LOCUS       GQ221974              235154 bp    DNA     linear   VRL 09-MAY-2013
DEFINITION  Human herpesvirus 5 strain 3157, complete genome.
ACCESSION   GQ221974 AY156040 AY169795 AY325311 AY446863 AY446867 AY446875
            DQ195526
VERSION     GQ221974.1
KEYWORDS    .
SOURCE      Human betaherpesvirus 5 (HHV-5)
  ORGANISM  Human betaherpesvirus 5
            Viruses; dsDNA viruses, no RNA stage; Herpesvirales; Herpesviridae;
            Betaherpesvirinae; Cytomegalovirus.
REFERENCE   1  (bases 1 to 235154)
  AUTHORS   Davison,A.J., Akter,P., Cunningham,C., Dolan,A., Addison,C.,
            Dargan,D.J., Hassan-Walker,A.F., Emery,V.C., Griffiths,P.D. and
            Wilkinson,G.W.
  TITLE     Homology between the human cytomegalovirus RL11 gene family and
            human adenovirus E3 genes
  JOURNAL   J. Gen. Virol. 84 (PT 3), 657-663 (2003)
   PUBMED   12604818
REFERENCE   2  (bases 1 to 235154)
  AUTHORS   Akter,P., Cunningham,C., McSharry,B.P., Dolan,A., Addison,C.,
            Dargan,D.J., Hassan-Walker,A.F., Emery,V.C., Griffiths,P.D.,
            Wilkinson,G.W. and Davison,A.J.
  TITLE     Two novel spliced genes in human cytomegalovirus
  JOURNAL   J. Gen. Virol. 84 (PT 5), 1117-1122 (2003)
   PUBMED   12692276
REFERENCE   3  (bases 1 to 235154)
  AUTHORS   Dolan,A., Cunningham,C., Hector,R.D., Hassan-Walker,A.F., Lee,L.,
            Addison,C., Dargan,D.J., McGeoch,D.J., Gatherer,D., Emery,V.C.,
            Griffiths,P.D., Sinzger,C., McSharry,B.P., Wilkinson,G.W. and
            Davison,A.J.
  TITLE     Genetic content of wild-type human cytomegalovirus
  JOURNAL   J. Gen. Virol. 85 (PT 5), 1301-1312 (2004)
   PUBMED   15105547
REFERENCE   4  (bases 1 to 235154)
  AUTHORS   Griffin,C., Wang,E.C., McSharry,B.P., Rickards,C., Browne,H.,
            Wilkinson,G.W. and Tomasec,P.
  TITLE     Characterization of a highly glycosylated form of the human
            cytomegalovirus HLA class I homologue gpUL18
  JOURNAL   J. Gen. Virol. 86 (PT 11), 2999-3008 (2005)
   PUBMED   16227221
REFERENCE   5  (bases 1 to 235154)
  AUTHORS   Cunningham,C., Gatherer,D., Hilfrich,B., Baluchova,K., Dargan,D.J.,
            Thomson,M., Griffiths,P.D., Wilkinson,G.W., Schulz,T.F. and
            Davison,A.J.
  TITLE     Sequences of complete human cytomegalovirus genomes from infected
            cell cultures and clinical specimens
  JOURNAL   J. Gen. Virol. 91 (PT 3), 605-615 (2010)
   PUBMED   19906940
REFERENCE   6  (bases 1 to 235154)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-MAY-2009) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, UK
COMMENT     On or before Aug 17, 2009 this sequence version replaced
            AY446863.1, AY446867.1, AY446875.1, AY169795.2, AY156040.1,
            AY325311.1, DQ195526.1.
            The original gene nomenclature has been retained. Genes presumably
            inherited from the common ancestor of alpha-, beta- and
            gammaherpesviruses (core genes), from the common ancestor of beta-
            and gammaherpesviruses (betagamma genes), or from the common
            ancestor of betaherpesviruses (beta genes) are indicated. A
            standard protein nomenclature has been applied so that orthologs
            have the same name in all herpesviruses.
