LOCUS       JF974297               32402 bp    DNA     linear   HTG 25-JUL-2016
DEFINITION  Cyanophage KBS-S-1A, *** SEQUENCING IN PROGRESS ***, 16 unordered
            pieces.
ACCESSION   JF974297
VERSION     JF974297.1
DBLINK      BioProject: PRJNA53285
KEYWORDS    HTG; HTGS_PHASE1.
SOURCE      Cyanophage KBS-S-1A
  ORGANISM  Cyanophage KBS-S-1A
            Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA phages.
REFERENCE   1  (bases 1 to 32402)
  AUTHORS   Henn,M.R., Lennon,J., Levin,J., Malboeuf,C., Casali,M., Russ,C.,
            Lennon,N., Chapman,S.B., Erlich,R., Young,S.K., Yandava,C.,
            Zeng,Q., Alvarado,L., Anderson,S., Berlin,A., Chen,Z., Freedman,E.,
            Gellesch,M., Goldberg,J., Green,L., Griggs,A., Gujja,S.,
            Heilman,E.R., Heiman,D., Hollinger,A., Howarth,C., Larson,L.,
            Mehta,T., Pearson,M., Roberts,A., Ryan,E., Saif,S., Shea,T.,
            Shenoy,N., Sisk,P., Stolte,C., Sykes,S., White,J., Haas,B.,
            Nusbaum,C. and Birren,B.
  CONSRTM   The Broad Institute Genome Sequencing Platform
  TITLE     The Genome Sequence of Cyanophage KBS-S-1A
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 32402)
  AUTHORS   Henn,M.R., Lennon,J., Levin,J., Malboeuf,C., Casali,M., Russ,C.,
            Lennon,N., Chapman,S.B., Erlich,R., Young,S.K., Yandava,C.,
            Zeng,Q., Alvarado,L., Anderson,S., Berlin,A., Chen,Z., Freedman,E.,
            Gellesch,M., Goldberg,J., Green,L., Griggs,A., Gujja,S.,
            Heilman,E.R., Heiman,D., Hollinger,A., Howarth,C., Larson,L.,
            Mehta,T., Pearson,M., Roberts,A., Ryan,E., Saif,S., Shea,T.,
            Shenoy,N., Sisk,P., Stolte,C., Sykes,S., White,J., Haas,B.,
            Nusbaum,C. and Birren,B.
  CONSRTM   The Broad Institute Genome Sequencing Platform
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2010) Broad Institute of MIT and Harvard, 7
            Cambridge Center, Cambridge, MA 02142, USA
COMMENT     This genome was sequenced by the Broad Institute and co-owned with
            CAMERA.
            
            ##Metadata-START##
            Isolation method                 :: double-plaque-purified
            Template preparation method      :: Henn et al. (In Prep)
            Phage/virus type                 :: DNA:ds Viral DNA
            Phage/virus "hybrid" information :: not applicable
            Phage/virus taxonomy             :: Siphoviridae
            Phage/virus strain               :: not applicable
            Morphology                       :: l-like
            Latitude                         :: 41.65N
            Longitude                        :: 71.26W
            Depth (m)                        :: 0.50
            Salinity (psu)                   :: 28.00
            pH                               :: 8.20
            Collection date                  :: 20-Aug-2008
            Sample collection site           :: Other
            Other collection site info       :: Mount Hope Bay, RI, USA
            Habitat description              :: coastal estuary
            Lab Host                         :: Synechococcus sp. WH7803
            ##Metadata-END##
            * NOTE: This is a 'working draft' sequence. It currently
            * consists of 16 contigs. The true order of the pieces
            * is not known and their order in this sequence record is
            * arbitrary. Gaps between the contigs are represented as
            * runs of N, but the exact sizes of the gaps are unknown.
            * This record will be updated with the finished sequence
            * as soon as it is available and the accession number will
            * be preserved.
            *        1     4616: contig of 4616 bp in length
            *     4617     4716: gap of unknown length
            *     4717     8516: contig of 3800 bp in length
            *     8517     8616: gap of unknown length
            *     8617    10824: contig of 2208 bp in length
            *    10825    10924: gap of unknown length
            *    10925    13014: contig of 2090 bp in length
            *    13015    13114: gap of unknown length
            *    13115    15093: contig of 1979 bp in length
            *    15094    15193: gap of unknown length
            *    15194    17161: contig of 1968 bp in length
            *    17162    17261: gap of unknown length
            *    17262    19146: contig of 1885 bp in length
            *    19147    19246: gap of unknown length
            *    19247    21049: contig of 1803 bp in length
            *    21050    21149: gap of unknown length
            *    21150    22842: contig of 1693 bp in length
            *    22843    22942: gap of unknown length
            *    22943    24628: contig of 1686 bp in length
            *    24629    24728: gap of unknown length
            *    24729    26208: contig of 1480 bp in length
            *    26209    26308: gap of unknown length
            *    26309    27661: contig of 1353 bp in length
            *    27662    27761: gap of unknown length
            *    27762    28963: contig of 1202 bp in length
            *    28964    29063: gap of unknown length
            *    29064    30165: contig of 1102 bp in length
            *    30166    30265: gap of unknown length
            *    30266    31329: contig of 1064 bp in length
            *    31330    31429: gap of unknown length
            *    31430    32402: contig of 973 bp in length.
FEATURES             Location/Qualifiers
     source          1..32402
                     /organism="Cyanophage KBS-S-1A"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:889952"
                     /lab_host="Synechococcus sp. WH7803"
                     /country="USA: RI, Mount Hope Bay"
                     /lat_lon="41.65 N 71.26 W"
                     /collection_date="20-Aug-2008"
     gene            complement(102..287)
                     /locus_tag="CPVG_00001"
     CDS             complement(102..287)
                     /locus_tag="CPVG_00001"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72811.1"
                     /translation="MEHNVGAVKMDIFDNEWKPLLKLFNRAVTNEDIMRHFDDQEVDR
                     LHTFMDALQELALEHTV"
     gene            complement(1070..1702)
                     /locus_tag="CPVG_00002"
     CDS             complement(1070..1702)
                     /locus_tag="CPVG_00002"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="AET72812.1"
                     /translation="MTHSVRLVSITPNAEELIAYCARVSNPTNQHNKETAPRLLKYLI
                     KHQHWSPFEMANMVVEIKTNRAVAAQILRHRSFSFQEFSQRYAEVESFPSPPYLRRQD
                     VKNRQNSIDDLDIHIKAHWHEKISELYTLSQEVYRGMLEDGVAKECAREVLPMGSDTT
                     LYMNGTIRSWLHYIALRAAPETQLEHRRIAEGCRMLINDTMPDVYEAMWC"
     gene            complement(2020..3774)
                     /locus_tag="CPVG_00003"
     CDS             complement(2020..3774)
                     /locus_tag="CPVG_00003"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA maturase beta subunit"
                     /protein_id="AET72813.1"
                     /translation="MHTNDLEANLRSDFRYFLTAIWAHLKLPQPTRAQLCIAEYLQHG
                     PKRLQIQAFRGVGKSWITAAFVLWTLFNNPDKKIMVVSASKDRADSFSIFCQRLILEV
                     TWLGHLKPKSDDQRWSRVSFDVGPAKPHQAPSVKSVGITGQLTGSRADLMILDDVEVP
                     GNSMTELMREKLLQLCTETESILTPHADSRIMFLGTPQTTFTIYRKLAERNYRPFVWP
                     ARYPKKLANYEGLLAPQLAEDIENGADPWTVTDPARFNDEDLIEREAAMGRSNFMLQF
                     MLDTTLSDAEKFPLKMADLVVTSVNPSTAPESVVWCSDPQNIIKDLPTVGLPGDYFYS
                     PMQLQGNWDPYSETICSIDPSGRGTDETAATYISQRNGFLYVHEMRAYREGYSDNTLL
                     DILRGCKKYKVTKLLIETNFGDGIVSELFKKHLIQTKQNIDIEEVRANVRKEDRIIDA
                     LEPVLNQHRLVMDRSVIEWDFKSNPTSPPEERLLYMLFYQMSRMCREKGAVKHDDRLD
                     SLAQGVKYFTDAMAISANHEIAKRKFEEWQDLEQAWLDDPQSAANHMVFGMTYTQRQK
                     ARSLNGKNKGYNWVSIDK"
     gene            complement(3883..4437)
                     /locus_tag="CPVG_00004"
     CDS             complement(3883..4437)
                     /locus_tag="CPVG_00004"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72814.1"
                     /translation="MARQTGSQRRKSQAAGRATRKPVVRRGAGGGQGNKARRSSSTQP
                     KPGDIRYVKGQKQIYTGTEFINASTQRDIAKMNFMGRQTEGQMARSRAKASATSSQKP
                     RRNVTSASASAPKPSPKPAPKPAPRKRAATAEEGRMIWARKYSADKYKDQAIGKEARR
                     YLAKQKKNKTLRKEGQATYNRGSA"
     gap             4617..4716
                     /estimated_length=unknown
     gene            complement(4881..6248)
                     /locus_tag="CPVG_00005"
     CDS             complement(4881..6248)
