LOCUS       HUMKER10I               2038 bp    mRNA    linear   HUM 13-JAN-1995
DEFINITION  Homo sapiens keratin 10 type I intermediate filament (KRT10) mRNA,
            complete cds.
ACCESSION   J04029
VERSION     J04029.1
KEYWORDS    keratin; keratin 10; keratin 10 type I intermediate filament.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2038)
  AUTHORS   Zhou,X.M., Idler,W.W., Steven,A.C., Roop,D.R. and Steinert,P.M.
  TITLE     The complete sequence of the human intermediate filament chain
            keratin 10. Subdomainal divisions and model for folding of end
            domain sequences
  JOURNAL   J. Biol. Chem. 263 (30), 15584-15589 (1988)
   PUBMED   2459124
COMMENT     On Jan 14, 1995 this sequence version replaced gi:340513.
            Original source text: Homo sapiens foreskin epidermis cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..2038
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="17q21-q23"
                     /tissue_type="foreskin epidermis"
     gene            1..2038
                     /gene="KRT10"
     CDS             5..1690
                     /gene="KRT10"
                     /note="putative"
                     /codon_start=1
                     /product="keratin 10"
                     /protein_id="AAA60544.1"
                     /db_xref="GI:623409"
                     /db_xref="GDB:G00-118-828"
                     /translation="MSVRYSSSSKQFSSSRSGGGGGGGSSLRISSSKGSLGGGFSSGG
                     FSGGSFSRGSSGGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGSFGGGSFGG
                     GSFGGGSFGGGGFGGGGFGGGFGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRAL
                     EESNYELEGKIKERYDQHGNSRQGEPRDYSKYYKTIDDLKNQILNLTTDNANILLQID
                     NARLAADDFRLKYENEVALRQSVEADINGLRRVLDELTLTQADLEMQIESLTEELAYL
                     KKNREEEMKHLRNVSTGDVNVEMNAAPGVDLTQLLNNMRNQYEQLAEQNRKDAEAWFN
                     EKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGR
                     YCVQLSQIQAQISALEEQLQEIRAETECQNTEYQQLTDIKIRLENEIQTYRSLLEGEG
                     SSGGGGRGGGSFGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSFGGGGGG
                     YGGGSSGGGSSSGGGYGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY"
     polyA_signal    2013..2018
                     /gene="KRT10"
                     /note="G00-118-828"
     polyA_site      2038
                     /gene="KRT10"
                     /note="G00-118-828"
BASE COUNT          542 a          465 c          601 g          430 t
ORIGIN      
        1 caccatgtct gtccgctact ccagcagcag caagcagttc tcttcctccc gcagtggagg
       61 aggaggtggc ggagggtcct ccctaagaat atctagctcc aaaggctccc tcggcggagg
      121 atttagctca ggggggttca gcggcggctc ttttagccgc gggagctctg gtgggggctg
      181 ctttgggggc tcatcaggtg gctatggagg attaggaggt tttggtggag gtagctttcg
      241 tggaagctat ggaagtagca gctttggtgg gagttatgga ggcagctttg gagggggcag
      301 tttcggaggt ggcagctttg gtgggggcag ctttggtgga ggcggcttcg gtggaggcgg
      361 ctttggagga ggctttggtg gtggattcgg aggagacggc ggccttctct ctggaaatga
      421 aaaagtaacc atgcagaatc tgaatgaccg cttggcctcc tacctggaca aagttcgggc
      481 tctggaagaa tcaaactatg agctggaagg caaaatcaag gagcggtatg accagcatgg
      541 caactcacgt cagggggagc ctcgtgacta cagcaaatac tacaaaacca tcgatgacct
      601 taaaaatcag attctcaacc taacaacaga taatgccaac atcctgcttc agatcgacaa
      661 tgcaaggctg gcagctgatg acttcaggct gaagtatgag aatgaggtag ctctgcgcca
      721 gagcgtggag gctgacatca acggcctgcg tagggtgctg gatgagctga ccctgaccca
      781 ggccgaccta gagatgcaaa ttgagagcct gactgaagag ctggcctatc tgaagaagaa
      841 ccgcgaggag gaaatgaaac accttcgaaa tgtgtccacc ggtgatgtga atgtggaaat
      901 gaatgctgcc ccgggtgttg atctgactca acttctgaat aacatgagaa accaatatga
      961 acaacttgct gaacaaaacc gcaaagatgc tgaagcctgg ttcaatgaaa agagcaagga
     1021 actgactaca gaaattgata ataacattga acagatatcc agctataaat ctgagattac
     1081 tgaattgaga cgtaatgtac aagctctgga gatagaacta cagtcccaac tggccttgaa
     1141 acaatccctg gaagcctcct tggcagaaac agaaggtcgc tactgtgtgc agctctcaca
     1201 gattcaggcc cagatatccg ctctggaaga acagttgcaa gagattcgag ctgaaaccga
     1261 gtgccagaat actgaatacc aacaactcac ggatattaag atccgactgg agaatgaaat
     1321 tcaaacctac cgcagcctgc tagaaggaga gggaagctcc ggaggcggcg gacgcggcgg
     1381 cggaagtttc ggcggcggct acggaggcgg aagctccggc ggcggaagct ccggcggcgg
     1441 ctacgggggc ggaagctcca gcggcggcca cggcggcagt tccagcggcg gctacggtgg
     1501 tggcagtttc ggcggcggcg gcggcggcta cgggggcggc agctccggcg gcggcagcag
     1561 ctccggcggc ggatacggcg gcggcagcag ctccggcggc ggatacggcg gcggcagctc
     1621 cagcggaggc cacaagtcct cctcttccgg gtccgtgggc gagtcttcat ctaagggacc
     1681 aagatactaa caaaaccaga gtaatcaaga caattattga agaggtggcg cccgacggta
     1741 gagttctttc atctacggtt gaatcagaaa ccaagaaaca ctactattaa actgcatgaa
     1801 tctcccttca cacagaccat tatttacaga tgcatggaaa acaaagtctc caagaaaaca
     1861 cttctgtctt gatggtctat ggaaatagac cttgaaaata aggtgtctac aaggtgtttt
     1921 gtggtttccg tatttcttct tttcacttta ccagaaagtg ttctttaatg gaaagaaaaa
     1981 caactttctg ttctcattta ctaatgaatt tcaataaact ttcttactga tgcaaact
//