LOCUS       HUMHXMA                 1546 bp    mRNA    linear   HUM 08-NOV-1994
DEFINITION  Huma hemopexin mRNA, 3' end.
ACCESSION   J03048
VERSION     J03048.1
KEYWORDS    hemopexin.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1546)
  AUTHORS   Law,M.L., Cai,G.Y., Hartz,J.A., Jones,C. and Kao,F.T.
  TITLE     The hemopexin gene maps to the same location as the beta-globin
            gene cluster on human chromosome 11
  JOURNAL   Genomics 3 (1), 48-52 (1988)
   PUBMED   3220477
COMMENT     Original source text: Human, cDNA to mRNA, clone lambda-Hx5.
            Draft entry and printed copy of sequence for [Genomics (1988) In
            press] kindly provided by
            G.-Y.Cai and M.L.Law, 01-June-1988.
FEATURES             Location/Qualifiers
     source          1..1546
                     /db_xref="H-InvDB:HIT000191124"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="11p15.5-p15.4"
     gene            1..1546
                     /gene="HPX"
     mRNA            <1..1546
                     /gene="HPX"
                     /product="HXM mRNA"
     CDS             <1..1386
                     /gene="HPX"
                     /note="hemopexin precursor"
                     /codon_start=1
                     /protein_id="AAA52704.1"
                     /db_xref="GI:386789"
                     /db_xref="GDB:G00-120-054"
                     /translation="ARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPD
                     VTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQ
                     GHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLF
                     FQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPR
                     YPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAF
                     SGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGY
                     TLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATW
                     TELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQP
                     QNVTSLLGCTH"
     sig_peptide     <1..66
                     /gene="HPX"
                     /note="hemopexin signal peptide"
     mat_peptide     67..1383
                     /gene="HPX"
                     /product="hemopexin"
     repeat_region   1380..1462
                     /note="tandem repeat copy A"
     repeat_region   1463..1546
                     /note="tandem repeat copy B"
BASE COUNT          330 a          427 c          430 g          359 t
ORIGIN      Chromosome 11pter-p11.
        1 gctagggtac tgggagcacc cgttgcactg gggttgtgga gcctatgctg gtctctggcc
       61 attgccaccc ctcttcctcc gactagtgcc catgggaatg ttgctgaagg cgagaccaag
      121 ccagacccag acgtgactga acgctgctca gatggctgga gctttgatgc taccaccctg
      181 gatgacaatg gaaccatgct gttttttaaa ggggagtttg tgtggaagag tcacaaatgg
      241 gaccgggagt taatctcaga gagatggaag aatttcccca gccctgtgga tgctgcattc
      301 cgtcaaggtc acaacagtgt ctttctgatc aagggggaca aagtctgggt ataccctcct
      361 gaaaagaagg agaaaggata cccaaagttg ctccaagatg aatttcctgg aatcccatcc
      421 ccactggatg cagctgtgga atgtcaccgt ggagaatgtc aagctgaagg cgtcctcttc
      481 ttccaaggtg accgcgagtg gttctgggac ttggctacgg gaaccatgaa ggagcgttcc
      541 tggccagctg ttgggaactg ctcctctgcc ctgagatggc tgggccgcta ctactgcttc
      601 cagggtaacc aattcctgcg cttcgaccct gtcaggggag aggtgcctcc caggtacccg
      661 cgggatgtcc gagactactt catgccctgc cctggcagag gccatggaca caggaatggg
      721 actggccatg ggaacagtac ccaccatggc cctgagtata tgcgctgtag cccacatcta
      781 gtcttgtctg cactgacgtc tgacaaccat ggtgccacct atgccttcag tgggacccac
      841 tactggcgtc tggacaccag ccgggatggc tggcatagct ggcccattgc tcatcagtgg
      901 ccccagggtc cttcagcagt ggatgctgcc ttttcctggg aagaaaaact ctatctggtc
      961 cagggcaccc aggtatatgt cttcctgaca aagggaggct ataccctagt aagcggttat
     1021 ccgaagcggc tggagaagga agtcgggacc cctcatggga ttatcctgga ctctgtggat
     1081 gcggccttta tctgccctgg gtcttctcgg ctccatatca tggcaggacg gcggctgtgg
     1141 tggctggacc tgaagtcagg agcccaagcc acgtggacag agcttccttg gccccatgag
     1201 aaggtagacg gagccttgtg tatggaaaag tcccttggcc ctaactcatg ttccgccaat
     1261 ggtcccggct tgtacctcat ccatggtccc aatttgtact gctacagtga tgtggagaaa
     1321 ctgaatgcag ccaaggccct tccgcaaccc cagaatgtga ccagtctcct gggctgcact
     1381 cactgagggg ccttctgaca tgagtctggc ctggccccac ctcctagttc ctcataataa
     1441 agacagattg cttcttcgct tctcactgag gggccttctg acatgagtct ggcctggccc
     1501 cacctcccca gtttctcata ataaagacag attgcttctt cacttg
//