FEATURES             Location/Qualifiers
     source          1..235154
                     /organism="Human betaherpesvirus 5"
                     /mol_type="genomic DNA"
                     /strain="3157"
                     /isolation_source="urine from a congenitally infected
                     infant"
                     /host="Homo sapiens"
                     /db_xref="taxon:10359"
                     /country="United Kingdom"
                     /collection_date="2001"
                     /note="sequenced at passage 3 in human fibroblasts; three
                     genes are mutated (RL13, UL40 and UL128);
                     acronym: HCMV; acronym: HHV-5"
     repeat_region   1..1218
                     /note="TRL"
                     /rpt_type=inverted
     repeat_region   1..500
                     /note="'a' sequence"
                     /rpt_type=direct
                     /rpt_type=terminal
     misc_feature    1219..194104
                     /note="UL"
     gene            1261..2193
                     /gene="RL1"
     CDS             1261..2193
                     /gene="RL1"
                     /note="RL1 family"
                     /codon_start=1
                     /product="protein RL1"
                     /protein_id="AAR31283.1"
                     /translation="MPATDTNSTHTTPLHPEHQHTLPLHHSTTQPHVQPSDKHADKQH
                     RTQMELDAADYAACAQARQHLYAQTQPQLHAYPNANPQESAHFCTENQHQLTNLLHNI
                     GEGAALGYPVPRAEIRRGGGDWADSASDFDADCWCMWGRFGTMGRQPVVTLLLARQRD
                     GLADWNVVRCRGTGFRAHDSEDGVSVWRQHLVFLLGGHGRRVQLERPSAGEAQARGLL
                     PRIRITPISTSPRPKPPQPTTSTASHPHATARPDHTLFPVPSTPSATVHNPRNYAVQL
                     HAETTRTWRWARRGERGAWMPAETFTCPKDKRPW"
     gene            complement(2382..4899)
                     /gene="RNA2.7"
     ncRNA           complement(2382..4873)
                     /ncRNA_class="other"
                     /gene="RNA2.7"
                     /product="RNA2.7"
     regulatory      complement(2399..2404)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RNA2.7"
     regulatory      complement(4894..4899)
                     /regulatory_class="TATA_box"
                     /gene="RNA2.7"
     gene            complement(5288..5575)
                     /gene="RL5A"
     CDS             complement(5288..5575)
                     /gene="RL5A"
                     /note="RL11 family; contains 17 nt deletion causing
                     frameshift"
                     /codon_start=1
                     /product="protein RL5A"
                     /protein_id="AAO48771.1"
                     /translation="MDMKKLNTTQGGNLTIVDDSGRFSTEWKRWDNDGGSLCNVTSNG
                     TTVVNTTVCVSSCSHTSLVLCNMTQQTDSLYGVGHRLNDEEDGEMWRVSVS"
     gene            complement(5860..6168)
                     /gene="RL6"
     CDS             complement(5881..6168)
                     /gene="RL6"
                     /note="RL11 family"
                     /codon_start=1
                     /product="protein RL6"
                     /protein_id="AAR31285.3"
                     /translation="MANVHVKTGDDKTVSANLKTVWSFFDGKNDTDVCSVEGTKNYTL
                     ATPPIHGVCNCSHTGLTFCNVTQGNEGSYDLKRRVDNGPEQVDTWFLIVTK"
     regulatory      complement(6069..6074)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RL6"
     gene            complement(6591..7643)
                     /gene="RNA1.2"
     ncRNA           complement(6591..7613)
                     /ncRNA_class="other"
                     /gene="RNA1.2"
                     /product="RNA1.2"
     regulatory      complement(7638..7643)
                     /regulatory_class="TATA_box"
