggcaatt gtatatgcga aaatttcatt tgaaatatat
   141301 gaagtaagcc atagtttaaa agtaatccac tgttgctccg ttgtcatata cgatatgcat
   141361 gcaatgaacc atgcaaacgg cgacttcccc attgttgtat caagaatgta aaatccaatt
   141421 cctccagtaa tgtattcgag taatggattg tcaaatccat ccgcggattt tttgtacata
   141481 aaaatggcac taaatccaat aatgtttata atcaagtcaa atgtgtcata cgtacgccac
   141541 cgaaacatat gtttagtttc taagtttctt cctagccaat aaatttttat tatgtgtcgg
   141601 tggctgtggg cgtttgaagc cctttttagg tgtcggttgc tctatttcca tatcggtagt
   141661 atgtgtgtca tcatcccatg taattctatg atcattttca tcatctacat ccatattaat
   141721 cacggggagt ggcggtaact tgttgaaaaa cgacgtaatt gttggttgtt tgtcaagttg
   141781 tagctgtact ctactcattg cggattgaat tgtacgctgc acgtcatgaa tgtgttcctt
   141841 gaacgcctga aaaattgtta atattggctt cgtaatcttg tttgtaatgt aatacagtcg
   141901 gtcaagtggg atattgttct ctcttaggta atcaatgtct tctgctcggt cacaaatatg
   141961 ttttgcgtgc ttgtcatatc ggatgacaaa tggaatgcgg tcccctggtt gtggcgttac
   142021 gccaccattt gtacgcgcag aaatcttttt tgcaagcata agttgttctt gttttgggtt
   142081 tgcatatgat tcttctttac gaagctcctt tgtaatgata tattcttcat atggaacttc
   142141 atcattgacc actcgttcaa gtgtttcttt tactgaagca agagccttga gtggatcctt
   142201 atcaaataca agaaaatcta caatcttttt gtaaagattt ttaagaagtg ggcaattgtc
   142261 acggcgtacg agttcaactc cctttgcatc aaccttggag aagacaacat ctcctgcctt
   142321 gtttggctcg tgcatgccac caaagtaccg ttttttcgta attaacagaa agccactgta
   142381 taccttttcc atctcaagct caatgtcttc acggaaagaa tcggaaatct tttgtgcaac
   142441 gtcttcacca accttaaaga cctctgaagg tgtaagttcc ttgccatttt tgtcttttac
   142501 gcgtacaaac acagaatcag tatccccgta gataatttcc gcaatccatg gtttaaataa
   142561 ttcaattgcc atctcggaag ttttattgat catcttgcgt ccgttaaatg tagtacattt
   142621 ggcaattgca ccaagtggat actttcctaa cttttctgca ccacaaaatc cataaatcga
   142681 attgcatgaa atctttaatg caagttggcg tgcattatag attgcctttt cttctggtgt
   142741 ttttgccgct gccatttgtt ttttcgcctt cttgcgtgcc ccaagaaggt acttaagcat
   142801 gtgagtaagt acacccggta catttaatgc aaacgtatat tcctctgttg gtgaaatttt
   142861 gtgtgtttcg tattcgaccc cgtcgacacg cggtgttcct ttttcaacaa aggttgagta
   142921 acataaattg tgagcaagca taattgatgg atatagtgat gcaaagtcaa gtgtggcgac
   142981 tggatccgta taaaaccccg attttgcatc aataacaatt gcgccttcgt aaccggatgt
   143041 attaattggt ctgggtactg gatttacaac atgtccaagt tgatgtgagt aacgcgtaat
   143101 ctgttgcatc accttaattg attgtccgcg aaacactaac tgattaatgg tagtgaacgt
   143161 tacacgtgac atttcaatca tacctggcat tacttgtaat gctttcatga gtctaattgg
   143221 taacaataca tcacctttac agtatgcagc cgctcgtgcg acttcttctg gcgtcgcacc
   143281 tggcctgacg caatcaaaca tttcttgata tggcaaatca actttagttt caccaataaa
   143341 gtgttgtgaa actggtccta aaccataaag tgacagtttg tgattacttt tgataaaatt
   143401 gaagaggtcg aaattacatc ttcctttcca ttcgattgga aacatgcgat tttgcccaag
   143461 tgcagatgat tcaagttctt ttgcctgtga ctctgtcttt actgtaataa gacgaccatt
   143521 gtatgcaaat ctggacgcct tgcacatttt tgcgcgcgtt gtaatatatt cgttatcaaa
   143581 cccaaagata ttatatccag tgcatacatc tgcatcagag tgtaccgtaa tcaagtcgcg
   143641 aaatgcatta tacaactctg cttctgtgtt gtagctctcg acatatgaac cttccactgg
   143701 tgcgcattca tttaaacaaa gtaaaactgt ttttgtatct tcaactggtg ttcccagtct
   143761 ccaaaatgca acacctatga ttgcaatatg atcgccttgt ctgtctgcca ttggaaaccc
   143821 gcgcgtttcg gaatacatct caaaatcata cgatgcaata agaattggtg cgattttgtc
   143881 aagatcaacc ggttggatat ttttaggatt agacacttca aattccattg tgcaatgtga
   143941 aattttatgt tttgtgatag ttttgcatgc cttcatctta aaccatccac acggagttaa
   144001 accatttctt tccataaaca tcgaccctgg atcaacaccc tgttcccatg gtttcggaag
   144061 acgagtttcg ggtggttcct tgtcaccgga tcgataacaa gctgctttca ttttagaaac
   144121 ggacggaaaa gatacctcaa cgatgcgaat ttgttcgtga ctcgtcgagt catctttatc
   144181 tggatgaaat ccatacgtcc gcttgcgttt aattactttt gcatcaatat caccttttag
   144241 atttagtgat tcgtcaatct tattcttaag agttgacacc gaatcgtttg tatgataata
   144301 taatacgggt cgaaatttat caacttttac acacacggtt gcaccggtgt gttcttctgc
   144361 gccaaataga tatgcaactg cttttcgttt tacatattca tgtgcatttt ctgggggaag
   144421 tgttgaaata aattgatcag atgcaatgac agattcattg tattcttcat ccaatgtaga
   144481 ctcgattggt aaatcttcca cttcgattgc cataagttga atgttaatat cggttgaaac
   144541 atattcattg gggggctggg cccttaaccc atatttacct aagattgaca ttggtatata
   144601 ttgcaataaa gattcttttg attgttaaat ataaacagga gacaatccaa ctactaaaga
   144661 atatgtatct ggaagatttg gattctttaa caattgcaat aagttgtgca tcgtttatgt
   144721 tctttataat ttccatttat gctatctttc tgatcgatcg tttggaggaa ctaacaatat
   144781 ttcaaaatat tatgggaagt attcaagctg gtatatcatc gatactattg atattatcac
   144841 atcggataat tatgacggaa ttatcagatg taatttatgt agttttatta tttgaaatat
   144901 ttccagttgc gtcattaatt gcgcgggttt ttgatcaata tccgagatct cttcaggtgg
   144961 tatttaatat ctttgcgagt atatttacaa cagcaattag ttttggcttt tctgctctta
   145021 ttatcaactg gtacaataaa aacccggacg taatggtgta ttatccagtt gttgcaccca
   145081 taatgttgtc attcaagtgc ttaaacgcat acattgctac atattcttca tacattggac
   145141 caagtacaca acccatttac tgggaatggc gaagaaatgt acaacgggca cgtgaaaatc
   145201 gcgagcgtga aaatcgcgag cgtgaacgaa tccataatga gaatcaaagt tcagacaata
   145261 cagaacacca tgtttcaact gaaattgtat cattagatgt tgctgtgtaa cgtcaaatat
   145321 ttttttatta tattaatagt atattataca tatctctctt ctttaataat gtttttcatt
   145381 ataacggcat taacggcatt aacggcatta acaccctgca ataacgcacg caataacaag
   145441 ttacttataa ataaatgtgt gaaactatca gatgcaattt atgtaaaagg acatcgtgat
   145501 ttaaaaaata gactaaacga ctatggacta aataacattg aaatcgtaga aaacaaacaa
   145561 aataaccggg cactggtata tatggatgat aaaaacacta tagtaacgtt cagaggaaca
   145621 gtttatccac aaaacgtagt acaagattta aatactagac tcatgcatgc tgatcaatat
   145681 ggacacaacg gaaaagttca cactggtttt catgaaatat ggaaaactct tgaacctgaa
   145741 ataacaaaac tatgtggaga caaacatatt acatttacgg gacattcgat ggcaggatct
   145801 gtcgcacaaa tcgcatcatg ctacactcca tcgtctgatg ttattacatt tggttcatca
   145861 cgcacaggaa atgtggagtt tgcagaaacc gtaaatgatg gcaatgactt tatatacatg
   145921 tttagaaata aaggtgatta tgtaacatcg cttccattaa atacaatggg ttatcgtgat
   145981 acaacgccat atattataga attggatgaa aacggaaatt ggcgtgacgt tagattaaat
   146041 ccaattccgt acatagacga tgcgaatgca ttaaatgcag ttacacgagg aaaaataagt
   146101 gtaagtgatg ttattaaaaa gcatcagatg tcggaatatg caaaacgcat gttactataa
   146161 cttataaagt tatacacttt tttgggttgc gtaaatataa agaacaatga aactaaaaat
   146221 tgtcgtacgt acccaactta taaacaatga agtcctgcgc gtatgcaaat cgcgccttca
   146281 gcatcataca gatgttgacg cgcgcaccat gtatattata gacaaaatga caacattatc
   146341 aaatataatg atggaaaatg gaatttcaaa taaaataact atatccacac tatttaataa
   146401 tattggagtt tcattggaaa ctgctatgca attatgtgga tcgaccgaga tggaatatac
   146461 tgagatgaga aatttaaaag aaattgacgt acgatcgatt ataagtaaat catccacaaa
   146521 acgttcaaat aaagcagtta ctgtaattgg taaccgaaca attgttaaag caccatccgt
   146581 tgtgtctgta aaacaaacac aattaatgcc accgccaatt aaaccacaat cattagttgg
   146641 taaacgcccc ggtgaaaatt cttccactat tttatctgcg catggtgata gtgctagttc
   146701 gataagtagg ataagtaaag taagcgtccg ttccacacaa agtaaagtta gtaatataag
   146761 caaggcaagt tcagttcgtc gtcctcgatc aagtgtataa attttattat actaatgaga
   146821 aagagtagta tgagtaaagc agccaaattt attaatagta aaatacgagt attatcgaat
   146881 gtatttgatg acccacatgg tgaatcttct cgtaatatgt atatgggtaa ttataacatt
   146941 gtgcataact cacgaggaac attaaaaccg acccagacgg accgtgaata ttggaatcta
   147001 gtaaatatag gtaacgaagc tagtgaaaaa agacgctcat caaatcgtag acgctcaatt
   147061 gatgagcgtt catctagaat tccgacaaac gaaagatcaa gcgtgaaccc actcccggta
   147121 ctagaaacag tttattcatc ggttgcagtt ggaccatcat ctgatggtat ttgggatgga
   147181 atgtactcgg accctttatc tcgtgaaatg atgtataatg gtgaaatgat gcataatggt
   147241 aaaataatgt ataatgctga tttataaaaa aatagttata aaatacaaat aattaaaatt
   147301 cttcatctaa tgtaaatccg tgttttgaac tatcattcaa tgcatccata acacctgctt
   147361 tttggtattc accaactctt ttttcgaaga aattggtctt tccttcaagt gaaataagtt
   147421 ccatccattc aaatggatta acgacgttat aatgcttttc ataaccgagt gaaattaata
   147481 gacgatctgc aacaaattta atatatgtac tcattgattc ggcattgata ccaatgagac
   147541 ttactggtaa cgcctcgcaa ataaatagac gttcaagttc aactgcatgt gtaataatat
   147601 caagtacggt ttcatatgga agtttatgaa tgatatgatt ccgatatagc atacacgcaa
   147661 aatcggtatg aagaccctca tctcggctaa ttaactcatt tgaaaacgtt agacccggca
   147721 taattgcacg tttttttagc caaaagattg cacaaaatgc tccagaaaag aaaatgcctt
   147781 caacaacagc aaatgcaata agacgttccg cgaatgaacg ttcattgttc atccatttca
   147841 gcgcccaatc tgccttgttc ttaattgatt gaatggtgcg aatcgcgcgg aataagtttc
   147901 gttgttcgtc tttatcttct acgagtgact gtagcatcat agaatatgtt tccgcgtgaa
   147961 cattttcaat catcatttgc acaccataga aacatctggc ctctgggtat tgaatttcag
   148021 atgcaaaatt agtcactaga ttctcaaaaa ctataccgtc tgcggtagca aagaatgcta
   148081 gaatatattt gataaaatgt tgttcgtttt ctgtaagttt tggccaatcc gtcttatcag
   148141 tggaaatatc aatttcggaa acaccccata gggaagcttc tgctttcttg tattcttcat
   148201 aaatatcttc gtgtacaatc ggaaatagta cgaaacgatc tttattctca ataataagtg
   148261 gctcagacat attgattatt taaagagtat ggggtggcgg agagtgttta tattgtttgt
   148321 ataaaaatat aaaattatat attttatgat gtatatatta aattatgaat tacccgttta
   148381 agggaatata tcatggtaca caaggtacaa atgtcggtat gttaaccccc gaagaatctt
   148441 atgattttag aaacaaaaag cacgaataca cacatgcgga aatgacacaa ttacatgcgc
   148501 acaatctatg ttctatgatg aattagaacg tctaaatcgt agatttatat cacccggacg
   148561 agcaattgat actgcaggta taacttcggc tgtaattatt gtcgccggta tgataacaat
   148621 gttagtgttt gcagtattgt attttataaa aggtaatatg ggtgcgggtt tcggattttt
   148681 gggtggttca cttggtgtgg ttcttagttc aataattatt ttcccagttt cagtcatgat
   148741 tgctaccatt ctagttccta ctggtgatac gcgagcggca agagcatata aaaacaaata
   148801 tattaaacga gtacatagca tgcagtccaa tattccaaaa actgggccaa tgcaggccac
   148861 aatggcgcgt gcgtggtagt tttgatatag actacaggcc gttttattaa caaacaatgg
   148921 actttacaaa gtgtatgtct tgtacagaag aaaaacgcgc ggattatata agttgggatc
   148981 agtattttat gggtgttgcg aaattatcag caatgcgatc aaaagatcca agcacacagg
   149041 ttggttcttg tattattgaa tcaacgacaa ataaaattat atcaattggt tataacggca
   149101 tgccacgcgg atgcaatgac gatgatttcc cgtggggtaa aaaaagagaa aaaattcaaa
   149161 catccttaat acaaaatatc catttgttgt acatagtgag gcaaatgcta nnnnnnnnnn
   149221 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
   149281 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn cacgagtcta ataaacgctg tcgctctgga
   149341 caatacatat atttaaaaac tgaaaaatag caaacgtaca cgacgaatgg actattataa
   149401 tcagttttat attactttgc tatttttatg caccacatgc ctcacactca ctagtgtcag
   149461 atgtgtctac cgtaaactta attgcatcaa tccatatgtt caatgtaaca caacttgcgc
   149521 tttcaattat attttttgag aataacaatt attcaatgca atttctttct gaacagattg
   149581 ataataacac gtttgaatcg acagaatttt acaaaatgaa cccaaagcaa gccaagtata
   149641 ttcaaaacta tttcacactt gaagatactt acagttataa taattttgag tatggcattg
   149701 agttttttgc atggtttgtc atggcatgtg ttgtcattgt ctatttagtg cacgaagttt
   149761 atgatataca atctcgggat aataacgtta tgttgtgaaa tgtatactat ccatatgtat
   149821 tcgtgttata tatgtaatta ttacattaat taatacaata acatgacata taatatgaaa
   149881 actttaataa ataatatcat attaataata tgaacagatg tcatatacaa aaagtagtaa
   149941 tgtcatatgt tgttttattt ttatatggag tatttttgca ctacatcata ttgtctaaaa
   150001 ttaatatgac attcaatcat acagagtttt ggttaaaacc ataaaaatcc ttaaatcatt
   150061 agcgtaaaat tataagaaca tgaagtaaaa ggcgttataa tacgctaata ttatatgttt
   150121 ttgtttacaa tatgacataa atttacaaaa gtgtcatatt atttttacat aattatgtga
   150181 tattgtcatc tttttttata taatattatt ttagtgaaac catatgacat aatataaaaa
   150241 taatatgaca taatataaaa ataatatgac ataatataaa aataatatga cataatataa
   150301 aaataatatg acataatata aaaataatat gacataatat attataaaaa taatattata
   150361 caaatagtga taattttgtt aactttttac cgtaatttta tcattgcaat gtaggctgta
   150421 tagtttgctt ttttcaaaaa tataattatg tcctgcatca tgttttgtat acgaatcagt
   150481 ttgataatat ctactgtatt gccatgtttc atttatatga cttggcataa atccatataa
   150541 atctataata ttgcatgtcg ataatgcaaa cgaaactgcc cataaaccag tactacattt
   150601 accccatcct ttgtatgatt gacaaagtgt gtttgtattg ttaattttcc aatatccccg
   150661 gttgccgagt ttgtagatat tgtaaccacc aatccatagt gtagatggat cattgtattt
   150721 agaacacatt ggtatacttt taccatgaat aggccaacag gctaaaattc gatgtgtcgt
   150781 ttttgaacca accatgtatt gttgatcaat tggcgcatcg tttatacgaa ttactgcatg
   150841 gtgttgatca atttcatatc caaatcccat tgcccccatg ccacttccaa caacagcaca
   150901 tgttttataa gacggaattt gtatattatt tacatttgac cttgtcgggt ttgatggata
   150961 tgaagttagt agattgcctt cgaacggaca agtagacccc ttgcatttat ttaaagtact
   151021 cgttgatata ggataagtac gtgcggataa tagtgtactt acgttgtgcg tataacatac
   151081 gcgcggatga cgatatctga acgcgtcact tactttatat gtgtcgcata tactggcaca
   151141 tttagtgtaa cgtttccatg tgctttggtt aaacaaatta atattggagc gtaaatgtaa
   151201 tgtacaaagt attgtgctat ataacgaaaa catatcaata caattgacaa aatcaacaac
   151261 tcgtgtaaat gcgggtgccg aattgattat catatcatgt taacctgtca tacgttcagg
   151321 gtacaaaata tgacatatta tggacactgc tgtatgatat acagtgttac aaatacatat
   151381 aaacaaacaa taaatgtatc aagacccgtc attgtaaggt aaagtttggc aatacaataa
   151441 actattttgt tgtatatact atatattaca tcagcaacat atcatacaat gtcaacgggt
   151501 ctatatacaa ttaccactgg taatctatat gtaaacgacg aagcgctggt tcgtgaatta
   151561 gtacatactg cggcaaaaca ttctaaggat gttggtacac ttgtcacggt agtatctgca
   151621 atcggaactg catgtggcgt cactatcgcg ctaggaaata ccctcctcac gacatttgca
   151681 ctaaagaaag caaaggaaaa caagaaacca aagcagcttt ccaataaaat ggcaagctat
   151741 catgcattcc gttcccaggt gaaagaagat cttaagcgca ttatacccgg cggacaggat
   151801 gcacctattt atgaaattaa ccggtttgcc tctatggtat ggaaggcaat tgcaaatgaa
   151861 ctcaaggaac aatgggcaaa tgaattcact gaactcacaa ccgaacgcat taacaaatgg
   151921 aatgagattt ttagaactac aattaattca acgcttgaag aagatacaga tagtatgatt
   151981 gcagccgaag aacatgaaga acgaaatgaa gaaccagaag aacatgaaga tacaaatgaa
   152041 catttagaag atattccgga agaaaacact gaagatatct ctcgtgacgt tgataaaaaa
   152101 cacaagaaga aacgcccacg cacgagcata cccccagagt atgcgtcgtt ttatgaactc
   152161 atgcttccat attacaccga acttgatagt attgcgtcac gcgctgaagc aaaacaattg
   152221 attgaacatg tatggcagca actcgaggat ggacattcca atggatggat tgtcgttcat
   152281 gataaaccag gcgataagac taaatgggtt aatctattta ttaaatatgc taaacgtata
   152341 ttggagaatc cttaattttt atcttgtata tagtataaat atagaatgtc gtatccgttt
   152401 gcgatatact ggaaaatgcg gtatattgaa ataattatat atttcattgt acttaccaca
   152461 ttatttacac tatcgtttgt accaaccatc tcatcacaca aggggtataa aatctcatta
   152521 caagtactaa tgggtattgg agtatatatg tcttttatga catttgtatt tgcaacacac
   152581 agacgataca aagagtaccc cgtacttgtc atgcagacaa atggtttact ttggccacgt
   152641 gagtatggta cacattatta aatttgtaaa acgtatataa atgaacagtc atgttgttct
   152701 attggcagtg gtgtgttccg cactacttgc aatatgcacc ataggctatt cggtgtataa
   152761 atataacaca tattccaatt atattaactg ggcacggatt tttcacacac tgcagggtgc
   152821 atgtatctct ttaccactga ttgcgttttc tgttccaatg agtacatcag cgcatgtagc
   152881 aatggttact ggcggcgtga ttgctacact atcatatccc acatacaaca taataaaact
   152941 tatccgtact cgcaatgatc caccaatctc tcgacagaac ggttctattg tttctccaaa
   153001 cacaagctca catgtaaatg gtcttgtact tggtattatt gttgcaacta tgatcagaca
   153061 gatgatacaa acagaacaac atcataaacc aaaaaataaa gtgattgaca tcatgcagtt
   153121 tgtcatactc attggcggat tactcacatc tagtatcgtt attcttactg cgatcttagt
   153181 acagcaatct taaattgact catcgacgaa ttgtaacata gcaaataatt tttctggatt
   153241 ctctacagat atctcttcga cgtcgtgctg cattgcaatt tgctgaatta catttggggg
   153301 tgggtaattg gttgaatcgt tatcatatgc agcaattttt ttaactccgt tcaaaatacg
   153361 cattgtagga aactgatata cactcccacc agcctttccc ttatttgcaa agaagttgtc
   153421 catattgtca cgttccaacg caattagatt aacgcgattt tcaccagcaa gtacttgaac
   153481 aagcgcgttc cagtatggca taaaacgttt acatggacca catgacttcc agtagaatag
   153541 aacaacggtt ggaacaccag tatccttttt cagtttcaag aagaagttct tatcgtttaa
   153601 gtttacgacg ttgtcaagtg tcccacgatg gcccactact ttcgaccaaa acataacacg
   153661 tggttcttca aagtttgtca tacgtggttg ctcctcttct tcttccgaat ttgataccac
   153721 agttgcggct attatcccag caacaatcaa accggcgact ggtgcgatta taaagatcat
   153781 cttttatatt tataatatat ttttatataa atgctacaac cagtaaagac acagacgttt
   153841 gtgccaatat aataaatcta gccaggcgat cttctacatt aaactgttcc ccaaccaacc
   153901 cccacattgc tacaatgcta aaatgtaaac tatcgatata tttaccacca cccgatacat
   153961 gactcacggt atcattgaat gcaaaatggt ataccaacga catgattaat gtgaatatca
   154021 caaggaatat tattttacgg aaacgcagtg tcgtttcaat tgcaccattc atgcgaaaaa
   154081 ctttacttac atttgaaata ttttgttgcg gtgcactata ttgcgtccgg tacattatct
   154141 tttatttaaa gtataatatt ttttatgaga cgggcgaccg acgcacttaa caatacagtc
   154201 ggcaattgca tacaacatac atacaaatag cattacaaga attttcattt cttcaatgtt
   154261 acagtgttat agttctcggg tgttataaat tcaccgacgg cacatttatg atttttggat
   154321 aattccctga tattgcaata cattatagta cattttccga tatggttccc gcgagcatat
   154381 cgagcggctt cttttatatc catagctgat gcagattcta caattacatg aggcccagac
   154441 tcatcttcta tatgaaacca caatgcatcg aactcgttaa aaaaaagaac catctcttca
   154501 ttatctctag cattttgtcc aacatatact ttattgttag attctagtgt atatgttctc
   154561 atatccgatt tacggcattg tttgccgatt caataatttt ctttaccgaa tcatacagag
   154621 cctttgccat aataccagac gacttgcctt cattatataa caccaaccat tggtgattat
   154681 ttgtcgttac aatatcattc ttgttatttt taagatctac accatttact accatattgt
   154741 cttttgacgt tatatgtgtt atttcttcat ttatcacatc accggataga tttaccggaa
   154801 atacatataa ttcggcaata ccttgattac ctgccttaaa attgtccaaa attgtctttt
   154861 tcaatttaca atataatttt gtatctgacc cattaatcgg gtcatttcca accgagatta
   154921 aacaatttgc tggatcaagt aaatccttgc gaattttcaa caattgcact gcaagtgaat
   154981 ataatcccat gttatgttcg taatcatcaa ctgacagata cttcatcaaa tgcatggctc
   155041 tagcaatgtg ttcttcgcat gtaaatcgca catcctggcc accgtttcca tcggcattct
   155101 gtttacgtat gttatcgtac attgtaatca tctccttgaa tgcaggtatc aattttggat
   155161 gaacatacaa ccatggcccc gaagatttta tggttacagc atatttacca ctcacgcttt
   155221 gcccaaagag tgctagcttc ttgcattgtt cattgtctat ggtagcgtcg cgtttcatta
   155281 tagtaatact ctgaattgta gaatatgcat cattcggact tagtaaaaac acttcatcga
   155341 caacaaccgc agcttttact tccaatacgt cataataatc aaatagcata acatcatcat
   155401 ttccaaaata ctgcatcaat agttccggaa tggtcactgc cattggaccg gcacgagagt
   155461 atgcatttac tgccatagtt agcagtttac taatgtacat cctctcgttt ggatttccct
   155521 gaaattcata atgaattacg tgatttttca cattgtctaa atatgattgg taatacattg
   155581 ccgtaacctg gtcatacatt acggttgata ttggtaaaaa cttagaaatg ttattaaata
   155641 cagtgagatt ccctgggttt ccaatagcag cctttagcca tggtttcttt gattgatcca
   155701 taattatacc agtagtagga tcgatctcga tgtcttcatt gcgcgtaaat tgacgcacat
   155761 ttccccaata gtcatttgga gacagaatcc aaattggcac actggcataa tattcgatat
   155821 cagctttcgt aagatataaa ttactatcaa acgaagaaga cattatacta taattcacat
   155881 ctacatgttt gtattgatcc cgtgatgcag gagttcgtac gtaaactcta catgcaagta
   155941 tatagcattc ggaaaaatct ttggcaatat tgtttagagt ggcaagtgct ttttctggtg
   156001 tggccatgtt tacctttata taacgattac aaaaaattaa acattatcta tttagttata
   156061 acatgtgtct actttggaat ttttcggaga gagtgagtat acatctacct tactaatctt
   156121 tgtacggttt ccattactaa cattcatata acggaaacgc aattcttcag tgaggcgttt
   156181 aaatggtttg atctcatatt tatcggtatg cccactttga attattctaa ttgcagcaaa
   156241 cccctcaaat gcaatcactc gaatttcaac tggaccatgt gcgtccaccc gtgcattaaa
   156301 ttcaaccgaa tcatttcctg gactatctac actgtttcca tataaagata aaacaaatgc
   156361 accgctatcc cgacggagtt caatcgcgtt tgtctttagc cacgaatcat ctttcacgtc
   156421 atcacttgtt gcaatggtca ccatattacc attgtcattt gcagttagat ccgctttaaa
   156481 tgcaattaca aacccatgca aatctatgtt tgcatcaata ttttccatat actgttgacc
   156541 aatagcatta caatccgccc cggggccaaa catcataaaa ccaattaaca cgagtgctaa
   156601 tataacaata aacccaatta ctacagcctg acgaaaatct tttggattgt cattacccca
   156661 tttaattaaa ttcgacatat tagattttga atttttttgt tcgttcttca ttctttcaag
   156721 ttcctgctgt agcctagcca tctgttcttt ttgtttctgc gcggttgcct cacttgcact
   156781 tgctgccatt tgagcattaa taagtgaaga agtatctggc tgtgcaggtg gtcgttgagc
   156841 ggcgcccgcg gcttgtggat ttggagcacc gccgcctgca gctgccatcg cggcagctag
   156901 ttgacttgat tccattgcac gcgatctacg cccggcaata ttacttgaaa ctgacatatg
   156961 gccagtttat attttatata agccaaataa aatatttaac gaagtgcgcg ctcacgtgca
   157021 acaattgcct tttcgcgatt atcaagtttt gcttccttat tagcaagttc aatctgcgag
   157081 cgcattagct tagcggtttc acggcgaatc cacattacat gactggaacc gtcctgcatt
   157141 tcttcggtgg ggtaatcggt catcatcgta ttaataaggg tatcaatatc ttccttacca
   157201 atcttgacat cattcataag ctgatccatg gtaatgttct ttattatggg ttatatattt
   157261 ttgtctccag gatattaaat ctgattcctg gctgttatct atatgtccga cgatcattat
   157321 ggtaattcat ttggtgacac cacactagat gaagagattg aaattgagtt aatgcaaact
   157381 gatgcagcgg tatattcacc agaagaattg tttgcacttt tgtgtgcaaa tgaacagtat
   157441 gcaatttcac gcattggtgg gtttgaaaat attgatgatt tatttgacat gttaagtaat
   157501 gtatggttgg ataatcaccc agacctggaa acgatctcat attataaatg gctacttggc
   157561 aaagtatctg atctacactc ggccacggat tcggaactaa aaccagcaga aatcgaacaa
   157621 ctttttgata taacaagcat tggtatttac agactatttc gtatttgtat gactgtaccg
   157681 gacgaaaaca gagatgttta catgtcagat acagcagaag gtcttgaacg acgaggcaga
   157741 cttgctcaca ttttaaaaac ggtgcaagtg tgtaaaaatt atatggttgc gcattctatg
   157801 atgacgaatc atatcaattc gtctcgctat gccagtctga ccaagtatga aacaacagtc
   157861 aatattattt ctgatactga tttaaaacct caccagcagg ttgagaacca tattcttaac
   157921 caactagata actatggata taggcattat aaaaaatatt gctacaagcg cattgtcaca
   157981 aaggacaaca gtccggtatt tgcatgggaa cgtaaggaaa aagttacaga tttcattcca
