LOCUS       ECOLEXA                  952 bp    DNA     linear   BCT 26-APR-1993
DEFINITION  E.coli lexA gene coding for SOS function regulatory protein.
ACCESSION   J01643 V00299 V00300
VERSION     J01643.1
KEYWORDS    SOS response; lexA gene; regulatory protein; repressor.
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 952)
  AUTHORS   Horii,T., Ogawa,T. and Ogawa,H.
  TITLE     Nucleotide sequence of the lexA gene of E. coli
  JOURNAL   Cell 23 (3), 689-697 (1981)
   PUBMED   7013987
REFERENCE   2  (bases 1 to 170)
  AUTHORS   Miki,T., Ebina,Y., Kishi,F. and Nakazawa,A.
  TITLE     Organization of the lexA gene of Escherichia coli and nucleotide
            sequence of the regulatory region
  JOURNAL   Nucleic Acids Res. 9 (3), 529-543 (1981)
   PUBMED   6261224
REFERENCE   3  (bases 1 to 944)
  AUTHORS   Markham,B.E., Little,J.W. and Mount,D.W.
  TITLE     Nucleotide sequence of the lexA gene of Escherichia coli K-12
  JOURNAL   Nucleic Acids Res. 9 (16), 4149-4161 (1981)
   PUBMED   6272195
REFERENCE   4  (bases 42 to 113)
  AUTHORS   Little,J.W., Mount,D.W. and Yanisch-Perron,C.R.
  TITLE     Purified lexA protein is a repressor of the recA and lexA genes
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 78 (7), 4199-4203 (1981)
   PUBMED   7027255
REFERENCE   5  (bases 306 to 407)
  AUTHORS   Little,J.W. and Hill,S.A.
  TITLE     Deletions within a hinge region of a specific DNA-binding protein
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 82 (8), 2301-2305 (1985)
   PUBMED   3887398
FEATURES             Location/Qualifiers
     source          1..952
                     /organism="Escherichia coli"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:562"
     regulatory      55..74
                     /regulatory_class="other"
                     /note="operator: lexa protein binding site (SOS box)"
     mRNA            74..>710
                     /product="lexA mRNA"
     regulatory      76..95
                     /regulatory_class="other"
                     /note="operator: lexa protein binding site (SOS box)"
     CDS             102..710
                     /note="SOS function regulatory protein (lexA)"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA24067.1"
                     /translation="MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAE
                     EHLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDP
                     SLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKK
                     QGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL"
     variation       355
                     /note="g in wild-type; a in lexA3"
BASE COUNT          215 a          224 c          263 g          250 t
ORIGIN      
        1 gaattcgata aatctctggt ttattgtgca gtttatggtt ccaaaatcgc cttttgctgt
       61 atatactcac agcataactg tatatacacc cagggggcgg aatgaaagcg ttaacggcca
      121 ggcaacaaga ggtgtttgat ctcatccgtg atcacatcag ccagacaggt atgccgccga
      181 cgcgtgcgga aatcgcgcag cgtttggggt tccgttcccc aaacgcggct gaagaacatc
      241 tgaaggcgct ggcacgcaaa ggcgttattg aaattgtttc cggcgcatca cgcgggattc
      301 gtctgttgca ggaagaggaa gaagggttgc cgctggtagg tcgtgtggct gccggtgaac
      361 cacttctggc gcaacagcat attgaaggtc attatcaggt cgatccttcc ttattcaagc
      421 cgaatgctga tttcctgctg cgcgtcagcg ggatgtcgat gaaagatatc ggcattatgg
      481 atggtgactt gctggcagtg cataaaactc aggatgtacg taacggtcag gtcgttgtcg
      541 cacgtattga tgacgaagtt accgttaagc gcctgaaaaa acagggcaat aaagtcgaac
      601 tgttgccaga aaatagcgag tttaaaccaa ttgtcgttga ccttcgtcag cagagcttca
      661 ccattgaagg gctggcggtt ggggttattc gcaacggcga ctggctgtaa catatctctg
      721 agaccgcgat gccgcctggc gtcgcggttt gtttttcatc tctcttcatc aggcttgtct
      781 gcatggcatt cctcacttca tctgataaag cactctggca tctcgcctta cccatgattt
      841 tctccaatat caccgttccg ttgctgggac tggtcgatac ggcggtaatt ggtcatcttg
      901 atagcccggt ttatttgggc ggcgtggcgg ttggcgcaac ggcggaccag ct
//