                     /locus_tag="CPVG_00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide reductase"
                     /protein_id="AET72815.1"
                     /translation="MSTELIARTGRVQSWIDDPTSRLPVSCTVFVVENEMEGPNGIEA
                     SWRFVSHALRYGAGCAVHLSKLDPQGHERPSGVTASGPVSFAKIYSTLNEILRRGGIY
                     KNGAVVCHLDVNHPDALQFITANRSELPWVKRCINITPEWWEACDFKDQLLYGIKSGD
                     IWLNKVKYDNEGNRIRGNVCLEVYLPSRGTCLLQHINLGACEFDDIPKAFVQGMQELC
                     ALHARTGVADNGEYLSPETDRQVGLGMLGLANLLRRYGVTYDQFGRALEQYNEGDVVR
                     SAAYELVSQLASGIESAASIARSHNMVRAFAIAPTASCSYRSTDLDGYTCTPEIAPPI
                     SQTVDRDSGTFGVQTYNYGDVEIASKVGWEAYKRVADGIMTLLNRTGLLHGYSFNSWS
                     DIVTYDNAFIEEWLKSPQTSLYYSLQVMGDTQDKSDVYAALQEDVDDYLAEILNEELT
                     CDCQE"
     gene            complement(6251..6616)
                     /locus_tag="CPVG_00006"
     CDS             complement(6251..6616)
                     /locus_tag="CPVG_00006"
                     /codon_start=1
                     /transl_table=11
                     /product="gp32"
                     /protein_id="AET72816.1"
                     /translation="MNSYIHTSLMDQAEEFRSAFQIQSGTNGREKDKALIDEEWSEFH
                     EAYHFHGKEDQLKELADLVYVCFQYAASQEWDLEEAMRRVHHSNMSKLGEDGKPIYRE
                     DGKVLKGPNYQPPNLTDLV"
     gene            complement(6746..6937)
                     /locus_tag="CPVG_00007"
     CDS             complement(6746..6937)
                     /locus_tag="CPVG_00007"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72817.1"
                     /translation="MIELTMEQQFKLRRLKDTLQEASKEDIITVFEALQHQNFVLCNT
                     VANLIKKWPTHPLITPEAQ"
     gene            complement(6906..7665)
                     /locus_tag="CPVG_00008"
                     /note="exonuclease; frameshift"
                     /pseudo
     gene            complement(7665..8516)
                     /locus_tag="CPVG_00009"
     CDS             complement(7665..8516)
                     /locus_tag="CPVG_00009"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase"
                     /protein_id="AET72818.1"
                     /translation="MLETQKKLGMLSQGSNAWLKLVKNGRLHHSCFIGAATHRMAHAR
                     PNLAQVSSDADCRELFITRPGWKLVDSDLAGIELRVFAHYLGRYDEGRYADILLNDDI
                     HQVNADKIGISRRAVKTVTYAFLYGASDVKIGTSYDSQLTEDQARKKGAEIRRAYLDA
                     IPGLERLVEAVKTKAKVDRSLRAIDGRKILVNSPHKALNFLLQSSAGVIAKRWLLITH
                     DRLQGIEHERYAFIHDEQALGCPPDVADQVASICTTSAAMAGDYYRLRIPIDADAKVG
                     DNWAQVH"
     gap             8517..8616
                     /estimated_length=unknown
     gene            8618..8776
                     /locus_tag="CPVG_00010"
     CDS             8618..8776
                     /locus_tag="CPVG_00010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72819.1"
                     /translation="MPFADLTSDVVVGWVKEKLGGDEKVAEIEAALQAQLDEQRTPTK
                     ASGLPWSA"
     gene            8800..8961
                     /locus_tag="CPVG_00011"
     CDS             8800..8961
                     /locus_tag="CPVG_00011"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72820.1"
                     /translation="MITLIRPILFSFLQSQSVKLLIVDLLAKLAESTDNDIDDKAVEF
                     VRNGLFSNS"
     gene            8958..9251
                     /locus_tag="CPVG_00012"
     CDS             8958..9251
                     /locus_tag="CPVG_00012"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72821.1"
                     /translation="MTIDNILTHPGYYNTPGNAYTVLTGDTYTSQVLSSHCRRVSLHA
                     NGHSIYFKLNSGTGEHYIKTDERIYITVPENSTLHVKTTQSNSGTCYISEYEW"
     gene            9280..9513
                     /locus_tag="CPVG_00013"
     CDS             9280..9513
                     /locus_tag="CPVG_00013"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72822.1"
                     /translation="MIEAVVSATLAALAAGAALTNRIHNRINDMDQRLDTFELRVATQ
                     YVPKQDFDTAMQKMEDHMIRIETKLDQMLLKNG"
     gene            9506..9745
                     /locus_tag="CPVG_00014"
     CDS             9506..9745
                     /locus_tag="CPVG_00014"
                     /codon_start=1
                     /transl_table=11
                     /product="gp49"
                     /protein_id="AET72823.1"
                     /translation="MAKNRANEDVFNELHNLITREFLARIKSGEATTQDLKAACDWLA
                     KNDITGVAVEGSALSGLADIMPTIDFDEVQRAIRR"
     gene            9745..10026
                     /locus_tag="CPVG_00015"
     CDS             9745..10026
                     /locus_tag="CPVG_00015"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72824.1"
                     /translation="MAPRKKPYSQLKKSAKNYRDNAAARRHKYAKAVKDGQSESATQY
                     RVKHTKARRDAGVYGKGGKDFSQTTKGTFVREDPSKNRARNRAKLKIKP"
     gene            10023..10352
                     /locus_tag="CPVG_00016"
     CDS             10023..10352
                     /locus_tag="CPVG_00016"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72825.1"
                     /translation="MTPLLPSPDHYLYNLITMTSPEAKRLWRRAIKEHFNCQCVYCGE
                     TYELHELTLDHVHPRSLGGEDLTSNIVPACSRCNQDKGSNNWLTWMRQTFGFHPQREQ
                     LILSHIK"
     gap             10825..10924
                     /estimated_length=unknown
     gene            10953..12695
                     /locus_tag="CPVG_00017"
     CDS             10953..12695
                     /locus_tag="CPVG_00017"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72826.1"
                     /translation="MFKYNWDLGLNRKSLSYEGKFDLEADLAEWQGLGQYYDRYGTGI
                     EKRGYDVLDRIVKMNTSPWFKYSQNAMGAGDALARTIIGRMEMRMRAARAALDKGVDP
                     SDIKKYVRETEEDFRNQIFKKDKNGRYIVKDKAAKMAGDEAAMTRALEENFKGFELIS
                     NIPGMKAFFPFVRTGFNALDLTFQHTPLAIWRDKYKDIMRGKNLQKYGIRPEDLPQAQ
                     ALMEGRIAMGSTIIGMATFAALSGKMTGDYPYTKEDRDAWQAAGIQPNSFKLGNTYVS
                     YQNIEPFNTLLSAAANVVQNSDILGEEVTDNMIKKLTFMTAAVLVDKSMLAGIESLAN
                     IMSADTSEEELKRTGAQLLRAHFPYAGLLGQLGDVIDANRKEAETFMELVIRRDAFMK
                     SSLPPKYDILNKDRSGKPLQMGAMNPLLRLLNAGSPIAIVDVEDDPIRQGIVEMRYNL
                     PEMLSQYKGEPLNAYEQSQLSKYMSMGDLRSRLEKVMVTDKAWRRGLDFYKDQNLTIQ
                     TGYKLYQQKFYQLVDQEFTRAKNLAMIKLRRENKDLDKRIQTRELKTAASKAGNYEAM
                     RRLSTPEGRTEFPR"
     gene            12720..>13014
                     /locus_tag="CPVG_00018"
     CDS             12720..>13014
                     /locus_tag="CPVG_00018"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72827.1"
                     /translation="MAVTRQDYTQAGSTITYVVPFEVIEATDIDVYVNNVLQLQQNTT
                     STADATHPQVISGEITQGTALTNYTVASNNGTITFNAVLTAGDYIVVERTTDDA"
     gap             13015..13114
                     /estimated_length=unknown
     gene            13117..14177
                     /locus_tag="CPVG_00019"
                     /note="DNA primase; frameshift"
                     /pseudo
     gene            14271..>15093
                     /locus_tag="CPVG_00020"
                     /note="DNA polymerase; frameshift"
                     /pseudo
     gap             15094..15193
                     /estimated_length=unknown
     gene            15339..>17161
                     /locus_tag="CPVG_00021"
                     /note="hypothetical protein; frameshift"
                     /pseudo
     gap             17162..17261
                     /estimated_length=unknown
     gene            complement(<17262..18875)
                     /locus_tag="CPVG_00022"
     CDS             complement(<17262..18875)
                     /locus_tag="CPVG_00022"
                     /codon_start=1
                     /transl_table=11
                     /product="tail tubular protein"
                     /protein_id="AET72828.1"
                     /translation="MAAVNQRIPNFLGGISQQPDFIKFPGQVRTCDNAYPDVTFGLSK
                     RAPGEFVSILSNATADGKWFEILRDNDEKYLVQIQSSGIRVWDLATGTEQTVNFGSTT
                     SNYNYLTDGSPSRYGIQSVGDYTIITNPAKTVATARTTSNTFGSNYAFVTVDAIAYNT
                     EYVIGINTSSITSSTKRIVKSLSISPDNFDDGAPEVQYAGKAEFFNSSWGGVKYAVAV
                     NGFTYVSGYQSNPDTNAEYDTRYTAEVVLQDGGLDAPATGTQTISIAGRNYTVSINDT
                     LEYQSYADANAAFYRTPKNPDEGLISVNAVLGGLKDSLLAVYPTLTVEIIGNGLFIQS
                     SSSLNVTTRAGTTDTALSVITSTAQNISKLPSMCKDGYICKVSNTDQSEADDYYVKFI
                     AESGTSGSGVWEETVAPGIDAGFDYDSMPHALINNRDGTFTFSKLDDVSQSSSENFWK
                     DRAVGDAVTNPMPTFVGQSINDIFFFNNRLGFITSENVVLSQPADYFNFFVNSAITVS
                     AADPIDIAASDVKPAFLNHAVPFQKGVVLF"
     gene            complement(18875..>19146)