   158041 aatgaactta caatggagaa aaactatgca atgtataaat tatatactca tgcaccatcg
   158101 tataatatga atgctcacct atcgcgtttc ctcaccgagg attccaagca gatacgtttc
   158161 ctcccactta accccaaccg gcatatttat tcatgtacaa atggtattta tcataccaaa
   158221 cattgcgcat tttatgacta tgcagatgag caaaattggc cacagattac acaacaagca
   158281 atcgatagaa tggttaagta tgatccatct gcagtagact ttgtaccacc aaatggcaac
   158341 gatacgtgtc tgcgtcatta tgagtatgaa tttaagcacg gtgattacat caataactgc
   158401 acggatttca tggacattga tccaagtgta ttcaagtgtc gcgattttga caatgtactt
   158461 gaataccaga aactcacacc agataccatt gaaaatatat atggactcat tggccgactt
   158521 ttcttcgaaa caaagcaata tgatgatatg cagcttctcc tattcttcaa aggagtggtg
   158581 agctttattc atatacacta cacatacaca ctttattatc tttatataac caataaaatg
   158641 ttttgtttta ggcgggatcc ggaaagtctt ccgtcctcaa tctcatctcc gagtgttttg
   158701 atcccgaagc cattggtatt ctaaacagta actgccaaga tcagtttagt ttagagcaca
   158761 ttgctgatgc tcatattgtt ataacatacg aggcaaagcg tgacttcagg tttaatcagg
   158821 cgacgcttca gcaatgtgtt tcgggtgaag gcgttaccat cgttcgcaag ggtgaaaaaa
   158881 gttatgacaa gaagtggaca gcgccgttcg ttatggcagg taacgagctc ccagggtgga
   158941 aggacgctgc cggttccatg gctaggcgtc ttgtgctcgt tccatttaac catcgtgtta
   159001 tcgaacaaga tgaagagctt ggtgatagaa tgtccaagga cattctagaa tatatcccta
   159061 agtttaccat catgtaccgc cagatgacaa ttaggtcaaa taagaaggga ttttggtccg
   159121 ttcgtggtga cggaactaca ctttgttcac agcagcttct tgatgtacga aatgaaatca
   159181 tttctgagct ccagccgctt gtgaattaca tgcttaggtc tgggaagttt gaactatctc
   159241 atatggataa ttcactccca gcagcagaca catacatcac agaagcaatc tttctcgagg
   159301 gatatcggca atattgccgc gacactggtc ttcagatggg aacatggaac gccgatcttt
   159361 accgtaccgt attcgaggat tataaaatta ctaggcgaca ggctgttctc gaatacgacg
   159421 gcgtggaaac aaacgcatat ttcctgtttg gtcttcgttt agtacaggct taactatatg
   159481 tatccagtcc agacgtcgtc atatttaaca cggtttgagc tagctagatt agctggtatt
   159541 gtggagttac agttacagga taacaaaacg tcagtcattg atagtagcaa aacactacat
   159601 gaccaagccg ttgatattgt tcttaataaa gaaactgata tagtaattcg tcgcatactc
   159661 ccaggtgact catatgaaga cgtgtcactc aaaacactag aaactagtca tcttaaaatt
   159721 taatattttg tataaataaa tgaagtttca taaatcactt ataataccat ttactcgtag
   159781 aatattatgg tttatgatgg tatttattat actgtacctt ttatgggaat tggccgaagt
   159841 ggattggcca gtattagtaa taatactact aacattcgtt gcatatgaag ccggtacata
   159901 tgatcataaa aaagctccat tcatacctgg attagtcact gcgtagtcag attggttata
   159961 tacaatccat atgttagata tgacggataa cacatataat gtcacagaag tggagccggt
   160021 aaatgcgcat atacttaggt gcacactggt aaatgcagat tctacaatta ttattgatat
   160081 caataatgaa ttatttccac tatcacttgg tgatacaatt gaagtatcgc atacatctcc
   160141 cgaatatgaa gtaaactata ctacaattac aaatacaact aacaaacaac ttgcatcagc
   160201 cggtggtctt cttgtagaat ttacacctag cattaatgca ggtactacat ttacaattgg
   160261 actagctaag gtaactagta actcatcaaa gcgttctaaa atagtttagt tgataatcat
   160321 cttcgttgcg tttgtatatc gttacaatat ctctaggtgc accaaacata ataccagttt
   160381 taccaaaaca aatatccata attgtattgt accattgaac aactgtaatg cacaaactta
   160441 ttatatgaaa tgcaataaaa tcataaaaca agtatagtac acctgtcatt attatcactc
   160501 gtatattata taggatatat atatatcaat ctgacaatgg acacgcaaaa aatatgtatt
   160561 tgggcacact gtgatctatg caatgctcaa atagaaagta cacagccgac gtattatgca
   160621 tttagtattc ctcactgttc aaattactgt agacttcaaa atctaaaaaa gattaagtat
   160681 tttgaacaaa tatattatcc aaagaaaaag taaatggaaa tacaacctca acgtcatgac
   160741 atgtcacata tatatatgtt tagtataata ttatggaata tcgcatgtcc cttagtatat
   160801 agacactgta ttaatttcta tgtcatacct cgcatgaata tatatctatc ggaatatgca
   160861 atcctatcta tcgcgccacc ggaaatcgaa ccaatgtcta tacccactgc gtatatgttg
   160921 gtgtttttac aatcggtaaa atttgtacgt tattagctta taaaagcatt tcgtttaaac
   160981 ccagaaattg catctgcagt atatgttggt aataacatat gtgatagaag agatccgata
   161041 ccgagacatg caagtacttg aaagtaaaaa tttctatctt taccagttgt tgttgttgtt
   161101 ttttgaatgc aatatacagt ggcacatacc acaaccatta caatgggcca cagatactcg
   161161 tgataatacg cagctttaaa atctgccgaa gttgcttgct ctgtgtttac aaatgtgaac
   161221 gcagttcctt ctacgcatct actatcttct gggtgtatct gtgtacaata tttcgtaaat
   161281 gcaggcccaa gtaacgcttc tacatcttca cgtgaactta aacgagcggc ttccatgcat
   161341 gtacgtgaca tgagttgacc gtcactatta cacgattcta atatttgacg tgttgttacg
   161401 gtggcagttg gtatctttcc gtagatatga tcaactgcga tagatttaca tcgattttca
   161461 gtattatcat ccggtgtcac accaagagat tttttacaat cattttttaa actatttgtt
   161521 tcaagtgcag ctgccatatt tatttgattt tgtgcatcaa ccgatggttt tgcaccagtc
   161581 ccctccccct tttttatttc taaataatcg ccactccatc ttagtatata ttgattgccc
   161641 atgatatatg atacttgctc aaatttggcg ttacgtgcac tttcagtaga gtaaaagttt
   161701 gtagaatcat gtttatcgtt tttaatccct aaatacgtat gcatatccca ctttaataga
   161761 tttctagcag tgtctgatgt attgtgaggt atggtcggat caatatatac ttccattact
   161821 cgttgccatt ctgctccggc acctgcattg tgtataatca tcatggggtc aatgtgttga
   161881 acgtaatcat ttgatatacc atagtaatac gcatatctat gttttatatc atctttatta
   161941 tagcgatatg cagttgttcg tgtatttaaa aatgagttta cagataaacc ggggatcaat
   162001 gcgatttcgt ttgccgtgac tactcgaacc tgttccaagt cagtgagtag agtgatagat
   162061 gtcacagtag atttcgctac attacggaga tcattcccgg cacgtccatt aaatgcaatt
   162121 ataatacatg gacatctatc gcgtttatcc atcactcgac tccccaattg taaacacaaa
   162181 tcaccccaac aaccaacaat tggagagtcc cagctatcca gtacatagca agcaagcgga
   162241 ttaacttcca ctgcttctcc acttatagaa tcctggacaa ttattggatt agtcggtgaa
   162301 gctggaccag cattgttaac cttacccatt gcctttccaa tataaaaccc ctcatccatc
   162361 gcagcggata cggctggtgt tgtttttgga gtgttactgt ataaatactt tctataataa
   162421 taagagtgtg atctgcgata acatacagta gcacccggct tttcgccaat attcataaac
   162481 tttaatggaa ttggtgcctc tcgaacatgt tgcatcagat caattatatc accaatactg
   162541 ccaggtggat ccattagttc tgtacacatt atggcattct ttgcagttcc gagacatcga
   162601 tccctgatag ctttacttgc ttctacgtgt tcggatatag aaggtgtaat actctgaaca
   162661 acccaacagt ttggattatc cggatcacca cacttttcat cgagtttacg ttttatggga
   162721 catgcttcat tgttatcaat catgcgttta cactgagaag tggttaaatc cggacaacat
   162781 cccatcgccc cttttccaat aaatggtgca aatgttctgg cttcatcata tacagatgca
   162841 acaccgcgcg gcattatcat tataacagtt ccatttctaa acagaggtct gccggatgga
   162901 aatgtaattt caccgtttaa tacataatca ggcatgatct ttatatattc aaagttaaaa
   162961 aatttataac actatttctt cctaaactca cgtatttcta cattttccaa tacattatta
   163021 attgtttcct ttactacata tagtgcattt ggggcagtct tatcttctcg tgttttaatt
   163081 ggtgcaaatg atacacgttg agtatgcgta tcaatatcta caccacattc tacaatgact
   163141 gagttttccg ctggaaacct agaaaagtac gtatcaagta taacattgtt tcgtacttca
   163201 tatagttcaa acaccttgtt gttgagcgtg atatttacgg acggcgttag tgcacgatag
   163261 tgcatgatat atggcgttcg gtctccttta tatacaaaaa catcaatagt attgagtggc
   163321 ttccatttat atacctttga tgtcacaact gtagtatctg gtgtaaatat aataccgtca
   163381 ttcaaatgtg gcacttgcat tcgtgtattc catagtgata ttgtatcttc tgcctttttt
   163441 atcatcttgg cccgaatact tataccgata gcaggtggga tgtaaacttt attcatttcc
   163501 tgaatcgcac cttctacatc catcgcatcg acatcatcgt ccaatatact attattcatg
   163561 gcagtaatgc gggtagtata atcttcaaga agtaaagaga cacccttatc tacatacata
   163621 tcaaatgcaa gaaatacatc acgccgtggg acattatccg agcgttctgt aacgatttct
   163681 ccatcaaaca atgtgtcatt gaagtatttc tcaggcgccc atacttccac ttcacgaatc
   163741 gtcaatttcc gatcgatcaa tacagcaaca aactcattgt tgtattttgt aaggagaagc
   163801 attgctcgaa ctccgtcggt tttcagcgac gcacaaaatt taccattcat gattgttggt
   163861 ataacagaac gtttaaaact ttctggttgt gcaatcggga atccattttt tgaagtagaa
   163921 ccagttagtt gggttaatct atgttgcaaa aatgttttct tgtcttcgtc aattaccaac
   163981 ttaccgtgat catttgggac tgggtatgat gacaggtgaa ggatttcacc gcttgtatat
   164041 aggatgtcgt tataccgcat gtctatgtgg tatattacag ttttacaatc tgacaacatt
   164101 cagtactcaa ttttagtata tagaataatt caaatttcta taacaatgtg acaggaatca
   164161 gatttaacat gtataaatca tatagtagaa cagtcttaga tagctcatat catataatca
   164221 tggtcaagcg tattcgtcag gatggtcagc caaagcgccc agtttccgga ttcattcgat
   164281 tcatgaacga gaatcgcgat cgattcaata ctcagtgcaa ggatcagaat atccagggct
   164341 ctctcgttac acatgtggct cgacttgcca aggtcgagtg gcgtgagatg aacgacgaaa
   164401 ctcgccagtt ctggaatgcc ccagcggctg agaagattgc tctatacaac gaagaggtgg
   164461 ccaagtggaa cgccgccaac ccaactccgg ttccagtaca ggaaccaaag aaggcaaaga
   164521 aggtcaagaa ggagcgacca ccaggaaagg tcaagaagac taccacgtct tacatcctat
   164581 attatgttaa cgagcgcaat aataccatcg cggagcttaa ctccgagggc gccgaaatta
   164641 catttgccaa cattgttcgt cgcacttctt ccaagtggaa ggcacataca ccagagcagc
   164701 gcgccccatg ggacgcaaag gccgccgaac ttgttgttct tgcaaaggca gaggccgcaa
   164761 aggagctcga ggagcacaat gccaagatgg aaatggagac taccgatacc ccagtcgatg
   164821 acactcagca agttgctgat gcacccattg tcgatgcacc cccaccaaag ccaaaacgca
   164881 agtacactcg caagcccagg gtaactgagc cagttgccga tccagtttcc gagccagtca
   164941 ccgagccagt cgctgagcca gtcaccgagc cagtcaccga gccagtcgct gagccagtca
   165001 ccgagccagt cgctgagtca gtcactgagc cagtcaccga gccagtcact gagccagtcg
   165061 ctgagccaga cataccaaag ccaaagaaga agcgtattag taagaaacag taaagtgttt
   165121 gtatattgta tactgtatat tgtattaaca agttcttaat tttggattaa tacacaacag
   165181 attattcatc cccttaaatg gaagtgttcc attcccatta accaatctct gataaataaa
   165241 atgatctata ccacttgtat catttaacgg aaccggatat aaaagcttac ttagatatgt
   165301 acagtatgcg cggtttggtg catgtgataa aattggcttt cgggtatcaa actcgataag
   165361 agtcatgcca agtgcccata gatctgcctt cattgggtca ttttgttcat gaaagtaata
   165421 ttcaggccca cgataccatt ctgaatgtgg ggcaaaatat tcaaactctc ccggttggat
   165481 taagcccgat agggaaaagt caataaggac aaccttttgt tgagaagtaa gcataatatt
   165541 ctctggttta atgtctcggt gaacaaaact gttgttatgc aaatgcgata atgcagcaat
   165601 cagttcagac ataaaccgca aacggtcatt aattggatcg gtgctgtata ttacatccgc
   165661 catgctacgt gcgtaaatag gcatacaaat gtacgtaccg atgggagtgg tctctgctgc
   165721 aataatttca gtgatatttg ggtgccgaaa ttgttctctt gcaaaacgta cttcatttcc
   165781 cccctctgtg ttgaaatcat tcgtcaaata ctttacaata acgttttgtg tcatactccc
   165841 tttcatattg accttgccgg tgtaaatact agaatgacca ccggaagtga atggtgtaca
   165901 atctgttata atggcatctg tcaatacgat tatttgcgat acatatgaat tagttgacat
   165961 gtttttgtat gtatataaat aaagtgatgt acgggtttga atacatatac caggcaagtc
   166021 gtataacaaa aactgcaatt atactcggta tatttattat tataggattg gctacgcgaa
   166081 attggagtgg agagattgac ccggataagg ttcaattaga ggatgagatt gcgcataaat
   166141 atacgggacc acatatcggg aaaaaaatta aagctgctgg taaattcgat aatattaaaa
   166201 ttacaggtac agataatata gaagactcta ttgattattg tgcagacaca tgtattacta
   166261 acaaacaatg tgggggattc aactttattg ggaataaatg cgaatttatc gcaggggaat
   166321 taacaacacc agtggattca gtggaagagg atggggccgt atcttttata aagacatggc
   166381 tttaatcatc ccgcttcttc ttggcatcgt cgtcatcggc cggtggggaa tacgcgagca
   166441 taaacgcgag aagcttggcc tcatccgatg cctcgttctc gccggtaatg tcctcgaatg
   166501 cttcatcgat gagctcacga ccgtcatcac cctcacatgc gaacttgaga gtcatggttg
   166561 ccccgcggac acgaatgctg ttctccttct tatggagctc gcaaccgagc ttggcggcct
   166621 cgcagaggac atcaattgca aagtggttga cacagtcgcc cttgcgaagg atacgacggc
   166681 ccttgtttag agaaagggag aaatcaaata gaacctcctc gtcctcatca gagtcagagt
   166741 aatcggactc ggcctcagac tcggatgtct cggtagacgc atcggacatg tactcgtcct
   166801 cctccttctt ggaacgcttg gtctcctcgg tagatggctt gcgaacggtt tccttaactg
   166861 gcatagacat atctatagta ttgggtgtat aagcttcttg tttatatata caacagaaaa
   166921 aatcaatctg acatctgtca gatttatata acattttatg ggtgttacca tatattataa
   166981 gtctttgtta agacgaatga tacccgaggt cataacagac actaacagtt tcacttttta
   167041 tataaagtat acacggacaa gttaatcata tgtatattaa aaaggttact gctttactcg
   167101 atgaagctaa gaaactacat aagcaagata taccagtaga aattgaagtt agaattggat
   167161 cgattgaaaa tggtacattt aaagcaggag tacctcgcgg tagatataat atgatgatgg
   167221 actggtttca gcaatctaat ttaacaacta caggtaactg gacgacgagt attgcgcatt
   167281 ttacagggaa acacgaaagg tgtatcatta cgaaagatac accagggtcg gttagaaata
   167341 tcgaactcgt tgaaaagaaa ccagttggtt caattatact ttccagcaat cacccagagg
   167401 ggattgcact gcgtttctgt gtgtacaccg aaaaaccact accgaataaa ggtatagtaa
   167461 caacaggagg tatggttcgg tatcgccaac gaaagagtta ctccatcgat tccaaggggt
   167521 atgagaacac attttcgttt gattttacac aagtatggca aggaacatct gaacgtaacg
   167581 caaaagaatt acatcgtcac agtaaagata cacgatttga aattgagctc gaactcacaa
   167641 ataatacgta tttagaagac atgtccagta attatctagc cgattccatt gttggaaagt
   167701 gtgtgtcact ctttcagcat gaaatggaag ttggaaaagc ttttgattta actgttgtat
   167761 aattatatgt ggtataatat aaacatgttt ctattcataa cacttatatt ttcccagacg
   167821 cctgtacctc atattataaa tggcgttgat gcggatattt cagagtatcc atctagttta
   167881 tcaatgcaag caaatgatca gcatttctgt ggcgctgtct taatctctga ttattatgca
   167941 ctatcagcgg gtcattgttt tgatgcgatt gattttactg gtattgttat ggcaggaggt
   168001 aaaacaaact tgaactcgaa tggaggcaaa tcggtgtttg tagaaagcgc atatctacat
   168061 gcgtcatatg atggtagtct tattacaaat gacattgcag ttattaaact agcatctccg
   168121 ctaccatttg gatttgctga ttttactgca acaagtgttg ctgaaactga agatgttaca
   168181 tctgttggat ggggtcttac ctcaccaaat ggaaagtcat ccatgacact acaatctacc
   168241 gaacagcgag tatatgcgga taatacatgt ggtgccgcat tgatagggac ggttgtatgt
   168301 acaaagagtc caacacttga tacgacaaca tgtaacggtg attcgggagg tggtttatat
   168361 gacattttca ataaagttgc tggtgtattg tcatatggtt atgtgggatg cccggttgat
   168421 ggcgtatctg catatactga tgtgtcctac tataaggatt ttatatgttg ttattccaaa
   168481 aacaccgcgg tgtttgacaa tgcacagtgc aacatagatc tggaaacatg tcaagcggca
   168541 aatccagctg ttcttattgt ttcatatgca aacctcattt tcatctttcc agtgttagct
   168601 ggtgcatttg cactatgtat gtgtacatgg aacgcagttg ataattacaa gaagtattca
   168661 ttgcgtacat agatagataa tttgttacca taatcagatt tttgatttat atatataaag
   168721 caacaacatg ggacgcttct ccatcgatca ggcgattcta aatcttgatt gggaagttgc
   168781 aaaccgtgtt caaatgaaca tcaatgcact tcgttccaca atgtcacttc gttacaatgt
   168841 aggtgtgcgt gacgacagtc ggcttgcata taactgggcg attggtacgg ttcgtgctcc
   168901 aattgaagaa attatggagg agttggcatt tatccagtgg ctatcttccc atacgaacta
   168961 ccagcaagtt tgtgaggatg gtctacgttc catcgcaaac tatattaaat tcaagtatcc
   169021 tgatattagc tggtccaagg tttggacgat tgttcgcggc atcggcccgg atctcataaa
   169081 atatacatta gttgataaat atagtgcggg tgttcccgat ttaactaaga ttaacgcata
   169141 aacagtttca tcttttacat aacagaaaaa gatttcttat ttctactaat taagaactgt
   169201 gacaacacac catttgaacc agacggtatt tccgtttagt agaaaataaa tagtagcgat
   169261 aaaaatattt acaataagta aagaagactc atgaacagta cgtggtacga ttcaagttat
   169321 aacgccggat acgacccagc ctcctacctc gccctcgccg ccgccgctgg gaccgttgcc
   169381 ccctctcgcg ccgaagtgcg cgggggatac gaacccccga ttatttatgt tgctccaaca
   169441 agtttcgccc gtcccacaga tgcgaatatg catcttggtg tgatgagata tgacccagaa
   169501 tatattagag agaatatgcc cgaatttaat acgattgagc caccaatgcc tattggccca
   169561 ttagtagacc cagaacttcg ggaaagactt gaacgtgcct atgaaaccct tgtaactttg
   169621 cagcgcaaaa ataatagtga aatggcacaa cgtgtggcag ctgctgcagt tgaagatatg
   169681 gagttgagaa gattggcaca acgggagaca cttcaaggta tatatggtga gtataatgaa
   169741 cgtttgaaaa caaaacgaat acaggaaagc atacagagag aacatttgaa agaccgtgtg
   169801 aacagaaaac aaatagcgga acgcatacag agacgacgta tagctaatgg cggacgtcca
   169861 gttcatattc aagcggatgg agaattttat gataactctc aaatgtttac cgacgaaaat
   169921 ggtctacatg tgatggtacg caatcccgac gaacgtgatc tacatgtgat ggtataaaat
   169981 cccatatgaa gttttgatgt acataaaaat attttatttt ataataataa atgccaaaac
   170041 tcacacaaaa gactgaaagc tttcttacat tagcaaattt aactgcatgt ggcaaaaata
   170101 taataaaact taggtaaact tatccatcat aagattatgt aagtgagcag atattgctcc
   170161 agatattagt tccatgtcct gttccacaat actaagtgta agtgggtctt taaatgtgtt
   170221 tattagtttt ttaaatagtc cctccacttg ttcaatcatc ttgtttgatt ttttaacatc
   170281 ttcttcatct aatgttattg tcataaattc agatagtttt gtaatacatg ttataaatag
   170341 agtaaacttc ttctcggtat aattttcttc acgttttaat accacgtaaa tacggtgaag
   170401 tgcatgtgcc attgtataat catacatgat tggcagaagt atttctatat ccacgtcctc
   170461 atcaaacttt gggagagcat gcccacttgt gcgaatggat tttgctacaa atgcaattcc
   170521 atatacacca gcagcagcgg atgctgtctt tattatattt tttgtgaggg gttctaatga
   170581 attccaatta gacatttact ttatataata tacaaacata atctgattac tttctagcct
   170641 tctttggttt gggtgcatcc tcgtctaatg gagtgagacg ctctacgata tactcatcta
   170701 cttctttacg gagggcgttt agatcagcga tccacatttt atttgcagtc gtttcacgaa
   170761 gggcatcaat atcggttgtg atattacgga tctgattccg taacttatca acattatcag
   170821 ttgtcagctg cccagttgaa atatcatcag tcaggtacct aaatgagttg tttgatcgca
   170881 agtacccatt ctgagccaga tattcattta gagaagatgt actcatcttg ccaatcttaa
   170941 ttttaccttc gatgaactcc atgatgtacc gaatcttatt atttagaagg tccatcttgt
   171001 gtgatgcttt ataaatctgg gaaatacgag atgattcata taacttaaga cgctcgcgtg
   171061 catgttcctg gataatctga gttggaccat catagtgtgt aatcttatta ttggcattgt
   171121 acaaccacat tcggtttgtc tggagttttg tcgataactt gagagtagcc actgggtcat
   171181 caattggcga agtaagattt agttttatag taacactatc aggaccgaga ttcttttcgt
   171241 aatttttaat cttgtctggg ataagatgct gaatactctc aatccaatcc tctgttgcgc
   171301 gtccaattgg tagttcagtg acagtaagtg tatttccact aacttcatat gtaccaatgg
   171361 aattaaaccc atcggttgtt tcttccatct ttccattgta gcctacatac cacgggaccc
   171421 acttggaagt acttagctct ccgccatttg ccatacgttt gcatgcatca attacttcaa
   171481 gcgggttata ttgtggtaca tcgcacttcc atccagtacc aattccgttt gcaccattta
   171541 caagtacaat ggggattact ggaatataca cggtaggttc caccttttta ttctcatcca
   171601 cgttgtacgt taatacatca ttgtcctcag acttgattag acgaggaagg aatgacgaaa
   171661 tatgagtaaa gatgtaacga ggggcagcgg cgctgttttt ggcatgccgg gatccaaact
   171721 gaccactcgg gtatagaagt ggtagattat gggaaccagt atacgtcgcg gccatcccaa
   171781 taattgtatt cgcaagagac acctcgccat gatgatactg tgtaacctgt gcagccgtac
   171841 ctgccatctg cgcgactttt gcttcattct taccaacatg attaagtgca tagaatacca
   171901 ccttgcgctg ccccgccttt tgtccatcaa gcatctttgg aatggaacga atgttatcat
   171961 aatttgagaa atgcattaga tcatcataaa taaatcgctc aatcgtagtc gactgtgccg
   172021 aatagtcgac attcgcgtta gggttatatt gattcgcgag atactccctg cgctcagcag
   172081 acatcttggc gtcgaatgca agtttcattg cctcagttga tggctgtccc gtattactga
   172141 tggtgattac attcttggac cattcattga agtattgctt tgcatcctta tctgtagatg
   172201 taccaagacc cttgtagtac tttacagcag cattttttga atctgggtgc ttgtcgatgt
   172261 attcccggta ctctgcatcg gtataaaatg tcttaccagc atgcttaccg cttgtaatct
   172321 ttaagatagg tgtcgcaaac cgcttgatat aatccgggaa gacttcaagt agacttggta
   172381 caagagtcat aatcagttga atacatagcc cagaaatatg actaccatcg acatcctgat
   172441 cggtgaatat cacaagatgg cgatatggaa gagcacgagc agacgcaaga tcgtactttt
   172501 tgtatggagt gattccaaga atctggatta gctcagaaat ctccttgttt gcagcaagtg
   172561 cctttaaact actatttcca gcattcataa gcttaccgcg aagtggatac aatcccatat
   172621 ttgcatggcg ctttactgca tttcttccca catttgcaag ttgtttggca gagtctccct
   172681 ctgtaattaa aagttcagcg tcattcacct tgaataactt tgttgctgga tcatactttg
   172741 caaactgggg gattttattt tttccaacct tcatatcctt ctgtgccttt ttatcatcct
   172801 tatcatgtag tagattcaca actgatgtat atagatcagt ttttgccagg gatttgatga
   172861 atgattgact tagatcccac ttgaatccat atttactaac gggtgtatac aattcttcct
   172921 ttgcctgtga agtgaaacga gcatttggaa tccatgcctc ggcgacaatt agaagtaacc
   172981 ctcttaacat gcttggatta atattatgct tttttgagag agcatttgca atatttttga
   173041 agatgtaatc atgaattgtt ccacgtgtag tatgcgcacc gtttacatat acaatcgatt
   173101 cagcatgatc tcttgcaatc gtcacagcta cttcaagtcg aaccattcca ttcacttcaa
   173161 ccttgtccat gcaaatctta tccaaagaat cccccattac cgcctggata taacccttaa
   173221 ttcccttgaa tgggattttc tccccattta gatgaacggt ggtatgctta ggtgcggtaa
   173281 ccgcgagatc aaatacctgg gaatgaataa tatcccactg acctgtggtt agtgggccac
   173341 gtagaccaaa atatggtaga tctgggataa atgtaattga cacatacgga gttttgtgtg
   173401 aggctttctt aaccaccgat ttctccacag tatacatgtt atttgtccag ataccatgat
   173461 aagattgctt tgtacttgga tcatgtacaa caacttcgaa atatttggaa aatacgttgg
   173521 ttaacttaat accaagacca tgctgtccca gcttgaatga ttcatcgtcg tcgccgaaat
   173581 tcgtgcctgt cataaaccga ctcactgcaa gtgcaacgga gtaatcattc ccatcgggga
   173641 catattcaat tacaaacttg gtatttgtct caatcttgat ggaactgtcc ctctgatctg
   173701 tggtaacctt gatatttttt gcgactgggt tattctggga tgcatcggat gcatttgcaa
   173761 gcggttcttc aataatcttc aatagagcag gtaccatcat ttcctttaca tgttttggtc
   173821 cggtcattgt cataacttct ttattatatt caactggttc aacgccacca acgtacatac
   173881 ccggacgggc taagatgtga tcatgttgag ttaagacctg catcttttga tcagacatat
   173941 gtataatatc ttacctttgt ccttatatta aaaaaaggat ttatggttaa catgataggt
   174001 atgtatatct ataatgattg ttagatcact gagaccagta taatataaca ctccttattt
   174061 ttgtattaat aaattaacaa tgtatacatc atttacatga ccaataccca tttaagattt
   174121 tttgtgtttt atttgtatac gacatctaac tctcttatca ttaacaatgc aacttcgtcg
   174181 gcagtgagtg ccctattaag accgaccaca tcacgcatac gaccaatata gttaccacca
   174241 atctcacgga tgtttcttga cacgtcccga gggaatatgc gtacctcagg tgagcttatt
   174301 tcaaacacgg actgaccatt aacatatata gcaatgtcat tattaggact ttccacattt
   174361 tgaacaacca ctgcaacatg tgtgaataca ttagtagtaa taacgttgga tgtttgtaca
   174421 tcaacaaggg caccaccaac tggttcagac ctgtatctaa ctgatctcgt tgtcccagta
   174481 ccaccagata cctgaacagc aataagatct gttccggatt gacttgtttg gaatatgtaa
   174541 ccgtcgtcag gcgaaatatc acccacttca atccatccag caatggtaat agcactcccc
   174601 ccaccaatgt tctcactgaa cgcaatatct tcgcgtggac tgttatcaat gaagagaagt
   174661 tcttgatcaa agcaaagtgg tggcactggt ggtggtggcg atggcggtgg aggcgatggt
   174721 ggaggtggcg atggtggagg tggcaatggt ggtggtggca atggtggtgg cgatggtggc
   174781 ggtggcgacg gtggcggcgg tgctggcggt ggtggcgatg gcggtggtgg cgatggtggg
