LOCUS       HUMPSPBA                2026 bp    mRNA    linear   HUM 08-JAN-1995
DEFINITION  Human pulmonary surfactant-associated protein B (SP-B) mRNA,
            complete cds.
ACCESSION   J02761
VERSION     J02761.1
KEYWORDS    pulmonary surfactant-associated protein; sialoglycoprotein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2026)
  AUTHORS   Jacobs,K.A., Phelps,D.S., Steinbrink,R., Fisch,J., Kriz,R.,
            Mitsock,L., Dougherty,J.P., Taeusch,H.W. and Floros,J.
  TITLE     Isolation of a cDNA clone encoding a high molecular weight
            precursor to a 6-kDa pulmonary surfactant-associated protein
  JOURNAL   J. Biol. Chem. 262 (20), 9808-9811 (1987)
   PUBMED   3597440
COMMENT     Original source text: Human lung, cDNA to mRNA, clone 17.
            Draft entry and clean copy of the sequence in [1] were kundly
            provided by K.Jacobs 07-APR-1987.
            The pulmonary surfactant protein is thought to be further processed
            on both the amino and carboxy ends.  The authors note that the
            possible mature protein corresponds to positions 614 to 841.
FEATURES             Location/Qualifiers
     source          1..2026
                     /db_xref="H-InvDB:HIT000191084"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="2"
                     /tissue_type="lung"
     gene            1..2026
                     /gene="SFTP3"
     CDS             14..1159
                     /gene="SFTP3"
                     /codon_start=1
                     /product="pulmonary surfactant-associated protein SP-B"
                     /protein_id="AAA60212.1"
                     /db_xref="GI:190674"
                     /db_xref="GDB:G00-120-374"
                     /translation="MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLE
                     QALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNV
                     LPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPL
                     PKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRI
                     QAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLR
                     CSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREK
                     CKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL"
BASE COUNT          444 a          625 c          532 g          425 t
ORIGIN      
        1 gaattccggt gccatggctg agtcacacct gctgcagtgg ctgctgctgc tgctgcccac
       61 gctctgtggc ccaggcactg ctgcctggac cacctcatcc ttggcctgtg cccagggccc
      121 tgagttctgg tgccaaagcc tggagcaagc attgcagtgc agagccctag ggcattgcct
      181 acaggaagtc tggggacatg tgggagccga tgacctatgc caagagtgtg aggacatcgt
      241 ccacatcctt aacaagatgg ccaaggaggc cattttccag gacacgatga ggaagttcct
      301 ggagcaggag tgcaacgtcc tccccttgaa gctgctcatg ccccagtgca accaagtgct
      361 tgacgactac ttccccctgg tcatcgacta cttccagaac cagactgact caaacggcat
      421 ctgtatgcac ctgggcctgt gcaaatcccg gcagccagag ccagagcagg agccagggat
      481 gtcagacccc ctgcccaaac ctctgcggga ccctctgcca gaccctctgc tggacaagct
      541 cgtcctccct gtgctgcccg gggccctcca ggcgaggcct gggcctcaca cacaggatct
      601 ctccgagcag caattcccca ttcctctccc ctattgctgg ctctgcaggg ctctgatcaa
      661 gcggatccaa gccatgattc ccaagggtgc gctagctgtg gcagtggccc aggtgtgccg
      721 cgtggtacct ctggtggcgg gcggcatctg ccagtgcctg gctgagcgct actccgtcat
      781 cctgctcgac acgctgctgg gccgcatgct gccccagctg gtctgccgcc tcgtcctccg
      841 gtgctccatg gatgacagcg ctggcccaag gtcgccgaca ggagaatggc tgccgcgaga
      901 ctctgagtgc cacctctgca tgtccgtgac cacccaggcc gggaacagca gcgagcaggc
      961 cataccacag gcaatgctcc aggcctgtgt tggctcctgg ctggacaggg aaaagtgcaa
     1021 gcaatttgtg gagcagcaca cgccccagct gctgaccctg gtgcccaggg gctgggatgc
     1081 ccacaccacc tgccaggccc tcggggtgtg tgggaccatg tccagccctc tccagtgtat
     1141 ccacagcccc gacctttgat gagaactcag ctgtccagct gcaaaggaaa agccaagtga
     1201 gacgggctct gggaccatgg tgaccaggct cttcccctgc tccctggccc tcgccagctg
     1261 ccaggctgaa aagaagcctc agctcccaca ccgccctcct cacctccctt cctcggcagt
     1321 cacttccact ggtggaccac gggcccccag ccctgtgtcg gccttgtctg tctcagctca
     1381 accacagtct gacaccagag cccacttcca tcctctctgg tgtgaggcac agcgagggca
     1441 gcatctggag gagctctgca gcctccacac ctaccacgac ctcccagggc tgggctcagg
     1501 aaaaaccagc cactgcttta caggacaggg ggttgaagct gagccccgcc tcacacccac
     1561 ccccatgcac tcaaagattg gattttacag ctacttgcaa ttcaaaattc agaagaataa
     1621 aaaatgggaa catacagaac tctaaaagat agacatcaga aattgttaag ttaagctttt
     1681 tcaaaaaatc agcaattccc cagcgtagtc aagggtggac actgcacgct ctggcatgat
     1741 gggatggcga ccgggcaagc tttcttcctc gagatgctct gctgcttgag agctattgct
     1801 ttgttaagat ataaaaaggg gtttcttttt gtctttctgt aaggtggact tccagatttt
     1861 gattgaaagt cctagggtga ttctatttct gctgtgattt atctgctgaa agctcagctg
     1921 gggttgtgca agctagggac ccattcctgt gtaatacaat gtctgcacca atgctaataa
     1981 agtcctattc tcttttaaaa aaaaaaaaaa aaaaaaaacg gaattc
//