                     /locus_tag="CPVG_00023"
     CDS             complement(18875..>19146)
                     /locus_tag="CPVG_00023"
                     /codon_start=3
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72829.1"
                     /translation="TLYVDVVWFFEFEDIPQAFRDYITAKAARIASGRMVNDETSIKI
                     LQAEESVLRAVAIEFDTSQADYNVFNASDLRNPYTSYKPFQALSR"
     gap             19147..19246
                     /estimated_length=unknown
     gene            19248..21029
                     /locus_tag="CPVG_00024"
     CDS             19248..21029
                     /locus_tag="CPVG_00024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72830.1"
                     /translation="MLVDGSLPSASSPLRSFVVDSFTQICLDGPGCLVTNNGYAQLVS
                     FFGTFCHYHTKALNGGQANLTNSTTDFGRYGLIADGKSSSAIFTSTANGAASAGDITF
                     AINEPTDNWFGTSTRPLDNMLVQIGSDIYEILSSSPNGLGWNVTISNPNPANRAENLG
                     LDNPHANGVAVSFFLQSFVSTSSHTFEYAGTGTDYRALPQNGGVAIEANQVISRNDGR
                     VWLSSTDQNGKFKVGDTFEVNQRTGFVTIDPQSVATIVISDSTPQLGGDLDVLDKRIY
                     SSSGNVHVNDTLEVNLGSASNPAITFNGDTNTGLYSPGADQVAISTAGSEKLLITSDG
                     KLGLGTSSPDSNLSIGNTNANYRIDIADERAYIGYNTTYGSSGALYLDGGAGATKDII
                     LQPVSTGNVGIGTSSPGSTLSVRQAAAHFGVARITRPDSDTACLYLGNDTDNNALISS
                     NNTALRFGKVVSSTFNEYARIDSLGRLGLGTLTPAYLLHLANNGTLALQLEDTSTSTR
                     YRIENTSGDLSFVESGVAERMRIDSSGRLLVGTSTSANRYGIESQLQVSGASRAASSI
                     SLSQTDGASAESGAIYFWSSGRNEVIA"
     gap             21050..21149
                     /estimated_length=unknown
     gene            complement(<21150..21427)
                     /locus_tag="CPVG_00025"
     CDS             complement(<21150..21427)
                     /locus_tag="CPVG_00025"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase/helicase"
                     /protein_id="AET72831.1"
                     /translation="MIQGSPVRLSKRGLSEEVCRKYRIHKDGDVLRFHYYDNSGKVCG
                     AKVKSLDKTFHWEGKNVDHQLFGQNLFPDNGARLTIYEGELDAASGYAA"
     gene            complement(21552..21764)
                     /locus_tag="CPVG_00026"
     CDS             complement(21552..21764)
                     /locus_tag="CPVG_00026"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72832.1"
                     /translation="MIYTPKPFGSKERMRQDFSDILAEVSETYDPCEVADAFLEELDS
                     WAAYHETCKATYESVKAALRKRVSET"
     gene            complement(21846..22211)
                     /locus_tag="CPVG_00027"
     CDS             complement(21846..22211)
                     /locus_tag="CPVG_00027"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="AET72833.1"
                     /translation="MMRSRLEEQVAELLDKLNIEYSYEPDKFSYVIEAKYTPDFKIGD
                     VYLETKGFFKPADRRKMLAVKKCNPDLDIRLVFQAPYNKISKNSKTTYAMWAEKNGFM
                     WCPYYEIPLDWLNEPKEKS"
     gene            complement(22265..22834)
                     /locus_tag="CPVG_00028"
     CDS             complement(22265..22834)
                     /locus_tag="CPVG_00028"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72834.1"
                     /translation="MTTYVTKEPVTLDGYQAILKPSEYGFTLTAMIPKELIDTLQDER
                     EGGLEWARSKTKNPKRAVVNPEPWEEASDGMYQCKFRWKDGDKLIPVVVDTEGTAITD
                     SNLPLYSGSKVKLAFIQKPYALPAGNIGTSLKLKAIQVVSLNTGAGVVDSGDLDAEDA
                     AALFGETKGFKTSEPNPEAAPDTSVDEDF"
     gap             22843..22942
                     /estimated_length=unknown
     gene            complement(<22943..>24628)
                     /locus_tag="CPVG_00029"
     CDS             complement(<22943..>24628)
                     /locus_tag="CPVG_00029"
                     /codon_start=3
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72835.1"
                     /translation="NENNIPGLITEEANQWYDNSIREAERIPDRPPEEEQPSEAATKP
                     SEPEQEGLGLVASETGAALAGGAAQAVESVGGFAELVGDTFKTGFNTLFGRPVDESQN
                     PFSTAYEANDAGWLDIPDEMVPENKTGLGKFARGLVEFGILTAATGGIGGATVGGLGL
                     GARGLAFASAIGIGSKGVRTIKFVQTGARIASEGAIADLVSSSSESENLANLAQEHTP
                     WMAPWLINALAVAPEDNPWLARIKTVGSGAGFNIAAAAVSAFVKGNWAAHRARKNGKS
                     VDEANEIGNKTMREELAKESKAENASVKEMADKNYKEGRGIRGTDPEENFGRRLDPYV
                     NASKYDMAENPVIPAGTARQAAAEGINDMKAGGPGHTYTQMVTDAQLDTIARGNKTVR
                     ELVIKTANELAEEAFKKGGNLEDIGALDYKDLVNLYIRQAVDMTSMIDEGGDIAANFA
                     KYFRENKKDARVYRNDGVEIVTGSPTQKAALNLVINSLAHRASAIANGSMFISDNLPI
                     NRQYDMTVDAMKVALTEHKKMGYMWGLDGQLQQLGSVPKEASAAAKKGLQQID"
     gap             24629..24728
                     /estimated_length=unknown
     gene            complement(24875..25195)
                     /locus_tag="CPVG_00030"
     CDS             complement(24875..25195)
                     /locus_tag="CPVG_00030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72836.1"
                     /translation="MILMSRPDPFGNRVDEVMEWDATDDLTEYTAADGMEAAAMWDLP
                     EAFVCIIRSEAKNGKITEKAYRSIHAARKHVFKCMDKKDRVLILTDSTISIPLIDDDD
                     DQPF"
     gene            complement(25310..25486)
                     /locus_tag="CPVG_00031"
     CDS             complement(25310..25486)
                     /locus_tag="CPVG_00031"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72837.1"
                     /translation="MKRKQINLTETELGIITDALARSWWIRYDPKLEPNVEPHHNLYN
                     RLVSIHATLTEANS"
     gene            complement(25559..25792)
                     /locus_tag="CPVG_00032"
     CDS             complement(25559..25792)
                     /locus_tag="CPVG_00032"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72838.1"
                     /translation="MPEFSPEAQAVLDAYRSNHLSNNNLATALRAVADNCKCDDAYGY
                     WIYRPNILAIAKELEAHCWDTMMGSKLQESSDW"
     gene            complement(25975..26208)
                     /locus_tag="CPVG_00033"
     CDS             complement(25975..26208)
                     /locus_tag="CPVG_00033"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72839.1"
                     /translation="MTTAVIIAMIKPHQTRYQVFYTRGGAACPGSITACEYVTASTSM
                     EAWSKGEALAVGFERVADVVPVNQPPNQHGAES"
     gap             26209..26308
                     /estimated_length=unknown
     gene            <26309..26477
                     /locus_tag="CPVG_00034"
     CDS             <26309..26477
                     /locus_tag="CPVG_00034"
                     /codon_start=2
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72840.1"
                     /translation="PKPTPLPEKVEGEKEPKIKPKTTTAKKRERIRTGTASLQTAPGQ
                     GLNISANVSRT"
     gene            26477..>27661
                     /locus_tag="CPVG_00035"
     CDS             26477..>27661
                     /locus_tag="CPVG_00035"
                     /codon_start=1
                     /transl_table=11
                     /product="head-tail connector protein"
                     /protein_id="AET72841.1"
                     /translation="MKTARQRYHELTSGRTAFLDIALDCAKLTIPTLLMHEETTTDYT
                     RFKTPWQSVGAKGVVTLASKLMLGLLPPSTSFFKLQLDDSKLGVEIPAEAKSELDLSF
                     AKIERMIMESIAASTDRVQIFSAIKHLVVTGNALLYMHKDGMKMYPLNRYVVERDGNG
                     NVTEIVTRERVNRKVLGPEFENPKSMQSVVDSSVGSKFEKDVDVFTCIKLTKKGWSWY
                     QEADDKILPNSYGKAPKDKSPWLPLRFVTVDGEDYGRSRVEEFLGDLRSLEALMQALV
                     EGSAAAAKVVFTVSPSSTTKPQSLANAGNGAIIQGRPDDIGVVQVQKQADFRTAFDLA
                     GVLEKRISEAFLILNVRQSERTTAEEVRMTQMELEQQLGGLFSLLTSEFLIPYLNRKM
                     LDL"
     gap             27662..27761
                     /estimated_length=unknown
     gene            complement(27793..28026)
                     /locus_tag="CPVG_00036"
     CDS             complement(27793..28026)
                     /locus_tag="CPVG_00036"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72842.1"
                     /translation="MRKEHKSPTGGLTAKGRKYFKNKEGADLKPPAPNPRTKKDAGRK
                     RSFCARMGGVKGPMKDSKGRPTRKALALRKWKC"
     gene            complement(28279..>28963)
                     /locus_tag="CPVG_00037"
     CDS             complement(28279..>28963)
                     /locus_tag="CPVG_00037"
                     /codon_start=2
                     /transl_table=11
                     /product="capsid assembly protein"
                     /protein_id="AET72843.1"
                     /translation="SGDDEEYDSDVEYESDEEQVEGDFERYDEEGYVNQDAVAQAYGE
                     GLAEAFAEANIDPWAMNDYFYENDGTLTEEMYDQLNEAGFSDETIDAYLGGLRSELGY
                     DDAVNVLSESEVNNIKDIAGGEEGYAQVVQWASENLPEEDIEAFDEVINTANEAAVRF
                     AVKALVGQYEDAVGRTPELVTGKQSSTGQAYRSMAEVVRDMSDPRYDNDDAYRMDVMR