   174841 ggtgtgattc cattacacac aaacgcagta tcacgtacaa gtgactgata agaaccaatt
   174901 gatggattaa agcttatacc actgtcactg tatggctgta gatcggaacc aagtaaactc
   174961 tggtagctcg tcgggatcgt cttaataagc tgagcgttct ttgtctcgat gaggaatgca
   175021 acatagaact ctgtagcttc tggttgataa tccatagaaa tcgcagcacg gaactttcca
   175081 ttgccaatcg ctgctgcctg cacaaccaac ggagtctggc taccggtacc tccgtcagga
   175141 taatcgggga aggatgatgg gaagcttgga tcacttgcaa taattgaacc agcagttgcg
   175201 gcaattacgg ttcttgttgg gtcaatgcgc atttcgaact tgacatccac aaagtttccg
   175261 tcagcaggtc tcgcaccacc agttccgtca ggctcggaca gatcaagtgt aacatcgacc
   175321 ccaccagatg atgtacactc tatagtgact cccgtgagga aacgatagaa tccaacttca
   175381 gttcgaataa gtgaaacaac atcgctggta tcaatctttg gttttccaat tgcgttgtta
   175441 acatatccat cttgagcagt gaacttgtct ctgtttggat tcagctgttc cctgagccac
   175501 tgacacgact gaccattcgc agtgtacgtc tcaagtgggt ccgtaccaat tcccgtattc
   175561 tcaaacgtct gacgagcgcc gataaatgcc tggagcgcag acgcgtcaga tgacagaagt
   175621 ttacagtcgc cgttaacatc acctggtact tgaccaactc cattacatgg atcacattcg
   175681 ctcatacgac gatagtcgaa cgagtaggtg acatcactca caagttcatc gtacaagttc
   175741 gcaccgaatc cagacacggc gtcgactgta acgataccga gaccagcaac aaccggctgt
   175801 tccactgcta cagcgtaaca ggcaggcttg ggatcctgtg tgatgtcaca acccaaagta
   175861 gatactgttt ccattgactg aatctcacca aacacaacag atgcaccaga tcccactgct
   175921 attatctgaa ttgtaccaag gaagaccttc cccttgttag acgaaccaga cggtgcagat
   175981 gcaccggata atactgcgat gcggttcggc tctcctggta tttgagtgtt cactgtaact
   176041 gggaactgtg gagtggctgg atctatccaa acggcagttg ctggatcgat tacgccgatg
   176101 tcggtggtct caatgaccaa cgaaatcgat ctgagatacg cgtttccggg gtttgcatat
   176161 acgtcgattt gaattatctc gcctgtttga gtgggttcga attgcaggcc agactgcgat
   176221 ccgagatcga catccaatgt atccgccata agattgccct gcgtaaattt accatcgaac
   176281 tttccggcat tgcatgttag ccgtgcaaac atactcacgt cagtaatact gttcttacgt
   176341 agttcaatcg taccatcgtc gtcaattaca gcaatggagt actcgccatc ggactcaaat
   176401 tcgataaggg tacttactgc aggaacgccc gcattctcag aagagcctag tgagaataca
   176461 aggccatcct ggaacctcaa ggtcaccgat gtaccgaatg tagagttcac aacacccgac
   176521 agcgtcgtac cagatgttgg aactgaccac tccacgatat tcacggggtt tacaacacta
   176581 tcaaccaccg taattggtga cgatccagaa gtagacgaac cgaatgttcc tgtgatgact
   176641 gatgttccag cggatatacc aaggacacgg cgatccgata cggaagcgac gcccggtgta
   176701 cctgagctgt aacttgcctg attatcaacg ttaattaacg ttccatctgt caatcttact
   176761 ctcaagcgtg ttcgcactga gtggtagtcg gatgtgcact cgataagacc aatagttgaa
   176821 gaagccgctc cacccgatgg atacttcaag aaagtcaatg atgtctgcga attatcgacg
   176881 cccacgacgt tcacagatgc agtgtctgtt agtgggcgcc cgtctaatgt tattgtggcg
   176941 gacacagtcg ccgttacgcc gacacagctg tcgtcgttaa tggttacggt gtttgcatca
   177001 ttatcaacgc ttgcgcatga tgatactgcg gtatacacaa cacggttgtc cgcagtcatt
   177061 gtcctgtacg acagctcacc cgttgttgta tcttggaatg taacaacaag agtcataccg
   177121 gaggtggttg cgacgctgat aggtgacaag cgagcatcgt tcacaattga agtcaacttg
   177181 gaagcgtcga ctgtgagctc gactgatata ggatacggta gatcaaggaa gattggaacg
   177241 tagtctggcg tgacaatttc ggtatcacac cagctcacgc gtgtttcaat accttgttca
   177301 gtacacatcg gagatgctcc ctgagcgaca gttacacgcg tgaaatcatc gctatttcca
   177361 ttcaccccag gcgcgtcgac ctcgatggaa gaagaaattt gggaagtgaa tgcaagcgat
   177421 cctagtgaac tagcgtaccc aacatctgaa cgagatccat ctgaccattc aagtgttgtg
   177481 aagatcaatc cagagtctcc ttccgaattc attgcgtttt cataccgtac cgaggcacta
   177541 aatgaaccag gataattgta agtggatggt ggctttgtga cccatgacat ggatgtaacc
   177601 acgcgtgcag tgaccgttgc ggttacctgc gtgtcggata cactcaatga aatggagtct
   177661 ggtgcaccgg agtatagacg gattgtcgtt gacccaggtg taacgccctg aacaacatct
   177721 tgacgatcgc cagtgcctga ggcaaatcgg atgacgttgg tatcgtcgat aaagaatgat
   177781 acttcattcg ttagatcaac gccgtcaacg atagcatgta gtgttgttgg ctgatataca
   177841 gtttcatcac tcgtacaacc agacgcatca agaggcgtcg taccaactgt aatacgttct
   177901 agtatattgt tggtgtcact tgctaaaatt acaatactct gtggtgcgta gacatcaaat
   177961 ccaatatttc gagtcattgt tgcgccgctc gaaataacct gtacgccaag cgtcacgcca
   178021 ccttgactat cggtctctgt ggtggtcatg cgcacaacgc aattggtgac actgtcgatg
   178081 acattgttat taataccaac tgggaagcta cacgacggag acgttgccgt tgacaccaca
   178141 ttactccctt catttgcctc atcgttactg ttatattcgt taacaaccat agtatagaca
   178201 gcgtcattgc catcaagaag agcgctattg agcagctctc cacggggttt gttggatgga
   178261 ggcgggaatg caaatatgcc acgcggcacg acttcttgga tttcaacgaa gccagttgat
   178321 cgcttgctgc cgcgatagtc aaacataaca ccagtggtct tgtcctgaac aataccaccg
   178381 ccgtagttga ccatctcgta cgcatacggg tatgctccag tgtcgatgct accaactggc
   178441 acgcctgcct tggacttgag cgtaatcttt gcaagataga tgacgtcacc ggtgacatcg
   178501 ttgagctgcg tcgtagtaca tccagtacca cagagcaggc cagcaactgc cagtgtgatt
   178561 ccagtgccat cgatcgtgac tgccggtgcc tggaacttgt cagacactgc ttggttttca
   178621 acgtcaaact gtgtcgtgtc gtaatacaac tgcactcgcc atgcagcaat ggagaacgac
   178681 tgagaagacg cataaatgaa cacgtcgaac ggttcggatg cgtacattgg cgagattggc
   178741 attgttgcga acaacttgtc gatactggga ctgtaaccag gcggtgacga tctgaagttg
   178801 gaactgaagt cggaacggta aagagggttg taccaggctg gggaggtgac gaacgacagt
   178861 gtgtcaccgg atgtggcagt gtcaaccaag acaccgttaa ctcggagagc cactgacacg
   178921 gttgcacttg ctgcgagcaa gaaccatgtt gacccaggcg acgaagtgac ggaacaatat
   178981 gttgcgaagc gatttccgtt gttgccctgg cgttcggcac atgcgttcgt gtatgtttgc
   179041 gacaaggagt taccggggtc cgtgagcgtg agctcaagcg catacgagcc cgtggttgcc
   179101 ggcgagccat acttgtcctt gacttgcacg gccactctga tagcgacgcg gtcttcccat
   179161 gcatgcagcg tacgaaggat aattgccaca gatgcgggat cattgcggga tgcagcaagg
   179221 gtagtcgaca ggtactgctt agtctgtatc cttgcgacaa ccgaaccggt agaggttgca
   179281 actggtgagt acgtgcggtc aagcaacatg acagcgtttg cactaggcgt cttttggtcc
   179341 ccactgttat catactcaac aaccaggtca ccggctggat acaccatgga cgcaccggta
   179401 aatgacgcgt cgatatctgg gaacgtgtta agcagcatgt ttgctgactt gcacctagcc
   179461 gggacgatag gcgccagagg aggcgctgcg ggcggcggcg gctgtgatgg cggcggtgat
   179521 ggcggtggcg gtgacggcgg tgggggcgaa ggcggtggcg gttcaggtgg tggcggtcca
   179581 ggtggtggcg gagttggagg cggtggataa ggtgaaaacg atggaggcgg ggtagatggt
   179641 ggcggggggg atggtggtgg aggagatggt ggcgggggcg atggtggcgg aggagatggt
   179701 ggtgggggcg atggtggcgg aggagatggt ggtggaggcg atggtggtgg aggcgacggt
   179761 ggcggcggcg atggaggtgg tggaactggc ggcggagatg gtggcggtgg tgatggtggt
   179821 ggacttggtg gtggtggact tggtggtggt ggcgacggtg gcggtggcga tggtggcggt
   179881 ggtgatggtg gtggagacgg tgggggcgac gggggtggcg gtgatggagg tggtggcgat
   179941 ggtggcggag gcgatggtgg cggaggcgat ggtggtggag gcgatggtgg cggtggcgat
   180001 ggaggagggg gtgatggtgg tggagacggt ggggttggtg gacttggtgg gggcgatggg
   180061 ccacacgtcg atgtaaacga atgaacaata atattggatc caaatccatc gtcatcggca
   180121 taagttgaaa tgtacctgta caatgacgat tctccaccgg caagatcatc aatatcacca
   180181 tttgcgacat agagtgcagt gagttcgcca ataaagtaat aatttccagg tggatcgccg
   180241 gtaccgtatc taacttcacc tgccaatatt tcaggtcgat atacttcagg tgggaagtag
   180301 ttgagtgact gatccggaga aatcgtagtt ccaacaaccg gctggttggt ttcagaattg
   180361 atacctcctc caatgcgcaa tgtaacaact gtcccaccag caccgtcatt tttatgaaca
   180421 ataacaattc tttgattttc attgattgta ggtattgtcc attcagcgaa tgttcctgta
   180481 acaactgtat caaagtcact tgaaagtaca tatcgcaatt tattgttttt gaatccaatc
   180541 tgaataacat cgttcgacgg tgaatcatta tactgtccaa tgtataacac gcccccagtt
   180601 tcctgaatag tgcgtgttgg cgaaaatgtg taagtaaccg gaccaagtgc gccaatatag
   180661 ccagggcgtg caccaaggcc aataacactg ttttccgtgc cgtcaaacac gccaactccg
   180721 gtattattac agaatggagg tgtaggtggc atggatggtg gaggcgatgg tggtggagat
   180781 ggtggtggtg gtgacggcgg cggcggcgat ggcggtggcg gcaatggagg tggcgatggt
   180841 ggtggaggcg atggaggagg cggtgacggt gggggaggtg atgggggagg tggtgacggt
   180901 ggcggtggtg acggtggcgg tggcgatggc ggtggcgatg gtggcggtgg cgatggagga
   180961 ggaggatatg gtggaggcga tggaggtggt ggagatggcg gcggaggaac ggggggtggc
   181021 gatggtggcg gtggcgatgg aggaggcggt gatggtggtg gaggcgatgg agggggtgga
   181081 gaaggcggtg gcggtgacgg gggtggtggg gaaggtggag gcggggaagg tggaggtgcg
   181141 ctcgggggct ggcactttgt ccatccttct aaaaatactg tttgataaga ttgctcactt
   181201 gcaacaacgt taaatggcat gaagcatgtc aatgtaatta gaaacaggga acccattcga
   181261 gaaaatgatc tcatgtaaat agtgccttat ataatctcct tttattaatg tataatattt
   181321 tttttatgta ttaacaattt tagttcgtat atagtaaata caatccatta tgaagtctat
   181381 cctatttaca attgtaataa caggaacaaa tgcttactca tactgtcatg accactctcg
   181441 caactgtcgg tcatgggcag atagtggtta ttgcattgac gataacgtaa caattgcatc
   181501 acgaacaaaa gaaatgtgcc cggtttcatg taacatcgtt ccacatatat gtgacgacag
   181561 taatccatca tgtgcacaat gggcagtaat gggtgagtgc aagaacaacc cagaagtcat
   181621 gtacaaagag tgtcccttgg catgtggaca tgcgtcaagt gtttgcgttg atctaagtcc
   181681 atcttgtcca tattggaagg accatggaca atgcgaaacc aatgccgact ttatgaataa
   181741 gatgtgcgct gcttcatgca tatgcaaacg atcgtgtatt gacaagcaca attcgtgcca
   181801 agggtgggcg cttgccggag aatgccgtaa gaatagtaac tttacattat tcacatgccc
   181861 aatgtcatgt ggtctatgtg agggccatca cgaaacactt gttgacaaag acacaaccaa
   181921 gtgtccactt tgggcacgga acggtgaatg tgttaaaaat ccatctcata tggcatttta
   181981 ctgcccggtg tcatgtaaca tcggtgataa tacatgtgga gacaatagag catatgacga
   182041 atgtaccgga tggagggatg aaggatattg tgaacttcaa ccagatttca tggaaaagga
   182101 atgtgcagcc acatgcggaa catgttctgt acttgaactt cactatgcaa caagtttact
   182161 tacacatgac gaactataat tataccaaaa acacaaaagt ccgacactat aggggtgatg
   182221 aaaaacacct ctacacctta ttctcggttg tcaaaccggg gaaattactt tctaattagc
   182281 taatctactt cagttttgtt tatgatgtct gtataaaatc tcataaaata gttttgcatc
   182341 actccttatt ttttattgtg tgaatataat attttatgaa tataaagatg cgatgcacaa
   182401 tattgtacta ttttcggctg gacagatacc tactgtattt atagagggaa gtacactatg
   182461 tttgcctcca tatgcgccac ctccatctgc tcccgcgatt gttgcagaat taaaagttac
   182521 gacaattatg acgttggatg gaacatacaa cagatcggta actgcatcag caattgtttc
   182581 gaaaacatat gaaattttag taacgtttgc aaataatacg gaatatttac caccaagtaa
   182641 tatactagtc tttcaaactt atactgtagt agttgaagaa ccgataccgt ccaacattcg
   182701 ggaattgttg tgtttaccat ttcctcgaca gagttatgat tttatgcggt gtattgttaa
   182761 aaatagaata gagtttaatg gtatttctga cgaaattcga cgactttctg aaaatttgaa
   182821 caatacatat actgtatccg ttcctatgac aattgatgga taccctggac gagaaccaag
   182881 tttcaataat acatttaatt attcagcagt gaacatagat gctgttacta tgcaaataca
   182941 gactgatgta tcagatactg aaaattatca attactgcgt gatgcagata tagtagcaag
   183001 taaacgggga ttgtctttgt tagttgaatc ggggacatcg gactttataa atgatactga
   183061 gattgtgcta ccgtcacccc ctggtattcc accagtacaa cctggtcaat tgcacccacc
   183121 aagtttgcca cctcctccgt tatctcctcc caatgaaggt ggtaaagtta attttggtct
   183181 tgcagtttgt attcctattc ttgttatctt tttaatgtta gcactgtact tcagaaaagt
   183241 tctaaaacaa actattaatc gtattttact atcaagatta caagttgctc ctgtcgacgt
   183301 tgatgaactc gatgcagaag atactgaact cgatgcagaa gatactgaac ttcaagagaa
   183361 ctatgagcaa gttccttcga gttattttgg tgcatcttcg cggtttgcga ctggatcacg
   183421 attcaataca caccggtctc gattcatgta atgtcgtttt tcggtatctt aaatcgtcaa
   183481 ctagcattga ccgaacgaat ttcggacagc acgggtgaca ttttaaaacc gcatgttatt
   183541 tttgagttgt aatagtaaac aagtcatgat aacgtttctc attttattgt tacattatgc
   183601 atatgtatat tgtgacgtta ctccgtcgtc gccacctcca tcgccaccat tgtttccaca
   183661 gtgtagtgca cctttatcgt ttccgcctga gataactgat gttgagttta gcacgacatt
   183721 tggtgggaga tatgggatta cagttgcagc atgggtgaat atcggttcag ttgattcaga
   183781 ggtaaattca ataataacac ttactgataa tgtacttaat agcatcgttg aatttgaatt
   183841 acattgtcct tcataaataa atattaacag aattattttt aaagtataaa gttaaagaat
   183901 gatagttgtt ctcatattac tgttgcactg tgcatatgta ttttcaatcg atccccttcg
   183961 tgttgggaat gtgctcgacc tccgtctcgc caccacatat caggaccttg ctaatgtttt
   184021 tgacgtgcaa gcacccgtga atactcttgc attcgtagac agcagaacgg gtcggccgtg
   184081 gtctgagtgt caagcctttt cattcgagtg gtggggcgtt gacctaggga gcgttgtcac
   184141 cgttggattt gtgaggttac agaaccgcaa cgactgctgc ccggagcggc tgcacgatgt
   184201 cgacattcat ctcggactga taccgaatac gtacgttggc aacgcgaagg tagcgtcggg
   184261 cgtgaccgtg ttgtcgaacg tgatgttgga gctcgagatc aatgcgcagg gccgctacat
   184321 gtactttaga cgaccgcccg aagtagttgt gagctttacc gggattacgt tgtgcaagtt
   184381 atacgtcttt acattttacc caccatcgcc accgccacca agcccaccac ttccgtcgcc
   184441 gccaccgcca tctccaccac cgccatcgcc atcgccaccg ccgccatctc caccaccgcc
   184501 atcgccatcg ccaccgccgc catcgccatc gccgccaccg ccacctccac ctccaccatc
   184561 gccgccgccc tcaccgccca ttccacctcc accaagtgct tctccaactc caccgccacc
   184621 atcgccacca acccccccag tggctccgcc accgtcatcg ccgacgtttt gtgaaacgta
   184681 tgcaattcgt tttgatccaa ctgcgggaga gaagaacgag tatcgaattg atatcgattt
   184741 gactaattac ggcgccgggg agtacatact tagcgcagat gtctactttt cggatgattt
   184801 tgacggcgat gcgcggatta cacattccag atggtataat gagaactcac aaattgcaat
   184861 agaaggacaa acgagttcaa ctcccagcag tcaatggaga agtattacag attctataac
   184921 gatttcgttt aatcctgtat acatgtattg gtttcttggt tatccaatcg agagtacaac
   184981 tggatatgtc tgggtaacaa acgtacaagt gacagcacca ataggtgacc tattgattcc
   185041 ggatggaacg ttcccgaatg gacaaaactt gggacaatat gaaccagtca ggtttcctgg
   185101 attgatttca accgtaccat catgttcaac ccccccagtg gctccgccac cgtcatcgcc
   185161 gccgccgacg ctaccgccat taagtccgtt actcactggt acattggtga taactggatg
   185221 taacatcgat accgtgagat gcgaacccgc gactttcaat acagggtcag ttcgatgctg
   185281 cagagacgac cctcctaatc ggggaatatc agtatgtcca tctgctcctg gagcccctgg
   185341 aggagcacag aaactcccac cggtcggtat taatataact ggaagtcaag acgcaagctt
   185401 atatacgaca agtttggtat gtacaacact tggttatcgc ttgtgttcga ttgatgaatt
   185461 gaggagaaca caatctactc aaatagcatg tgattctggc tgtgcttata acggtaacac
   185521 ccattcaatg attagttctg acccatgtgc cccaccatca cctccgccgt cgccgccacc
   185581 tccgtcgcca ccaccaccgt cgccgtcgcc tccacctcca tcgccacctc cgccgtcgcc
   185641 tccacctcca tcgccacctc cgccgtcgcc tccacctcca tcgccaccga tatcgcctcc
   185701 cgaaccccca agtccaccgc cttcttgcag tgttgtattt cgatcaaaga cagatgcatc
   185761 tccattacct gttgtcgtaa caaaaacaaa tgcagttgaa caaaatattt gggtgcatct
   185821 cactgttacg tttaatcaag ttgacggaaa cattaaattc tacaaggacg gtttagttat
   185881 aaaaaatgtg attgtatcac aagtacactt ccccgatggt attgaatatt caagtcgaat
   185941 tattggtaag agtttcacaa acggtcagat gcgtgatatt gccggattta actatattct
   186001 taatcagatt gaaataatac agttgatgca ccaaacactt aatttagaat tcggtccaaa
   186061 tcctccggaa gtgccacttg ctcaacaggt tgttgttgga tcaccaagta ctaccgagta
   186121 ttcaacccct ccctatataa tttcggcgcg ctttgatgat gcaaatggag tacattatat
   186181 atatatatca aacacactac caagaccaac agtcggtgca cttgttacgt ttacatttaa
   186241 cacttataag tgcgtgatga agtacaccga agaaattata cgagataatt ttggtataga
   186301 atattgggct ttgattgcaa cccctgagca gcctctaaaa ggagctaatc taatttcaaa
   186361 tacgtttcca ccatccaatc cttcatgtag tagttgtgtg aatcaaggat atatacttga
   186421 ctctaataca aacaataatg aatccggtga tcttgtattt agttttgaac taaacagccc
   186481 atctcctccg ccaccgttac caccaattgc tccttcacca ccactcttcc ctccatcgtc
   186541 ccctgctgac acgtacgacc cttacttcgg ttacactggc tgacacgctt caaaacgttc
   186601 atatatatat ttttgtttca atacttaaca aaaacattat agagttattt gttgtcatta
   186661 accgatattt cataatgtta aaaaaattat ataccattat acacgatttg ccatgcgtat
   186721 aagattctct cctaatataa aactaaatag aagcgaccat cgcggaagtc tacattcccc
   186781 ctggtacata ctatgtccat cacgtggatc cgtttgtgta ttcttccgca cccagttttc
   186841 gcctttatat ttcttacaat aatgttttgc agcgtcttca tttttgacga aacagcgtcg
   186901 agtgtcctca tgaaatgttt gccatgcgtg acgtacataa tttgcatccg taaacgaact
   186961 ttcttcatac caatcgttaa atccaatata tggcttactg ccgcggttca taattgcatg
   187021 gggtacacca gactttgtct gaacacgata tacttcatat atcattctgt cttgatttct
   187081 atgtttataa tgcttcgaaa tatgagcgtc gtcatatgta tcaattctac catgtccatc
   187141 ctttgcgtgc aacatcatac tatcgtcatt ctccataccc tttgtgcacc attgatataa
   187201 tcgattgata ccaaggaaaa acattctagg ctctgaaatt gttccttcat gtgcaacggg
   187261 ttcccacttt ggatttacat ttccatcata atttacaaaa tggcagatct cttcttctcc
   187321 ataattcttc tggtcataag aagtcaccga cagtttatat attccaactc gtaaatcatt
   187381 tgtatattca cccactttta tatggggaat atctcgcggc gtgccatctg ggtttttata
   187441 aacttttgga tcaggtggac caattatatt tacccacaca aggtcatggt atgtcttttc
   187501 attaatttca acttcagcat caaacatacc ttcatcgtca tctttaagaa gcgtaccatt
   187561 tggtctattc tttaggtggt gtttaaattc tccttttatg tataatttta tgccgaatgt
   187621 tatgccggaa attgcgggaa attcctttac atctgatttc ttttttatta cagcttcagc
   187681 cttctttagc catggattaa cacctgttgt atttccatta taaaatatat attgtctgcc
   187741 agctaacttt attttataaa atttctttgc ttctaatgta tccgctgctg tctcataatc
   187801 cactggagtt ggatcaaacg attcagtttg tagaaattcg ccccagccct tggatttgtc
   187861 ttttaagtta tttgtaattt tgttgtagtc agactcactc attatcttta caacacgggc
   187921 gtctatccat tttttaaaat aaatccgtcc gtcttgttta taaacacgct cgaaattcgt
   187981 caagtttttt ataatacggg ttttcagtgg agttgggtgt tcgtcatctg atacttcatt
   188041 gccaacggat acatctggat aattacgtga ccatatcgca accggtgcat ttgggacacg
   188101 atcaggtggg atgccacgga actgatacag tacatttcca gcagtgcgtt gatgttcaaa
   188161 cacttcattc caccgtcgcg cggctgcctt gtttaaaaag attgaagtct cggtttgatt
   188221 gcaataacga agatctaatg atacaaatct tggttcatgc catggacgag gtgcaaatgc
   188281 tctatagtat ttctccttcc atttaaacac accaaataat ttcactgaag tatctccctc
   188341 attatatgcc gcggccgcat cccctagatt tacattcacc ccagggtgct gtgcaagttg
   188401 aagtagaaat tgctgaaaac agcacattgc caaccagtta gaatgtgcgc cattttttgc
   188461 acgaccacca gtaacatttc cctcgtcacg aaacccaaac ttctttttac tcatttcagt
   188521 tggaggtccc atcttttttg taatcatctg cgagatcata ttgtctccga ttccttttcg
   188581 tttataacga aagtattctg cagtgcgctc cttcacttca tcaatatcag gcatttctgg
   188641 tattaatgca gtttccaaat catccataat atcttcttct tttatttcat atgcacgaac
   188701 acgctcttct gcgtatggta cctttgccct atatatatcg atacattttc gcccaaactc
   188761 ttcgcgttcg ggagttacct ttatatcata tatcgtaagg tttgaatacg taatgccacg
   188821 ttttgcggca gggatatctt ccgtacttat tgcacctgta tatgcagcag ttgggatact
   188881 cattgcgaaa taccagaatg gcgcagcctt tgcgttttca aaatctcgat tagaattttc
   188941 agtaatgtga cgtactagat gaccatacat tgttgcgtcg cgatactgtg gagattggcg
   189001 catcatttct aaaattagag cagagaattt tgcgtgttga tgttccaatt ctggtacgtc
   189061 aatctcttca acttttttca atatctgctc ttcaagtacg cgatcaggaa taccgaatgt
   189121 catctgcatc acaatggcag ttagtccaac gtcttgatca gggttatcta gaatatgtgc
   189181 aactgcacgc tgctgatatg taaagtaaac atcatcatat gcttgttcat attcctctgg
   189241 gaaaaacttt tgtacctgtg cgactggagg ccatggtctt ccatttgttt tcgcaacaag
   189301 tgctgctcga cattcaatat actcaacttc atcattataa tcttttggat caagtcgatc
   189361 gttttcgtta tttggatccc acaaatcaat gagtgtaccg ataagaccaa ctgcttcaat
   189421 tgcccaccca attggcccca tcgccataga catcataaat ttagctgcca tcataaattg
   189481 ttttttcgca agcatagaaa tcagtcgttt accagcagcc atcattgctt ttttctgggc
   189541 aatcagaaat gcttttttct gagcaaaacc agccaatttg cgctgggcaa tcatgacggc
   189601 aattgttttt ccagcatccc atgccaaatt tccaattgca ccagttaaac tcgtactttt
   189661 cattccacca aattcaagaa gcatcttttg tgtgtttttg ccaatacgtt taaatgcttt
   189721 ttcggagact tcctcacctg cttctgatac gagatattgt ttaagaacag aatcagctgg
   189781 taattccgat attagtttag gatccccgag aatctttgcg gcttttttca cagccgcttt
   189841 tgttgcatcc tcacttgctt cacctcccaa atccttcata atagcatatg ctaatttatc
   189901 atcaagtgtg tttacaaatt gaccaggagg caatgccgtg ccagaaacca tgatgcgatt
   189961 catcattgtt tcgagacgag atgatgcaat ttcttccgct gccatgacat aaccttcaga
   190021 tagaatacca agcaacatat caccgtgtgt aatttcttct ggtgacatat aagaaactgg
   190081 ctgttctgct acaattgatt cggataaatt tccaactaac tcttcatcta cattaagtag
   190141 agatgctggg tcagtatcgc caccaccatc aataaacgac gggataaaat tatcactttt
   190201 tccaaaacgg gaccatagat caaaaccaaa tacttgtaga actatcagtg taacgacaat
   190261 accggctgca acaagtgcaa caatttggtt ggtctttagg ttggcatacc aaggtccaga
   190321 agattttgcc attctttcat tatacttctt aaaataatca gtgtcatata aattttttat
   190381 ccatagtata atatataaat gactgattgg aaagaggccg ggtattctgg acttgccgca
   190441 tatggaaaat ttaaggctgt catgggggca atagttggta ctgtaatttg tcttcttatg
   190501 attgtattcg gatttaaata tctaggtaaa actacgaaat attcggcaag tacaaatgtt
   190561 acattagcaa tgacagaggg gtgtaaacaa acgacagaaa caagagatgg taacacacgt
   190621 actgtctata cgtgtatggt tagtgctgaa tatactgtag gtagcgacac atttacatat
   190681 aatgatacca tttcatctgg cacaaaatat gcaaatggtt cgaacgtaac actatactat
   190741 gatccaaaaa atccagggga tgccactcta aagtatcaca ttaatccagg gacacttgca
   190801 cttgctggtg taatcattgg attccttgga ttattcggta catggggata cacctacttt
   190861 gtactaaaaa ataaagaaat tgcggctgtg accggaggtg ttcatctcgc cggtgatatc
   190921 gttggggcat ttaggcgtta atttaatact tcaaatgtca gtgttgtatt tcgtttgggg
   190981 agtcgtacca tgcgggctgt atcttgatgt gatccatatg caacttcatg aatcgctttt
   191041 tggtatttag aaatactttc agtgaggaca gtatgcaacg aacgttttat aaataagatt
   191101 ggcatatttc cataatatgc atatccattt acatcgacaa tctttttttc atcaatttcg
   191161 gaaatactag agattgtgct gtattctggt gggaatgata ttaatattga ataatcatct
   191221 ggtgttttca ttttataaac atactgagca aacttatatt ttagcatata cgtcttgtcc
   191281 atgtgaactg gaaataccga gttttccaat tcccatagtt tatcctttgc ttttacatta
   191341 ccaattgcaa gttttttacc atttaccaca tatgccaaac tatttagcaa tattctaagg
   191401 tcatataatg tccgtaactc cttttgtatt gtagtatata gttcaatcgt atatgaaaat
   191461 gcgtcatgca tcttgtcttg tatccgagac acaaatgcac gcatgctctt tagttttctg
   191521 gataactcac gtgtgagcga attagtgttt agtaaatatg atgatctatg aagtcgattt
