LOCUS       SYNINSGS                 351 bp    DNA     linear   SYN 27-APR-1993
DEFINITION  Human (synthetic) insulin gene, complete cds.
ACCESSION   J02547 M25881
VERSION     J02547.1
KEYWORDS    artificial gene; insulin.
SOURCE      synthetic construct
  ORGANISM  synthetic construct
            other sequences; artificial sequences.
REFERENCE   1  (bases 1 to 351)
  AUTHORS   Brousseau,R., Scarpulla,R., Sung,W., Hsiung,H.M., Narang,S.A. and
            Wu,R.
  TITLE     Synthesis of a human insulin gene. V. Enzymatic assembly, cloning
            and characterization of the human proinsulin DNA
  JOURNAL   Gene 17 (3), 279-289 (1982)
   PUBMED   7049838
REFERENCE   2  (bases 1 to 351)
  AUTHORS   Narang,S.A., Brousseau,R., Georges,F., Michniewicz,J.,
            Prefontaine,G., Stawinski,J. and Sung,W.
  TITLE     The human preproinsulin gene: synthesis, cloning, gene
            modification, and expression studies
  JOURNAL   Can. J. Biochem. 62, 209-216 (1984)
REFERENCE   3  (bases 1 to 351)
  AUTHORS   Narang,S.A., Brousseau,R., Georges,F., Michniewicz,J.,
            Prefontaine,G., Stawinski,J. and Sung,W.
  TITLE     The human preproinsulin gene: synthesis, cloning, gene
            modification, and expression studies
  JOURNAL   Can. J. Biochem. Cell Biol. 62 (4), 209-216 (1984)
   PUBMED   6722637
REFERENCE   4  (bases 1 to 351)
  AUTHORS   Georges,F., Brousseau,R., Michniewicz,J., Prefontaine,G.,
            Stawinski,J., Sung,W., Wu,R. and Narang,S.A.
  TITLE     Synthesis of a human insulin gene. VII. Synthesis of
            preproinsulin-like human DNA, its cloning and expression in M13
            bacteriophage
  JOURNAL   Gene 27 (2), 201-211 (1984)
   PUBMED   6373502
COMMENT     Original source text: Synthetic human DNA.
            In places where the human insulin amino acid sequence is identical
            to the rat insulin amino acid sequence, the synthetic sequence
            follows the published nucleotide sequence for rat (see separate
            entry).
FEATURES             Location/Qualifiers
     source          1..351
                     /organism="synthetic construct"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:32630"
     CDS             6..350
                     /note="synthetic preproinsulin"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA72172.1"
                     /translation="MGLWIRLLPLIALLILWGPDPAAAEFRMFVNQHLCGSHLVEALY
                     LVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTS
                     ICSLYQLENYCN"
     sig_peptide     6..77
                     /note="synthetic insulin signal peptide"
     mat_peptide     90..179
                     /product="synthetic insulin B-chain"
     mat_peptide     186..278
                     /product="synthetic insulin C-chain"
     mat_peptide     285..347
                     /product="synthetic insulin A-chain"
BASE COUNT           65 a           93 c          100 g           93 t
ORIGIN      78 bp upstream of EcoRI site.
        1 aattcatggg cctatggatc cgtctactgc ctctgatcgc gctgctgatc ctctggggac
       61 cggatccagc tgcggccgaa ttccggatgt ttgtcaatca gcacctttgt ggttctcacc
      121 tggtggaggc tctgtacctg gtgtgtgggg aacgtggttt cttctacaca cccaagaccc
      181 gtcgtgaagc tgaagacctt caagtgggtc aagttgaact tggtgggggt cctggtgcgg
      241 gttctcttca acctttggct ctcgagggat cacttcaaaa gcgtggcatt gtggagcagt
      301 gctgcaccag catctgctcc ctctaccaac tggagaacta ctgcaactga g
//