                     KLERSNIKV"
     gap             28964..29063
                     /estimated_length=unknown
     gene            29072..30165
                     /locus_tag="CPVG_00038"
                     /note="major capsid protein; frameshift"
                     /pseudo
     gap             30166..30265
                     /estimated_length=unknown
     gene            <30266..31153
                     /locus_tag="CPVG_00039"
     CDS             <30266..31153
                     /locus_tag="CPVG_00039"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72844.1"
                     /translation="DIRTLLNYTTRIESSNPTLISRQTIGRITINWITSSRTACLQTS
                     KGETSDVRTAITTEHRLSLSSSSRVNKAATDRLTDNREVRYRNIDWKGFLINSRNHID
                     NITSISRSYSILNCPFRVDDAVPIKAIITVFRVNVNNTRLCSKCTTRSNTNPSRTIPN
                     RKGVIRRLLKPRLTYFPVTTSRGGVRDNSVKPLRGCSSSEQVSISRTRCASILLRLSD
                     DVYIFNLRKINTTVSNAKLYITVSRTVNGDRIAISNTRCSNFNNTSLASSTLISRNGD
                     LLVRVSTASSISKVDSLAF"
     gap             31330..31429
                     /estimated_length=unknown
     gene            complement(<31430..31576)
                     /locus_tag="CPVG_00040"
     CDS             complement(<31430..31576)
                     /locus_tag="CPVG_00040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72845.1"
                     /translation="MSTNDREGGDSFPFLFSTIINDSNDCNLLQVFVFKLATEFVSVI
                     ILLNK"
     gene            complement(31566..31823)
                     /locus_tag="CPVG_00041"
     CDS             complement(31566..31823)
                     /locus_tag="CPVG_00041"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72846.1"
                     /translation="MGFRSTLKSNIKRQLCELSINAVSEVVYNYIKHNPGSRLCEVSK
                     DLMPHGETSRLFTSHIIKDLVNNGRVVRDDRLKHKPVYYVN"
     gene            complement(31894..>32402)
                     /locus_tag="CPVG_00042"
     CDS             complement(31894..>32402)
                     /locus_tag="CPVG_00042"
                     /codon_start=3
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AET72847.1"
                     /translation="VSDGERGTDWQGLCEFVSQLPAKQLWRHNQAGDLPHDNGDINFS
                     DMVELVLANHGKRGFTYTHHVLNDHNAAIIKAANDHGFTVNVSTESKADAVSAYNQGL
                     PAVCVVPSDHADTAEHEGVKFVTCPAQTNDTMTCSECGLCSQSKRQCVVMFKAHGNAK
                     RHVSELVG"
BASE COUNT         8354 a         6918 c         6996 g         8634 t
ORIGIN      
        1 ctgtaatgtg tacacgcatg tacttaaaca atagctactc tcattgagta gcaatagcta
       61 gggcaggact caaacctgcc tgtaggtctt aacctactag ctcaaacggt gtgctcaaga
      121 gctaactctt gaagagcgtc cataaatgta tgcaagcgat caacctcttg gtcatcaaag
      181 tgtcgcatga tgtcttcatt agtgacagca cgattgaaca gttttaacaa tggtttccac
      241 tcattgtcaa agatgtccat cttaacagca ccaacattgt gttccatgat cctgaaagat
      301 agctactctc attgagtagc aataacaggt agaaggattc gatcctaagc gtcaagcttg
      361 ctacctgtca cccatgatca aacaaagcct gtgggtcggc aattggccac acttagcctg
      421 atgccctggc ggttgggttc agaggtcagc cccttaccaa atccgtgccc ctgggatccc
      481 gcccgacagg tagcacggca gcagtcgcca ctgacgtgaa tgtttattcg gttgtctagg
      541 tgcttgcagc tatcctacag agtcggctgc ccaggttgtg ggtgtcggtt acaaagctta
      601 acaaaggtac tcatcagcct ttggctgtct ccccttgtcg gtcgcttgcc tcccgatgac
      661 ataagtagat cacggatcgg ctcccattac cactaaggtt tggttaaggt ttggttaagg
      721 tttggttaag gtttggttag gggcggacag attttgagag aaatatagga acgtgcctgc
      781 acgcgcgcgt tacatgttag tgccttttcc gtgcctacca gtgcttttgt actacttcag
      841 cgtgctttgt gggcggggca tgggggggta gcgccgggcg cggcgtttta taatagactt
      901 cacaaaatta tgtcaaaatt tttaggcgat tctaaacact caacaacctc agtcgttggt
      961 acaaccaccc atctaacaat ctcaccctct aagaactgaa ccatatacct gtcaggggcg
     1021 ccttcaacgc ccccaacaat agccaatgac aataaaaaac tacacataat tagcaccaca
     1081 tagcttcata gacatcaggc atagtatcat taatcagcat tctacaccct tcagcaatcc
     1141 tacgatgctc taattgggtc tcaggagccg ctctaagggc gatgtaatgc aaccaagacc
     1201 tgatagtacc attcatgtac aaagtcgtgt ctgagcccat tgggaggacc tctcgtgcac
     1261 actctttagc gacaccatct tcaagcatac ctctatagac ttcttgactt agggtataga
     1321 gttcactaat cttctcatgc caatgagctt taatatgaat atccagatca tcaatgctgt
     1381 tctgtctgtt cttaacatcc tgccttctaa ggtaaggagg ggatgggaat gattctactt
     1441 ctgcataccg ttgactaaac tcttggaagg agaatgatct gtgtcttagg atctgagctg
     1501 ctactgctct attggtttta atttctacca ccatattagc catttcaaag ggagaccaat
     1561 gctgatgttt aataaggtat ttaaggagtc gaggggctgt ttctttatta tgttgattag
     1621 tagggttaga cactctagca cagtatgcta tgagttcttc tgcgttaggg gtgatggaaa
     1681 caagacgtac agaatgtgtc actattgtta ggttgtgttg gtagcggtgt ggtgataggt
     1741 aggtggtgag tggatgttgt tcttattgtt accggtacta tatatgagta tacatgagta
     1801 tacatgagta tactaatagt cttattagta gtaagaataa gagtaataat aataagaact
     1861 aatagagaag atggttcagt cgcttcgctc cttcacctca tcttccatta gtagcgattt
     1921 aagaaaagga ggaagtaatg tttgtctttt actccctcct tgaccgctgt ttccacacaa
     1981 gagggcacca ctccccttgt tttatgtggt ggttacgggt tacttgtcta tagaaaccca
     2041 gttatagcct ttgtttttac cgtttaggct cctagctttt tgtctttgag tgtatgtcat
     2101 tccaaagacc atgtgattag ctgctgattg ggggtcatct aaccaagctt gttcaaggtc
     2161 ttgccattct tcaaacttac gtttagctat ctcatggtta gcggagatag ccatagcatc
     2221 tgtaaagtac ttaacgcctt gagctaggga gtctaatcta tcgtcgtgtt taactgcgcc
     2281 tttttcacgg cacattctac tcatttggta gaagagcatg tagaggaggc gttcttcagg
     2341 tggagaggtg gggttggatt taaaatccca ctcgataaca gagcgatcca taacaaggcg
     2401 atgctgatta aggacaggtt ccagggcatc aataattctg tcttctttac ggacattagc
     2461 tctaacttct tcgatgtcaa tgttttgttt agtttggatg aggtgttttt taaagagttc
     2521 agagacgata ccatcaccaa agtttgtttc tatgagtaat ttagtgactt tatacttttt
     2581 acaacctctt agtatgtcca agagtgtatt atcactatat ccttctctgt aagcacgcat
     2641 ttcatgcacg tacaggaaac cgtttcgctg ggagatataa gttgctgctg tttcatctgt
     2701 gccacgaccc gacggatcaa tgctgcagat tgtttcggag tagggatccc agtttccttg
     2761 gagctgcata ggactgtaga aatagtctcc agggagccca acagtgggga ggtctttgat
     2821 aatgttttgg gggtctgagc accagacaac tgactcagga gcagtactag ggttgacgct
     2881 ggtaacgaca agatcagcca ttttaagggg gaacttttca gcatcactaa gggttgtgtc
     2941 cagcatgaat tgtagcatga aattgctacg tcccatagct gcttcacgtt cgataagatc
     3001 ttcatcatta aatcgtgcgg ggtctgttac tgtccaggga tcagctccat tttctatgtc
     3061 ttctgctagt tgaggagcta ggagtccttc gtagttagct agttttttag ggtatctagc
     3121 aggccaaaca aagggtctgt agttacgttc tgctagttta cgatagattg tgaaggttgt
     3181 ctgaggtgta cccagaaaca taattctaga atcagcatga ggtgtcaaga tagattctgt
     3241 ttcagtgcag agctgtagga gtttttctct catgagttct gtcattgagt tacctggcac
     3301 ttctacgtca tcaagaatca tgagatctgc gcggctacca gtaagctgac cagtaatacc
     3361 aacagactta actgaaggag cttggtgagg tttagccggt ccaacatcga acgagactcg
     3421 tgaccatcgt tgatcatctg atttaggttt aaggtgtcca agccaagtta cttctagaat
     3481 aaggcgttga caaaaaatag aaaaggagtc tgctctatcc ttagaagcag ataccaccat
     3541 aatttttttg tcagggttat taaaaagggt ccagagcaca aaggctgctg taatccagct
     3601 tttaccaaca ccacgaaagg cttggatttg taaacgttta ggtccgtgtt gaaggtattc
     3661 tgcgatgcag agttgagccc gtgttggttg tggtagtttg aggtgagccc agatagcggt
     3721 aaggaaatat ctgaagtctg atctaaggtt agcctcaaga tcgtttgtat gcatgttatg
     3781 taactctcta tgagtggtgt ctagaagcgc ctgtaagggg cctctagggt gtgttaggta
     3841 ggatgacacc ctagaggagt tttaagagcc ttctagaggc ttttaagcgc taccacgatt
     3901 ataggtagct tgaccttctt tacgaagggt cttgtttttc ttttgcttag ccagataacg
     3961 gcgagcttct ttaccaattg cttggtcttt atacttatca gcagagtatt tacgtgccca
     4021 aatcatacgc ccttcttctg cagtagcagc ccttttacga ggggcaggct tgggagcagg
     4081 cttaggggaa ggtttggggg cagaagcaga ggcggaggtt acgttacggc ggggtttctg
     4141 agatgaagtt gcagaagctt tagcccgact acgtgccatt tgaccttcag tctgcctacc
     4201 cataaaattc atttttgcaa tatcacgctg ggtagatgcg ttgataaatt cagttccggt
     4261 gtaaatttgt ttttgacctt ttacataccg aatatcgcct ggtttaggct gagtgcttga
     4321 agaacgacgg gctttattgc cttgtccacc accagcaccg cgacgaacaa caggtttacg
     4381 ggtagctctt ccagcagctt gagatttacg gcgttgtgat ccagtttgac gagccatgat
     4441 aaattactta agtttagtgt tgtatttttt accgcgccaa gtaaatgtag acttacctgt
     4501 tttgcgtgct gcagcaaatg cacggtcaaa atctttagct gcagaagacg ttgctttagg
     4561 tttaggagca gattttgctt ttaactttag gtttttgatt gtttggacga ctaaccnnnn
     4621 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     4681 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnctct atagcttctt tgttagaaac
     4741 tactcgacca ttaataacag tagggatgtt gataaacatt ccatcagctt caattccaat
     4801 ggtacgaaca gtactgaatg aaccatcttc attttgaata ggttttttaa tttttaaatc
     4861 gatgtttcct ttaattgggc tcattcttgg cagtcacagg taagttcttc attcaagatt