   191581 tcgtcacata aataatcacc attttgaagt tcgatgcaac catttccatc ttttatggtt
   191641 ttactggaaa tctttggaat acaatccaac tcgttaatat ttaaatactt aaataccata
   191701 tgtttacccc gattgcgcgt ggtgtatcta tattttttat caaactttgc aatgttagct
   191761 aattccatca ttgtcttttc cgggcagatt gccatgcata caatcttaag ttcccataaa
   191821 tatttataca gttccgtcat aaataactta ttggtttcga ctaagttata agatgacgtc
   191881 tcatcatcag atgattcgta atgttcgagt tctgattgct gcatttacat ataccacata
   191941 aattagttga tacagttatc tatatgtcta atcaatcaat tacagttacg tttgagggga
   192001 tttctggaac cgttaatgta tttgaagcag tttcttcact cgttactgat ctaatgttta
   192061 agatttttaa tgaagacgat tttacaggta tccgtatttg tacacttgat tcgaatcagg
   192121 tttgtgttat ctatgccgat tttgaagcga ctgtagataa tctcgacgta gggtcatctg
   192181 ttcaggtatg tgtgccagcc aagctacttg ttagtgttct aaagtgcatc aaagaacaga
   192241 atatcctagt cttcgagtat ccccaatcaa gtggtaccca gcaacttatt attcatcaat
   192301 atgagcagga aaattcatca attacacaaa aattcatcat tgacgcaatt gacgcaccca
   192361 tccaagatga actagacacc gagtttgatt atccatgctc tatgaatatt tcattgactg
   192421 aagtgcgaga gtttattgtc aactctggta catttggagc ggacacactc acgattggag
   192481 tatatagatc cgtgaaggat cagtataata tagcgaataa actaactctc agtacagatg
   192541 ggtcaatcaa gtgcgagaaa gtatattata ccgaacacac aaccgaagaa caagcaaacg
   192601 aattctccgt cgacaatacg cttgccatga aagatcaacc ggttggacat tcatttaatc
   192661 cactcgtaag aaatacattt ggggtaaagt atattaaaga ttttcttcgc cctcttcagg
   192721 cgattgatat tcgcttaagt atggcaaatg aaatgcccat tcgtttagac tatccgatta
   192781 gtgagaaatc gttcattaca ctttttatta ctccaagaaa cattgattga ttattcatat
   192841 gtatcgtact gcattatctg cgcacgaggc cattaaatgg gtcagttgtc caacgcatgg
   192901 tcaatgtatc ttgtttaaaa atcacatgta tccaaatggt gatctgttac aacgaaaatc
   192961 atataacaca tgtgcatcat gtgttactac agacatatta ccaacactaa atacaaacca
   193021 tatcgtattt gacgatagta aaaaaatcgg aggtcttggc agtcacattc gtctatatct
   193081 acaggcaagt acatcacatg tggcaatttc tttacttgta cttgatattt catgcccaac
   193141 taaacaagca aggctagaaa agtatgtcga aaatacagca tctctgtcat taaaagaaga
   193201 atgtgatcca tactatccat tcaacggaga tatggcaact gatctaatcc tggaaacacc
   193261 aagtaaatta ccaactgtaa ttttacaact tgcactgtta gatatatcat gcgtatcatt
   193321 tgatacagaa gatagtatca cggtaatcgt tgacaaattc actcgaacat attcgatgtt
   193381 cacagccaat gcagatcatg cactcaacaa accaactcgt gaacctcaaa actggcaagc
   193441 aattacatat ttaggtacac aacattatac tgcagaatct cttggacgtg ccatcgcaaa
   193501 aactaataag ttaccgtcgt tatatgatga ttatttgcca gaaattctaa ctaggtcaat
   193561 tcatacacag actgcaatta tatcaccaac gggctcacac caaggacaaa cacccactcc
   193621 aaaattaaaa ggtgatacca tcccgaagat gtgttacgaa taccaaaaac ttgtcattat
   193681 ggcatatatg atcaacaagt atatcccgac acacaaatat tcatcgcaga tagaggcgtt
   193741 atttttattc ttcgggatgc acgggtatat tgttagacag ttaggggcat atgttaggtc
   193801 ggacaaatat agagggactg gtaaaaacgt tagaacgttt tcaggggaag atgcagggtc
   193861 agagaatatt gatgaatatt ccctaaagcg gcttaagatg attgatggaa aatggagggg
   193921 tcttaagtat aatgataagt gatcagatta atataatgta actgtgtata ttaaaggata
   193981 tatcatggat cccccaccac gtcagacatc caagatcccc ctcccggagg atacaattat
   194041 tagaaagtcc gtatttggac gcgcagtcac tggattttca gatgaaaatg accctagata
   194101 ctctgaatta aaatgcggat ctgcaattac ccaaattgta aatgattcac atgtatttca
   194161 ctcacatgaa ctaaacggac gaaaagagtg gaatcgccca accaagattg cttgttatca
   194221 ttgttgtcat caattcaaaa ctgcaccaat cccaatcccc aaaaaatacg acagttattc
   194281 cagacaattt attgtacatg gaaatttctg cagtttgtcg tgtgcaaaaa catacgttct
   194341 cgatagagag gcaagttcac cacatgcact tactctgttt ttaaaaatgg catccgaagt
   194401 ttatggcatt aaagaatgca tcccaactgc accaccaaag gaagcacttg tactatttgg
   194461 gggaaatatg tcaattgaaa catttagaaa caacaaggta aatgttgcag taatgcagcc
   194521 cccatttatc aactcatata cggtaattga agaacgcaca cttatggaac agacatcttc
   194581 atatcatatg ccaatcggta gcgttaaggg ccttaaacgt ccacgtgata aattacagct
   194641 tatagtagaa ccaaagccag aaaaatcacc ttaccaaatt tatcttgagc aaagaaataa
   194701 accgaacgat gcttagtgaa tatgttttgg tgaaatttca aaaatccatg gacgacctcg
   194761 atcgggttcc actcccactt caccgcatgc cagtggcacc aatggtacca acagataaag
   194821 tacaatttta tacaaagtca tttaatgagc taatggagct ttacacagaa ctaacaaaaa
   194881 catccaatga caatatcatt gcttccgtta tcaaggagga actcgaacgt cgactctttg
   194941 atgtcgtcga taataaaatt agtagactta cactattggt gaatgaacca tttaacgacg
   195001 atgcaatcat gctatatgaa aatactcgtc agtcacttat gaaaagcaag gaactctata
   195061 ataacggatc tattacactt gcacaatttt caaacaatgt ccgcgtattt taattacatt
   195121 atagtaaggg tgtggggcgt gttttgggtc agttatatat gtttactacc gcggatgtat
   195181 gggattgtat gcgcgcagaa agattcttat taaaactatt acatacaata aaaaatacga
   195241 tattacccga attaattata ccagataaac ttaagaaata cacacacaaa atagaaatac
   195301 ctaataatgt atcagtgtcg caactcggta ttacgatcag tcccgatcca cagacatttg
   195361 gttatataga atgtaaatat tacaaaaaca attatccgac ttgtctaaat ggaacacaaa
   195421 aaagaatatt taaaacatat ccatctctaa tcatacacat tcagatgctt ttattccgcg
   195481 aataattcgc tgaataataa acgaagcact cccgcgcacg tgattatgta tactggccca
   195541 cacgcgttca atctccgttt caggctcata tttttttgca cgatagtttc gcaagttgtt
   195601 tttgagcata catagtatca tcacctgtat gcagaaactt gccgtttatc cagtcggttt
   195661 ttagatttaa tgacgaagaa caatcccaca ttgccttcct ttgcatttct tttgtataag
   195721 atgtctcgtc tcttgggata ttttcaagaa ttcgactgtc acaatgaaag tcaactgcag
   195781 acagtggaat gtccgtttcg tttatcatgc gttcatgaac atacttacct ggtttcataa
   195841 acccaaagac tgtgttgtat gaaaccaatg caatcttatc ataatagcga cactgccatt
   195901 tctttgcggc acattttaac atttcaatgt ctcccttcat tccaccaaat gattcgcgca
   195961 aaattataga atttgcaagt ggggtatttg caatattaaa tactggtgca tcttcgacaa
   196021 tgtcaaacat aggatcacga tacattacag tggcgatgta gtatacgaat ttaatgattt
   196081 gttgaatgtc atgattagtg aattcatatg aatgagaatg cgacgcaagc attaaccacg
   196141 tgattaaatt aaagttgaat ggtacgattg catcttcaat tgcaataatt ggaaggcgtc
   196201 gtaacagttc ccgcaaacca tctgggttgc atgtacatgt ccacgcaata tttaatgcac
   196261 caactacatt accagttcgt acatttttct gaagggccga ctttaaatga tgtactggga
   196321 ttttctgcaa cctgaatttt ggatgatatg ttacacgtgc acttgtccgt ttatcatgta
   196381 gttgaatcct ggtcgtatac tttctagaac cacgtcgtat gcaactgtta aatggagcag
   196441 atgaccatct cgactccggt agagtgtcgg tgtatctcac tacaccatca tcatacaatt
   196501 caacatgata tacatcattt agttgacgcg acgctgtcat aagtttatcg aatgcattta
   196561 ctttttgttg cttagacata ttgattataa tgtatgggat cgagtattaa gtttacttga
   196621 aacgtattcg ttgtcagatt ccatatctgt acaccacaaa taataacacg gcaaagtata
   196681 tgtttagcaa catagaagat gccacatggt ctgttatcgg agattatatc aacagtgtat
   196741 ctccagtagc tcatcagatt gaatcatatg accacttcat cgaaaaccaa ctcccttata
   196801 ttattagtga aggaagcgat atatcataca tgcactctag cggaaaagta tctcatcacg
   196861 tgcactttac caacccaagt gtgaatcgac cggcaatcca agagtcggat gggttttata
   196921 aaccaatcac tccacatatt gcaagacttc gtggtcttac gtattcatct accgtagttg
   196981 ttgacgttat ccacgatcgc attaatcata ccgtatctcc accaactcta attaaccgta
   197041 aagtatttcg taatgtcatc attgcacaaa ttccagtcat ggtacggtcc aaactctgct
   197101 atcttgccga tgtttccgaa aacgatctat ctgcagatgc gaaaaaacac gaatgtaagg
   197161 ttgaccccgg tgggtacttt attattagcg ggaacgaaaa gacacttatt ccgcaaacaa
   197221 agattagaac aaatcatgta ttcatctttc caagtaagca cggggaaaaa cacaagtata
   197281 ctgcagaggt ccggtcatgc cacgaggcca aacttcgcag tacaagtact atttatatga
   197341 atatcaacga tatttcaaat ggagaagttc cagtaattac atgcaagctt ccgtttttaa
   197401 aatcgaacct tagtgtcttt atattgtttc gcatgctagg agcggaaagt accgacgaca
   197461 ttattaacta tatcggaaac attcccaagg acactgaagc aattcttcga attatgttag
   197521 actcggacac caaacaaaac tactctcgtg atgcaattat ggattgggtt ggtaggaatg
   197581 tgaccagcga tacgactcgc gcaacaaaag aatcgcgcga gaaatacatt gatcacatca
   197641 ttacatccga gcttgcccca cacatgggac tcgtgaataa tccagaaaca aataaaaaga
   197701 agatgatttt cattgggcat atgattcagc gtctcatgtc tgttgcaaca ggacaggaag
   197761 tcgttgatga tcgcgacgac tttgtcaata aacgcatcga ttcagcaggt gctctccttg
   197821 cacttctgct acgccagcat caccggggga atgcaatgca agggcttagc acgcagctcc
   197881 gcaagcaagt tgaatctcct cgcgaagcga cattcaatgt aggtgagatt gtatctcaca
   197941 aaaaaatcac aagcgggctt aaatttgcat tcgcaactgg tacatggggt atttctcgcg
   198001 gcggcggtac agcaaacggt ggccaaactg gtgttgttca gatcttacct cgtctaacta
   198061 caatggcgac gctaggtgca tctcgtaaga ttaatacgcc aattgcacgc gaaggacgca
   198121 ccgccggacc acgtatgctt cacccaagca gctggggtct cgtatgttgc tcggatacac
   198181 cagaaggtca agcatgtggt cttgtctcca acctagctat gacaacacgt attcgtattg
   198241 gtgcaccaat gcaacctatt gccatacttc taatgacact agatcataca attgacattt
   198301 cgactgccac atcacatgag agatacattg ggtatgcact tcatgtaaat gggacaattg
   198361 tgggatatgc aatcaccatt gatcaaatta aagaaattgc aacacagatg cggtctctac
   198421 gtcgccatgg caatcttcca ttcgactgtt ctatcagcat ttcaaacgac aatagtttgt
   198481 ttgtaaattc tgatcacggg gcattgcttc ggccattaat tattcgagat aggtatcatg
   198541 attttgtatg tatggcgatg cagaatccag ctgttgttcc aaacaaatat acgcgcatgc
   198601 ttcgcgaagg aatcattgaa tacattgatt cagcagaaca gacaaatatg agagttgcca
   198661 ttcaccatac tgatattgag caggatgaat acacacacat tgagattcac ccggctctac
   198721 ttaccggtat ctgtgtatca caaattccat tttgtgatca caaccagagt ccacgcattg
   198781 cataccaggc ggcacagtgc aaacaggcaa ttggtctata cactaccaat tttgcagaac
   198841 gtttggatac agtggggcat gtacttgcaa ccccacaaaa accacttgtt accacgcgtc
   198901 tcgaggaatt actaggcacg agtgttgttc gttccggcgc ggttcctatt gttgccatca
   198961 tgtgttattc tggttttaat caggacgact ctgttctgct taaccagtca tctattgata
   199021 ggggactatt cacaagcttt gcataccaca ccattcgtga tgaagaaaaa ggaacggggg
   199081 cggacattga acgattcgaa aatcccaaaa atatccccgg ttgcagtggc atgaaagagg
   199141 ccgattattc aaagattgat gacaagggaa tgccaattat tggaaaaacg ttttataacg
   199201 gtgatgttct tattggtaag gttgtatcaa tgtcactcct ccaggcagat ccaaaagaag
   199261 gtgaagtacg acgggacacg aagcgcgatc gttctcatgt acttcgcaca gacgaaccgg
   199321 tcgtcgtcga tgctgtattt ttgtccaaga cgccagaagg tcatggatat gtaaaggtac
   199381 gaacacgtgc tattcgtatt ccaatggtag gcgacaaatt ctcggccagg cacgggcaaa
   199441 aaggtgtatg tggcgtcact atgccagcag ccgattttcc gtgcacagcc gacggagttg
   199501 cacccgatat tatcatcaat ccacacgcca tcccatcacg catgaccatt ggtatgctaa
   199561 tggagatggt tctctccaag gttgcatgtt acgaaggaga aacacaggat ggcacgccat
   199621 tcactggtaa taatattgaa cttattgccg atcgtctaga aacacatgga atgcaacgct
   199681 atggcaacga gatgctatat aatggaatgt ctggggaaat acttgaatct atgattttta
   199741 ttgctccatg ttattatcag cgattaaagc acatggtagt tgacaagtca catgcacgca
   199801 accgcggtgc acaacagcta cttacacgcg cgccaacaga aggacggtca cgcgatggtg
   199861 gtctccgaat tggtgagatg gagaaggatt cgataattag tcatggtgcg ggagacgttg
   199921 caaaggatcg tctcttcgag cagtcggaca tttttgaatg tgttgcttgt gaaaaatgtg
   199981 ggcattttgc acgcgaggga accgatgata catccgtaaa aaattcgggc atgtggtgcg
   200041 aacattgtaa gacaggggaa cattgtacac atacacagct accatactca atgaaacttc
   200101 ttatccaaga attagcggct gctcatattt ctgccacatt agaattttaa tgttagtttg
   200161 tcccatattt tgatgccatg tgagctttgt atgcttttgt attgtattta tgttcgtcta
   200221 cataaaattc tgcacccttt cgctcagaca gagatgtagc acgcatccgc ttaccgacat
   200281 ttcgttttat cacatctcgc cctgcctggt gcatactatc atccacggcc aacacttctg
   200341 cgtctgtcaa ttgctgcaac tcttttagat tttcttgttt tgtatcacca atttccgcgt
   200401 cagtataaga atatttaagt ttattattcc atgcaatacg agctactaca attgcaaaga
   200461 caaacaatat accaataact actatgttgt tcatttatat actatggata ttttttatta
   200521 aggttccata cttttacacc gattggcata tctgggatat ccacttcgtg tacataacac
   200581 gtatcataaa tcacatcgga aaaatgcttc tgataatccg cgagaaatgg ttcgtactct
   200641 cgtacagtcg ataacatttc atctgcggga gggagggtat ctggattgta gtcaagtacc
   200701 cagatgtcat cacaccaatt tactaaatta ttaaggattt ccttgtgtgc ttggtgtggt
   200761 agttcgtgaa atagattgga aattacagct acgtcatatt tatgctttat gtccactgcg
   200821 tttaactgat gaaattctac gtcttggttt acatcacgtt cctttgccac atctagcatc
   200881 tcacatgatg catcgatgcc gatgagtttg catgaccgat ccagaaactt gtttagttca
   200941 aatgtcgtct gaccaacacc acatccgata tcgataacac tcgagtcctt ataatactga
   201001 gagatatact tggcgaattt ggcacggggg tttaccccct catatagata ggcgtccgtt
   201061 gcgtcctcta gtgtttgggc cactgatgcg tggaattttc ccataagtcc gtgatttggc
   201121 ataaaatgaa ttggggtgtt taaaatagca tttgatttag atacaaatcc acttggtttt
   201181 atatcaagtg ccgatgtcac gatacatacc gataggaaaa atgtaagagt cttcatttct
   201241 atacgtacaa tattttttac gaaaatcaca tgtgcttatt cacaaactta tcagaccaca
   201301 taccataaat cttattgtgt acatctttgc gagaaatacg gatatcatca tccatgcact
   201361 ttacgatatc atatgtacga cgcagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
   201421 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
   201481 nnnnnatggt ggtggtggac ttggcggcgg tggcgatggt ggtggcgatg gcggtggact
   201541 tggtggaggg ggcgatggtg gtggtggact tggtggtggt ggacttggtg gtggtggact
   201601 tggtggtggt gatggtgggg gtgacggggt ggtgggacgg aggtggcggt gatggtggtg
   201661 gtggtgacgg tggtggtggc gatggtggtg gtggtgacgg tggtggtggt gacggtggtg
   201721 gtggtgatgg cggtggcgat ggtggtggtg gagatggtgg tggtggagat ggtggagggg
   201781 agatggcggt ggcggggatg gtggtggtga tggcggtggc ggggatggtg gtggtggtga
   201841 tggcggcggt ggcgatggtg gtggcgatgg tggtggagat ggtggaggtg gagacggtgg
   201901 tggtggagac ggtggtggtg gtgatggtgg tggaggtgac ggtggggggg atggtggtgg
   201961 tggcgagggc ggaggtgggg atggtggtgg tgggcttggc ggcggcgggg atggtggcgg
   202021 cgggcttggt ggcggtggtg atggtggcgg tggtgatggt ggcggtggcg atggtggtgg
   202081 cgttgaaggc ggaggtggca atgggggtgg tggagatggt ggaggtatta gtggcggtat
   202141 tgatggtggt ggtgacggtg gaggcggtga cggtggaggc ggtgacggtg gaggcggtga
   202201 cggtggaggt ggtgtggatg gaggagcatg ttgcacgtat atttttacgt aagaatagtg
   202261 agtaaagtca ctatcgctac ttggtccatt tccggcggtg tatggtccat ttgctacaca
   202321 cattgtgtat gtggaagata cttgctcgcc tctgtaactt tcaagtgtat tgttagcgtc
   202381 acctaaaact ggatcaacta taccatcaat ctcacttgtt agttttatgc tatgtgtaag
   202441 tccagattta actagtccac catagtcatt gcctaaattt gctgcaccag tacactcagt
   202501 gttaccggat actaaatcat ctcggaccca tacaacccaa tcacctaccg aaactacatt
   202561 tccgccgtat acaagatttg taacttgttc atgaagtaca gcagtctcaa tatttggagt
   202621 tccaaattcg gtacttaaca atgcgagtgg tggtggtgat ggtggtggtg gtgatggtgg
   202681 tggtggactt ggaggtggtg gtgacggcgg tggtggtgat ggtggtggtg gcgagggtgg
   202741 tggtggactt ggaggtggtg gtgacggtgg tggtgagggt ggaggtggcg aaggcggtgg
   202801 tggtgatggc ggtggtggtg atggcggagg ggatggtggc ggaggagaag ggggaggtga
   202861 tggcggggga cttggtggtg gtggtgaggg cggcggcgga cttggcggtg gtgggcttgg
   202921 tggcggtggt gatggtggtg gaggagacgg tggtggtggc gatggtggtg gtggagacgg
   202981 cggtggaggg gacggtggag gtgatggtgg tgggcttggt ggtggtggtg acggtggtgg
   203041 cggggacggt ggtggcgggg acggtggtgg cggggacggt ggtggtggtg atggtggcgg
   203101 tgatggcggc ggcggtgatg gtggtggtgg agatggtggt ggtggggatg gcggtggtga
   203161 tggtggtggt gatggtggcg gtggtgacgg aggagggctt ggtggtggcg atggtggtgg
   203221 cggtgacgga ggagggcttg gtggtggaga tggtggtggt ggtgacggcg gcggtgatgg
   203281 cggtggtggt gatggcggtg gtggtgatgg cggtggtggt gatggcggcg ggggagaagg
   203341 tgatatatca aagtgagtag tatactgtga ttgtggcgtt tcatatactt cagtgcccgc
   203401 agacaagcta tttcctgcat catagtatgt gtttgcaata taaaatgtat aaccatcttt
   203461 gacgcgtatg cgcgcgggat tcgcactgtt aactgtctga actaatgcgg gcgatatatg
   203521 atatgcgcca tactgtatac cacctgttcc aaattgactg ctaaatgttg taccgccaaa
   203581 aactgaaatt ttgttgacta ctgcactata ttgaacctca tctgcggttc cttcatttag
   203641 tacaccatcg atgtcaaagc aatctgagac ttgttgatgc tgattattaa aacaaacacc
   203701 agaaatgaac gcaacgttaa attttcttgt gatgaacaaa catgtacgcc atggttcagt
   203761 aagacaaaga cttgtgtata cttttaccct acatctttct tcttctactc catcaactgt
   203821 aattgaatat ccatcaaaac ggttgtaaac acaaggttcg ttaaaatatg gatgaagtgg
   203881 cggtggagat ggagcatttg gtggagtatc aagtactact acaaacgccc ttccactcaa
   203941 gcagtttcct tcggggaaga taatcttacc tttgtaagtt gattctggtg cggtaatgta
   204001 acttatgaaa cgagtattaa ctgcatcagt cgatgaagtc agcttgtatg ttaacacatc
   204061 tgttgcatcg atgtcagtag aaagtagttc tgaaaatgtt tcttcgtcat gtgtgattgt
   204121 ataatacgtg aaaccctgat tattatatgg tctaaaactt ccagtggttg ggtcggtttc
   204181 atagttcacg taaccatgaa ctgctttaca gtcggatgtt atcgtgtaga aatctattag
   204241 aacatagttt ggtatgaaag atgttataga tccagttata gtagttgggt ttgtagatgt
   204301 ttcaaataca gcgtacgatt caccacaata ctctgatgac gtcccatcga aatctcttcg
   204361 aacaatcata tgataagaac ttcctgcagt tttgtaatat gtgtggtatg atccaccata
   204421 gtttaaatca agttccgtac cggcataatc caaatatgcg ttaaattgta gccttgtata
   204481 tgtgccatca aacgtgtcat cgatgccaca gcagttagtc gctgcttcaa ttgtcatact
   204541 agtttgtccg catgcatgag cactactgtt cgcaaatacg tctgagtgta gtatattttt
   204601 accgtttaac tcgtcaagat ttctagctaa tagttctatt ttttgcgcgg gtctagtaat
   204661 aactcgctta gattctttca aatcatctac aacaattgca catcgtctat tattcctaca
   204721 gtccatgtca gtatagtatc caagtgcact cgcccctggt gataatggag gaggaaatgg
   204781 cataggggag tttggaggat tcggtggttc tagcgggggc ctaggttgtt gtggtggtga
   204841 tggcgggtat attggaggtg gaggggatac tgtgttaaga agaagtattt gtaatcctcc
   204901 gatcatttta cactttactt atttatatta tttacacaaa ataatatttt tgaaaaatat
   204961 tattgcgtga atataaatta caattatgaa ataattatga aacaaatact acgaagtcac
   205021 agtggttgtg tgttttagag tgatttcatg tgtatgttga gtttcatatg ttggatttgc
   205081 ctttttttac tgtcatttca gagatagtat atgtttgatt ttgttcaagt aattgatcaa
   205141 actgctcgta tgtatcattc catgcagtca taccaatgtt tccagtatca tcctgaattc
   205201 taaatttgca cataaaacca tttttgtatg acctgcagtt tttaaatgta attacgcctt
   205261 gaatcttaaa atttccaggg gttgtcccaa cttctgcgat tggtgtaatg attacatcat
   205321 ttgtgcgttt tttaagaaca cctcctggag tgtgtgtgag attcatacga tcgagttgaa
   205381 tgtccataag tgtagctttt cgcgcaccca atacgacaag tacaggtgtc gtgcctactt
   205441 tattgtgaat tgcggatgta ataacaacat ttgtgttatt ttcaacacga tcagctgtat
   205501 atggtagaag cacaacggtg gaactttcac caaatgcaga taccgttgcg gtaggtggga
   205561 atgtttcctt attaagattt gttaagtgaa cataaccagg aagatgcgac tgagacatat
   205621 caataacata atctaaagtt gacatttttt gtaaacacta gttaaatgta taatgcctcc
   205681 ttcgacgcag ttaaaacaga cagtaaacgt aacatctaag agatggtgga ttcaatattc
   205741 acaggggttt ataataactg caattattgt tatattctta tctgcaatga caggtaatat
   205801 gagagatatt ggaattggcg caggcgtact tgcattgttt attggaattg gtttattcgc
   205861 ttcgtttcga aaatatggcg tatgggctac aattgcaagt ggtccgaccc taatatttgg
   205921 aagcccacca ccaccaaagg agaaacaggc tactatggat agtacattta acctaacatc
   205981 ggggtattaa taaaaatatt ataaaattac catttaggag acaaatcttc accattatat
   206041 ggtgtaaaca catatgctaa ttcatgtgca caaacactag ttacgattga aaataaaagt
   206101 tcatctgaat aatatgcaga tgcatgaagt tcttcgagat tgtcacggat acgtgactca
   206161 aacaaatcga tcgcgtgctg agaatcttgt ttatatgaag aagatagtct aatattggtg
   206221 ctacatacat aattggcaaa attagatacg gggatattgt acttttttgt gatatccgtt
   206281 acgttaaaca tatcgatact aaaggagttc ggtggggagt agctcgttaa caatgccgta
   206341 cttgacacac ttatcatccg ttagatctag ctcagatttt aggagctttt ttaagatggc
   206401 tgatggaagc cacgtttcct ctttataaag agcatgcata cgttccatga tacgcttaca
   206461 gttcttgtaa tcgtcttcaa tttcttgaaa ctttccatat ccaccagtgg aaagttggtg
   206521 aataagaacg tgacttgatg gtacaatata acgatatgac cctgcaagta acagaaatgt
   206581 tgcagcactt gcgacatatc cgtctgcaat agttacaacc ggaattacat tccggcggat
   206641 tagactaaac gccgaaaatc cagcaaacag gtcgccgcca catgaatgaa tgtatagaga
   206701 aacatatgga gcatgaagac cataattgct attgattgca gtttgtgttg ccttgtgtag
   206761 cgccttgcga agttttccgg tatttttcgt cgaaacactt gtggaataat atacagatgt
   206821 acccatcaca tatacttcag tatcagaatc ttcgtcgtcg tcatcatcat cgtcatcatc
   206881 acctgacttt ttctttgact tggaattgtt atcgtcattt gttttcttgt ctgcattttc
   206941 tacattatcg acattttcga tattaccata cttgcgctta cgagcagaaa catacgcatt
   207001 ggatttatat agcatgactc agaaaaaccc taggggaatg ttatccttcc ctaacagatt
   207061 atattccttc gcagtttcca tatcagttgg aatgcattct ggtttccatt tatgacaagt
   207121 atacttcttg caataacatc ctgcagtaac acatgcaaat agattatact tgatgtaaat
   207181 cgtcgattgt ttgtgctttt tttgcatatg tggacaataa gtttcgtcta atttgaggat
   207241 atgccccgca tattttggat ttgggtgatc atattgcatt gtatctttaa ctacgggatg
   207301 cgagaaaatt gtatcaattt gtgcggcata ttcaaatatt tttttacctt tttcggttga
   207361 gattgaccca attgtaggtg cgtccctctt tctcttttta acataattga tgctttttgc
   207421 atatgaacgg attgtacaac gttgaattgt taataatgta gaacttttga acgatgctgt
   207481 ttgtttttca tgaattgtcc catttgggtt aagtactgca tgtacagtgt atcgtcgatt
   207541 aactaattct tttgtaccat catcaagttt ctttgttttg tatgaatatg ccatacgtaa
   207601 tccggaaccg gtttttccag tgtaaggtgc cggatcatat atgtctgcag catatatttt
   207661 tttgtttggt gaaatgcgat cgagaatttc ctggaagcgt tcaaatgatg cttcgcgtac
   207721 gcctttttca tagtcaaatg aacacttaat atatggtgca attatgtgca tgccatgttt
   207781 tactccttct tcttcatttg ccgacggtgc agttagtata attaatgttg tatttgatac
   207841 gtgaacttca ggctgctgtt gtagcgttag ttgtagtgca cgtgcaaacc caatgtaatc
   207901 aaattcgatg tctgtcggta catgagcatc tatatcagca tgaaatatat gttctggtgt
   207961 ggcaatttca gtaatacaat ctttgtaccc ggcgtcaatc gcagcagcac gtagccgaag
   208021 gaaagtcgaa tggtcattat ttttcgttgt tatgcaatat ttcccttcaa acatatctaa
   208081 gtgtgtgtga atttgttcgt cgccacatcg tcgtttacat atgaattgcg tgtatctatc
   208141 tatactcata ctgtcaaact ctttttgtga tgtacatttt aaataatatt tatactatat
   208201 aaatgggcaa aaagacgtcc aaaccgaaaa ttgattctgc ctattatttt ataggagcaa
   208261 ttgttgtggc aattttaggg tattattact acatcaatta ttatcaaaat ggtattaatc
   208321 ttgaagtata tggatatgtg ttaataaatg caagcgaaaa tattacatcc ccgacaatgc
