LOCUS       HUMTLCA                 1116 bp    mRNA    linear   HUM 03-AUG-1993
DEFINITION  Human ADP/ATP translocase mRNA, 3' end, clone pHAT8.
ACCESSION   J03592
VERSION     J03592.1
KEYWORDS    ADP/ATP translocase.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1116)
  AUTHORS   Houldsworth,J. and Attardi,G.
  TITLE     Two distinct genes for ADP/ATP translocase are expressed at the
            mRNA level in adult human liver
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 85 (2), 377-381 (1988)
   PUBMED   2829183
COMMENT     Original source text: Human (adult) liver, cDNA to mRNA, clone
            pHAT8.
            Draft entry and printed copy of sequence for [1] kindly provided by
            J.Houldsworth, 04-JAN-1988.
FEATURES             Location/Qualifiers
     source          1..1116
                     /db_xref="H-InvDB:HIT000191183_04"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             <1..789
                     /note="ADP.ATP translocase"
                     /codon_start=1
                     /protein_id="AAA36750.1"
                     /translation="LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVI
                     RYFPTQALNFAFKDKYKQIFLGGVDRHAFWRYFAGNLASGGAAGATSLCFVYPLDFAR
                     TRLAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVSVQGIIIYRAAYFGVYD
                     TAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGT
                     VDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI"
BASE COUNT          231 a          330 c          346 g          209 t
ORIGIN      5 bp upstream of PstI site.
        1 ctgcaggtcc agcacgccag caagcagatc gccgccgaca agcagtacaa gggcatcgtg
       61 gactgcattg tccgcatccc caaggagcag ggcgtgctgt ccttctggag gggcaacctt
      121 gccaacgtca ttcgctactt ccccactcaa gccctcaact tcgccttcaa ggataagtac
      181 aagcagatct tcctgggggg cgtggacaga cacgcgttct ggaggtactt tgcgggcaac
      241 ctggcctccg gcggtgcggc cggcgcgacc tccctctgct tcgtgtaccc gctggatttt
      301 gccagaaccc gcctggcagc ggacgtggga aagtcaggca cagagcgcga gttccgaggc
      361 ctgggagact gcctggtgaa gatcaccaag tccgacggca tccggggcct gtaccagggc
      421 ttcagtgtct ccgtgcaggg catcatcatc taccgggcgg cctacttcgg cgtgtacgat
      481 acggccaagg gcatgctccc cgaccccaag aacacgcaca tcgtggtgag ctggatgatc
      541 gcgcagaccg tgacggccgt ggccggcgtg gtgtcctacc ccttcgacac ggtgcggcgg
      601 cgcatgatga tgcagtccgg gcgcaaagga gctgacatca tgtacacggg caccgtcgac
      661 tgttggagga agatcttcag agatgagggg ggcaaggcct tcttcaaggg tgcgtggtcc
      721 aacgtcctgc ggggcatggg gggcgccttc gtgctggtcc tgtacgacga gctcaagaag
      781 gtgatctaag ggccgcggcc tcctccacac acacacacac accaggggaa ccaagagaac
      841 cacgtagaat cctcaaccgt gcggaccatc aaccttcgag aaattccagt tgtctttttc
      901 ccagccgcat cctgcctgta gatggccggg gaaggctcta gaaaaggggc gcattgcgat
      961 ccaaccatcg gcagccgatt ccgtgtcttg atcacggggt gggagggaac cgtggcgtcc
     1021 ctgcgtgggg cccatgggtg agacactcca gtactgagac ctagagtcca gatgcttgta
     1081 ggagccaagt cgtgttctaa gtatttattt aaaaca
//