     4921 tctgcaagat aatcatcgac atcctcttga agagctgcat atacatcaga cttatcttga
     4981 gtgtcgccca ttacttgcag gctgtagtaa agagaagtct gggggctttt cagccactct
     5041 tcaataaagg cattgtcgta ggtgacaata tcgctccaac tgttgaagct atacccgtga
     5101 agaagcccag ttcggttaag tagagtcatg atgccatcag caacacgttt gtaagcttcc
     5161 cagcctactt tagaggcgat ctctacatca ccatagttgt atgtttgtac tccgaaagta
     5221 ccgctgtcac gatcgactgt ctgcgagata ggtggagcga tttctggtgt gcaagtatag
     5281 ccatccagat ctgtgcttcg ataactgcag gaggcagtgg gcgcaatagc aaaggctcga
     5341 accatattat ggctgcgagc aatgctggcg gcactttcaa taccagaggc aagctgagat
     5401 acaagctcat aggctgctga gcgtaccaca tctccttcgt tatactgctc caaagcacgc
     5461 ccgaactggt catacgttac tccgtacctt cgtaggaggt tggcaagtcc aagcattcca
     5521 agtcccactt gtcgatctgt ttctggggag aggtattctc cgttatcagc gacaccagtt
     5581 ctagcgtgga gggcacacaa ctcttgcata ccctgaacga aagcttttgg aatgtcatca
     5641 aattcacatg ctccaaggtt gatatgttgt aggaggcatg ttccacgtga gggcagatat
     5701 acttcgagac agacgttacc tcggattcgg tttccttcat tgtcatactt tactttgttg
     5761 agccagatgt cgccggattt aattccgtaa aggagttggt ctttgaagtc acaagcttcc
     5821 caccactctg gggtgatgtt gatgcatcgt ttgacccacg gaagttcgct acgattcgca
     5881 gtaatgaact gaagagcatc agggtggtta acatcaaggt gacataccac agcaccattt
     5941 ttgtagatgc caccacgtcg aaggatttca ttgagtgttg aatagatttt tgcaaaggat
     6001 accggaccgc tagcagtcac gccagagggc ctctcgtgcc cctgggggtc gagcttagaa
     6061 aggtgaacgg cgcagcctgc accataacgc agtgcatggc ttacaaagcg ccaagatgct
     6121 tcgataccgt ttggaccttc catctcattc tcaactacaa acactgtgca gctgactgga
     6181 aggcgtgagg ttggatcgtc aatccaggac tggacacgac cggtgcgagc gatcaactca
     6241 gtagacattt ttatactaga tcagttaggt taggtggttg gtagttagga cctttgagaa
     6301 ctttaccgtc ctctctatag ataggtttac catcctctcc aagtttactc atgttggagt
     6361 gatgaacccg acgcatagct tcttcaaggt cccattcttg ggaagctgca tactggaaac
     6421 aaacgtagac taaatcagct aattctttga gctggtcttc ttttccatga aagtggtaag
     6481 cttcatgaaa ctctgaccat tcctcatcga tcaaagcttt gtctttctcc ctcccattcg
     6541 tcccagattg aatttgaaac gcagaacgga actcctccgc ttggtccatc agactcgtgt
     6601 gtatgtaaga gttcattttc aaggtagtga atagcttttt ttagatcatc tgctttgctg
     6661 tgcttgaacc cagctctgca gatatattta attgcattac ctagatggta gttgagttgc
     6721 tggtctcgga taaaatccca aacctctatt gagcctctgg tgtaatgagt gggtgagtcg
     6781 gccatttttt aattagattt gcaacggtgt tacagagtac aaaattttga tgctgtaaag
     6841 cttcaaagac agtaataatg tcttctttag aagcttcctg taatgtatct tttagtctcc
     6901 tcagtttaaa ctgttgctcc atggtcagct ctatcaccgg gggtgggggc aggctgccag
     6961 agaatcggct gtccgagttg gtagtcatag ttttctttct gaaggatttt agcaagcctt
     7021 gcattaagca gagcatcatc gtctgacaac cctcgctctc tgtaggcttg acacacagct
     7081 tcccatggaa agtcgtgatt gtcaactaaa tcagctgctc tcttgactcc aataccagga
     7141 cagccagggt aaccatctgt agggtcacca gctagtgact ggattaagtg ccaacgatcg
     7201 ccattttccc tagtgatctc ttgtacatca cctttcatgt cccagtacaa gccagggatt
     7261 tgaagcatgt ccttatcagg acttacaagg attggctgtt caagtgcata catggtagca
     7321 tcaataccaa gagagtcatc agcctcaaga cccttacgag tcactgtgtt gtaattctct
     7381 atgcaccagt ttaccaaacg tttgtacccc aaaggtttac gtctattgcg atgacctttg
     7441 taatctgggt agattttttt cctgtaaatt ctcaggactt gagaaataaa ggatgatgtt
     7501 atcatccatc atatccatcc tgattttatt cagctcacgc tcaaagatct tcagaacttc
     7561 actaaagttg gatctagaga tgatgacatc atcaccaaaa tcaatccctt cttcagatgc
     7621 ttgagctgct ttgtaagcaa tgtagtcggt gtcaattaaa agcattagtg tacttgagcc
     7681 cagttatcac ctacctttgc gtctgcatca ataggaatcc tgagtctata ataatcacca
     7741 gccattgcag ctgatgtggt gcagattgat gcaacctgat cggctacatc gggaggacaa
     7801 ccaagagctt gctcgtcatg aataaaggcg tacctttcat gctcgatgcc ttggagtcta
     7861 tcgtgggtaa tcaagagcca ccgctttgcg atgactcctg cagacgattg tagtagaaag
     7921 ttcagcgcct tgtgtggcga gttaacgagg atcttacgac cgtcgatagc tcgtagggaa
     7981 cgatccacct tcgccttcgt cttgaccgcc tcaacgaggc gctccaagcc cggaatggca
     8041 tcaagatacg ctctacggat ctccgcgcct ttcttacgag cctgatcttc agtaagctgt
     8101 gaatcataac ttgtaccaat ttttacatcg gacgctccat acaggaatgc atacgtgaca
     8161 gtcttcacag ccctacggct gatcccaatc ttgtctgcat tgacctgatg gatgtcatca
     8221 ttcagaagga tgtccgcata gcgtccttca tcgtagcgtc ctagataatg agcaaacacc
     8281 cgaagctcaa taccagccag atcactatcc accaacttcc aaccaggacg tgtgatgaat
     8341 agttcccgac aatcagcgtc actacttacc tgagcaaggt ttggacgtgc atgagccata
     8401 cgatgggtgg cagctcctat aaagcaagag tgatgaagcc tgccattctt gaccaacttc
     8461 aaccacgcat tactgccttg tgatagcatt cctagttttt tctgtgtctc taggatnnnn
     8521 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     8581 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnntatc ccgtttgctg accttacgtc
     8641 tgacgtagtg gttggttggg tcaaagaaaa gcttggtggt gatgagaagg ttgcagaaat
     8701 tgaagctgca ctgcaagcac aacttgatga gcaacgcact cccaccaagg catctggtct
     8761 gccctggtct gcctgattta aacttattgg agaataacaa tgatcaccct tatccgtcca
     8821 attctttttt cttttcttca atctcaaagt gtcaaactac ttatcgtaga tttgcttgct
     8881 aaacttgctg agtctaccga taatgacatc gacgacaaag cagttgaatt tgttcgtaac
     8941 ggtctttttt caaactcgtg actatcgaca atatcttaac gcatcctgga tattataata
     9001 ctccaggtaa tgcttatact gttttaacag gtgatactta cactagccaa gttttgtcta
     9061 gtcattgtcg tagagtaagt cttcatgcta acggtcattc tatttatttt aagttaaata
     9121 gtggtactgg tgagcattac ataaaaacag atgaacgtat ttacattact gttcctgaaa
     9181 actccactct tcatgtaaag acaacacaaa gtaacagtgg tacatgctac attagtgaat
     9241 atgagtggta gcacctgact ctagcaagcc ttttgtaaaa tgattgaagc agtcgtatct
     9301 gctaccttag ctgcactagc ggcaggtgca gctttaacta acagaataca caatagaata
     9361 aacgatatgg atcaacgtct tgatacattt gagctacgtg ttgcaacaca atatgttcca
     9421 aaacaagatt ttgacactgc aatgcaaaaa atggaagatc acatgatccg tattgagact
     9481 aaacttgacc aaatgctatt aaaaaatggc taaaaaccgt gctaatgaag acgtatttaa
     9541 cgaacttcat aatctaatta cacgggagtt tttagcacgc attaaatctg gtgaagcaac
     9601 tacacaggac cttaaagcag cctgtgattg gttagctaaa aatgatatta ctggtgtagc
     9661 cgttgagggt tctgctctca gcggtcttgc tgatattatg cctaccattg attttgatga
     9721 agtacaacga gcaatccgac gctaatggct cctcgtaaaa aaccttattc ccaactgaag
     9781 aaaagtgcga agaattaccg cgacaatgca gccgctaggc gtcacaagta cgcgaaggct
     9841 gtcaaagatg gtcaatcaga atctgctacc caatacagag tcaagcacac caaagcccgc
     9901 agagacgccg gtgtctacgg taaagggggc aaagacttct cccaaaccac gaagggcacg
     9961 tttgtccgcg aagacccgtc taaaaaccga gcaaggaaca gagcaaagct aaaaattaag
    10021 ccatgactcc gttacttcct agtcctgatc actaccttta caacctaata accatgacat
    10081 ccccagaagc taaacgccta tggaggcgtg ctattaaaga gcactttaac tgtcaatgcg
    10141 tttattgtgg agaaacttat gaactacatg aacttactct tgaccacgtt caccctcgtt
    10201 ctttgggtgg agaagatctt actagtaaca ttgtaccagc gtgttcccgc tgcaatcagg
    10261 ataaaggaag taacaactgg cttacatgga tgagacaaac ttttggtttt catccccaac
    10321 gtgaacaact tatcttatca cacattaaat aatggctgac aacagagacc cacgaaaaaa
    10381 gtcacgcact aaccgtaatc gtcgtactag ctcttctaac cgagctgcac gttcaagagc
    10441 atcagcagct gataccccac gtcctacttc ttcacaaaca cgttctagcc gtacgtctgg
    10501 gcgtgctgtg gtaactcaaa gcggcgcaca aggtcaacgt cgaggagcac aaggaccacg
    10561 tagtgcgcct gttcaaggtc cttcacgacg tacacctagt gctattacag gagatacagg
    10621 tcgtcggggt cgaaggaatc aaccggctaa acctaaaagt aatgtcccac gtccacaagc
    10681 acgtggcgat aaacttcctt cttcttctgg agcacgaagg gttgcaggtg cagccgcccg
    10741 tggagcaggg gttgcaggag gggctggctt gctgccttcc ttggcgcgag ctggtcttat
    10801 gatccttgag aaggtgctgt acgannnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    10861 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    10921 nnnnaggatc tgcttatgca gaagggttcc gtatgtttaa atacaactgg gatctaggct
    10981 taaatcgtaa atctcttagc tatgaaggta agtttgatct tgaagctgat ctagctgaat
    11041 ggcaaggatt gggtcaatat tacgataggt acggtactgg cattgaaaag cgtggctatg
    11101 acgttcttga ccgtattgtt aaaatgaaca ccagtccgtg gtttaaatat agccaaaatg
    11161 ctatgggtgc tggtgatgcc ctggctcgta ctattattgg acgcatggaa atgcgtatgc
    11221 gagcagctcg tgcagcttta gataaaggag tcgatccctc tgatatcaaa aagtatgtac
    11281 gtgaaacaga agaagacttt aggaatcaga tctttaaaaa agataaaaat ggtcgttaca
    11341 ttgtaaaaga caaagctgcc aaaatggctg gtgatgaggc tgcaatgaca cgggcattgg
    11401 aagaaaactt taaaggattt gaacttattt ctaacattcc ggggatgaaa gccttcttcc
    11461 cgtttgtccg tacaggtttt aatgctcttg atcttacttt ccagcacact cctttggcaa
    11521 tctggaggga taaatataaa gatattatga gaggtaagaa ccttcaaaag tatggtattc
    11581 gtcctgaaga ccttcctcaa gcacaagctt tgatggaagg acggattgca atgggctcta
    11641 ctattatagg tatggctact tttgcagctc tatctggtaa aatgactggt gattatccat
    11701 ataccaaaga ggaccgtgac gcatggcaag cagcaggcat ccaacctaac tcctttaagt