   208381 cttcgttacc aaatccacct tcacctacaa cacaacccat tgacccactc cccgtaccgg
   208441 aacctgcccc tatgccggat cctcctacac cttctcctcc tcctggtccg gggccgccac
   208501 catcagtacc ccacgtggaa gtgtttccta caatgccagt tattcctcca tttactcctc
   208561 catcagaagt aacccaagct aacgcgccac ttccaccagc accaaaagta ttaccaaaac
   208621 catgttcaca acacaaatgt gcatcacata gaaagttaca cccacaagca tcaagtaaaa
   208681 atggaacaaa cgatgcagat tgttgtgtcg acataatgtg tgatgaatat accaaatgtc
   208741 caattgatca ccttcgtaaa ctaaatccag aacgcattgc tgggactaca actccacaat
   208801 gttgcgtaaa gatgaatgtt tcgtctggtt ggtatataat acctcataaa tattacgacg
   208861 accgaaccat taatctattt cataacacaa gatcatcgga tgaatgctct aaaaaatgcc
   208921 agtctaaggg taattatgca ttttcatgga atatgaaaaa taacacatgt tattgtaaaa
   208981 atgacattaa acaacctaaa aaatcaaccg gtcaaggtga tgtttgggta tccggacgtt
   209041 atggtaatgg tgtcaagcta tgcgaacata gatcaatgaa aggaaaatgc cagactttca
   209101 ctgctcctgg taaatataac gtgcatcatc ctaaaatggc aggtaatccg cgcgagtgtg
   209161 aaacgacgcc gcttgcggga cgaactgtag cattgtatag tgatcattgg aaacgtttcg
   209221 taaaaataga tggacgtcgc gtgataatgt ctccaacaat taatgttcca tcagtgcctg
   209281 cttggtggca ctcggaaaaa tttgaacttg tatcagcaca agacggtcag tttgcattat
   209341 ataaccataa gtataaaaat tatcttcgaa tgccggggcg taataaagat atggatggtt
   209401 cggatagaca aaataagcac tctagtatac ctcacaatca aatgggttgg gaacgattcc
   209461 aatttataca caaaggagat ggacaatatg caataaaatg cccatattct attggtggac
   209521 catcgtatat gagagcaggt ggacatcatg taaatggagt accacactca ggttcatggg
   209581 aacaattccg tcttattgat gttcattgca gagtaggatt taatgattcg tttagttcag
   209641 cgcttgtata tcctgggtat gcagtgggac tgtatgagca caataacttc gatggaaaaa
   209701 aatggtggat tggccctggt caacgtaatg agttaggcga tcatggtgat agggcatcat
   209761 caataatcgt aagaagagat acatggtgat attgcatcaa tgtacatttt ttagattgtt
   209821 ccatacatgt atttaatgta ctgtgttatg atattaagca tatgtgttac tgccaggagt
   209881 ttaggaattt tcccccaacg ccgcattggc catggcccaa taaatggtgc aatttataaa
   209941 ggagaacata agtttgcctt tatgttcaag gaaacatttg aacttgaaat tacagacaat
   210001 acgtccggaa ttcttagaat gaatggttat gtttcacacg aagaccaaaa tatacagatt
   210061 aaaccattga atcaatgtga gtttgttctt gaatgcagta gatgtacgtc agaaaagttg
   210121 gaaactttta atgttgaact cgaacaagca atatatgatt atgatatgga tgcaatatgc
   210181 ttatatataa agccaaaaaa cggcaaagta caaaaaacat ttatgtatag agaaagacac
   210241 gccacatatt aaatgttttc ctttgtatta tttgcgttaa gcgtatgttt ccccatggat
   210301 aatttaccaa tacgaatcaa gacacgtcgc atgatggcag cagaggattt aaaaacgggc
   210361 agtcgcgttg ctgcgcttgc acactttgag gtatcgaatt actatgtaca aaacggacca
   210421 aaattactta caccgtcatc tgtatctaat gcaactgata atgtaaccat atcggcagcg
   210481 gaaatcgaag gtactttgcg aaaatatctc gaagagtatc ttaaaaaaag aagagaagac
   210541 gagaatgact tttaagactt tttatacttt ctatatccaa ccacaccggc ggcaataact
   210601 gacgccacta ctaccgagga aattaggata ataatgttgc gatttgaatt ttcaccactt
   210661 aaaccaagtg acgatgtcgt tgcgttaccc ggacactttg tggatgctgt aatatattta
   210721 gcacgtacgg tgtcaatcga aacttgtggt ttgtttgttc ttgtattcac ttcattgtgt
   210781 aaattaacaa gtgcagttgt aagcgaatcg cgcgatttaa aaattgcact attttttcct
   210841 tcttttacat tttcatcaaa ccatgcagaa taatgccctc tgcattcctc acatggtatt
   210901 acctgtttca gtgactttaa aaagtcgtgc attccttgct ttttattaca tgtatcctca
   210961 catgctactg ggtggctaaa tgaaagagcg tgaatcgcgt tccaaagagc attaccccat
   211021 acgtcaatgc taacttgaga tgtctcgtct gttttgttgg gcatctttaa aatatgagta
   211081 ataaaaaact tatacagtac agaatagata tgtccttaac tcatcaactg tttcaaaccg
   211141 accttttgtt tcactgattt cttttgtgtt catatcaatc ctatatacat atctacaacc
   211201 aaccagttgg atacgcttca cctttattat ataggatagt taatattcga gtaatgaatt
   211261 taatttgcat ataaatttcc gcatcggatc tgccaatcat tgcgctatca tacttctgat
   211321 gtattagatc atatatttca ctatgacgca ttgactccac tggattgtat atttcagtga
   211381 ttgcagttct cattgcacgg gtagtaattt tcttccaaat ttttctatcc aatttatccg
   211441 ttggttgaac tgcagccgaa atatacgaaa tgattgtatt atcactcgcc tttgatctaa
   211501 gttcttggcg aagaccatcg taaacaagac catgctttct aatgtattta taaattgtct
   211561 cgtgcttttc atcagatctg gacggtatac caaatatctt ccgtcgtaga tcatataaca
   211621 tgattgtaca ttcgggcaat gtatatttca tctgggtttt tggatttcca gttttaattc
   211681 cctcatatgg ttcaagttta ccgagttgat tatatacata cattacatta tcccgtgtat
   211741 cgaaataata tgtagtacgt gtcaatatat tattgcctgt atatgacggt aggacaagca
   211801 actcatatgg agttgtttgg tcattgttta tatgatcact attctcgggc tcgtcatctt
   211861 tcacgaactt tagtggccat tgtgtatatg catctgacat tgttatttta aaatcaagtg
   211921 atgaaccgaa tgatgggaac catgcaatat gttccgcatt acaatcattg tcattccatg
   211981 cacgaggata tagttgttca tttgattgcg gaggttctac ccatgcttgc gcgactgctc
   212041 ttgttatatt aaattcatgc gatgaaacat attcccatgt atatgagtta tcttgattta
   212101 gtttacgcaa gtaaatgtcg cctgtatctt tggtaatcca aaattgcttg tatttcccag
   212161 ggataggaga tggtgtaaac tctcttacaa tttggccagt ttctggaata actcgtccac
   212221 caatttcata atcaccaata actctactta ttggaaagta tcttgacata ctcttagtag
   212281 ttataaaaaa catcataggt ttctttacta agacacacta tataaattat acacgactcg
   212341 cacttctagt tgactttggt tgcgttacaa tatgtgattc aatctcactc gtatcaacta
   212401 gaatggcttt atcttcacca aattcttctc caatttcggg aagttgagca ataaactccg
   212461 acccaaactt tacatatact tcaatatccg tgtttagcgg atattccggg tcccttttta
   212521 cctttttgcg tttgggtttt ttaatatgag attttggacc aggggacata tggtttgttg
   212581 tttattatat aacagacaaa atagctactt gtataacaaa tacgactttg ataattttgc
   212641 aatttgactt gtactttgta catgatgcga agaaatgtct gatgtatatg gaatttcaca
   212701 tgcgactggt acgatgccaa gtatcgcatt attcaattcg ttattgaaat cataagtttc
   212761 gtatgtattc tttatattgc agttatttaa tgaagattgg actgacgcca tgtgcccgat
   212821 atctagatca tattgtgcat atacatttgt agttgcattc cataacaatg gagttaattc
   212881 tttagagttg caatatgtgt ttgtgagagt tggtgcttga tccgggtatt ctagcatttt
   212941 tctaattgca tcatgggggg tatatacttg atctggtttt atgatgatag ttaccgaatc
   213001 atccaaatca acaataccga ccattctcat aaattgacga atatctccat tgcattcaac
   213061 tgcacataat gttttgtgtt catgtgttac tgttttatat ccttgtgcaa agttaagtag
   213121 ttgatcaact gaaggtgctg atatttcaat atcaatgtta catcgatcaa ttaacgattt
   213181 tatttttgta ctcgatgtgt atgatattat tatattgcaa cattgtgttg gattgaattc
   213241 ggtttgcatg tattcgacaa tattgttcac ttgttgttct ggtaatgcgt cgacatcgtc
   213301 aataaacata atcttatatt ggtttatgtt ctttttaaat ttgttttttg tcgcagtgag
   213361 tgactgtagt tcttctgaga tattacagtc cgacgatgga tcaaatatgc taattgtatg
   213421 attggtttgt tttgcgagtt cgtttacaat atatgtctta ccgcaaccaa ttggaccatg
   213481 tattgcaaca agtttagtcg gtaaatttgg attaaatgca tcttttaatt cggagatgtc
   213541 actttttgac aaaacactgc aattgtgttt cagaataatt tttttggacc gatttttcaa
   213601 taaagtttgg cacttattcg aggttaacgt gactgaactt gatgtcttcc ttttattcat
   213661 aaacatatag ttaaagttat acgccagcta tggccgatta tacaaacaat atgtttttac
   213721 gcatagaagc agcaatgacc cttcttcgta tggagttgga acaggttaat ttaaaattga
   213781 ccgacatgga aagttccata aaccgatttg aaacaaattc agcaaatcca atgaatcgcc
   213841 cggcaagcta tgcgagcatg gtctcactaa atccatccgc atcatatgct gatattacat
   213901 tatcacttcc aactcagtca atgccaactg aatcacatgt accattaata agcgaatgga
   213961 cagacgttga acaggttgaa ccatatatgg aaattctatt gaattatgta ctggatcggc
   214021 ataaggatga aatgcgtcgc gtatcaaaag gtgcatctgc atttctatgt aaagatacaa
   214081 atggtgttat aattgctgca ttaatttatc ggtatcgtgc aggatgtggt aatgaaattt
   214141 tgcgtcacat tgctacgagt catgttgtgt ttcatgaaca tgtgatccta aaatatgtag
   214201 aactacttac atccacaaca cagaatttct acacggagac gcatacttcg gttgcagaag
   214261 cgcttatttg tcgtggcgtt acgcatattg tggatgtaaa tcacataagt cgtgtacttc
   214321 cacatatccg aaaaacggta aatgcacgta atacaccttc taatttaatt ataacgaacg
   214381 agcatgatta tcgtcgaaca tttaaaccat acagtgagac tgaaaaggca ccgttatatt
   214441 cctatatcat tccacccggt aatcggattc gacttttact tggaaatcca cagtaaaata
   214501 tattgataag tgtaaatagg tagggttttg ggtaatggaa aatgggagtg ttattgacgc
   214561 atttagtatg tggctatttc acactcgacc attgtatgta ttgcaaacgg tgtcgtgttt
   214621 aaatagggaa tggaatgcgg ttgctaatac aattgatact ggtgacatct gcaataatat
   214681 gaataaaata tgtaataaat ggtttgaaaa tataaaggaa atatatgatg aatcggataa
   214741 tactgtacat tataatatta gacacagcgt aaaaaatgaa gtgattcgta tgtctggtgt
   214801 aaatcattat acaatattaa aacttaaaca aagtggtctt tctcgtgatc atgcgtgtcg
   214861 tattgttaga tcacttcaga ttttatatag gcaaccgtgg gcaattcgaa aattacacag
   214921 agatggggtg cccgttatta caccacactt tctaaagaca ctaaattcta atttatgcgc
   214981 agtgcatggt actaaatgca atcgcacgcg tagaaaaata tgcataacac atgattacaa
   215041 atttgaattg tcgtgtagat gcagaacatc aattactcga cttggacggt aaataatgga
   215101 tcaaaatgat gatgtggttt atcccatacc gagtctttaa ttggttcagg caatggagga
   215161 ggagtgattt ctgcaacctt ctctggttct ggtttttttc gataaattgt cgaaggattc
   215221 atgaatatat atgtcacaag taacatcatg agaatcatgc atgcaattac aatatatttt
   215281 ttataattca ctggttcggg tgccgatggt ggagtaatgg caactggttc aactggtttg
   215341 tcaggtgcaa tctttcgttg ttcagcgact ggttcgttct gttccgttct gttgtatttt
   215401 tgacgaatgc ggataggtgg ggtttggatt gctgaactta cagatgaatc tgaatcagac
   215461 atagtttact atatgtaaaa taatatttaa tataatgtaa caatggtaga tctagcttct
   215521 ataaaaaaga aacttgcgcc atataaaatg atgattatta taggtgcgtt ggttggggta
   215581 ttgatgtatt ggcattatac gtctaacggt attcaaacat ctgaaagtac aattggtggc
   215641 ggatatactg gtggatatac tggtggatat actggtggat atactccacc acaaactggc
   215701 tccggcggga cacaacactc aagtgaagat gataactgga ctgttggtta ttatagtgtt
   215761 gtaccaacgg atactactga aattattgca tcttctagtc gtacatatac tgacgcaaaa
   215821 tatttgaatt taccacataa gtttacagat gaacaatgca tagctgcatg taaaaaggaa
   215881 aagggtgatt ttgtaaatat cggtagtgta ttaccaggtg tatctcggtc atgtaattgt
   215941 tacacaacgt caatgcaatg tataaaattt agtggtatgt ccaacggtat ccaaaaaaca
   216001 tactcaccgt catacttgaa acgctgtcca gcgatcatca caacaaaaga aactacgagt
   216061 acaaaaacta tttatccaga ttgtgatcca cgtaatgaat atccagatga taaaacaaaa
   216121 gagtgcaagc gatgtaccgc atctcccggt atgtacgttc aagtatgtga tgtacatctt
   216181 aaagttgtta catgtccacc atgtgataca aatatggtcc gagtaggctg cggtggtaca
   216241 agcgttgggc gatgcatcgg acggccatca tgtaagaaat ttcaaacata tgatagaaac
   216301 aataatattt gtatctcatc tgctcactgt cctcctggta ctggtccata tactcattca
   216361 aataactgtg ttcagtgcat gggcggtaca aaacgccaag aaaaacccct tatgtctggt
   216421 aaagtcaaaa tagtatatga tatggattca aataaaccag tttatattag aagtgcaagt
   216481 aattgggggt acttaaatac aataaaagca tatggacaga atgcaacaaa ggaaattgta
   216541 aataaagacg gtgctgggta tgtattcgaa gcaaaaaatg gtgggccagg atcgttaact
   216601 gatgttattt cacatgaact tgctgttgtc agtgtcgatg aatattctgg tatggtttat
   216661 ccatataacg ggcaaaaggt acatgtaaca tttatgaata tagaaattcc atataaatgt
   216721 ttataaaatg tactccttaa tatttaagat gtttcattaa acacgattgc cgaattaaat
   216781 gcatattcat taataggaga ataaataccc tgggcagtaa gtaatcctgc taacaaccca
   216841 gccacaatta gtgttattat ccaaccaaat cctgctttac tcaacacttt tgtattgatt
   216901 ccttttttac cttcgagtag tgcaacaccc actgttgctc caacttgtgc atgggtcgtc
   216961 gataatggaa tacccatata acttccgaca ataattataa ccgcggaacc aagctcaata
   217021 caaacaccac gacttggtgt aattactgca agttttacac caattgcctg catgatattg
   217081 tatccatata atagtaaacc gattccaatg ccaatacctc caattgcaag tatccaatat
   217141 gaatcatctc caatatctgt tttactccca ccaattgctc ctccttccgc cttccatatt
   217201 acccatattg tcataaatgg acccattgcg tttgcgacat cattcgcccc gtgggcaaac
   217261 gaatcgaaaa ttgctgaaaa tatttgaata tatttgaaca catattctgc tttttcatca
   217321 aaatgttctg cattattata aataaccgac actttctcgt ctgtaacagt tattgcatga
   217381 atatctatat cgaacaattt gcttgctgtc tttgctaata tattttttgg tttttctata
   217441 tcttcggctt tattttctat ttgttttggt tttgaaaatg tatctagtgt agtgcggtga
   217501 atatatttat aaagtggaat caatgcaata gcagcaacga caccacaccc agcagataat
   217561 ccaaatgcaa tccctgcatt tactttacct ggtgcaatcg cttttgttac ttccgctccg
   217621 tttggtaaac tagcgtccca tccttggcat atccagatgt tatatttcga tggacagatt
   217681 tttttggata cccccttgga tataatgaaa aatgcgttaa ttgtaactgc cccccacaca
   217741 agaaatggat acgcgcgaat agatctaata aatggctgag cactgcgcaa tacaaatgtt
   217801 cttatactca agaataagag cactgcaact attccagata gcaatggtga gaatacccat
   217861 gacaatacaa taccaacaat gcctcctggt aggtatttgc cactatcaat atcaatttct
   217921 ttgtaccaaa caacgcaatc agcgcctttt gctgcaattg tcataccaac gaggccacca
   217981 acacaagaat gcgtagtcga aactggcatt tcaaactttg ttgccacaag taaccatata
   218041 ccaactgccc caatgacgca caaattacca tacatgagaa ttgcgcgatc catatatgaa
   218101 ccatcgaaac attcataatc agcagtcccc tttcgaattg tctcagcaac agcagatcca
   218161 gcaagaaccg cccctaagaa ttcaaagata accgcaagaa aacatgcttg ttttattgta
   218221 agtgcttttg aaccaacgga ggttgcgtat gcattcgcga catcgttggc acctatacca
   218281 aaggcagcaa agaatgcagc aaatgcacca aatacaacaa tccaagtgta ttcaacaaaa
   218341 ccactcataa atataatttc acactaccac tcacttcaat tttctattgt gaatataaaa
   218401 tagtatgatt aaaattttta tactatgtta atatttttga atagtattaa taaatgaaca
   218461 gtggtatcct tgcgttatta atcggaactg tattaacaac caatacggaa aacatattta
   218521 tgcaagttgt gtcggcggca atattgacaa cgcttccttt tgctcatagt ttattaatta
   218581 tgtttgcatt tgtcgcattt gccatattcc cattattatc atctacacat gcggaatata
   218641 cacgtaaacg tgactttgtc attgatttgt actgccgtga cattattgta atatgctttc
   218701 ggtatataat ctactctaat ctttctcaat atatgttatt attgccatgt cttgggatat
   218761 ttgaatcata ctctattcag aatatggtag actcatatga catgaacaca aaaaagagga
   218821 ttgtaccgac tcaaattgtt aatcatacgt ctcttgcgat tgttgaatta cttgcattgg
   218881 taattggaag aatgctattg ccattggata cattagatga cactaaatat gctggatttt
   218941 atccaagttt gatcgttgtt ataccactgt ttactatact atttgatcta tttgccgata
   219001 ttggattcta taatatacat agaaatttcc atgaaacgcc atttctgcgt acatttcata
   219061 tacctgacca tcataaaaac accgggaaac acaacaaact aatggcatat gaaacataca
   219121 caatttcgac aatagaaacg ttatcgattg cattgacata tttcatagga tttggtgcac
   219181 ttattttggt atatggtgag ttatcaacat tgattgtatc tataatggta tcgtggatgc
   219241 atacagtaga actgatggga catacggaac tatcatggac acctaagttt acatacaata
   219301 ggatagttca tgatatactc gggatatcat taacaagtaa agatcattta attcatcata
   219361 tatacccaac aacaaattat agtaaacgca cgcgactaat ggactatatc tgtaatacat
   219421 atcgcgagaa actatgaagt atatttatat ataccaaatg ggttgtattc ttgtttatct
   219481 tcaagtatat cttttagaaa ttcggttgcc gtattgaaaa tgtcatttcc aataaagttg
   219541 agtttatctt tatctataaa tttaccaaat gatttgttca tacacgcggg tattattatt
   219601 aaattttttg gatgattgag ttttcctgcc attttttgtg gtaatatgtg atcaatatta
   219661 tactcccaat ctacaactgt aggcattgaa tctgttatta ttagctgctt gcggtaccat
   219721 gataacgttg gatatctttt attctttcgg taatattgat caaataataa aacaatgcgt
   219781 ggtatatttc ctaaatacaa cgaatctcgt tcttcattcg ttaacgtggt tgtgatgcgt
   219841 atagacggca tctttattga gtgtgtataa aattgaattt ctgtatttat aaattttata
   219901 ctatataaat aaatgcaatt aaactttcaa tcagtcggtg caatcgttgt cacatcaatt
   219961 attttgattg ttattattat agttatacta actaccattc gcagacggta tattaatgca
   220021 cgagaacaga agcgcgtgat ggcgtggaaa caacctgcat tatctaagca tgtaccgtcg
   220081 actacaacaa gtttattgag aggagcggat catggcacac gggaaatgct tagacaccgc
   220141 aacgccaccg attacaggac aggtattata aagacactac cagtgccgcc catgactact
   220201 cacgcagttg tgcaaaaaaa tccattcttt attcctgaac tgatgatgta atcatgcaga
   220261 catatccatg tgaatcttcg ggtgacactt gtaatcgttc agaataatat catcagatgt
   220321 aacgtcaaag attgttttcg gtatgttatt gatatgaatc gttgggaaat cgtatggttt
   220381 gcgcttcaac tgtgttttaa gtgcatcaat gtggtttgtg taaacatgcg catctccgat
   220441 aacgtgaatg aattcacccg gtttgagatt tgtaaaatga gcaattaagc aagtaagtag
   220501 tgcgtaactt gcaatattaa acggaacacc aagaccaata tcagcagatc gctgatacat
   220561 ttggcatgaa agcatcccgt cgtgtacata aaactggcac ataagatgac atggtggaag
   220621 tgccattttt tccagtgcat ttgggttcca tgcactcata ataatgcgac gagaagttgg
   220681 gttgttctta atttgatcaa ttacattctg taattgatca gttccctgtg aatcatatga
   220741 gtcgtgcatg gttttatagt ctgcaccaaa gtggcgccat tgaaatccgt aaactggtcc
   220801 gagatcacct tcttcgttgt cgacaagacc aactgaatcc agaaagtcac gtgatccatt
   220861 tccatcccaa atttttacat tttttgctgc aagttcattt gcatttgtac ttccgcgaat
   220921 aaaccacaaa agttcttcga caattccctt ccaatatgtt cgctttgttg tgagaagtgg
   220981 aaaatgagtt gacagattaa aacgcattgt ttctccaaat aaacttacgg taccagtgcc
   221041 cgttctgtca cttcggtatt caccatgttc tagtacttta gaaatcaact gaagatattg
   221101 atattcttcg tggattactg tagcattgta tgtatgatac gaacatgtaa gatgcgcttc
   221161 ttttgtaacg tatgatgttt ttgatttgat aaaatttgat tcaagatcat taactgtaag
   221221 tgggaagaat gtatcacatg tgtcaaatgc ccctggatca tgttgatttg acacaaatgt
   221281 catatgaatt ttatcaacaa ttttcagatc aattacatct ttatagatat aagatccacc
   221341 aatgacatag attgtttcta tatccgaaac tgtcttcaat tcggaaatcg caagttcaat
   221401 tgaagatgaa atgccaacat tatttgggat attataaaca cgccttgcat ctttattgcg
   221461 actgataaca atattgtaac ggtttggtaa acgttttccc atactctgcc atgtttttgc
   221521 acccataatg acaacattct cacaaattgg catcgatgtt gatgcagtaa gctgtctgaa
   221581 gttatgcata tctgctttgc tgttccatgg gattttgtta ttaatcccaa ttgcaatgcg
   221641 accatccgaa cattttgcac cagctaccac gatgcatact tttccatagg acatatgaat
   221701 agtttatatt ataaaatata ccaaacaata ttgttacgtg cgagtataat cttactgaaa
   221761 tactatttta tatcgtatat aataaacaac acaacacaat tatgtctctg catttatctg
   221821 cgagtgatat gtctgattat atgggatttg ctacagctgg ttcgtcgtcg ctacatccag
   221881 taatgaggca acagtttcag caaactcgtc aggcaaatcc atccaatgca aagcgcccaa
   221941 ttaatattgt acctacaaaa caagcagttg aagtgaagca gccatttgtc gcggctcatc
   222001 caccagttgc ccctggacag cgcacacaga cccgtcagcc accacgtgca tcgctccttg
   222061 ctgcacgaaa ggccgcgatg gctaagccaa atgttcccgc ccctgctgcg gctagtctaa
   222121 ccgagtcgtc cctaatggga ccgcgcctag atcatgtcga aaagacacta aaggaggtat
   222181 gtgagaatat caccgccgta gacaataacc agacacgtgt cgaagaagtt gtaaatacat
   222241 catggctagt tgccgatgtt gtatgtgaca caactgaata cgttacaaca aatgataacc
   222301 atgaagaagc cgttgcaaat acaccatcca ctgtagtaac atcaaagcag agggtaagtg
   222361 ttacttatcc aatggttgag agtgtcgtag atggaaatga agtatttcta atgcgccgcc
   222421 gtgcggttga tccggaaacc gcggaagtag tagcatcgtg gattgtcgta tataaaccat
   222481 ctgataccgt agaggctgct gatggtgatg tcgcgtacgt aacaaacttt tcgttttggt
   222541 aaaaaatata tatacaaatt aattttttta atcacgacga acgagctgat ataccgcggt
   222601 tttgtcatcc ataggaggtt tatactcgtc atcgtccgaa taatcacgct tagttgtcat
   222661 ttctacgcga gagcgcgagg atttttttgc gatccttctc ccgacgacga tcatcgcgat
   222721 gcgaacgatc atcgcgatca tcgttacgac gacgatcatc gttacgacga cgatcatcgt
   222781 tacgacgacg atcatcgtta cgacgacgat catcgtcacg acgacggggt tcccggttct
   222841 caactggtgg tgcagatgca actacgggag ctacaggtgg aggtggcgca actggggtag
   222901 gtggtggttg ttccacaact ggtttctttt cctttttaac ttttgtgcga atggtaagca
   222961 tttcctcctc ttcatccgag gaagattcaa cgagcttatc agatagcttc tttttggact
   223021 ttttcttatt tttcttggtg tctaccgcgt catgtggcgg aagcatcccc cggcgctgca
   223081 tcggcatttc ataaccaggt ggcatgtttg tgtgaaatcc acgctctggg aaacggggct
   223141 gtgcgtattg atgctggcgc ggtggaatac caactgggta tggttgcgat ggaatacgcg
   223201 gctgaaggtg tggttgcgat ggaatacgct gctgaaggtg tggattgttg cgttcgaaaa
   223261 tgcgtccaca gtgaagacac tgtggtgcac ctgggggtac ttcattcttg cacgaacggc
   223321 agatttctgg gagatttccc cgattataca tcgtgtggtg gtttgttgtt tacttataca
   223381 atataaaaaa tgtttttagt tacattatac acacactgta ctttgggaat tacatggtca
   223441 ccgcaatctg gttttctcca tgtagtgtaa tgcgtgcagg tacgatggtg gtcattgcaa
   223501 ggaaatcatc agcaagagat aatgttgttg taatacatgc aatatatgca gttgcattta
   223561 ataaatttag ctccagtaga cgagatgtaa tgaataatgt aagaacgaca atacgtaaga
   223621 gtggtagatt gctaaatact tcctgtgcgt gattgatagt gtgcattgac acgtttcctc
   223681 gttcttttac aaatggagtg agaattccta tcgttagaat attcatgaag aatagcaaaa
   223741 ttaatgcata cgtagacatg taaagattgg ttgaaacttc ataaatatac gcagctggtg
   223801 aaatagcaga cgttattatt tgtctaaaca taattctacg cagttctggg cgtattgttg
   223861 cgagaaccgc cggtatatta attatattgc gattgggtgt agttgaacgt ggtgtcgtat
   223921 gtaccgactg tctgcatagt ggacaatgat tattgtgcga taaccatgtt tctatacagt
   223981 gggtatgaaa tgtatgatta cattcaagtg tacgtgttcc aagaacaata ttctcaccat
   224041 caggggcatg cgacattggc atcatacata tagtacattc tggatcgtca tctgaacttg
   224101 tactatcgtc gtgatgtgaa tgtgtcaatg tatgttgttc taagtcatct tcgactgtag
   224161 tttgacttgc attactagcc agatctgtgt ctggacatgc gttgaaattt ctagtatccg
   224221 ataatcctgt attaaacata tcaatagcga cttcctcgtt tgacattacc agatattatt
   224281 ttaactatag ataataaaat gacatcaacc gcatcccgta tacgctttct attctattta
   224341 gttatatttg gagtatgtat atactttata catggttatg catccagaca aggggtgagt
   224401 caatctggtg cgacaatcat ggtggatggc aagtcatacc ggttaaaaca aatatcagga
   224461 cacgataaca attgcatgat gagatgcatt gccgatcaat ataacagaac acataacgat
   224521 actgtacatc acttggatgt gcgacgtaca ataacacgtg aaattgaaaa taaaccacaa
   224581 ttatatgata cagacgcacg aacggtgtca attgatgata tgaaaaagtc cgggacacag
   224641 ggtggtcata tggaacttgt agcagcagca aattatttca agcgaccaat ccatatcaat
   224701 gacgtgactg ctggaaatgt tataaaaatc ccacccaaaa atcctaaaca tacaactcca
   224761 tgggtattga attttacatc aaatggaagc gagtccggtc attatgactc attagtaaaa
   224821 caataattat acattaggtg atacaacaag cctatacgta atcccacctt cagtaacacc
   224881 acctagacta cttctatcaa tttctattag atccccgatc ttataatgac aaaatactgc
   224941 cattggatca gtagataaca tcatagggaa atgctcgggt tttgccgcga atgaattaat
   225001 aatcacatcg gcctgttcct tgtcaatgta tgtatgtggt ttaactaata catgtttagt
   225061 aatattgtac gaaatctgtt tgtatgtgat aaattcaaca ttttccattt tatgagccgg
   225121 tcgtgatgat gtaccaccct gtacacttac taaaataaga tgcacgcttt ctggtgttgc
