LOCUS SYNINSGS 351 bp DNA linear SYN 27-APR-1993 DEFINITION Human (synthetic) insulin gene, complete cds. ACCESSION J02547 M25881 VERSION J02547.1 KEYWORDS artificial gene; insulin. SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 (bases 1 to 351) AUTHORS Brousseau,R., Scarpulla,R., Sung,W., Hsiung,H.M., Narang,S.A. and Wu,R. TITLE Synthesis of a human insulin gene. V. Enzymatic assembly, cloning and characterization of the human proinsulin DNA JOURNAL Gene 17 (3), 279-289 (1982) PUBMED 7049838 REFERENCE 2 (bases 1 to 351) AUTHORS Narang,S.A., Brousseau,R., Georges,F., Michniewicz,J., Prefontaine,G., Stawinski,J. and Sung,W. TITLE The human preproinsulin gene: synthesis, cloning, gene modification, and expression studies JOURNAL Can. J. Biochem. 62, 209-216 (1984) REFERENCE 3 (bases 1 to 351) AUTHORS Narang,S.A., Brousseau,R., Georges,F., Michniewicz,J., Prefontaine,G., Stawinski,J. and Sung,W. TITLE The human preproinsulin gene: synthesis, cloning, gene modification, and expression studies JOURNAL Can. J. Biochem. Cell Biol. 62 (4), 209-216 (1984) PUBMED 6722637 REFERENCE 4 (bases 1 to 351) AUTHORS Georges,F., Brousseau,R., Michniewicz,J., Prefontaine,G., Stawinski,J., Sung,W., Wu,R. and Narang,S.A. TITLE Synthesis of a human insulin gene. VII. Synthesis of preproinsulin-like human DNA, its cloning and expression in M13 bacteriophage JOURNAL Gene 27 (2), 201-211 (1984) PUBMED 6373502 COMMENT Original source text: Synthetic human DNA. In places where the human insulin amino acid sequence is identical to the rat insulin amino acid sequence, the synthetic sequence follows the published nucleotide sequence for rat (see separate entry). FEATURES Location/Qualifiers source 1..351 /organism="synthetic construct" /mol_type="genomic DNA" /db_xref="taxon:32630" CDS 6..350 /note="synthetic preproinsulin" /codon_start=1 /transl_table=11 /protein_id="AAA72172.1" /translation="MGLWIRLLPLIALLILWGPDPAAAEFRMFVNQHLCGSHLVEALY LVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTS ICSLYQLENYCN" sig_peptide 6..77 /note="synthetic insulin signal peptide" mat_peptide 90..179 /product="synthetic insulin B-chain" mat_peptide 186..278 /product="synthetic insulin C-chain" mat_peptide 285..347 /product="synthetic insulin A-chain" BASE COUNT 65 a 93 c 100 g 93 t ORIGIN 78 bp upstream of EcoRI site. 1 aattcatggg cctatggatc cgtctactgc ctctgatcgc gctgctgatc ctctggggac 61 cggatccagc tgcggccgaa ttccggatgt ttgtcaatca gcacctttgt ggttctcacc 121 tggtggaggc tctgtacctg gtgtgtgggg aacgtggttt cttctacaca cccaagaccc 181 gtcgtgaagc tgaagacctt caagtgggtc aagttgaact tggtgggggt cctggtgcgg 241 gttctcttca acctttggct ctcgagggat cacttcaaaa gcgtggcatt gtggagcagt 301 gctgcaccag catctgctcc ctctaccaac tggagaacta ctgcaactga g //