    11761 tgggcaatac atatgtatct taccagaaca ttgaaccatt caacactctt ttgtcagcgg
    11821 cagctaatgt cgttcaaaac tctgacattt tgggtgaaga ggttactgat aacatgatca
    11881 aaaagcttac atttatgaca gctgctgttc ttgttgataa gtcaatgttg gctggtattg
    11941 agagccttgc taatattatg agtgctgata cctcagagga agagcttaag agaactggtg
    12001 cacagctatt gcgcgctcat ttcccttatg ccggtcttct aggtcagtta ggtgatgtca
    12061 ttgatgctaa ccgtaaagaa gcagaaacgt ttatggaact tgtgattcgt cgtgatgcat
    12121 ttatgaagag ttctttgccg cctaaatacg atattttgaa taaagatcgt agcggtaagc
    12181 ctctacaaat gggggctatg aatcctttac tacgtctgct taatgctggt agccctattg
    12241 ctattgtaga cgttgaggat gatcctatca gacaaggcat agttgagatg aggtacaacc
    12301 tacctgagat gctgtctcaa tacaaaggtg agccacttaa tgcttatgag cagtctcagc
    12361 ttagcaaata catgtcaatg ggtgatctga gaagtaggct tgaaaaagtt atggttactg
    12421 acaaagcttg gagacgagga cttgattttt ataaagatca gaatctcact atccaaacag
    12481 gctataaact ttaccagcaa aaattctatc agctagttga tcaagaattt actcgtgcta
    12541 aaaatctagc aatgattaaa ttgcgtcgag aaaacaaaga tcttgataag cgtatccaaa
    12601 cacgagagtt gaaaacagct gctagcaagg ctggtaacta tgaagctatg cgtagactta
    12661 gcacaccaga agggcgtacc gagtttccac gataaccaca ctctaaacta ccctaaacaa
    12721 tggcagttac aagacaagat tacacccaag cagggtctac aattacatac gtcgtacctt
    12781 tcgaggtcat tgaagccact gatattgacg tttatgtcaa taacgtactt caactacaac
    12841 agaatactac ttctactgcc gatgcaactc atccccaggt tatttctggg gagattactc
    12901 aaggcaccgc tctaactaac tacacagttg catctaataa cggtacaatt acatttaatg
    12961 ctgtacttac cgctggtgat tacatcgttg ttgaacgtac tactgatgat gcagnnnnnn
    13021 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    13081 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnccttgc tgcagggtta tgatgagatc
    13141 gtactgttct ttgacagtga tgagcctggt cgtaaagctg ctgaggagtg tgctcagatc
    13201 ttgcctcctg gtaaggtcaa gattgcacgc atggagaagt acaaggacgc ttctgatgct
    13261 ttacaagcta acgatccaga agctatccga cgagctgtat gggatgcaaa gacctatcgt
    13321 cctgatggta ttgttgatgc caagacccta cttgatctgc taaccacacc tgaagaacca
    13381 tgtgctcatg agtacccatt tcaaggatta caatcaaagc ttcacgggat cagatatgga
    13441 gagcttgtta caatcactgc aggatctggt atcggtaaat cctcattctg tcgtgacctt
    13501 gcaactcacc ttcttaacaa aggagaacga gtcggttacg tggcgttgga agaatccaac
    13561 cgtcgtacag ccttaggctt gatgtctgct gctgttggta aatcactaca tctaggagaa
    13621 catgatcgaa ctactctcac caaagcgtat caagattcta ttgctaattg gaatctcttt
    13681 ctttttgatg ggtttggtct tttgatcctg atgtcattta caacagaatt gagtaccttg
    13741 ccaccggtct tgaggtgcgc tgtgtattcc ttgatcacct cagcatcctc ttgtcagggc
    13801 ttgatggtga tgaacggcgc atgattgaca cgacaatgac acgcttacgt tcacttgttg
    13861 agcgtacagg tattgcattg tttcttgttt cccatctacg acgtacatca tctgatcaaa
    13921 accatgaaga gggagcccgt gttacgttgg gacagctgcg tggaagtgca gcaattgcac
    13981 aactatctga cggagttatc gcactcgaac gagatcaaca gagtggaggc aaacactctg
    14041 atacgactgt tagagtcctc aagaataggt attctgggga agttggcgta gcctgtaacc
    14101 ttacttatga cctttccact tgtaaatttg atgaaactga aatcgaagaa gagttcgaac
    14161 caacaacaga cttctgagtt tgttcaccct tggtatgaat atgttaatcg tcccaaccct
    14221 cctactgctg aatccattga acgtgctaag tttgttgaca agacgtatgt ctggaaaaac
    14281 tcgtgaaatt agcgtatgat atcgaaacgg acggatttga ctcaacgacg attcactgcc
    14341 ttgttacaca agatcttgtt accggtcagg tatgtgagta caatgatcga ggaggcgatt
    14401 gtcgtactat ttctactggg atttcttttc ttgcagaggc tgacctcatc gttgcacaca
    14461 acggtatcgg gtatgacaca ccacaaatca aaaaacactt acccttggtt tgaccaccat
    14521 catcaaatag acacactcat cctgagtcga ttctttcatc ctgacttact tgacatagat
    14581 ttgaggaaga aatggactat gatgcctgct aagctgtatg ggtcacacag cctggaggct
    14641 tggggttatc gacttaagtg tcacaaagat gattttggta agcaagctga ctgggggcat
    14701 tggtctccag agatgcaagc ttactgtgta caagatgtca ctgttctcgt aaaactatgg
    14761 aatcacttcc aaaaatacct ggaccagtaa ccttagagca tcagattgca caactgatgg
    14821 tctctcagga ggctgtagga tggccttttg atgtacgtgc tgcccaagag ctagagaaca
    14881 cccttttgac acacttagag cgccttagag agaccgctca gagcctttgc tgggctgtgc
    14941 ctggtgacga gttcacgcca aaacgtgata acaagactca aggctatata aagtctgcca
    15001 gcatgactcg tgtcaaagag ttcaacccaa gtagtaggaa tcacatctct cactacttca
    15061 aatggcatca aggttatgag ttcaagaagc tcannnnnnn nnnnnnnnnn nnnnnnnnnn
    15121 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    15181 nnnnnnnnnn nnnttcctga cctaaacatc agtaccattg aacagtactg tgaggcttat
    15241 ccatccgatc cccaatgcaa atgctatgat gtttaacccg ctgacacaga tcgagattga
    15301 caatcttgat gagcaccaat actccatgtt cttagcttat ggcgacacct tcacagatcc
    15361 aaagacaagt caagttggag gaagaggcgt tgagttgtgg gaaggagaag cttcacgact
    15421 cattgcagag gcttcaagag agaagctatg catcagcaag tgtgtatgga acagcaagta
    15481 tctcagcggc actacctgat gtcatagaga gtgttgaagt tgagttaaag aagcttcgta
    15541 agggtcaggc gggtcagtat tacaagccag tgtctgagca cattgataat cttgagtcat
    15601 tagctattgc tactatcgct ctcaaggtta cctttgattt agtgttcagc atgaaacgta
    15661 atgcagatct actcaccaat gtattggtgt ccattggctc tgctcttgag gctgagtgta
    15721 agttcaggtg gtacaagaag aaccatcctg gtcttatgaa gtacgttgaa gataagtact
    15781 atcatgagtc atgtggtact gaacagaaac aagcaattgc ttctgttatc tttggtcgta
    15841 agaacattca ttggcctacg tggcacatca aaacacgagc gtctcttggg gcttggtgtc
    15901 ttgatcgagt catgagcacc actggatggt tcgagaagag ccttgagaag cggggggaag
    15961 cgtatgctga cccgtgttgt acctacgcct actttcatgg aggtcagaga ccagctcatc
    16021 agcactgctg agatgttttc cggcattcca tggcctatgc ttgtggaacc taatgactgg
    16081 acaaacgaaa ggtcaggagg gtacctcaca aacgagctaa tgcggggtca tgagctgact
    16141 cgacgcggta accaccacat aaaacacggg gaaacaccgc tgaggttttt tgaacaagct
    16201 tcagaaggtg agatactgtg tcaaccctca tgtcttagaa gttgctaagc acttccagga
    16261 gaggggggtg aagattggta agttcattcc attgtgtgaa gcgtacaagc ctcctaaacc
    16321 tcctgacatt gaggagaatg atgaagctag acaatcctgg aaacgggaga tggctgagtc
    16381 atacaatgct gatcgactga acttcaagag atcagtaaga acaagaactc agctagaagc
    16441 agctgagaag tttaaggatg aatgctattt cctttgttgg tcttttgatt atcgaggaag
    16501 agcgtatcct attcctgcac acttaacacc tcaagataca gactttggta aaagcctgat
    16561 aaggtttgct gacgagtctt ttgttacacc tgaatcagag gagtggttag cttttcaagt
    16621 tgctactacc tttggtctag acaaagctac aatggctgag cgtctggagt gggtgaagaa
    16681 caaccatgac ttgatcacaa agatcgctac cgatcccata gacaatcttc ctgaatggga
    16741 gggtgtcgaa gaaccatggc aattcatggc agcatgtcat gagtattacc actgctgtat
    16801 tgaatgtgat aaacagcata ctggtctgat ggttgctgtt gatgctacct gttctggtct
    16861 acagattctt gcaggtcttg ctaaagatca atcaactgct agtcttgtta atgtttgtcc
    16921 aggtgacaaa ccttctgatg cttacaaagc agtggctgag gaagctaaga agcatcttcc
    16981 tagtgagatg gcatccttgg atgacaagaa agaccaccaa gcgtaccgtc atgaccatcc
    17041 catacaatgc aaccaagtcg tcatcatgga cgtacatcaa ggaagcattg attgagcaag
    17101 gttttgatcc tactaaggat caggtctctc aagtagtgga ctgctgtcta tcaaagtatg
    17161 gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    17221 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn naaacaacac cacacctttt
    17281 tggaaaggta cagcgtggtt taggaaagca ggtttgacat cagaagctgc aatatcaatt
    17341 ggatctgcag cactaacagt aatagcagag ttaacgaaaa agttaaagta atcagcaggt
    17401 tgactaagaa caacattttc gctagtaata aagcctagcc tgttattaaa gaaaaagatg
    17461 tcattaatag actgaccaac aaacgttggc atggggttcg ttactgcatc tccaactgct
    17521 cgatccttcc aaaaattttc gctagaactt tggctgacat catctagttt ggagaaagtg
    17581 aatgtaccgt cacggttatt gattaatgcg tgaggcattg agtcataatc aaaccctgca
    17641 tcaataccag gagcaacagt ctcttcccat acacctgaac cagatgtacc agattcagct
    17701 ataaacttta cgtaataatc atctgcttca gattgatccg tgttagacac tttacaaatg
    17761 taaccatcct tacacataga aggaagttta ctgatgttct gtgcagtaga agtgatgaca
    17821 gaaagggcag tgtctgtagt acctgcacga gtggtgacgt taaggctaga gctggattga
    17881 ataaacaatc cattaccaat aatctcaaca gtcaatgtgg gatagactgc aagtaaagag
    17941 tctttcaacc cgcctaggac tgcattaaca ctaatcaatc cttcatcagg atttttagga
    18001 gtacggtaga atgcagcatt agcatctgca tacgattgat actccagggt atcattgata
    18061 ctaactgtgt agtttctacc agcaatgctg attgtctgtg taccagtagc aggagcatct
    18121 aatccaccat cttgaagtac tacttcagca gtgtagcgcg tatcgtattc agcatttgta
    18181 tcaggattac tctgataacc acttacataa gtaaaaccat taacagctac tgcatattta
    18241 actccacccc agctagagtt aaaaaactct gctttaccgg catattgtac ttctggagca
    18301 ccgtcatcaa agttatcagg gcttatgcta agagacttga caatacgttt agtacttgaa
    18361 gttatgctag aggtgttaat cccaataaca tactcagtat tataagcaat agcatcaacg
    18421 gtaacaaaag catagttact accaaaagta ttggatgtag ttctagcagt ggctacagtc
    18481 ttagctggat tagtgattat agtatagtca ccaacacttt gaataccata acgagaaggg
    18541 gatccatcag ttaggtagtt ataattagaa gtggtagatc caaaattaac agtctgctca