   225181 tccgagtttc tcgaggagat ctcggacaat ttttacacca acctttaatt cgttgaaaaa
   225241 atagattacg gaatccggac gacaacgatt ggaaaatgat ccagtaagta gcggtgtggt
   225301 attttccatt gcgtactcaa ttgtgctgta tgatgtaaca tctccctcga tgcatccata
   225361 tccccgggcg gataacattt cccttgctac tcgcgcgcaa ttaaggagag tatccttttt
   225421 attaaggata cctgccccag cggttgtaaa tagtgctgta tcaaagtcca tttttactat
   225481 actattacat atatacaatc tgacaatgtt aatgaaacct agttataact taaataactc
   225541 taatgtttta actggatcca ttgggaattc atatatacta actattcctt tcttaagatt
   225601 aataatctta agtttctctc ttgcaaaaat ggcagggaga gataggcggg cttttgtttg
   225661 atatgagata tcatcgtcaa agatacattg ataaatgata ccattaccac gagcaaaata
   225721 ctttgccctg tatgttaacg tttcactgcg agtaaaagat acatgtccat tataatcagt
   225781 gatgttatct ggaattgctt catgtaatgt tcgttccatt gtaatggcaa taccatccga
   225841 taaccaattt tcgaccggaa tttgcatctg ggtcttgtta tgaaaacgtt gccatgaatt
   225901 taataacact gcaagtgtca tccagtctga tatgcctgta agttcaaata aacttgtata
   225961 ctttgttttt aataactttt gtgcaaaacc aggtaaaaga tcatattcgc gagaaccttt
   226021 tgctgggaga tcatgaatgt tttctaaata cctgcgcttg cgtttcgctg ttggtatggg
   226081 agcttttatg aaatcataca tacgtacttt accggtatgt gcatattcat tgcgtatcat
   226141 agcatatgtc aaataatgta tagcagtcgc gccatgaaag tttccaataa tcgtttcatg
   226201 atctactggg atctgatcgg gtgttaccag atattctgtt ccaaataatt gaagatgacc
   226261 actgactcga tattcacgtc caagtggttc ccagtgagac ttatttgaaa caatcttatg
   226321 tggtggatta atattaggag tacgttcacg tgctgggatt tcttcgtttt cgatgtcacc
   226381 ttcgggtttt ttcctgttgc gttccgtttc gatcgaacta tcaattgcaa attgcgccga
   226441 ttcaatggtt cgctgcgtgt caatcaaatt aaggtagtct ggactttcga caactaactt
   226501 tgcaaatgga agatggatat tttcacgttc agcaagaaca agaagtctgt gttttgaacg
   226561 cgtaatggct acatgaagag gattttgagc agaagatgca cccattccta atataatggt
   226621 agtttcggac tcacttcctt tgctggaatg ccatgacatg acatgtacat tcgaaaactt
   226681 tttattttcg atacaatcgt caatgtgaac ataaatacca tatccatatc gtgcaagtgc
   226741 attaactagt tgtcgaattt caacattctt acgacgatga gccgctaaaa tatgaatagt
   226801 tccgggaaaa gttattgggt ggtgtttcag tatccagttg attgcaatat cagaccataa
   226861 actcttgcta caaatctgta catccacttt ttcgttagta acttttgtgt taccaggtac
   226921 aatttgcacc gaatctttaa ctgaaagagc atttgataga tgtgtgatac atggcgtcaa
   226981 acgaaacgat actgaaagtt ccccctttga aaatggaacg ccaaaatgcg tatctggatc
   227041 attaataaaa ccaaggatag ccggatcatc cggatcataa tcataaagca tttgttctgg
   227101 atcaccgact aaaccaatct gtacggatga aaagtcggga atcagtagat gtagaaaatc
   227161 aaaatacact tgtttcatgt cttgtgattc atcgataatt acattcttgt ataagaatgg
   227221 cttgggagtt atggttgtga cgatgtcaga aagagttgta tcatctctac agttcgagca
   227281 gtattcagat gctaaaccat gaaacgtgta tgcaactgag gtggaattta tggcaatgag
   227341 tttatcgcga agttcttctt ggagaggctt attgtatgta ataatacaca ctggctcggt
   227401 tgtatgttca catatctcca aaataactgt acttttacct gcccctgcaa ctgcaattac
   227461 acggatattg tctccctgtt tccataaatc aagtacatgc tgttgttgag atgataaact
   227521 gtattttggc atggaactgt ttacatatac tttacaaaaa ctttgttaca gttaaactat
   227581 ttcccccaac acgtttgctt tccttttatt tgactcctgc ttcgatagta aattaactat
   227641 attaatatct aatattttaa tctcattttc acgttcgtta agcactgata gattttgctg
   227701 agaacgtgta tcaatgtgag tggggaagca acgtttaatg tcgtctgagg gtagtggttt
   227761 aaatggtttg ttgtccatgc gtttcttaca ttgcatacca tcgacaattt cttttgaaaa
   227821 acaacattgc ttgatgccct gtggtgtaat taagaaatag atgtagctat ctttatgatc
   227881 ttttcgtttt cctgcgcatg tattgcatcc ttttcccttt actgcaactt ttatctgctt
   227941 tcgcttctga tcaattagga tacattcaac cgaaacaaca acttcactgt gaaattccgg
   228001 gaacgttgtt cgaaccaaac gttggatgta tcgtacaaat ccttcctctg gtggtgtggc
   228061 gtttttgttt tttgctcccc atagtgaacc atttgccttg atttttttat ctacatgctg
   228121 acagtgtggg gttccaactg gatatgtgat ttgtgtatta tccggttcgg atggtttagt
   228181 ttcatttgct gtgtaataaa cggatgaaat agaagaagcg attagtagat cgacacccgg
   228241 aatatcataa atgtctgtga ttaatggcct tcgttcatgt tcatcaaatg ttacattgta
   228301 tcttatgacc catgatagct caggtgaaaa tactttaccc gatccattgc aattcataca
   228361 attctctcgt tcattttttg tattacaaag cgtacatgca ggtgtagatg tactatatgg
   228421 cattaagaga acaggatgtc ctcgcttggg gatgtatttt gacggatgtg tgaacaattc
   228481 cttccatcta tatgatgccg atctaatacc atccatacca gaaaagacag cagcaagtcg
   228541 cgtgacgaca attgcagcat ctcgtggact tatcaaaaac ctcggccata caaaacgcgc
   228601 gcgttttgtt ttgtctgtta atataatgca ttgttctgtt ttgtcggctg atgcaaattc
   228661 atcaagaacc gttttcataa gtttaagtaa ttgaagtggt gacgaaatat catccggtag
   228721 ctttgcatca acataaaatt tatgacattc ggttgccaaa tgctcatata tttgatgaga
   228781 tgggtgtctt gtgctaccgt catttcgaat atcagtaata tatgatgaaa tgacagtgac
   228841 aactgattca tgggttggta gtctcatatg agagtctttg ttgtttgatg taaatgtatg
   228901 cgttggacat gcagtagaat gtttgtcaag tttatgatga attaattctt gcaatgatgt
   228961 ccgaacgtca gacatatagt tagtgcaact tgcgtgatat actatttgaa atacaaaatg
   229021 tgatttgtat atatacaaaa ttactgcact ttccactttt gattacactt aacacatcta
   229081 aagaacatgg tagttccttc atcggcagat cgcgtttgtg ccattgccat aagaatttct
   229141 gaactaccac atttattgca tgtaattgcg gccttttgtt tcattgatgc tacacttcct
   229201 tcctctacct tatcatacag catctttaga gaaatatcat attgttcgcg ttcgtcatcc
   229261 ataacttttt gtaaaacagg accgcgcatg ttttcatccg aaataaatgc aattgttgtt
   229321 ggctgaatct tgcattttgt catagtatat tgtgccattg ttggatgcgt ttcatcattg
   229381 cttagatact ttaaaacgtg actctttggt agaaatgcaa tattgtgaca tatacgcttt
   229441 gcattacgaa tatactcctc tgtatttagg ggatttttgg taaatagtga catttcaatt
   229501 tgctcacatt gcacgtccgt ataatcgggt aacatatcat taagcatgct gctgcatgat
   229561 agacgtacta attttgaaat agtcattgtt atttatacga tatatacata tccaatctga
   229621 tctgcaaagt atatgtttgc gaaatgtatt tcaaaaccat tatgtaatgt attatataat
   229681 atggaatggg atccattatc atcggatttc gatgccatca gtagtacagc aatgcattta
   229741 tacaatccgg aagtacgtag aataatcgat aaaaattgta acgatattct tgatgacgta
   229801 ataacggtga ctgattcttc aagtaaatgg aattatactc atccaatgtc gttggtattt
   229861 catggagaat gtaaaatgcc ccttcgcgat cacgtaactc cacacttgca ccaaaaacaa
   229921 gtactaactg atatttatga cgaagtaaac aaaacgttta cgtcggcaac tattcaatct
   229981 ccatgtgcat ctggtaaatc attattgtct ttattgatca tttctaaagt gatggaagtt
   230041 accggtgcat gtgcattgta tgtgacaatt aattcaactg caatcgcaca ggttgtaaac
   230101 caagcagtta aattttttca tatatctcct gatgaaatct tagttcttga tacgactgaa
   230161 tcatgtaatc cattatcttt gatcaatcgg aagtataaaa ttgtaattgc aacgtatcaa
   230221 ttattaacag catccgagca cccagacgaa tcgaaacatt tctttgattt gctcttttgc
   230281 attattacat ttggtgttgt tattcttgac gaagcacatt actcgtctgc aaaaaattat
   230341 aagcaaattt atcgcataaa agcagcattg aaatatggcg tgtccgcaac attaaaacgt
   230401 atggataatt tattggtaca tttaacagaa tataccggcc cataccagat aaagattgac
   230461 agagatgcat tgattaaaca aaacttaatc ccagacgttt ccctgcaaga atttcatatt
   230521 gacgaaccag aacatcgcga tcggttaatg tctgtgcgaa agatggaatt gttttatgac
   230581 atcttacaac gtcacattgg acggaatcaa agtataattg cattttttga aactatacac
   230641 gaattagaca atacatatgc gtgtatgaat aatattctat ttaagcaagg acgaagtgac
   230701 gtattattgc catcaatgaa gggtgataca aatagtgaaa ctcgaatctc attgataaat
   230761 acatttagac aacgtgtaaa tgacaacaaa ccagtggtat tgttcctgtc ttctgttgga
   230821 aatgccgcat acgatttctt atgtgaaatt gtggtgcaag tgcgttgttc ggacggatcc
   230881 ggcccaattg ccgcacagag aattggacga gtgcaacgct atattaaaca aactacagca
   230941 catgtatcgt atacattggt tgcaactggt acatcagaaa taaatcatgc acaatcacgt
   231001 cgtgactttt tagatttaga taactataag acatcaatca taaaatcatc gcagatatat
   231061 acaaaaaccc catcagacgt acatcgtcaa tttattgatt ttgttatgga actcggcacg
   231121 aaacaccaaa aacgccaacg cggtaagcca gtaaatcgga aaaagacatc atcaacacga
   231181 ttttctgcat taaagaaaaa aataggaaag ctttaagcat atgttatcaa gcacgataaa
   231241 tcctatggtt tcagaaaatg ttagtgttga agaggtcact gtccaaattg aagacgttgc
   231301 aaatacaatg cgccaaaatg cccaatatgc actgagaaat cttgaatcta caagtcaact
   231361 tgcagaacgc acagaatctc tctcggcaaa tgcgaatcgt tttgcgagaa ccacgcgtcg
   231421 agtacggcaa aaaatgtggt ggaaaaattg caaatacatg ttctattgtg tacttacttt
   231481 gtttatactc ggcggtggcg ccgcattact tgcacaaacg ataaaggaag aatctgccgt
   231541 gccagatcct ccttcaccgc catctgatgt ttaaactaaa ctatccattg cgcttgcttc
   231601 ctgtatttca gcttttcgtg cttccattgc atccttttct gcagaaatgc gttctagttt
   231661 tgtagttagc tcaacaagct ttaatttctg tgatgcttcg tgaacttgtg cgtctaaact
   231721 tggttcagtt gacataagtc catctaattc tttttgtttt ttcagtgtgt cgatttccat
   231781 ctgagttgct gccttatgca gttgcatatc tttgatattc tgttcttcca cccgcgcatc
   231841 agctgctcta attcgcattg ccattaagtg tttattctct tggtcaattg acatttgcgt
   231901 agtttcccca ccaattcttc tacttgttcg actcatttgt ttttgtaata ttttagacgg
   231961 gtcagtttct tgttgtatcg tacctgctat aaatttcttt tcatcatttt cagatgttgt
   232021 tacaaacatt cgatataaaa taaaacaaga tacaactccc gcgccaatgc ctgcaaacgt
   232081 accaaacatg aaccatataa caattgttac aattaatgca attgtaacaa tgacaacatt
   232141 tgaccgcgat gacgccatct gttttactat aatgtatata taaaatagat atggtatatg
   232201 aagcgattga cgatactctt atacattact catataacaa gtgtaatgga aattgcaact
   232261 gtattgttat gattcatgac atctttgcat caaaagaatc atggttttat ttacagcagc
   232321 attttacaaa atcaaacata acaaatatat caatcgatat tccagggttt ggtgcatcac
   232381 cgactctcac caccaaatat gactattcat atcgttctct tgctgtaata ataagtttat
   232441 tattaacaaa attagcaatc gggccatgtg tagtcatcgg acatggtacc ggttgtatta
   232501 ttgctgcatc actctcaaca atttctgcaa acattaaagg aattgtaatg atttcgccaa
   232561 attttgatac tccacctagt tatttaaaag tcgcccctag ttgttttgtg tcgagttatg
   232621 tatctcgaat ttgtaaacaa tattatcaat acaatcgact tgaaactctc catgaacatc
   232681 agattattgt aaaaccattt aaacatcatt ttcaaaactc atatcgccgc gatgtagtgg
   232741 aacgtatgat atatgcagtg gaatcatctt acattgatat catagaaatg atattttgtc
   232801 cattgtttac tattgcaccg tcgaaagaaa aacatgcaat tcattctaat gtattgacta
   232861 cattagcaga tgcaggttcg acatttaaat ttgttgatca tgttggtaat tttatgcatc
   232921 atgaagcacc tgaacttatt tttacataca tttatgaatt tgtgaaacaa ttatccaaat
   232981 ctgatatgtc aatttaatat tttatttata taatataaag ttatgcgtgg tattgtagtt
   233041 ggtgtcatta tagtaataat attactaatc gtgtgggcaa gtgttgcaac aaatttacta
   233101 gtagtaagtt taggtaagac tgatgatact atcgcttata gcaatcagac aattagtgat
   233161 ttgaagcgat tgattgattc tggtgacgtt gctaattcag atctacatgc tttactagac
   233221 aaactagaaa gtgattttgc aagtcaagag actgcactta tcacatgcag aaacaccaaa
   233281 acacaatgtg gaacggatct ttccgcatgt atgacagaaa aatcagtatg tgatcagact
   233341 ctaacacagt gtacgaccga gaagggtaca tgtacgaccg agaagggtac atgcattgga
   233401 aacctaacac agtgtacgac cgagaagggt acctgcactg gaaacctaac acagtgtacg
   233461 accgagaagg gtacctgcac tggaaaccta acacagtgta cgaccgaaaa gggaagttgc
   233521 gtatctgcaa aagcaacatg tgataccaat ttaatcgaag cgaatgcagc gattgttgca
   233581 ttgcaaggac agattacaac tctaggagag acaccaacga cgagtacaac aacaacgtcg
   233641 tcgtcaaata ccggtcaaac gattggaatc acggttgcag ttacacttgt ggtagttggt
   233701 gcaatttggt ttttaatgcg cagtgccagt gcaaaaatta caacagtgac tgctaatggt
   233761 ccacctgtca agtatcgtaa tcggacttca tttgcgccaa gtagtttaat ccctagtacc
   233821 cgcaaactct tttcgcgtaa aatgtcggct ttaggtgctg atatgccagt aagagatctc
   233881 gatctaccac ctattccgcc tctggttcgt caggatgccg tgtttttcga acagccggcg
   233941 gcgcctgcgg tcccgttctt gccgagggcc accgcatcga gattggagaa tggactcgcg
   234001 gagcgtgagg cggctcgtag tcttattggt agggatattg caaaagcgac tgccgtactt
   234061 acggacgatg accttcgtat ataacacgaa ttaatgaagt cgtaccacgt tgtttttctt
   234121 gcgatatgca ccccgctcca gcaagtggac gtgcgtgtcg tggatgcatt cgacgtacgc
   234181 gtcgtgaatt cgccaagtac gaaacgaatt acaacgatgc acttgtcgcg catcgcgcat
   234241 ggacttctaa tttaaatcaa gatttacccg cagccaaaat tcgctgggtt agatcgattg
   234301 tatataaata ccataaatat aaaatatttt ttcacgtgta aatataaaat ggcagagggt
   234361 gtcgcagaaa gcataccttt tccgaaagaa acggaaccac agaaattgca gcgtgagcgc
   234421 acggaacgag aagagacctc taaacttgcc ggtgatgaca tatggaatat agtgtattat
   234481 gctgggattg tacttcttgg tattattgtc atgatggtaa tcaatagtga aggattccaa
   234541 tttcttaaaa attcccttgg caaaatggta ggcgctgccg cgagtgttat ggattttatt
   234601 gggaaaaatc catggttgtt attcttactt ccattgattg caccgctatt caggttttta
   234661 tcaacaatgg gtagtcgttt tggatcacct gagggaaaga agcaggccgg tttaatcgat
   234721 aaattattta ccgacgcaaa attcaaaggg cgaaatgttg gattttccgc acgtgttcgt
   234781 gcagaatatg caaacttcac gccagatcaa aaggcgtatc tgaatggtaa attagaacag
   234841 atgaaaacac caattgatag caagagtctc gccgccgata tcgaaacgcg gatgccgaat
   234901 gccactattg aagcgaaagc aaatgcatat tcgcaacaaa tggtagttat gaagaaaaac
   234961 caagcagata tggtgtttag tgatttgatc gctacgatgg gtccggataa ccctaggtct
   235021 gggccgagta atttattgat tgagggtaca atcaacagtg ctcaaaatgc aggcgatatg
   235081 ttaagatcag gtaaacctgt atcaaaggta gatgtacaaa atgtatttat ggctgtcact
   235141 gcattaaaga aagcggaatc ggctctgcga gcatcatata aagatggatt tgatgaattg
   235201 aaagctgata tagaaagtac tggccgtacg atggaatcgg aaatgaaact acgggaacgc
   235261 attgctgttc taaataatac ggatgcaatt accgatccgg atggaaaaaa accaaacatg
   235321 aaaattgacc cagatgcggt tcttaaactt gcacatggca aggcaatggc caagctaacc
   235381 caaaaacaca aatcacttgt taatgtttct caggcacaga taaattatgc agtaaaaaca
   235441 gagcttgaca atgcatatac agcgtttgac ccagagaacc ccaaaagtcg ggccaatgtg
   235501 ggtgcgaaat taacggatcc cacaaacaag aaatccacag ccgtattgtc attcaaacct
   235561 cctaaggaat atggagatgc acttaagaaa aagagttact ggtcaaatcc aaaaacagca
   235621 aattcatttg gagatgttcc atcattcaag gcaccaaaat tgaaatttcc actttagaat
   235681 tccatagaat cagatttata tattagtagt agtaaaggta gaacaatgtc agagactcca
   235741 tcacgtgaag aacttcgccg tcgccttcgt gaaaagacat catcacgtaa tcgtgccggt
   235801 ccatccaaat ccaaggacgg cgtcccgtct ggtgtgggtc gtaacgttga tatggcatcg
   235861 atgatgatgt cgatgggaat tgacgatcct tctctcatta aagaactcgc atctagtaat
   235921 aacccaaagg ccatgctatc taaactagga tcaatggttg acaagatgaa aaaagacgag
   235981 gatacacagg agtatgaaaa gacatgtgcc ccttctcata ttgtacccga agtctctgat
   236041 gatgaggaag ctcctgaact tgtggtagta tagacttgaa cttgatattt tttatactag
   236101 ttattgtaaa cactatgcct gcaagtagta aaaatgtaaa ccacctcgcc gagcagtttg
   236161 atcgcgagtt ggcaattgca agtactatgc cagataagac cacgtatgtt catcctatta
   236221 cacccgcgac atcgcgcgca gtaaataact atgaaatgga cggtgacgaa cgtttgcttg
   236281 ttattgaaga gacagtagag acaaaaaaat gtcaccgaga ttgaatacga cccggacaaa
   236341 gcatcagcag acgaagtact tgccgaatac attgaaaaca aagaagaatt tttacaggat
   236401 aagatttacg atagtgcggt atctaatatt atgttcacgt cggctatatt tgttacagtt
   236461 attactgcgt tgttagtagc gattgtatat atcagaagac gtcagatgat tcgatcatct
   236521 agatattctt cttattctag accaatgaca tctagtatag gaatgcagtc tgtccctacg
   236581 atggtttaaa taataatgtt ataatagtaa atgcaaacgg atagtggtag atgggtaccg
   236641 ctttcaatgg aaaatgtagt gaaaccagca tttccgcgcg gcgcaacaat tgatcttagt
   236701 aattgtatta ttaatattca aaattacacg gtatacacgc acgtaaaaat aaagagacac
   236761 aaatacggtc gtgaaactat tattactttt ctaaacaaac ctaggtttac acaagcatat
   236821 aaatttccgg ttcgtgtaat gcacgtcaca aatggtgata tgtatatgga aacgacaatg
   236881 ccgccgctta ataaaactta tggtatttct catgtaacac cggacgcatc ttggcactaa
   236941 ttgtgtgcgg atgataatac tgatatccta catagaggaa cagtgataca actaaccatg
   237001 caggatgata gacatatgac gctgcaatgt atcctgatag tagaatattt gtcgagtaat
   237061 tgagtggttc ggtaaacaaa tcacctcgtg atccattcat ggacgagaat ggtaggacaa
   237121 agtatccaag aagacggaca attgtaccaa cttgaagaag aatccatgcg tttgggtagt
   237181 ttcttggatg aaccccaaat acacggatac attcaagaat gcgaatgaca ccaaagattg
   237241 taaatcctgg gacagtgatg tgttttacac cataaacacc tgatgtaagt gcaaatccag
   237301 tcgggatatt gtttagtaga gcaatccctg ccgataaata cgcaagaaag tacttttctg
   237361 gatatatgat ggcaaccata ccaagtgtta attcaattgc tgatccaatt ccatgaaaca
   237421 tgacatagac tgaaacattg tgtgcaatgt attttttatg tgcacgatcg acgactttgc
   237481 gttccacgta atatgtcttg attaaaaagt aaacggtgac ggcgtagatg ttcatacata
   237541 aaaccggatg catctcagtc gtaatgtagt ctgtattcgg agtaaaatga ttaggaaaca
   237601 tattgaaatt ttgatacagg taattcacat actcggaaag tccaccatat ttccatgatg
   237661 aaatgagaag aattgacagt atgataacga atatacgatc atatactttt gtaaaatgtg
   237721 ttggttcata catgtctacg ggaattgatc catttgcccg cgtgagtttt ggtggataca
   237781 ttgtgtgata catggaaatc ggtattaaac atgcaagcaa cgcatttgga gaaatgacaa
   237841 atgccattgt gatataaaac ccaagatatg ctgaaaacgt agaacaaagt ggatccatcc
   237901 acgccagtag gatctttggc ccattgtttc ttgcatgtga aatgtatggt gttacgaaat
   237961 acatgagcag acgaattgta acattgacat atgttattgc ccaaatggca tatgcattgt
   238021 atggattcga tagacttttg attgattccg taagaacaaa gaaacgatat aaatgattaa
   238081 gtgcaatacg catgtaccat ggtcccataa agtaaacaat ctgtttttga tgagctgttg
   238141 caatggtaaa cattaaataa aacgaagtga gccactgtat gttatagaat acagatagaa
   238201 atcctagtgt taactcgata acattgtaaa ccgatgatgg atttgcaagg aattcgccat
   238261 aatcaagctt gaggatggca tataacccaa cgagatacat ccctgtcgta aagaatacgt
   238321 ttacgttttc tgtatattca aatttgccat tatatacatt gggataattc gaaattgtgg
   238381 tggtaagatg acggttgatg tcactcacgg aataatattg aagcgtgatg aacaaacata
   238441 cggttagtaa tgcagtatca caatatgcgt gatatatcat tttattataa caatcaaaaa
   238501 ataaaaattg tgaaattaca ttttatgcat tattaagttc ggaaccaact aaaatatctc
   238561 cactaaacga tgcaatgtta tcagatggga gtagtttgtc tggttcggga cgcggtgtgt
   238621 tttctatttt agggggaacc gtatctagaa cgggttcttc atgtggaact tcatccgttg
   238681 gattcggatc tgtagtgtct tcggttaaca ctggtggtgg atccacatca aagttttcgg
   238741 gtatgtattc gctcgataga gctgacgcta ggaacggcgc ggctccattt ttccaaccaa
   238801 gtaggaatat tataagcatg acaatcaaaa tcgcaactgc ggcgattaga attccaagaa
   238861 tgactgtcga tggggtgatg ctcattgttt atttttacaa tataaaatag tatatgcatt
   238921 taaagtaaac aacatgcagt ctgataaaca ctgtaccatg tgacatgtga tcgggggact
   238981 tatacgattt caatactttc atctacagtt tgactatttg tatcgcttgg ttcaatattc
   239041 gtaatgacat ccactggtgg atgcgctggt cttactatgt gtagataaaa tctaggtatt
   239101 gttgtgattt atacaatgtt aataataata aaattcctta tattcatcca cattcattgt
   239161 acccatactt tggttacact gactacaaat ataaaataga ttgttttgcg agttacttcc
   239221 accgttgtga agcgatgttt tgtgagcaag atgacaatgt ttacgttccg actccctctt
   239281 gcaaatcggg catacgatgc ttaatgtctt gtatccttgt acgactatac aagaattctc
   239341 ccaaatctgt tcgcgaatgg ccttggggat attgatgcgt tcagtcggtt cgggtaacgg
   239401 gaccctactc ttctttttaa ttggttttgc cttgagatac ttacgctttt cattataatt
   239461 acggctaatt ttaagacggc gtgaccgata gttgtacata tgaataattt tagattgtat
   239521 atatcaaata atgagtaccg aaaatacctt taccaacaat ctcgcaacta cacttaagaa
   239581 cattgtaaat gacccatctg gaaatatgaa gaaactaacg gaagctatga gaaccgaagg
   239641 aggggtcgta tgtgacgcct gcttttgctg ttaccgggca attgatatta atgacgtaac
   239701 actttgttgt aacaagaagg gacagtgcat ttgcataact cacgaatgct gcattgacat
   239761 gtctcttgct ccatacgcgt ttgaagtgac aaagacagac aatagtgtta ccattggagt
   239821 tggtatctgt ctccttggtt taacacgtga ttttaagaat ccatgttttg gtacagataa
   239881 atgcctttgc tgtcgcaaca cataccagat tctcccaacc gaatcgatgg gggatttgat
   239941 cccagcgcca ctgtgtgcat gttgttttat tgaatgtatt ccatcggttg catttgcaaa
   240001 ccaaactccc ccggggaatt ttatcgttgg ttccgctcgt gatggggcac cggcatcttc
   240061 tgaaatggcc cgttgaatac atgatgaccg aaagcgccga tgaatgtgtt atttgtatgt
   240121 ctaacccgcc agttaacgac gcgcgtataa aatgtatcca taatgataat ttctgtaaag
   240181 aatgcattga tgagtgtatc aaaaaagata tatatacttg tccaaattgc agagaaccgt
   240241 ttgacgttga tttgccaatt tatattgaaa ttaccgacga tggagtagta caaccacgtc
   240301 gcatatttac tctacttaca aactatctcg taagtgttgt tgttcatttt atacttatta
   240361 tgtggttgac tggaattatg ttaagtttta ttgatttatg tcgtgcgatc gttactatgg
   240421 attctaatat ttaattttta taatatttat ttttttaatt acaatattac tatagttctt
   240481 ctaattcagt tgtttctgta tcgcgtccct cagggtgttc ttcaataaat cgacgaacgt
   240541 tttcatcaag tagtgcaaaa aaaggctgat taacacgaag tgtggtttta tgggaatatg
   240601 aatatctatc cattcgatag agactgattg ttccatttag agaaacatca acttcttcgg
   240661 tacgacgcag gttttcactg cgagccgttt ccataatgtg attaagtgcc tcgcggtatg
   240721 cttctggatt ctgaacatcg tagctaacat caagatgagg attgaacata ccctgacgcc
   240781 tatagttctt ttttgtcgtg atttcgaatt tatcaccatg gattgtgcga tgacaacaac
   240841 tgatttgtgt catgtgtgaa tatccatcgt ctagcttaat aaaccactcc cagtcacgaa
   240901 tccgtcgggt ctctggggga aactcatcat ctgttggtgg tggattgtat ccgtcattat
   240961 atccccaatg tgttccgcct tggcatttta cataaatgtc cattgtatgc ttaaatggta
   241021 caaatgcaca taattcatgt gtgatattta gatatagcat tggcgtgtca cttccccaca
   241081 tgtcgaaacg aaacatattg attaagcgtc ttttggtcgc gaagaatccc cagcaaaatg
   241141 agcgggcgaa tagttccttg ttttgttaaa gaatgagttt acttggtcag atagtgataa
   241201 tcttgtatca aagctcgatc gtccgttgat cttttctgct tccataaact tatcaagatc
   241261 agataccccc tgtcttaatg gatcccatcc tccaggttca cctacatcat catacgaacc
   241321 agtcgaccat ctattgtcaa gactggttgg tcttagattc gagttaatgg aaggtcgaat
   241381 tggtctcatt gttggttggg tatcttgatc atctggagtt acattcggtg ccctgtatcg
   241441 cggttcgatt cgagatgtat cacctggatt cgggtgtaat tttgcagcgg catcaccaag
   241501 tgggttagtt ctctcccttt ggcgacgatt cattactgtt gatgttagca tactcaatag
   241561 aacatatgcg atacataatg aactgaatac aatggcgaca gtgtagtttt tcattgttat
   241621 cgaaattata ttaatcacga ccaatgccaa aatggctatg agtaatatgc gtttttccat
   241681 ttatttatat tatatattta aaatataatt ttggtttagt gcaagaaaat tttgaaatgg
   241741 tataattcaa acaatgctga tcactgcaat ctccatagtt gcatgttttc aaatcttggt
   241801 tgggttcatc aatgacggat tatcgaaagt gttgataagt agagcaacta cacattttgg
   241861 cttggtgagt gggattccta taataactgc ttacttgttt gttacattcc aacttggcaa
