LOCUS       HUMLGTPA                3168 bp    mRNA    linear   HUM 07-JAN-1995
DEFINITION  Human liver glucose transporter-like protein (GLUT2), complete cds.
ACCESSION   J03810
VERSION     J03810.1
KEYWORDS    glucose transporter protein; membrane protein; transport protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3168)
  AUTHORS   Fukumoto,H., Seino,S., Imura,H., Seino,Y., Eddy,R.L., Fukushima,Y.,
            Byers,M.G., Shows,T.B. and Bell,G.I.
  TITLE     Sequence, tissue distribution, and chromosomal localization of mRNA
            encoding a human glucose transporter-like protein
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 85 (15), 5434-5438 (1988)
   PUBMED   3399500
COMMENT     Original source text: Human liver, cDNA to mRNA, clone
            lambda-hHTL-3.
            Draft entry and computer readable form of sequence [1] kindly
            provided  by G.I.Bell 30-JUN-1988.
FEATURES             Location/Qualifiers
     source          1..3168
                     /db_xref="H-InvDB:HIT000191207"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="3q26.1-q26.3"
     gene            1..3168
                     /gene="GLUT2"
     CDS             39..1613
                     /gene="GLUT2"
                     /note="glucose transporter-like protein"
                     /codon_start=1
                     /protein_id="AAA59514.1"
                     /db_xref="GI:307125"
                     /db_xref="GDB:G00-119-995"
                     /translation="MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRH
                     VLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLSVS
                     SFAVGGMTASFFGGWLGDTLGRIKAMLVANILSLVGALLMGFSKLGPSHILIIAGRSI
                     SGLYCGLISGLVPMYIGEIAPTALRGALGTFHQLAIVTGILISQIIGLEFILGNYDLW
                     HILLGLSGVRAILQSLLLFFCPESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEM
                     RKEREEASSEQKVSIIQLFTNSSYRQPILVALMLHVAQQFSGINGIFYYSTSIFQTAG
                     ISKPVYATIGVGAVNMVFTAVSVFLVEKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNK
                     FSWMSYVSMIAIFLFVSFFEIGPGPIPWFMVAEFFSQGPRPAALAIAAFSNWTCNFIV
                     ALCFQYIADFCGPYVFFLFAGVLLAFTLFTFFKVPETKGKSFEEIAAEFQKKSGSAHR
                     PKAAVEMKFLGATETV"
BASE COUNT          920 a          591 c          600 g         1057 t
ORIGIN      30 bp upstream of SpeI site; Chromosome 3q26.1-q26.3.
        1 cacaagacct ggaattgaca ggactcccaa ctagtacaat gacagaagat aaggtcactg
       61 ggaccctggt tttcactgtc atcactgctg tgctgggttc cttccagttt ggatatgaca
      121 ttggtgtgat caatgcacct caacaggtaa taatatctca ctatagacat gttttgggtg
      181 ttccactgga tgaccgaaaa gctatcaaca actatgttat caacagtaca gatgaactgc
      241 ccacaatctc atactcaatg aacccaaaac caaccccttg ggctgaggaa gagactgtgg
      301 cagctgctca actaatcacc atgctctggt ccctgtctgt atccagcttt gcagttggtg
      361 gaatgactgc atcattcttt ggtgggtggc ttggggacac acttggaaga atcaaagcca
      421 tgttagtagc aaacattctg tcattagttg gagctctctt gatggggttt tcaaaattgg
      481 gaccatctca tatacttata attgctggaa gaagcatatc aggactatat tgtgggctaa
      541 tttcaggcct ggttcctatg tatatcggtg aaattgctcc aaccgctctc aggggagcac