    18601 gttcctgttg ctagatccca tacacgaata ccagaagatt ggatctgaac aagatacttc
    18661 tcatcattat cacgaagaat ctcaaaccac ttaccatcag cggttgcgtt ggaaagaatg
    18721 ctaacaaact caccaggagc acgtttagat aatccaaacg taacgtcagg ataggcattg
    18781 tcacacgtcc tgacttgacc tgggaactta ataaaatctg gttgttgtga gatacctccc
    18841 aggaagttag ggatacgttg attgactgct gccattatcg actcagggct tggaagggtt
    18901 tgtagctagt gtaagggttc ctaagatcac ttgcattgaa cacattgtaa tcagcttggc
    18961 tggtatcaaa ctcaatagct acagccctca gaacgctttc ttcagcctga aggatcttaa
    19021 tgctagtctc atcatttacc atacgcccag aggcgattct agcagcctta gcggtgatgt
    19081 aatcacggaa tgcttgaggg atgtcctcaa actcaaagaa ccatactaca tcaacatata
    19141 aagtgtnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    19201 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnntatt ctggttgatg
    19261 gctcccttcc ctcagcttct agcccactcc gtagctttgt tgttgatagc ttcactcaga
    19321 tctgccttga tggtcctggg tgtttggtta ctaataacgg ctatgcacag cttgttagct
    19381 tctttggtac gttctgtcat taccacacta aagcacttaa tggtggtcaa gccaacctta
    19441 ccaacagtac aactgatttt ggtaggtatg gtttgattgc tgatggtaag agttcttctg
    19501 ctatctttac gtcaacagct aatggagcag caagtgctgg tgacattacc tttgctatta
    19561 acgaacctac tgataactgg tttggtactt ctacacgtcc actggacaac atgcttgttc
    19621 agattggtag tgacatttat gagatcctgt cttctagccc taatggtctt ggttggaacg
    19681 ttaccatcag taaccctaac ccagctaacc gtgcagagaa tctaggtctt gataatcctc
    19741 acgctaatgg tgttgctgtt agcttcttcc tgcaatcctt tgttagtact tctagtcata
    19801 cctttgaata tgctggtact ggtacagatt accgtgcatt gccacaaaat ggtggtgtag
    19861 cgattgaagc taatcaagtt attagtcgta atgatggtcg tgtctggctt tctagtactg
    19921 atcagaatgg taagtttaaa gttggtgata cgtttgaagt taatcaacgt actggttttg
    19981 ttaccattga tcctcagtcg gtagctacta ttgttatctc ggactcgact ccacaacttg
    20041 gtggtgatct tgatgtactt gataagagaa tttatagttc tagtggtaat gttcatgtca
    20101 atgatacgtt agaggttaac cttggttctg cttctaatcc agccattact tttaatggcg
    20161 acactaatac tggcctctat tcacctggag cagaccaagt agccatctcg actgctggtt
    20221 ccgaaaaact cctcatcaca tcggacggga agctgggtct ggggaccagt tcgcctgata
    20281 gcaacttgtc catcggcaac acgaatgcaa actatagaat tgatattgct gacgaaaggg
    20341 cttatattgg atataataca acctacggct cttcgggagc cttgtaccta gatggcggcg
    20401 ctggtgctac caaagatata attctgcaac ctgttagcac aggcaacgtc ggcatcggca
    20461 cgtcgagtcc tggctcaacc ttatccgtaa gacaggcagc agcgcatttc ggtgttgccc
    20521 gtataacacg cccagacagt gacactgcat gtttgtattt aggtaatgac accgataata
    20581 atgctttaat ttcctccaac aatactgcat taaggtttgg caaagtcgta tcaagtacat
    20641 tcaatgaata cgcccgcatc gacagcttgg gtcgcttagg tctggggacc ctcacgcctg
    20701 cctatttgct tcacctagca aataatggca cactcgccct tcaattagaa gacacaagca
    20761 cgtcaactcg ttatcgtatt gagaatacga gtggcgatct ttcttttgta gagagtggtg
    20821 ttgcagagcg gatgcgcatc gacagctcag gcaggctgtt ggtggggact tcgacgagtg
    20881 ctaatagata tggcattgaa tcacagcttc aagtctctgg cgcttccagg gctgcttcaa
    20941 gcattagcct tagtcagaca gatggcgcaa gcgcagagag cggagcgatc tatttctggt
    21001 catcaggacg taacgaagtg atagcttagg tcttattcag tttggaggan nnnnnnnnnn
    21061 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    21121 nnnnnnnnnn nnnnnnnnnn nnnnnnnnng cagcgtagcc agacgcagca tctagctcgc
    21181 cctcataaat ggttaggcgt gcgccattat caggaaacag gttctgacca aacaactggt
    21241 gatcgacatt cttgccttcc cagtgaaatg ttttgtcaag actcttaacc ttggcaccac
    21301 aaaccttacc agaattgtca tagtagtgaa accgcaatac atctccatcc ttatggatgc
    21361 ggtacttacg gcacacctcc tcagacaatc cacgtttgga taatcggact ggagatcctt
    21421 gaatcatagc ggtgtaggta gtggaagtct gctctccatc agcgggttcg tagttgccac
    21481 aggagaagca gtaagcatga ccatcagtat agcgagcgag agcatcactg ctcccgcacg
    21541 aggggcaagg ttcatgtctc tgaaactcgc tttcggaggg cggctttgac agactcatag
    21601 gtggctttac aggtttcgtg gtaggcagcc caactatcta gctcctcaag gaaagcgtca
    21661 gcaacctcac aagggtcgta ggtttctgac acttctgcta aaatgtcaga aaaatcctgc
    21721 ctcatacgtt ctttagagcc aaagggtttt ggagtgtaaa tcatgagcgc ccctgacctc
    21781 gataaggctt gacacccttg agtgggcggc gactcttttt ctttttactt aagtggatct
    21841 tgccactaag acttttcttt aggctcattt aaccaatcaa gagggatttc gtaataagga
    21901 caccacatga agccgttttt ctcagcccac atggcgtagg tggtcttgga gtttttactg
    21961 atcttattgt aaggcgcttg gaagaccagg cgaatgtcaa gatcagggtt acacttcttg
    22021 actgccaaca tcttgcgacg atcagcaggc ttgaagaaac cctttgtctc aaggtacaca
    22081 tccccaatct taaagtcagg agtgtactta gcctcgatga cgtagctgaa cttatcaggt
    22141 tcataactgt actcgatgtt cagcttatct aacaactcag ccacctgttc ttccaggcga
    22201 ctacgcatca aattttaaag taggaatcag ggacaatgta agcgtcgtat agatcatcga
    22261 actctcagaa gtcctcatct acagaagtgt caggagcagc ctcagggttc ggttcagagg
    22321 tcttgaaccc ctttgtctca ccaaacaaag ctgcagcgtc ttcagcgtcc aggtcaccgc
    22381 tatcgacaac accagcacca gtattcagac tgacaacctg aatagcttta agtttgagag
    22441 acgtaccaat gttaccagca gggagtgcgt aaggcttctg aataaaggct agcttcacct
    22501 tactcccact ataaagaggc agattggaat cagtgatggc tgtcccttca gtgtcaacga
    22561 caacaggaat caatttatca ccatctttcc agcggaactt gcattggtac ataccatcgc
    22621 tagcttcttc ccatggttct gggttgacga cagctcgctt agggttcttg gttttgctac
    22681 gagcccattc caaacctccc tcacgctcat cctgaagggt gtcaatgagt tccttaggaa
    22741 tcatagcagt gagggtgaaa ccatactcag aaggcttcag gatggcttga taaccatcca
    22801 gggtgacggg ttctttagtg acgtaagtag tcatttgatg atnnnnnnnn nnnnnnnnnn
    22861 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    22921 nnnnnnnnnn nnnnnnnnnn nncatcaatc tgctgcaagc ctttcttagc agcagcagag
    22981 gcttctttgg gtacagaacc tagttgctgt aattgaccat caagacccca catataaccc
    23041 atcttcttgt gttcagtcaa agctactttc atagcatcaa ctgtcatgtc atactgacgg
    23101 ttaatgggca ggttatcaga aataaacata gagccgttgg caatggctga agctctatga
    23161 gccagagaat tgataacaag gttaagagct gccttttgag taggagatcc tgtaacaatc
    23221 tctacgccat cattacgata aacacgagcg tctttcttgt tttccctaaa atacttagca
    23281 aagttagcag caatatcacc accttcatca atcatggagg tcatgtcaac tgcttggcgg
    23341 atataaaggt tgacaagatc tttgtaatca agcgcaccaa tatcttctag attaccgcct
    23401 tttttgaaag cttcttctgc aagttcatta gcagttttga tgactaactc acgtacagtt
    23461 ttattgccac gagcaatagt atcaagctga gcgtcagtca ccatctgtgt gtaggtatga
    23521 cctggaccac cagctttcat atcgttaatg ccttcagcag cggcttgtct agcagtacct
    23581 gcaggaatga cagggttttc agccatgtca tatttagatg cattaacata gggatctaaa
    23641 cgcctgccaa agttttcttc aggatcagtc cctcgaatac ctctaccctc tttatagttt
    23701 ttatctgcca tttctttgac agaagcattc tcagctttgc tttctttggc aagctcctct
    23761 cgcatggtct tgttgccaat ctcattggct tcatccacag acttaccatt tttacgtgct
    23821 cgatgagcag cccagttgcc tttaacaaaa gcactaacag cagcagcagc tatgttaaaa
    23881 cctgctccag aaccaacggt tttgattcta gctagccaag ggttgtcttc aggagccaca
    23941 gcaagagcgt ttatcagcca aggagccatc caaggagtgt gttcttgggc aaggttagct
    24001 aagttctcac tttcagagct gctagatact agatcagcaa tagcaccttc actagcgatc
    24061 ctagcacctg tttgtacaaa cttaatggtt ctcacacctt tagaaccaat accaatagca
    24121 ctagcaaaag caagaccacg tgcgccaaga ccgagaccac caacagtagc cccgccaata
    24181 ccaccagtag cagcagtgag gatgccgaac tcaaccaagc cacgggcaaa cttacccaga
    24241 ccagttttgt tctcaggcac catttcatct ggaatgtcca accagccagc gtcgttggct
    24301 tcataggctg tgctaaaagg gttttgagat tcatcaacag gacgtccaaa taaagtattg
    24361 aatcctgttt taaatgtatc ccctacaagc tcagcaaatc caccaacact ctctacagcc
    24421 tgtgcagcgc ctccagcaag ggctgcacct gtttctgatg ctaccagtcc caagccttct
    24481 tgttcgggct ctgagggctt tgtagcagcc tctgagggct gttcttcttc tgggggtcga
    24541 tcaggaatcc tttcagcctc acgaatgcta ttgtcatacc attgattagc ttcttctgta
    24601 ataagtcctg gaatgttgtt ctcgttttnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    24661 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    24721 nnnnnnnngg ttgatggaat tcatcacgac ctaccgtaat cttaccaaga agctgcaaga
    24781 ataatcaaga gatgaagggt agtcaggtcg gtagaaaatc tctcctgtgt cataatccac
    24841 atagagatca tctagacaaa gtaagtccgc aagatcagaa gggttgatca tcgtcatcat
    24901 caatcaaagg aattgaaatg gttgaatcgg tgagaattaa gactctatcc tttttatcca
    24961 tacatttgaa cacgtgcttt cgtgcagcat ggatagaacg ataagccttc tcggtaatct
    25021 taccattctt tgcctctgat ctgatgatac agacaaaagc ttcaggtaaa tcccacattg
    25081 cagctgcctc cataccatca gcagctgtat attcagtgag gtcatcagtg gcatcccact
    25141 ccatgacttc atcaacacga ttaccgaaag gatctggtct tgacatgagt atcacataag
    25201 gcggaacgat ttggtgcttg ggttgtactt gttctgctca acatgatgag caacaagacc
    25261 taaacataac cacgtaaaaa gaatggctac gataggagtc acaatggaat taggaattgg
    25321 cttcggtgag tgttgcatgg atagaaacaa gacggttgta gaggttgtgg tgaggctcca
    25381 cgtttggctc taactttgga tcatagcgaa tccaccaaga ccgtgcaagg gcatcagtga
    25441 tgattcctag ctctgtctcg gttaggttga tctgctttcg tttcatagac aatggtcgta