   241921 catgcatcca agttattaca cgcatcatgc cacacgacca ttccatgtta tttgcgcatt
   241981 actcattatg gatgcattca tgtatttcat gcatcgcatg gagcacatca caaagtcttc
   242041 atttcaccaa gttcatcaca aatattcgat tccagaatgg cacaatgcat atgacgcgag
   242101 tattattgac acatgtttaa tgatattgct tccgttgcat ttaacaacac acttgtttca
   242161 cttatcgttg tctgaataca tttggtttgg aacattacta tcgtcttggt tgacactcat
   242221 ccattccaat cgaacatttt ggttcgaaaa gtacttaaac agaatgggac tatgttcacc
   242281 ggagtttcat agaaagcatc acatgtaccg gaatgtaaac tatggtcaca tttttgtgat
   242341 ttgggattat gggtttggga caataaaata ggaaacaatt atatactcaa gacacttcca
   242401 tatcgactac actttctaca aaaggtttta cgatatcatt gtttgcatta acaatgtaat
   242461 aatatataga cttatccaca ttgggagttg gtgttgatct atttgttgca ccttcgactg
   242521 cttttgttgt aatgtttaat gcttccgcgg ctgctggttt actaatgtgc attttccatc
   242581 gagttgggtc gaactcagga atatgatctt ttttctgtga aacctcaatc gaccataacg
   242641 tagttccttt gcgtggatgc gctggttttt tatttggttg acgttttggt acgtcgtgtt
   242701 ctccattgac aaagtagtaa tacaatgtcc ctgatttgtt tggtgtggga gttgctcggt
   242761 ttactgcctt gccaatattt tgacgtgtta tannnnnnnn nnnnnnnnnn nnnnnnnnnn
   242821 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
   242881 nnnnnnnnnn nntaataggg aacgcagcac atgcaaagaa tgcggcggtt cacaaatttg
   242941 cgagcataat agggaacgca gcacatgcaa acaatgcggc ggttcacaaa tttgcgagca
   243001 tagtaggcgg cgcaaccaat gcaaagaatg cggcggttca caaatttgcg agcataatag
   243061 ggaacgcagc acatgcaaac aatgcggcgg atcatcaatt tgcgagcata gtaggcaacg
   243121 cagcaaatgc aaagaatgcg gcggtgcatc aatttgcgag cataataggg aacgcagcaa
   243181 atgcaaagaa tgcggcggtg catcaatttg cgagcataat aggcaacgca gacaatgcaa
   243241 agaatgtgca ccaattggat ccaaaaactt ttgccaaatt tgctgtgcca caatgctatc
   243301 gtctcatcgc atgcgccaag gcatcataat gtgtgcaaaa tgtgacgccg aagtaccaca
   243361 acgtaccgag cattggatcc gagacaagtt acttcagctg gggatatatg agccgtcggc
   243421 ggcagatgat atccttttcg gcggcagcga atgcactgaa ataaacaagc ggcgtaggcc
   243481 cgacctaatt tggtttggcg aagattctcg agtccttatt gtcgaaatcg acgaacattc
   243541 ccacaccagc tccgggtacc aaccatcatg tgaatcggca tggatctccg acatgaccga
   243601 cgtttgtctc aaactaaata tgcagccacc tcacgtgatc agatttaatc ccgatgcata
   243661 cgacgcggag accgttggca ttaacgtgcg aattgatgag ctatatacga agattgatac
   243721 ctttttaacc gcacaattcg agccatgtaa tgcaccaacc gttgagtaca tgtattacca
   243781 ttctaatgcg caagcgtata ttgaccatgc catggctagc gagggaattc atgtaattac
   243841 ttagaatgat tccccaactt tggtccaatg tctacagtta cacgggaaaa ttactatttt
   243901 attacttttt attatatacc aaacttataa actaatactc aacgttcaca agcacccgcg
   243961 tgcccgatgt acccgtgcgg cagcatcgac caatgagctg cgccttgata tcagaccgcg
   244021 agcggccaat gacaatcgtt acgtatgtgt tgtgcaaatc tagtccttgt gaattgttac
   244081 tgctggtgct ggtattgagc actgcaattt gagggttcgt aaatgacgga tcattgtatc
   244141 ggttaatgtc aaatttcttg ccacgactgc caataaagta taactccaga tttgggtgat
   244201 cacgcttgat atcgttgcaa aatccggtga ttacatcacg cgaatccgtg gcattgtacg
   244261 acgaaagaat gatgcgtgca tctggcttac gtgccagcac gttacggata gtattttcga
   244321 ctgcattcac cgcagtaagt cttgcatttg acagctgctt gagtccgtcc tcgagtggcc
   244381 cactgtaatc gtgtgcatac atcggagtac gtacgtccgc tgtaccaaat gtaaatgtat
   244441 catgtagcgg tgcgcggcac ataggacaca ctcggcgctg cagacccgta agtgcatcaa
   244501 catgaagtac atttgagcag catggtagga ttgctgcctt gtcaaccgga attggttcaa
   244561 gcaacactgg acattcgggt ggatccgtcg cactctgatc aaccactcct gtcatattaa
   244621 taatagtgcg caccagcgaa ttgattgtgt tatgttcacg ggcaggatcc gaaatggcat
   244681 cacgcatatc acggaggatt tgcagtaatt ccggcggcga aacgccggca ttcgcgcgtg
   244741 ccacaaatga attcatggtt tcttggttaa atgtggtgtt tcgaatagga acgagcgatg
   244801 aaatgttatc ggccatggaa cgcggtgcca gtggtgcgtt ttcttggcca aatacacggt
   244861 tcaggttgtt actctttgcc atcacattgt gaatgtggta accatcaggc atcattgcta
   244921 ccgctttttt gttccatgca atgcgaatcc agtcgggtag cattgaattt ctcatgcatg
   244981 cgtttgtgaa tggttccgtc atatcaaatt gatgctttgg tttgcaaaac tcggtgcgta
   245041 gaatcgcatt tggtttattt gtggtgctat cgatgagttt ctttggtgtt gcctgaataa
   245101 tgacggtttg cattgggctt gcttttgcag gatcaccacg cttcgtcatc gaagtattca
   245161 tttcgtcaat gtaatcagca taataagagt accccttgct attaatgagc atcttggtag
   245221 tgcgttgatc ctgcggtagt acccaaaaaa taggacgtcc atgtgcatgt gcctccttga
   245281 gtgtaccatg cgttaggccc acccataccg taatatctga ccccgccatg aatttatgag
   245341 cggccgcaat tgtttgcttc ataagcggag taggtgtcat gaaacaaatt acgggcaata
   245401 gcgtattgat ttcccggtat tcataaaatc caccggaaag tggattgaac tgtgattgat
   245461 tcatggtctg gtatgcttca tggcaacgct cgctttgcag tgcaaaacga gcagccgcca
   245521 tacaggcaca tgttttcccc gcaccgggca tggcagtgta tgtaaggata gtaggaaagg
   245581 tgccagcttt tacgacaatg gaagtatcgt caattgtggt tactgcatca actgggagtg
   245641 ggactgtagt agacaggccc gccatgattt gctcgggtgt gattttaatg ttaccaaact
   245701 caagcggtac gtactgtgtc cactctgaga tgagctcatg cgcatttgca cgaaaaaagc
   245761 gagcatattc aatgtcgcga gtatgcatct tgatattgat aggggatgta cgatagcggt
   245821 tgttgttaat gaacgttgaa tagttaacaa agtgtgttcc ctcgacaaac tcggtaagtg
   245881 gcatgtactg gtaatcaccc ccagaaagta cgttatgcag tgatttcttg agtggcaatg
   245941 ttcccggaag attcaactct gcaagatcaa agtcggtgaa tgcaatatgc tcgccacttt
   246001 tgttaacacg ataatcgtac agctccttac ttgagtatct tgacatgacg tcaatcgcgt
   246061 gctgcgaaag ttgaattatt tcgttaatta tgacaacagt cggtgaaatt tcacgaagtg
   246121 gttctgggta ctctgcgtta ttgacatcgt caatattgcg cttaacatcc atttggggaa
   246181 ccgcggacat gtatagtatc tgtgatagac tcgataaacg atatgaatcg attgataatg
   246241 ttataagaca tttggagtct tgggtcatga tgttacataa tattgcatgg aaatgatgta
   246301 tgtgttttac actttacttt cccatctggt ccatatacta catctatcat cttttgtata
   246361 cagtatatat gcatgcgtcc cagtataaat actatgtttt tattttgagt aatcatatta
   246421 ttagcagttt ttgctgcgtg tatattccaa atcccgcgat gtaaattaaa tgccattgta
   246481 agtggacggt ttccaagaaa tgcaacaccg tgatatgaat ttgggaacgt atcagtagat
   246541 aacacttcac taattgtcgt ttcacacatg acagccaata gtgcttgata ttcatcttca
   246601 cttgtaccga gttttataac ttcgcgtttt acaatactag atagagtact aaatgtattg
   246661 tcatttaaaa atgcaatact attttcaagt agttgatcat tgggtacatc gcatccaaag
   246721 aattcgtcta gataatttga aatatctgta cgtatatctg ttgctttatt tacatatgcc
   246781 atatatgcaa ctgaaaatat cggatcattc atgtaaatac tcatgctatt tgatggctcg
   246841 aaccattgaa tattaacatt atcgcatgtg ggtacatgta ccggccatgg cggttcatat
   246901 ccaagcgctt gtacgagttg atcatatcct tcatcaaatt tattcacaaa aatatcagaa
   246961 tgttgatcag tttcgcatac aaatagagtt tcaaatgacg aacccttgca taatttaatt
   247021 aattttttat atgcagcgtt ccactccgat ttcgaccatc cgtgggtgac cgggtaaaag
   247081 aagatattgg gtttcattta acttacttgt tagaatattt ttgtatcgtt ataattaaat
   247141 atggccacct ttaaacccaa taatacacat cgcaataata atacacgtcg caatattaaa
   247201 atagcggcga ttatatgtgg aggattgata ttgttggcta tattggtata cgttagtata
   247261 gtatatttaa gccccgaggt agctccagat acagtaacac tcgatgcgtt tgacgaaatt
   247321 ccagacattg aaactggggg tatggatact gatgaatcat cgattgatat aactgatcca
   247381 gttgatccat tgacagttgc ccctgcagca gagagtacta atgaaatcgg cttacctggt
   247441 gacgatggtc caccagaggt tgacataccg cagcatccat atagaatcga gcaggaaagt
   247501 agctgagttc cctaaatgac aaggataaat gtagtaccag ctaccgaact tacaaacaaa
   247561 cacctgatgg ccgagtaccg agaattgccg cgaatattca ctgaagtaaa aaagaaagtt
   247621 attaatggca tttccgtaaa tgatctgact caacctgaac attataaaat ggggcaaggt
   247681 catgtaatgt ttttcatgtc aaggtgcggc tggttgattc atcgatacgt aatgcttcat
   247741 gatgaactga ttcgtagggg atattcgcta aatgatgaga tgtatactag cattgtgaat
   247801 ggcgtaaatg atatacccat ggaatttatg gattggtatg aaccgaccga tagtgcaatg
   247861 accataaaca gagctagaat tactgacaga cttaataatt aaatctccat ttgaccctct
   247921 gggtcaaata cgccatcatc tgtataccga gcagtctggt acagtgcatc tcccgatggc
   247981 atacccatca atgaaatcac taacgattca atattagtca ccatgtatga aattccatat
   248041 attccaatgc gtcccacacc aatgtcataa tctgcaagtt caatcctgtc atgtaaattc
   248101 attcccaaat tgacacgcga aatcattggt acatctgcag cagcagctag tgcattaaat
   248161 gcagcgtcaa catcttgatg atcgaatgcc actgaaagtt gaccaagctg tcccgcggtc
   248221 acaccagccg gaggggtata aaacaacatt aatgaaagtg aatcactatc gacatgccga
   248281 acccgctcct caatttcttt attgagattc gtatattgtt ccagagtacc cggcgttgca
   248341 tcaataccga tcggtagtag tagtgcgagt cgaagatatg ccatattaat gacatactct
   248401 gtatcaacga ctgcagtttg tattgcatcg ttgagctgca tatagcgttg ttcaatatcg
   248461 ttcgcatcat caacattgcc aaatactgta tatatagaat taattggtac cttttgtaat
   248521 tcacggcgag cagcgagtgc cacttttcga accatttttg catacccaat ttccaacatt
   248581 gtatggtatt taatgcgcat caatctcatt tcatcatgct gtgacgactc tactgtattt
   248641 atttcatcat cttcaatttg ttgtagttca gattcaaccc aggcaacgat attttcatcg
   248701 cgtaatatcc gttccgccat ttattttttg taaacaaaat taaaaatttt attacgttaa
   248761 atataaacac gaatggcaat tccagttggg gctataattg cgggaattat tgggtttctt
   248821 gtaatcgttg gtgtgggtgt tggactatat atgattgctc caactgcacg aagtggcttg
   248881 ggtgacggtg agctacccgc tggtatgggc ggtgccgccg ttggcgcacc cgatgaaaca
   248941 gaggctggtg gtattgttgg agatactaca tcccccgcat cggatgcaga taatacaaac
   249001 attacagaag aacaaattgt aaattcagtt tcagttgaaa ccccggataa ttatgaattt
   249061 atgtttgacg attgtccaaa gggactaagt tcatctgtta ttagcaccaa tatgacaatt
   249121 acttcatgtg cggatgagtg tacgaaacgg gaaaattgcg gtgcattttt aatgacagga
   249181 tgcacaactt caaaaaattg tggcggacaa tgtacacttc ttacaaataa tacaacaaac
   249241 attatttcaa agtcggagtt tggtaatgga ttgtgttcga ctacggtcgg tgatatgaaa
   249301 ctatatcgta aaaaggctta agtatgtttc accgaaatct tcccgaatgg aagctgcaca
   249361 accgggtttt cctatgatcc gcggcaattt gtttgcgtat tcattgcata tcagatcgta
   249421 tttatcgtgg atatcccata cttcaaagat ttgttgtttg gtatgtcttg gtttacttac
   249481 atatggtctc gaatacttct gttgtacaac tcgttgccct ggttgctcga atccatgtgc
   249541 gtccagtgta ccccatatgg tctcggctaa tataataccc ggaccactat cccatcgaag
   249601 atacggcgca tgcgtttgaa cgatttgtgt caccatgtcc atttttttgc gtatggcctt
   249661 tagcgcggtt gtatatgaca taaagtaaac ttgatcgcat cgttctgtgt aacgttgccg
   249721 atattcttga taaaactcgg taaatgtatg acttggacgt gtattgaaat aatccgactt
   249781 tctctccgaa taaatatcca tacatgattg gcaaatcgat gcatttattg ccatcatatg
   249841 aagaaattca atctgttcat tgcagcgatt gcagcagtgc ttcattttaa acatcctgga
   249901 tttagggaac ttgttgcaat tccttactcg tcaaatagcc ccactgtcag caaaatccat
   249961 tagtgcgtct gcgatgtcat attgatctgt tatatttcca ttgataaaat cgataacatc
   250021 ttgatcatgc gcaatgggta ttgatattgc agttattgcc cctatgcaca tatcgttaca
   250081 tatttcacgt ctcatgtagt gtatatacgt ttcaagtaac atcgcctttc cgatattgcc
   250141 atcaatgaca tatatatcag ataatgtata tgataaaaac acacagtgag attttagtgt
   250201 atttgttgat ttcgaatggt attcaaatga aagtgcacca ttggacatct tatattcgtt
   250261 atattcaaca taatattgac gtataatatc acaaattgca atgacatttt gtaacaataa
   250321 aacagcaatt ttaaaaatct cagttggatt tgtttcaaat tgtggagtac ctgctggatg
   250381 tacagtttcg ttattctcat gtgtttgatg ttctgatagt aattgtataa cgattggttg
   250441 ttctggattt atacgaaatg gtatgacatc tttgtggttg ttatagtatt tttccaattc
   250501 attgtaatcc acttgtaata aattgccatt ttcacatgga ataccacacg catttattaa
   250561 ggtaaatata gcaacatcaa cataaccgcc gtttttacca tcttgttcta cgagtgcata
   250621 gtgttcttct agaaagatag gatatagttt ttgaatccat tccggcatca tattaaactc
   250681 tacaaaatga gagtgtataa agtgatacag taaattacat gcatttaatg tattatcttt
   250741 aagattgacc agtagttcta aaaacaactc attccctgca tgtgcgcgta atactggatt
   250801 aatgttgggt actttgttgt ttaatatatt tagtttgatt gcatcaatct gtgggcgtaa
   250861 atgagaataa tagatacaca gtgcagcaga aaataggtaa catatttgcc ccttctgctt
   250921 tattggaaat gagatatcat gggtagttgg acctgccatt acaaattgct gcaaaaattc
   250981 agcccttgga tcacttatgt caataaatgg catattgtta gccgcatgtt cattgtgaaa
   251041 atagctaatc gccgacatct ttgatactag taagacaaaa acgaagattt tgtattaatc
   251101 tcggtcagat tgtaattgtt taatacacaa gtaccaaact tgccgccagt tccctaaatg
   251161 cctatccata atcgtaccgt cactgagttc actaacgaaa caatgcactt ggcggcactt
   251221 gccaatacga tttttaatga ctgtgttgtt gaaaacagta ccatcccccc ggaatccccg
   251281 cctccagtag atgtaaccgc cgttgcgtca attgacgacg acgagtcacc aaccgatgcc
   251341 aatgtcgaaa aattactaat taaactaaca gaatcgacgg aggacggtat tgccacaagt
   251401 agtacatgcg atgatgtcat ttcatatgcg atttctctac tacgagattt gcgccataag
   251461 aaagctgccc ttattaaaaa agagcgccgt gcggacacaa ttacaaaccc tcgtgaaagg
   251521 gcaaagtatc gtacaaatgc accaactccc gcaatgctct tttgtaataa tcatcgagca
   251581 gaggcagggg agtggtatga tagtggggga cgcattgaag gtgttcgcga atctcgtccc
   251641 tctcagattc agcgccgcct tgcaaatcaa tggaagtttg cggactcatc ggttaggatt
   251701 aagtatagga acaaggccaa ttccctgggt aacttggcgt caactgtacg tgaaactgat
   251761 gcaactgatg atgacgtaat tgtagattag atgtatatta tatatgtaga ctagatgata
   251821 tatgtagact agatgataaa tcgaagtaca gtagatggca atgtgtcaca ttttgtaaat
   251881 taacaatctc ttttatactg ttctactgtt tgcatttgta ctttgaatcc atcgcggttc
   251941 cctaaatgga aacattggat tttacccata ttacaccttc gggaaacaca gttaaaatca
   252001 atgtaaaaaa tggggatgtc gttggatata acggtcgctc tgggtatata aagtttggcc
   252061 cagtgtggca cattgacggt gcaatgttta tcgcaggcaa aactgctggg tatatgtggt
   252121 tttcggaaat tcgcagtgta aatggcgtcg aattggatga ttttatctag tacgtgtgtt
   252181 actctttttc attaatctac caagtttcat cgaattccac atgtaattcg tcaataattt
   252241 atttctttca tacatttctt gatgcatcat attttgtaca cgtgatgcgt ttccccacat
   252301 tgatcgtgta ttgttatgcg tatctgcaaa cttttgtctg tgctttttca ttctgtaaat
   252361 acgcacccga ttagccggtt gtaacaatgc aattattaca ccaagtaata tcgcggataa
   252421 taacacaaca actgaaaccg ttggactcgc ttccatttat atataattgt taaaaaaaaa
   252481 cgagattgaa aaatcacaag attataagat ctaagatcag atttgcaatc gcgccatctc
   252541 tttgtagtat acttcacgcg agttccctaa tgtcggatac gtcgtatgtg aagaaggtga
   252601 cgttcaatac ggagaatctt ccaccgattc cgcctctggt tcgtcaggat gccgtgtttt
   252661 ttgaaccgcc gccgtcgctg gttcgtcagg acgccacgtt ttttgaacca ccgccgattg
   252721 ttcataagcg aacgcgctcg gatactcaga aaattcagtc tatccttaag aaggtcggta
   252781 agaagtggct tatgtagact agaccagttc cccaaatgct tagtatcgtt ggcccagttt
   252841 acacgccata tgatcgttcc atatatgact tgtgttttgc aataaatgtc tttctttata
   252901 gtgttataaa ttatcgaacg ttcatcgttt gcgtcgcgtg cgacttttaa tacttccaat
   252961 gacacgcgaa gaaagatctg tcctttaccg tgtaaaagac gaagatctta gccccagttc
   253021 cctaaatggc tctcactgac attgtgaatg agaaaatgca gggcaagggt atttttttca
   253081 agtccgtcca tatggacccc ctcaaaggca agcgagcgca cgttcttatt actgcaactg
   253141 tattgtggag gggtacgtcg acgctcatgg acgtacagaa gcagctgtat tttgcaatta
   253201 agcagctgtc cgctgagttt gatcatgtta tcaagtcgac ggtgcgcgaa ccggtccgac
   253261 tgcgcgacat cccggagaat acaaacgagg accagcgcaa acggatggag aatcgccggg
   253321 ttcgctttct cgagcaccct gcaccaaagc ccattaagtt tagtgtgaat tttgtatgga
   253381 atgtccagga cgtgtcgtga tcagatttag tatttgttat ttgtataaca aatgacgctt
   253441 gagttttcat atcccaatcc aatccatata tatggccaac ccccaatgcg ggtttcgtca
   253501 tttgcatttt tgtgtttctc atccgccgta tttgaccaag acattgtttt atcaatgata
   253561 ctgctcgcca atttcatgac aagttttaac atacacaaac ggtgctttat tttcgatcaa
   253621 acctgctccg ctctatatta tgatcacctt gccattggca catggtttct ttataatttt
   253681 tatctattgg ttacaacgac ggtaccgtta aaaaataaaa tttacgcctc atcgtgtgca
   253741 atcttaacat ggggaaccaa ccgactttgt aaactatttg aattcaggca cccgatccgt
   253801 gatgtaattc attgtagcat gcacgggatt ggtatacttg ggacgtggtt tttaatttaa
   253861 acacagttct caaagttcgc cgcatcattt acatcactgg catcattatt ttagggaact
   253921 tggcgagact tccctagttg agcataatgc gtcttcgttt gaaatttgat ggtctaccgt
   253981 cgactttgga tatccctctt ggtctaatac ttcctggcac tggatctgga ccaatgtcat
   254041 cgataaaata agccaaatcg tcttcattaa taccagagac aacatcattc acatcgtctt
   254101 gattaacacc agcgaccaaa tcatccaaat cgtctggatt aagaccagcg accaaatcat
   254161 ccaaatcgtc tggattaaga ccagagacaa cataatccat ttcgtcggta ttaccaattg
   254221 aatcgttgaa tgcgctatct atttcagtcg ctgtctctgg gactaatact tgacctccgc
   254281 caaacacgaa tagtaaacta agtgaaaata tcacaactgc ccatgtaacg attagtaggg
   254341 ctaaaaatgt tatactcata tttttatatt atataaatat tttaaattgt acaatgggaa
   254401 tgatcaaatg gtaatccaga tgcaaagtac atgaaacatc tggatcagat gcctgatgat
   254461 gtgtataata agatacggaa tggatttaat gagatagtga atctggtaac gtcggttgtt
   254521 gtataactta atttttattt gtaaaagtaa tcacactaat caatataata attccaataa
   254581 agacagtacc ccctataatt ggaataagaa gtgcatattt gcctcttttt ttatttttga
   254641 aatttgtaaa gtcgtgacca ttatatggcg atgcagttgc atttcctcca caaatatgtg
   254701 tcattggaat cgatacgata gacgaacttc ttgataaacg ggttgacatt tttatacaca
   254761 caatattttt atatgaaata tgtaccctgg cgagttggtg gtattgtatt actaaacgat
   254821 ggaatgtgtg gtctatttgt tattttttta gtataactga gatatgctat agttaatagt
   254881 atagaaaata ctgcaactgt accaattata ataccaataa gtgctcctgt acttatgcca
   254941 ggttggtcgt ccggttctgt tacgattatc tctatatttg ataatgcata tccaattgtt
   255001 ggatttgcat ttcgcgattg tatattcgat tcatattgtg gtgtaatacg aacgccgcca
   255061 tattttccag cgtgacccag ctcgttcagg tatcgtatat atgatgtaat atcatacgaa
   255121 aacgatttta ttggagatat gccacttggt atgaacgcat tatctaatat aatggaatcg
   255181 gtagagttta tatcataaaa tacattattg gattcaacta acgttgcaaa atcatccaat
   255241 gtatcggcag ttgcatttgg aacggcatca agttgaagct caagtccatc gttcaataca
   255301 cttgtaacat cgactgtaaa tgtatatgtc ctgactgtag catagacagg tatattcagt
   255361 gaatacacta ctaaaaccgt atctgattca tatgcatcat tccatatttc gtatgtatct
   255421 ataaatcgtt ccccggtagg tattatgtct ccaaccacac ctgaaaatgc agcaccatta
   255481 agtgtatcta gatcacaaca tgtatttgta tattgaatat catcacttat atcttttgat
   255541 aatccaacac acatcgtatt gcataccggt agcggcggtg atggtgatgt ggatggtggc
   255601 ggcgatggcg atgtagattg tggcggcggt gatggtgatg tggatggtgg cggcggcggc
   255661 ggtgatggtg gaggtggcga tggcggaggt ggcgatggcg gcggcggtga tggcgggggt
   255721 ggcgatggcg gcggcggtga tggtggaggt ggcgatggcg gaggtggcga tggcggcgga
   255781 ggtgatggcg gaggcgggga tggtggtggt ggcaatggcg gactgcttgg tggtggagac
   255841 gaaggggggg atggaggagg cgggcttgga ggtgcggacg gtgcgtcggg tggaacgaat
   255901 ctccctctga aggctgtgac gttaaggggg gtctcaattg ttgagttgaa tccgaactgg
   255961 atgcggtcac ccggttgaaa caaatatgtg ttgaacgcct catctagaat gcgagtggca
   256021 aagacattgg caccgaaggc tccaaactcg acaacctcac gtgtgacttc accgaacaga
   256081 gtgttgtcaa cgttatagag cgatgcgacc aagacagttt gtttggggcc tgaaaatgta
   256141 aagagtaaat caaatgcttt tgacacatcg gtggcggtga cattgcacca aatagtaggt
   256201 tcggaggcga cgctgatcgc gatgaggtcg ttgcaaattc ccgaaaatgg agagaatggt
   256261 ggtggtggtg atgggggtga cagtggaggg cttggtggga aagggcttgg tggcggcggt
   256321 gatggcggag gtggcgatgg cggcggcggt gatggtggag gtggcgatgg cggcggcggt
   256381 gatggtggag gtggcgatgg cggcggcggt gatggcggag gtggcgatgg cggtggcggt
   256441 gatggcgggg gtggcgatgg cggaggttgc gatggcggag gtggcgatgg tggaggtggt
   256501 ggcaatgaag gtggcggtga cggtgacaac gagggaggcg gcggtgaggg agacggaggc
   256561 gatggcggaa gcggggatgg aacgtcgtta tttaagacaa tatttttcat tgcaccaacg
   256621 aactcatctt tttggggaac agcaggcatg ttttgctgtt tagcaatata tcccgatccc
   256681 caaatgtaca taaaggttcc acctcccaac cgaagacgat ctgtcaaacc actagtatac
   256741 accaaattca tttttccttc agctgttgca acaacagaac cgtccacttt taggcgtagt
   256801 gttggatata tgtacgacac ttcgatagaa tgataattat tgtctccaaa aggagagtct
   256861 gcttcgaccg ttagatttga cgtaccaacg cgaattttcg acgtgccata tactacatgg
   256921 ttttgaactg gaaatccaat taaatactcg tatccgttta tgaatggcgt tgctatattg
   256981 tcatcatcca ccactacccc aacaatgtat ctgtcatctc caatgtcaga aagtggatta
   257041 catacaccat actgacattc gtaacgatat atctgtatat atcctttatt ttcctcagat
   257101 gcccaaaacg agcctcttga cttttcctca acggtgatgt aacttggaat gaatcctgag
   257161 ctggagaatt ctcctaatgc gcctatgaat gcaataggcg aaattgggtt aatgagaaag
   257221 gtattatctt gactaaccaa cagcccttga tattcaaaag tcactactag gtgtccactt
   257281 ccacttggag tcatagtcca ccaattaata tctccgtcgt tcaattgtaa tccggcgttt
   257341 gttaatctta cagttagtat agtttggtta acgctatctt tctccaatac aaaaccaata
   257401 acagtattca ttaaactata tattggtact ttgaccacat aagtatggcc cgtcttgccg
   257461 aaataaccaa tacgtgagaa attgccacct atcgtgtaac tgcgtgtttt actgttcatg
   257521 tgcatttcaa aatctccaaa cccgagtaag ttattaacac ctaacccatc tgaatttgat
   257581 gtgttaacat ccaaactgat cgtgaatgga tcatttcgtc tcggtaaatt ctgtactgtt
   257641 acattctgag ccggtatagt tctatcttct ttggtatagt tgaacactct gaagttccga
   257701 atcgagcctg taaaatactt tctgactcct gctatataac ttccaccaac atgaagatac
   257761 ttttcatgtg tattttttgt actgactggt gactcaaatg cagttctctc attgtctttc
   257821 cagttaccat agaggtctgc gctccttaga tacgtagacc gctgactgct attacttctc
   257881 atcataacgc agtaaaactc tccgttagat agtgcattaa cattctctgg tcctaccaag
   257941 ttattgttgt accagtcatg gttcattgta tttccagatg tcaagtaacc atttataaat
   258001 ctgttcgtag attcttcctc tgcgagtcca ccacctccga tttcaaatat gtgattttca
   258061 gttgcagtag acagtgttag atattcaaga tcaacggtat acggcgtagt accttttatt
   258121 ccactaaatg gattcactgt cgtataactt gagccatcat attctttgga aactataaag
   258181 ttatataagg gccactttgc tttgtcatac tcaatgtcaa actcaatctc accactgtac
   258241 tcgaagtcta atataggtgg tggggatggg aaagctggcg gtggaggtag tgacggtggt
   258301 ggtgacgatg gcggtggtga cggcggggga gtttgtggtg gctgtgaagg agatggaggg
   258361 ggttgtgacg gtaacggtgg aggagatgat ggtgggggag ttggtggtgg cgatggtgga
   258421 ggtggcgatg gcggcggtgg tgatggcgga ggtggcgatg gcggaggtgg agatggaaga
   258481 ggcgggctcg gaggttcgga cggtgtgtcg ggtggaatga atcgccctct gaagtctgag
   258541 acgttaaggg tcgcaaatgt tgttgtgttg aatcctaact gaatgcggtc acccggttga
   258601 aacaaatatg tgttgaaatc ctcagctagg aagcgagtgg caaagacatt ggtaccaaag
   258661 aagcttccat actcgacaac ctcacgtgtg acttcaccga ccagagtttc gttaacgtca