      601 ttggcacttt tcatcagctg gccatcgtca cgggcattct tattagtcag attattggtc
      661 ttgaatttat cttgggcaat tatgatctgt ggcacatcct gcttggcctg tctggtgtgc
      721 gagccatcct tcagtctctg ctactctttt tctgtccaga aagccccaga tacctttaca
      781 tcaagttaga tgaggaagtc aaagcaaaac aaagcttgaa aagactcaga ggatatgatg
      841 atgtcaccaa agatattaat gaaatgagaa aagaaagaga agaagcatcg agtgagcaga
      901 aagtctctat aattcagctc ttcaccaatt ccagctaccg acagcctatt ctagtggcac
      961 tgatgctgca tgtggctcag caattttccg gaatcaatgg cattttttac tactcaacca
     1021 gcatttttca gacggctggt atcagcaaac ctgtttatgc aaccattgga gttggcgctg
     1081 taaacatggt tttcactgct gtctctgtat tccttgtgga gaaggcaggg cgacgttctc
     1141 tctttctaat tggaatgagt gggatgtttg tttgtgccat cttcatgtca gtgggacttg
     1201 tgctgctgaa taagttctct tggatgagtt atgtgagcat gatagccatc ttcctctttg
     1261 tcagcttctt tgaaattggg ccaggcccga tcccctggtt catggtggct gagtttttca
     1321 gtcaaggacc acgtcctgct gctttagcaa tagctgcatt cagcaattgg acctgcaatt
     1381 tcattgtagc tctgtgtttc cagtacattg cggacttctg tggaccttat gtgtttttcc
     1441 tctttgctgg agtgctcctg gcctttaccc tgttcacatt ttttaaagtt ccagaaacca
     1501 aaggaaagtc ttttgaggaa attgctgcag aattccaaaa gaagagtggc tcagcccaca
     1561 ggccaaaagc tgctgtagaa atgaaattcc taggagctac agagactgtg taaaaaaaaa
     1621 accctgcttt ttgacatgaa cagaaacaat aagggaaccg tctgttttta aatgatgatt
     1681 ccttgagcat tttatatcca catctttaag tattgtttta tttttatgtg ctctcatcag
     1741 aaatgtcatc aaatattacc aaaaaagtat ttttttaagt tagagaatat atttttgatg
     1801 gtaagactgt aattaagtaa accaaaaagg ctagtttatt ttgttacact aaagggcagg
     1861 tggttctaat atttttagct ctgttcttta taacaaggtt cttctaaaat tgaagagatt
     1921 tcaacatatc atttttttaa cacataacta gaaacctgag gatgcaacaa atatttatat
     1981 atttgaatat cattaaattg gaattttctt acccatatat cttatgttaa aggagatatg
     2041 gctagtggca ataagttcca tgttaaaata gacaactctt ccatttattg cactcagctt
     2101 ttttcttgag tactagaatt tgtattttgc ttaaaatttt acttttgttc tgtattttca
     2161 tgtggaatgg attatagagt atactaaaaa atgtctatag agaaaaactt tcatttttgg
     2221 taggcttatc aaaatctttc agcactcaga aaagaaaacc attttagttc ctttatttaa
     2281 tggccaaatg gtttttgcaa gatttaacac taaaaaggtt tcacctgatc atatagcgtg
     2341 ggttatcagt taacattaac atctattata aaaccatgtt gattcccttc tggtacaatc
     2401 ctttgagtta tagtttgctt tgctttttaa ttgaggacag cctggttttc acatacactc
     2461 aaacaatcat gagtcagaca tttggtatat tacctcaaat tcctaataag tttgatcaaa
     2521 tctaatgtaa gaaaatttga agtaaaggat tgatcacttt gttaaaaata ttttctgaat
     2581 tattatgtct caaaataagt tgaaaaggta gggtttgagg attcctgagt gtgggcttct
     2641 gaaacttcat aaatgttcag cttcagactt ttatcaaaat ccctatttaa ttttcctgga
     2701 aagactgatt gttttatggt gtgttcctaa cataaaataa tcgtctcctt tgacatttcc
     2761 ttctttgtct tagctgtata cagattctag ccaaactatt ctatggccat tactaacacg
     2821 cattgtacac tatctatctg cctttaccta cataggcaaa ttggaaatac acagatgatt
     2881 aaacagactt tagcttacag tcaattttac aattatggaa atatagttct gatgggtccc
     2941 aaaagcttag cagggtgcta acgtatctct aggctgtttt ctccaccaac tggagcactg
     3001 atcaatcctt cttatgtttg ctttaatgtg tattgaagaa aagcactttt taaaaagtac
     3061 tctttaagag tgaaataatt aaaaaccact gaacatttgc tttgttttct aaagttgttc
     3121 acatatatgt aatttagcag tccaaagaac aagaaattgt ttcttttc
//