    25501 gaaagaatcc cttgatccaa caatgcgtga gggtccgcaa ctagttacca gttacttttt
    25561 accagtcaga gctttcttga agtttcgatc ccatcatggt gtcccaacaa tgggcttcaa
    25621 gttctttagc aatggcaaga atgttgggac ggtaaatcca atatccatag gcatcgtcac
    25681 atttgcaatt gtcagcgacg gcacgtaatg cagtggcaag gttgttgtta ctgagatgat
    25741 tagagcgata agcgtcaagc actgcttgtg cttcgggaga aaattcaggc atggtaatag
    25801 gttttactag gagggaggga gttcactgga gtgcatcaat gcttactgat cattgttcta
    25861 ctaggtgtgg atacatctta gcaagctgct tgtcttgtgt gtctttggct gagtcagcta
    25921 ctgctaaccc aagattggct gcaatgatga cagcgaacgc agcaatggtg atcctcatga
    25981 ttcagctccg tgttgatttg gtggttgatt gacaggcacg acatcagcga cacgctcaaa
    26041 gcctacagct aaagcttcgc ctttgctcca agcctccatg gatgtgcttg ctgttacgta
    26101 ctcacaagct gtgatgctac caggacaggc agcaccacca cgtgtgtaga acacttgata
    26161 acgcgtttga tgtggtttga tcatagcgat gataacagcg gtggtgatnn nnnnnnnnnn
    26221 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    26281 nnnnnnnnnn nnnnnnnnnn nnnnnnnngc ctaagcctac tcccttgccg gagaaggttg
    26341 aaggtgagaa ggagccaaaa attaaaccaa agactacaac agctaagaaa cgtgagcgca
    26401 ttcgtactgg cactgcgtct cttcagactg ctcctggtca aggcttgaac atctctgcca
    26461 atgtatcgag gacctaatga aaactgcacg acaacgctat catgaattga ctagtggtcg
    26521 tactgcattc ctcgacatcg cacttgattg tgcaaagctg acaatcccta cactgctaat
    26581 gcatgaggag actacaaccg attacactcg gtttaaaact ccttggcaat cagtaggagc
    26641 aaaaggggtg gtgactctgg catctaaact gatgctaggg ttgctacctc cttctacttc
    26701 attctttaaa ctccaattgg atgactccaa gttgggggtt gagattcctg ctgaggcaaa
    26761 aagtgaactg gatctaagct ttgctaagat tgagcgcatg atcatggaaa gcattgctgc
    26821 ttctactgat cgtgttcaaa tcttttcagc catcaaacac cttgtggtta ctggtaatgc
    26881 tttgctttac atgcacaagg atggtatgaa gatgtaccct ctcaatcgtt atgtagtaga
    26941 gagggatggt aatggtaatg tgactgagat tgtgactcgt gaaagggtta accgaaaagt
    27001 tcttggtcct gaatttgaaa accccaagtc tatgcaaagc gttgtagaca gtagtgtggg
    27061 tagtaaattt gaaaaagatg tagatgtatt cacctgcatc aagctaacta aaaagggatg
    27121 gtcttggtat caggaagctg atgataagat tcttcctaac tcctatggca aagctcctaa
    27181 agataagagc ccctggcttc ccctccgctt cgtaacagtt gatggagagg actacggacg
    27241 ctctcgtgtt gaggagttcc taggagacct acgctctctt gaagccctta tgcaggcgct
    27301 tgtagagggc tctgcagcag cagctaaggt ggtctttact gtatcaccca gctctacgac
    27361 taaacctcag tccttggcta acgctggtaa cggtgctatc atccaaggac gtcctgatga
    27421 cattggcgtg gttcaggttc agaaacaagc tgacttccgt actgcctttg atttggctgg
    27481 tgtattggag aagcgtatct ctgaagcgtt ccttatcctt aacgtaaggc aaagtgagcg
    27541 caccactgct gaagaggtca ggatgacaca gatggagcta gagcagcagc ttggaggatt
    27601 gttctctttg ctgaccagtg agttccttat tccttatctt aatcgtaaga tgctggatct
    27661 tnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    27721 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn natgttagcg tagagacctt
    27781 gtttagccat agtcagcatt tccatttacg tagtgcaagt gcttttcggg taggacgacc
    27841 cttactgtct ttcataggac ccttgactcc acccatacga gcacagaagg atcttttacg
    27901 accagcatct ttctttgtcc taggattagg agcaggtggt tttagatcag caccctcttt
    27961 atttttaaag tacttcctac ctttagctgt caagcctcca gtaggacttt tgtgctcttt
    28021 acgcatgatg tctacatact ttatttaggt tttttacgaa tgattgcgag atctgctctc
    28081 gtaatctttt tatgaggctt ggctactgca gctagttttt tctgttttgg tgtgtactta
    28141 ctgtagggca tcaccaaata ccgggaatga tttgcccagt catagcgtat gcaccaacag
    28201 cagcaacgaa gcctagcata gccaggcgtc cgtttagctt ctcagccttt tcccagtagg
    28261 tttcgtagac gttcatagtt ataccttgat gttggatcgt tcaagtttac gcatcacatc
    28321 catgcgatac gcatcatcat tatcatagcg aggatcgctc atgtcacgaa caacctctgc
    28381 catgctgcga tacgcctgac cagtagaaga ttgcttacca gtcacaagct caggtgtacg
    28441 accaactgca tcttcatatt gtccaaccaa cgccttaaca gcgaagcgga cagcagcctc
    28501 attggcagtg ttaatgacct catcaaatgc ttcgatgtct tcttcgggta gattctcaga
    28561 agcccattga acaacctgag catagccttc ttcacctcca gcaatgtctt tgatgttatt
    28621 aacttctgat tcagacagaa cattaacagc atcatcatag cctagttcag aacgaagacc
    28681 gccaagataa gcgtcgatgg tttcatcaga gaagccagct tcattaagct ggtcatacat
    28741 ctcttcagtc agagtaccgt cgttttcgta gaagtaatca ttcattgccc agggatcaat
    28801 gtttgcctca gcaaatgcct cagcaagtcc ttcaccatag gcttgggcta cagcatcttg
    28861 attgacgtaa ccctcttcat catagcgttc aaagtctcct tctacttgct cttcatctga
    28921 ttcatactct acatctgaat cgtactcttc atcatctcca ctannnnnnn nnnnnnnnnn
    28981 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    29041 nnnnnnnnnn nnnnnnnnnn nnnttttaac aatggctaac gctacccaaa ctgcgctagg
    29101 tcgtgctaat cttagcaccg gcactggcta cggtggtgct ggtgataagt acgaacttta
    29161 tctcaagctg ttcagcggcg agatgttcaa aggctttcag cacaacacca tcgctcgtga
    29221 tctggtgatg aagcggaccc tcaagtccgg taagtctctt cagttcatct acactggtcg
    29281 tatggacgct ggtttccata cccccggtac tcccatcctt ggctccggcg atcccccggt
    29341 ggctgagaag accattgtgg tggatgacct gctggtctcc agcgcattcg tctatgatct
    29401 cgatgaaacc ctggctcact atgagctgcg tggtgagatc agccgtaaga tcggttatgc
    29461 tctggctgag cactatgacc gccgcatctt ccgtgctatt gtccgtggtg cccgtgctgc
    29521 ccaccctgtg tctgctaccg gtaaggttga gcctggtggt acgcagatcc aagttggtgc
    29581 tggtgctggt gctactgctg atgctctcga ctctgacaag atcgtggctg ctttctttga
    29641 agccgctgct gttctggatg agaagggtgt gtctcaagac ggacgtgtgg ctgtcctcag
    29701 cccccgccaa tactatgctc tcattgagaa tgttggaacc aatgctctga tcaaccgtga
    29761 cgagcaaggt actgctttgc agagcggtaa tggcgtcatg tcgattgctg gtattaagat
    29821 ctaccgttcc atgaacatcc cgttcctggg taactatggt accaactcga ccattgacaa
    29881 ccccggctcg ttcgtgggtg cctctgttga ggctaccgct actggcgaga caacccctat
    29941 ggttctgcca ctgacttcga tacctcctgt ggtctgatct tccaacgtga agctgctggt
    30001 gttgttgaga ccatcggacc tcaggtccag gtcacctcgg gcgacgtgtc cgtgatctac
    30061 cagggcgatg tgatcctggg acgcctcagc atgggtactg actatctgaa ccctgctgct
    30121 tgtgtcgaac tgcacgctac cagcaccgct ggttctgcat tctgannnnn nnnnnnnnnn
    30181 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    30241 nnnnnnnnnn nnnnnnnnnn nnnnngatat aaggactctt cttaactaca caaccaggat
    30301 agaatccagc aacccaacct tgattagtag gcagaccata ggtagaatca ctatcaattg
    30361 gattacctcc tcgcgtaccg cttgccttca gaccagcaaa ggtgaaacca gtgatgtacg
    30421 taccgctatt acaacggaac atcgtctgag tctcagtagc agcagtaggg tgaataaagc
    30481 agctacggat agactgaccg acaatagaga ggttagatac cgtaatatcg attggaaggg
    30541 cttcttgata aactccagga accacataga caatatcacc agcattagca gaagctacag
    30601 cattcttaat tgtccttttc gggttgatga tgcggtgccc atcaaagcta tcattaccgt
    30661 tttcagagtc aacgtaaata acactaggtt gtgtagtaaa tgtaccacca gaagcaacac
    30721 caatccatcc agaaccattc caaatagaaa gggtgttatc aggagactgc tgaagccacg
    30781 tcttacctac ttcccagtca ctaccagcag gggtggtgtc agagacaata gtgtcaaacc
    30841 gcttagagga tgcagctcca gtgaacaggt tagtatcagc aggactaggt gtgccagcat
    30901 tctgctcaga ctcagtgatg atgtctacat ctttaatctt agaaaaatca atactaccgt
    30961 cagcaatgct aagctctaca tcaccgtcag caggacggtt aatggtgata ggattgccat
    31021 tagtaacact aggtgcagta attttaacaa cacctcgctg gctagcagta ctcttatcag
    31081 cagaaatggt gacttgcttg ttagagttag taccgccagt agcatcagta aggttgatag
    31141 cctcgccttc tagcaggtca tcagtgataa ccttaccaag ttgtcctctg ttgactgcat
    31201 catcatcact atctgcatca ccaaggttct caatcttata accctgtgca gtataagagt
    31261 tgtcacgttc gcgtgattca atgacgttct gtctagcagt aaaaaccgcc tcctgagcca
    31321 ggaagcggan nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    31381 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnc ttgttcaaga
    31441 gaatgatgac agacacaaac tctgtcgcta gtttaaaaac gaacacttgt agtagattgc
    31501 aatcatttga gtcgttgatg atggtggaaa aaaggaaggg gaatgaatcc cctccctctc
    31561 tgtcattagt tgacatagta gacaggcttg tgcttcagcc gatcatctct aacaaccctg
    31621 ccattgttga ctaggtcctt gataatgtga gaagtaaata acctcgaagt ctcaccatgt
    31681 ggcattaagt ctttcgagac ctcacataac ctagagccag gattgtgctt gatgtagtta
    31741 taaactacct cagacacagc gttgatcgaa agctcacaca attggcgctt gatgttgctc
    31801 ttgagtgtag aacggaaacc catgatcttt aaacagtagc cagactcagt gcctggcaat
    31861 agctagggca ggacttacac ctgcctgcag gtgtcaacct actagctcag atacgtggcg
    31921 cttggcgtta ccatgtgcct tgaacataac gacacactga cgctttgact gtgaacataa
    31981 tccacactct gaacatgtca ttgtgtcatt agtttgtgca gggcaggtga caaacttaac
    32041 accctcatgc tcagcagtat cagcgtgatc actaggaacc acgcaaactg ctggcaatcc
    32101 ttgattgtaa gcagagacag catcagcttt agattcagtg gatacgttga cagtgaagcc
    32161 gtgatcatta gcagccttaa tgatggcagc attgtgatca tttaagacgt ggtgggtata
    32221 tgtgaaccca cgcttgccat ggttagctaa cactaactcc accatatcgc taaagttgat
    32281 gtcgccattg tcgtgcggta agtcacccgc ttgattgtgt cgccataact gtttggctgg
    32341 taactgtgag acaaactcac ataaaccctg ccaatcagtg ccacgctcac catcagatac
    32401 ct
//