   258721 tagagcgatg cgatcaagcc agtttgttcg gtggctgaaa atctaaagag aaaaccaaat
   258781 gcctttgaca aatagggggc aacaacattg caccatacaa tgggttcggt taagactctg
   258841 atcccggcaa tctcgtcgca aattcccgca aatggagcga atggtggtgg cggatgtgga
   258901 ggcggcgacg gagggggcgc agagggcgca gagggtttgc acgggcagag ggccctctcc
   258961 gacgacaagt aggtttgatt gcagtaattc aaactaagca tacccatagc ttgtttgggt
   259021 agaatcttac aagtacctgt cctgtctgca acacttgtaa gattcgatat gaagggagct
   259081 ttcgcatccg cgttatgatc ctccaagttg ggggctgaag ggggtggtcc gtatggtgga
   259141 aatggagatg gtggtggaaa agatggattg gcacataatt catcgggtac caagtccaca
   259201 cattcacttc ctgtccactc acagcacgtt gcaaaccagt caaacttcgg ggtgggaata
   259261 ccgttcgcgt cttgtccacg gcagtatttc ggagatggat ttccattccc atagcgcgct
   259321 gacgtgcatc gggagccgta atcttgggta aacctccccg ggtcgacgca gcaatttgcg
   259381 ggaggggaag ggggacttat tggaggtgga ggtgccaacg ggggcgtgtt aggtgggaaa
   259441 ggcagttgtg ttatttggat gtcatttaat tcactttcgg taccatcgct tagtagtgag
   259501 aagggacttg gtccatagac acgaacctgt ctattgccgg ccaagttgta ataccagtac
   259561 gccccgaccg cgcgaggcac atcaaacgta gcatactggg gtctgataat gtattgattt
   259621 gccatttcta tccctaatgc agttccgaat cgcgcggctt tgtactcacc ttccgaacta
   259681 aagagcatag tcacatcacc aaccgtgaag tcgagagcga caggagtggt aaacacgtat
   259741 acgtcactcg attttgtgta acgtagagtc caggccggtg catcgactgg tatgtcttct
   259801 gaccaagttc tatcgacttc cacttttatg ataaaggcac caatacttgg tataatggcc
   259861 ctgtattgct tactacctcc tgtggtcagg gcgtccactt cgtcgtctac aaagtccgct
   259921 ccattcaata gaatcgcgtc cgcaaactgg tctccaaagt ctacatctaa cattgtgagt
   259981 tcgaagcgtc ttgtcccttt ccccttactc acctgcatac ggggcttcaa atttgcgagt
   260041 gtagcatcgc ctctagcgta ggatacgaga gagattccat ttacgacttc gtcaacttct
   260101 atgcttacgt caaaaattgg aggaaatacg ccgatgttta gttccggaag accgggaccg
   260161 gtaagctccc acgataatcc atcatctgat ttgaccattt cgattgtgcc atcatcagtt
   260221 tcctttgtgt acgtgtactt aaaagtatcc tcatcaatta taagggtgta gtttccctcg
   260281 taggcaagtg ttcgttgatc agcaacgttt tcggagagct cgatgcgcaa gtccactgtg
   260341 tcttgctgcc tccacacttc accgtctcct gcgtaaagtc cgttgtagta atcattctcg
   260401 aaccccgata caatgatgaa gtcggtttgg ataggttcaa tggtctgaat cgtggcctga
   260461 gcaatttcga caccgagaca attgaaccca gcgagcgata caatgtcctg catgctctcc
   260521 tccgtctcga aaacgaaatt cggagtgagt ggcctttcgc actgcatccc aatatcatag
   260581 cacgcaacgt cacaggagga tccagggtcg gcgatgacat tcactgggtt ggaagttgga
   260641 atggtaatcg gtcccaatgg tggtggaaat ggtggaaata caggcctagg tggaaatggc
   260701 acaggcggtg atggagatgg cagagatgga ggtggcgaag ctggtggtga gcaaaatata
   260761 atacttgttt tgtcgcacac aggtccaaat tgttcacata aacgaatttc atcatcattt
   260821 cgaatttgat aaaactgatt gcatgtcggc ggattctcat tatcacaatt cgatgttaat
   260881 gaacgcccaa taagggaaga gcatgctaca ggagctcttg gcggtaatga agggggtgat
   260941 gatggcggtg gcgaaggaag cggactgctg ggtggtggag acgaaggggg agatggagga
   261001 ggcgggcttg gaggtgcggc cggtgcgtcg ggtggaacga atcgccctct gaagtctgtg
   261061 acgttaaggg gggtctcaat tgttgagttg aatccgaact ggatgcggtc acccggttgc
   261121 aacaaatatg tgttgaattc ctcatctaag aggcgagtgg caaagatatt agcaccgaag
   261181 cttccaccga caacatcacg tgtgacttca ccaagcagag tgttgtcaac gtcatagagc
   261241 gatgctacca agacagtttg ttcggtggct gaaaatgtaa aaaggtaatc aaataccttt
   261301 gacacatcag tggcagtaac attgcaccag atagtaggtt cgctggcgat gttgagtgca
   261361 gtgagatctt cgcaaagtcc cccaaatgga gcgaatggtg gtggtggcga tgggggcggc
   261421 ggtggacttg gtggtatgga agggggtgat agcggaggga ttggtggcgg cgggcttggt
   261481 ggtggcgggc ttggtggcgg gggcagtggt ggctgtggtg atggcggagg tggcgatggc
   261541 ggaggtggcg atggcggcgg cggaggtgac gatggtggtg atggtggtgg cagagagggt
   261601 ggagagggag gagagagcgg agagggtgga tgtggtgatg gcggaggtgg cgatggagaa
   261661 ggcggcgagg gtgaggcgga gggcggtgga gaggatggtg gtggcggcga gggtggtgat
   261721 ggaggcggcg gcgagggcgg cgagggcggc ggtaatggag acggcggcgg taatggagat
   261781 ggcttagacg gaggtggcga agctggtggc ggtggcggcg aaggcgatgc tgagggcggc
   261841 ggtggcggcg aaggcgatgc tgagggcggc ggtggtggcg aaggcgatgc ggagggcggc
   261901 ggtgacggag acgcggacgg aggcggcggc gacggcgagg cggacggcgg aggcggcgac
   261961 ggcgaggcgg acggcggtgg cggagatggc gaggcggagg gcggcggcga cgatggcggc
   262021 ggcaacgatg gcggcggcgg cggagagact ggtggggcca tctggccagg agaaaaaggc
   262081 ggcgggtatg gcgaggcgga cggcggcggc ggcgatggtg aggcggaggg cggtggcggg
   262141 gatggcgagg cggagggcgg cggtggggat ggcgaggcgg acggtggcgg tggggatggc
   262201 gaggcggacg gcggcggcgg ggatggcgag gcggacggcg gcggcggcga tggtgaggcg
   262261 gatggcggcg gcggcgatgg tgaggcggat ggcggcggcg gcgatggtga gacggagggt
   262321 ggtggcggcg agggcggcgg tggtgagggc ggtggtggcg agggcggtgg tgacgacggc
   262381 ggcgagggcg gcggcggcgg caatagtggc ggtgtactag gtgggcaagg cgggggtgat
   262441 ggggatgcta agaagacgta cgtcttgcac accgtcaaac ccgtttgtgt accatattcg
   262501 tttgcgtcgg gtggtcgtct gtagtataag tatcgcccaa ccgcgtctat atccacctcc
   262561 aacataacgt tcgacggcaa cacgttcacg tccgacttca caagcgcatt gccaatgtac
   262621 gtattcggcg tagagccgag atagatttcg acctgcgtca gtcgctccgg gcagcagtcg
   262681 ttgcgactct gtaagcgaac aaatccaacg ttgacctcac tcccgagatc gacgccccac
   262741 cactcgtatg aaaaatggcc gcactctgcc cacgaccgtc ccgtggtgct gtttacgaat
   262801 gaattatcgc ctacgggctt attatcgtca taagcgtcgt ctgagctttg ctggtcctca
   262861 tatgcctggt tgaagcgaag gtctagaacc ttctcgtagg tacgtggcgt ccccggaggg
   262921 ggagagggtg gaggacatga cgaagctgat tgttccgtag gaacagtaat gttaactgaa
   262981 agaagatcac ttgtcacaaa atgtaataaa taaagtaatg cagtggcttt catttacatt
   263041 taaaaaacaa aaaaaatagg ttagatggtt tatttataat agtgtgaata tacatatttc
   263101 attacaattg tgacgtgcat tgtgactgaa aaaaaagtgg tatttgtgtt aatttttttt
   263161 attatataca attaaagaaa agactatggc agacaaaatc ggaaatctgt cagttggtgc
   263221 atttgttgca attatggtta caactgcagt aattttaatc gcaagtcttt ggatgttaac
   263281 aagacgtcgt aaaagttcat atgtacgttt ttacgacgaa ccagtgcaac gtcaatcaca
   263341 tgccggattg gtgccaggcc cacaccgcga aaacgacaac acctaccgaa cattctgatt
   263401 gatgttaatt tttatataac atataaataa atggaagtgt ggaaacttgt tcttgcagca
   263461 gttttctata catatatatc atatgacctt acacgtaagt cactcaataa aagtgttggc
   263521 aaaacgttgc cacgtcaggc agagcgtctg cgtaatacaa ttaataccct tactggacaa
   263581 cgggatcaat atttagacag tccatcaatg gggtactttg aacaacaaaa aaatcgaaat
   263641 agtggagtgg aaattgacga gatagatgat acaaactatc cgagtgtacc atataaagag
   263701 acaacatttc atgcaccgcg tgttacacaa agtacgcgta gtcggggtgg ttttgctagt
   263761 cgggggccaa ctagtacgaa tcggggtatg ggtacgtttg gatcacgtgg ccaggactcg
   263821 ggcgtattta tcaacatgaa cccgaatggt actcgcgaga gcacacgcag aacaagagaa
   263881 agacgggatg gtaacatacc atcatttact cgacgatcaa atatcccagc gcgtacattt
   263941 taaacacgcg gtgggcatac tgtttgtgca tagtgtgtgg tgcatgcagc aagtgtatct
   264001 tccgtagttg tgtgcatttg tgtccatcgt ttgaatggtg cattattgca tatcgcccat
   264061 acaccaccat catgtacttt acatgttggg tgtgtcatat tattagaatc tacaaagagt
   264121 ggatttggta catcgcgatc tgtttggtct cgactagaaa ttggtggatc aatacgtggc
   264181 gatgtaatgc tatttgtctg gattagactg tcgggtggca cgggcactgg atttgtgtct
   264241 tcatttgcat caatcgtttc gtaatttttt cccactgtct ctggatcatt tccagcaatc
   264301 tgcatttcag attcgtcacc cgcagtgagt gtggcggcat tgtctataga accgggcgct
   264361 gcgttttttg gataaaatgc cataataagc attccaatca ttactgcagt tacaataaat
   264421 acaaaaccaa ttaaaacaac tttgttcatc tgtttaatta gtgtaatata aaaaagtaaa
   264481 atgatgctaa aagacagcag tctcacgtga gagatcaaac caatcattct catccatcca
   264541 gtgtccaaac ttgtatggaa acacctgtac cgttacattc ctatgcttaa ggtcatctcg
   264601 gataaagtgt gccttggcct cctcggcggt atgtgcttgt acgatggaat atgctgaata
   264661 atcccggtcg taacttccgc ggccacagca gtccattggg tcgacgtaat actcggaaat
   264721 acacacacac cacatacttg gtgtcagaat ggttggcggc ggtgtcggta tgggagtggt
   264781 tgcgaccaag tcggatgtgt cagtggatac ggatttcttt gttggcgtat catcgtcagt
   264841 gttagttggt gtagacgacc agatatagga aaacatgttt agggaactgc tggggagttg
   264901 tcttgttata cgatgagaaa attacaagaa tggtttgata tggaaatgct cacaggaaaa
   264961 cgctaatgat catattcata taatgttatg attatttata atttaccata taacccaatc
   265021 ccggtggcgt ctcagtcaat cccggcggcg tctcagtcaa tcccggcggc gtctcagcca
   265081 atcccggcgg cgtctcggtc aaactcggtg gcgttggtat ttgcgaaaaa cgagcacagc
   265141 gaatgatgtt ggtattacga aaagcgagca cattgttaca cttgttaatg ccaattttgc
   265201 aagcatgcta ccgttgttta ccgtgtaaaa cacaagcaga tatatcatgt tgacaaagtt
   265261 aaagaaaagt aacccatcaa ttagtggtag tattttggaa atgttatgaa aatcttgcat
   265321 gtagttcata attggtagtg gcatttgggg aacctgttat atagtatata tcttataagg
   265381 tatcaaatgt ctgacacgtc acaattttat gaaagattaa tgcgatttta ttatatatag
   265441 tataaatggg taaatcgaaa agtaaagcat cacccaagcc caaggacaat gactcttcta
   265501 aaaaagaaaa ggagacgcca ccaacagaaa catctccacc aaaagttgca tcgaaaggaa
   265561 gaggttggat tcagataatt actagcatga taattaagct actaatatta gcgatactat
   265621 cagcatgtgc atatgcaggt tatgtagcat atgaaagatt taaaccaaca cccacatcgt
   265681 tagatcgtgg agatgcggtt cagctgcaaa aagaatacaa ttcaaagaca tatgagtata
   265741 aagtatcttt acaggaaaaa tcatgggagg aacatgaagc atcggcacgt aaatggggtg
   265801 gacatcttgt atcattcacg gcagaagaag aatattataa aatattacaa caacttgatg
   265861 atgatatgaa taaaagtgag aatctcgcgg tcgcacaaca gttgataatc gagttttcta
   265921 attcatataa aaacggtcaa aaacatggtt tctggacagg aggacgtttt aaagacgaat
   265981 cgcgttcgac acctccatca tattcagaaa ataatgcaaa aacatcacag ttctggagtt
   266041 ggtcggataa ctccaagtgg ggatatggca tgtcattatg ggaagataga tcaccagatg
   266101 gtgatgggag ttgtgtatta atgaaaatta aacggagggg ggatatggaa tttttaaaca
   266161 gtgaagactg tacacggaga cttactgcaa tatacaaaag aagaaagtga tacatttaca
   266221 tgtgtatttt acttttttag catggtggta gaaccgtcca tgttgggttc tttcaaaatg
   266281 gggcatctgg gtattgcccc ttgataaatt tggtgagagc atctactttt gaaactagtg
   266341 atgcaatttc ggtttttagt gatgcatttt cggtttttag tgatgcaatt tcgggtttta
   266401 gtgatgcatt ttctttcacg agaaaatgga tcatttccat aaaattatca gttggtatag
   266461 tttttaccgg aacatatgct ttgacaacct ggccacattg ggtacataca actggcatat
   266521 ctccagggtt atccatgtac tttgtagtat cacaaataaa ataaaaaata cgatgttttc
   266581 aatgcgaacc tgctcgcgct ccgcgacatt tttttgccgc attgacttca gtccatgaac
   266641 tacaaccggt tgcatcaagt gcaatttcat cattacgctt gtttatatca gtccatgaac
   266701 tacaaccagt tgcatcaagt gcaatttcat cattgcgctt gtttacttca gtccatgaac
   266761 tacaaccggt tgcagctaac ttagcggcat cttcgcgatc aaattcttca atcgagtcgt
   266821 acccaaatga cttgaggatg gcgtttaggg aactgtcgct agacattcga aatgtcactg
   266881 tcaatacgtc gtttgcggag ttctgaataa atcttgacaa actccaatgt cgttggatcg
   266941 ttaagatccc cccatgattt tatgacattt ccatgaacca ttgccccaat gtatgacgga
   267001 tcattatcag agagagctgc ccgtatgtgc gcaaatccga tacccacctt taccagatgt
   267061 gttgcaatct cgtgtgcata tgaccggtac cccgccccaa atagaatatt gcatgtttcg
   267121 tcaatcgttt gtatgctagt gtcaccaatg atatcttgag cattggtgag aatttcatag
   267181 tttgacagat acatattgta tcgtgattta agacaaagtg cttgtgtgat tgcatatcgc
   267241 tgaatctgct ccgtaacctg gttgattgtc atgatgagaa acgaccgaaa gcatgagagt
   267301 tgcatttagg gaactggtca gcttaaatgc aattgaacca gtcaatcagc tgtgcagctg
   267361 ttgtatatac accgactgcg aatatgtaac ctaaaacaaa attaacaccg aatgatttta
   267421 gaataaaaaa ttcgttgaat gtatttggtt ggtacatttg gggaaccaat attaaatttc
   267481 tatatgttat aataaatgct agccgcaatt ttaatttcag tgtttcttgt aataataata
   267541 ttactactac tactactaat acgaaagcgc cgtaatatag cgcggttaat atattctagg
   267601 tcaaccggta ctgataagaa ttacccaaca tcatttgaag agaccgaaaa tacacccggg
   267661 tatttatctg caagatctgc actccgacaa atacatgcac tggataaatc acgtgcactg
   267721 gataaatcac gtgcaagctt tgaaactcga caaaggttgt agacgtatcc ggtctccttt
   267781 tcttttttag aagagtcatt gtctttgggc ttgggtgata ctttactttt cgatttaccc
   267841 atttatacta tatatttgag tgaagttccc taaatggcca atattaataa aattcacaca
   267901 tcacttcgca atgttaagcc aaatacggat attctaatta caattactcg cccggggtat
   267961 cgggtatttc aaaacatcat tattaagtgt gctaccatcg aagaacacga tgacgaaact
   268021 gcaattgatc cggtattgtc tactagcttc attattcgca gtaattgtgc acttcccact
   268081 gtgtttggat atacaattac aaaacatgcc ggtaatcccg acagtgatac gattgcaatt
   268141 gttgatgggt atggtatgaa atttccaatt gggtaccatg gtgtgaataa gaattggaca
   268201 catgagtttg atatcgtaga tgcaagagaa tctacaggca aataagttta ttttataagt
   268261 gttaaataaa aatgaaatga aagttttgtt attaatatgt caaagtcaga ttataaagtt
   268321 ggaatctgtt ggataaggat ggagattgag acaattatag atggggttgc cgcgattggt
   268381 aaaaaaatca atgaaaagtt aggaacactc ggtgatgttt cggatactgc ggaatgtaaa
   268441 aaatacaatc aatcgtacaa taatatctgc aaaactctga caatttataa cgaacaccaa
   268501 acccatatga acacacacat gttggatgag tgtgttcagc tgctactaca gcgcgcttgc
   268561 gacatccccg gtatgcccaa atataataaa aacatgtccc ctgatgagtt atagtcagtt
   268621 cgttctctgt gctaccatgt cctgcaatga aacgtggata aatgcaagca tttctgtgta
   268681 ttgcttgcga aggagatcct ccgactgtcc gtaatatata aagtcatcga gtagatcaac
   268741 acggaacgta agttccgtgt ctcttgccca tgatgttaga gtgtcatctc ctttgataat
   268801 tgccccccac tccgattgca ctcgctgtct catggcataa agaatacgtt gtccacgtgt
   268861 gcgcaagtga ttgcaggtgg cgcgagtgag ggtacgtgag tgatgcattt ggggaaccga
   268921 ccgaaagtta cgaactcgca tactctgcca agaatgaaca aacattttat aatataaaca
   268981 atataatttt acatggtcgc agatggaact gcacaaaacg catcgttaag tgcatacccg
   269041 acacacagtc caacaataat ctcaaacacc atttagggaa ctgggtgaaa ctgggaaacc
   269101 tgtgatatcg tcaagtgtcg tccaggtgac acttctacca agtgtagctt gagtattata
   269161 ccttgacaag tctccgctgg ttccctaaat gcctgttacc attgagaaca tgatcaaccg
   269221 tacgaatgct gaaatcgtgc agattctttc gtccgagccg cctgagtcgc gtcgcccccc
   269281 ggcacgcgcg gtgtatatac acatgcgtac caatggcggg tcatggcggt cccgttttgt
   269341 acagtatgaa aatgcggcaa aggataccgg tgtctcgtca agtgaatata ttaacaagaa
   269401 gtaaatgtgt tcccatcaat taaacgcact cttcgaatac ctcagcatca tttacacatg
   269461 acatggtatg aacagtgtca ttggcattta ctgggtcatt tctatcgtaa aattccttgg
   269521 gtgaaataca cttatagaag aagcatgtgt ttttattgct ctcatccgag tgattaccat
   269581 ttcgaaaccc aactgcgatt accccattga tatttctcgc aattgcacga cagttttcaa
   269641 ttgacgaagc agggatttta tgactatgaa gattcgccat acaaccacca tccctaaaat
   269701 atccaggtac gatatcattt gctggtatat cgggtatatc gggttcgtcg gatgtcgata
   269761 cgtccgatgg tggtaggtac accatttctg gctcacgctt tggaattaca ccaagtgcaa
   269821 acaaaatccc aactacaacg attgtaacaa ccattatacc aacgactaaa agaattacag
   269881 ctttcttgct ggtactcata tttttaaatt tttttacaat accactgccc atatatatat
   269941 atattgttat tatatacata atataaaatg atatactaca ttgcaaatcc gactcgcggc
   270001 gtttaccgac tctacaactc acacccagtt ccctaaatgt cgtattacag catcccaaca
   270061 aagaaacaca atgaggttgg tctcgagatc atcaagacgc acacgcttga cgaactgccc
   270121 gctttttttc gcgatcagcg attggggtat gactttgtga tcgaagcact tacactgctc
   270181 gaacccacgg gtggattacc gcacgacgtg tactcccaca ttgaacagcg actcactgga
   270241 tatgagatgg acgtcgtgca cgcagagatg tgtaaggaac atggtcggtc tcggctattg
   270301 gacgatttca tcaagaacga agcggtgaga atcaccgaac agtcaaagac gctcatccaa
   270361 atacaaacat cacggttgac acatacccag cttcgtcgca tgatcccgga cgaagcagtg
   270421 aactcatatt atgagtgtga tttggcatgt gagtttaatg ttaagtttgg tgcgtaaaat
   270481 ttaaacgaat taaaaaaaat gatagctaga tgacgaattg ttccatcgag tgtccactct
   270541 atcatctagt ttgtatccgt tacaaaacat gcaaaaacca aacatggtat cggtacaatg
   270601 cgcgacccca tatttatcca attcttttgt tcgctcacgt ggatatagta tatccccgat
   270661 gttttttcga ttttgcagta caagtttatt tatatagtca accgtattct tgtcatcaat
   270721 atatctagtt ccgtcccaat caaagttctg gtgtcttgtt atcatgggat taattgcaga
   270781 atatccatga tcgcacccgg tgcattttcg ccactgtgtt tcaattgtat gaatcaaatg
   270841 attccgagag cgatgatact tgcagtatcc tttatgattc gcaccatttt tacaaccaga
   270901 agatagacat atcattaagt ttaggtcttg tctccgggca ccaacgttaa cgaaaaatcc
   270961 ccttctggta gtcgctcatc actctccaac ttttactcag ttccctaaat gccaaagatt
   271021 gccccgattg taaccgcata tgtgctcatg gatgacgaaa ctcgcggtgg aatttcgtca
   271081 attgacgaac aagtttccga cgaagacaaa aaggaagtag tcattaaaaa tgtatttgac
   271141 ggcctgcgtc ttgcgggtat cgtggattaa ttatataatt aaaataatta ttgatcaagc
   271201 acgcacacgt taaatatttt aattaattaa ttagtcaggg tttacggcgt ctattttatg
   271261 tttttctttt tatcatgttt tctttttatc atgttttctt tttatcatgt tttcttttta
   271321 tcatgttttc tttttatcat gtttttcttt tatatgtttt tcttttatat gtttttcttt
   271381 tatatgtttt tcttttttat catgttttct tttatatgtt tcgttacaaa acactaaaac
   271441 ccggactcaa gatcacgcaa atactgctta agattctctg acagagcatc ttccatctta
   271501 tcaaccgtct gaagcatttc cgcatctgca caaggcggca gcggggcact tgactgataa
   271561 taactggcca ctgccctgtg catcgcagat gtcaccggga agttattttt tgcatcatgc
   271621 accgacatca tggtacgcgt gtttacacgc agcttcatca cgggatccat ggacatggcg
   271681 gtagatgcga cgatgaaaga tagcatttag ggaactgggt gaagactggg aagttttcgt
   271741 actcgtttga atctcactca atggtttgat aatataacag cccgtctaga gtgtatcatt
   271801 gcgaattgtc atctaccgcg gtacattttg tactgctctg caatctctgc gaccagtcac
   271861 ccgttcccta aatggctctc accgatctca tgaacgaggc attcgcgtcg aatggtattt
   271921 ttttcgagtc ggtctacatg gatccactaa agagcaagca gtctcgcgtc ctggttacgg
   271981 cacgcgttct ttggcggggt acgtcatcga ttgcggatgt ccaaaacaag ctgtatatcg
   272041 cacttaagcc atacgcaagc gagtttgacc acgtaatcaa ggcgtcaatt cacgacccgg
   272101 tccattttct cggtattccc gagaatgcta acgatcactg ccggcaacgt atggaaaatc
   272161 gccgggttcg atattccgag tacagtgatg caggtttgat taagttcagt ccgtcttttg
   272221 tctggaatgt gcaggatgtc tcctgatata tggattgatg gtagtgtaag agttgtgaat
   272281 tattttttat atacataaag taagatgtat actggttcta gtcacgcgta ttcatttcca
   272341 aatagaaatc aatttgctca agataatatt cgaaatcacc gaagtgtgta tttaaacccg
   272401 atccggtatc agtatgtaca agaccatcct tataattacg caatgccagc tgtgccatac
   272461 tatggcgggg tagtccaaat cccggaatta ttaaataccc aaaatgcact ttacaacaca
   272521 ctcaattcag taccggctgc gtcgcctgca tctggttact tggacatgtt tcctggcgtt
   272581 cgtgacggta taaatgtaat tgaaacggtc ggtaccaatc aaagtttcgg gcaaggtgaa
   272641 gtgcgcagac ctccatttgt tagtgatgca gaacttcaat tttatcttaa cactcttcgg
   272701 accacgccac agcaggtacg tcaacctcaa ggggtcaatg tttctgaact taaacatgtt
   272761 cgtgacaacc ttagacaccg gccacgtagt tcaaggcaat ttcgtgcctt gaccggtaga
   272821 gtactataat aaggtgaaga ggtgttttgc atcacctctt taaaactgta agggttgtat
   272881 aaaacaaact gtttcacgct aatgtaacaa caccctctga cagagtacat ttctaattca
   272941 caacaactgc ccttgccgct gcaattgcct tgtactccgc ctttgtgtcc ggcgtctcat
   273001 ctcgccacat ctcggcgaga atgttttgga tgtgagacgc cttgttgtcc gtctttggtg
   273061 gcttaactgc gcggcgcccg ttaatgtact cctcggtggc aagcgctcgc ttttcggagt
   273121 tgtaaatacc agcggcagtt ggcggtcgcg acccctttgg cgcgcgttgc cgcggtgcac
   273181 cgtcaacacg cgttgtggac gcggtcgctt gtttttttac tgcagatgac agcgtcttac
   273241 tgtgcgcgcg cgtagacgaa atcagtttca tcgcgacctt gataatttgc gagcacgtct
   273301 cggtagtgga gaggtcggtg gtaagctcag caagcgtggt agcgatagaa agcggcgtgt
   273361 ccgtgacgac tggtggcgtg tcggtgactg gcgacggcgg ctcatcttcg accggcgacg
   273421 gcggctcatc tgcgactggc gacggcggct catctgcgac tggcgacggc ggctcatctg
   273481 cgaccggcga cggcggctcg tcgatttcgt cacccgatgc cggatcttgc gatggctgtg
   273541 tattcgatgc ccagatcgct tgcgtttcgt catcatcctc atcatcaata gtgggcgaag
   273601 gcgagcgcat gggcgacgat ggaggcgagt tcatcgccgc catcagctcg tcatcatccc
   273661 agtcgtccat ttggggaact gccggtgaat cggacattga cggagacttg ggcgcgatgt
   273721 aaaagtagtt tgtgatgtca agctggggtg aggtaagcat ctgagagacc atgcttttag
   273781 ggaactggct ggaagatgag gagctggtgg agtcgatcga ctcgctgcga gtgatggtag
   273841 tgtcaatcga cagattcggc atcgtcggca tcgcagagac catttaggga actggttgaa
   273901 agatgtggag ttggttgatt caaatgagca atgctcagtt gtgttgtaaa tttgcatcaa
   273961 ctcacccccg atcgattcaa tcacccaaac acaatggcca acatggactc ggttccccaa
   274021 atgcccaccc agttcgatga ctcgatcacc gtgaccgaca ccatcaccat cgagacagtc
   274081 gccgatcgcc caaacacaat ggccaacatg gactcggttc cccaaatgca cacccagctt
   274141 tccgagttca tcccggagcc catcgacacc accgatgacg agacgcacga cacgccgtct
   274201 gagctgatct cgcagctttc cgagcacctg gccaccgagt ttgatgagac caccatcacc
   274261 gccgccgccg cggttgcatc caagttgctc aagacactaa agtcgcgcga gcgcgcaatt
   274321 aagaagaagg cgaagaaggc ggctgcaccg cccaaggagc gtgttgcata cggtactaag
   274381 atcccgagca tggccgccat ctttgccaag gacaactcgg agattgcggc aaagtggtat
   274441 gccgacggcg gtcgcgttcc ggatttcaat cccgcgcgcg gtgctcaaac cgcaaagtac
   274501 cttgcgctgc tatggaggga cgtccccgac accgtccgcg acatgtacaa gaccaagcga
   274561 gatgcaatta ttgcagatcg cgcctctgtt gccgatatgg caaatgtgat ccatcaggcg
   274621 attgtaaatc caggcggtga gattcaggat ccggtgtgcc ccgttgtgtg agtatgtgtg
   274681 taattacaag taaaagtctc cataaaaaat atacacaaat taaaaaattg ccgggcgaag
   274741 taccgtcgcg tgattttgtt tatataatat taaatggatt ataaaataat tataataata
   274801 atacaatctg tcttattatt tgtattagtt tcggtactac tttatctgat atttggacga
   274861 ggccaggcgt ttatgccccc aatagacaat actacattaa cgttacttga tacatttgca
   274921 atgacaaata atctcggtat atttgattcg ttatatggag aagatatgtc acttgatgaa
   274981 aagcaagtag cagttgccga tgcatataat ttactagatt ctcatgcatc aatgattaaa
   275041 aattcaccca actctaacga tgaacgtaaa ctatacacga taaatcatct caagtcaatg
   275101 tttgatgcaa caaatgacga cttaagaaag cgtcaaatca agtccagggg gttggatata
   275161 ccagtggtaa gtaatattgc gtttgctgca agtaaattaa ccgattggtt aagaacagtt
   275221 cccgagtcaa agtatccgag cgaggatgca aatatttctc gggaaattta taatgagttt
   275281 catctggcgg aaaaaagacg catgcaaact caaatacaac gagaagaaag tattgcgcga
   275341 gaattggaac ataataataa aattgcagat gaatggggta gacaacatcc gaaagaacta
   275401 caaaaattac gagaaataag ggcgcatgat gatagaaaaa aagtagaagc tgcttatcta
   275461 aaaagacaaa aacgtcaccg ccggcgtcgc gattaaataa atattttaat taattaatta