                     /gene="RNA1.2"
     gene            complement(7744..8016)
                     /gene="RL8A"
     CDS             complement(7744..8016)
                     /gene="RL8A"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein RL8A"
                     /protein_id="AFP95498.1"
                     /translation="MPHGHLRQVLSPTSWTCEGLLLLLGLLVLFFHHHNQSAVERRRR
                     VSFVEADRLPHESGWYSSDDDGDRDGDEETGESHNRNSVGLSAVFS"
     gene            complement(8082..8225)
                     /gene="RL9A"
     CDS             complement(8082..8225)
                     /gene="RL9A"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein RL9A"
                     /protein_id="AFP95499.1"
                     /translation="MSLDAAGHQPEARRLLDSALVRRVLACMIIVIMIAISIWILTYV
                     LFL"
     gene            8433..8945
                     /gene="RL10"
     CDS             8433..8945
                     /gene="RL10"
                     /note="type 1 membrane protein; possibly related to RL11
                     family"
                     /codon_start=1
                     /product="envelope glycoprotein RL10"
                     /protein_id="AAR31286.1"
                     /translation="MYPRVMHAVCFLALGLISYVAVCAENTVTTNCLVKAENTHLTCK
                     CNPNTTSNTNNGSKCHAVCKCRVTEPITMLGAYSAWGAGSFVATLIVLLVVFFVIYAR
                     EEEKNNTGTEVDQCLAYRSLTRKKLEQHAAKKQNIYERIPYRPSRQNDNSPLIEPTGT
                     DDEEDEDDDV"
     gene            8974..9678
                     /gene="RL11"
     CDS             8974..9678
                     /gene="RL11"
                     /note="type 1 membrane protein; binds IgG Fc; involved in
                     immune regulation; RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein RL11"
                     /protein_id="AAR31287.1"
                     /translation="MQTYSTPLTLVIVTSLFLFTTQGSSSNAVEPTKKPLKLANYRAT
                     CEDRTRTLVTRLNTSHHSVVWQRYDIYSRYMRRMPPLCIITDAYKETTHQGGATFTCT
                     RQNLTLYNLTVKDTGVYLLQDQYTGDVEAFYLIIHPRSFCRALETRRCFYPGPGRVVV
                     TDSQEADRAIISDLKRQWSGLSLHCAWVSGLMIFVGALVICFLRSQRIGEQDAEQLRT
                     DLDTEPLLLTVDGDLE"
     gene            9682..10926
                     /gene="RL12"
     CDS             9682..10926
                     /gene="RL12"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein RL12"
                     /protein_id="AAR31288.1"
                     /translation="MRVDRQKRNNFTYRQTVYIILTFYIVYRGKCNSTDTNNSTSTSD
                     STVSDTSVYSTPNLPSTFFTTLDTSTGSQISTASNTISSTTNTLAASSITTLNTSTNT
                     TSYTASTLTALSSTHTNSPILSNNATLYTTSLDNTTTDITSSESSINASTIHNTTYSP
                     VTSIAVNCTVAANETNNSSSKNCQQDIGTIRVKSTTLTAEEGKNITIQGNSTWNCPNV
                     VWYRHYNWSTHGHHIYPNRRYQTPTYRHKILTSHPICHPDVSSPAAYHDLCRSCNKTE
                     LRIYDLNTTNSGRYSRRCYKEYNHDGPHEDENFGLTVNPRNDTDNHTTPLCPRYVGTQ
                     SEEDEDDDYTLSTITNNNMRKTSHRDISHGTRTTWALTLICIACILLFFVRRALNKRY
                     RPLRDDISESSFVVRYHPEHED"
     misc_feature    11021..11904
                     /note="similar to RL13; contains 2 nt insertion causing
                     frameshift; RL11 family"
     gene            12008..12664
                     /gene="UL1"
     CDS             12008..12664
                     /gene="UL1"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein UL1"
                     /protein_id="AAR31289.1"
                     /translation="MSVRCNSKLLLLAVLITIILSSILVQAIPHKQKTSYQQLLLQSG
                     HVQIPITVAEGDTICFNVSDNPCNFSSYWNHNNCELCGWTPFYSEYAGYSENKSCHPR
                     FTCLHDTKGLKLHNVTTNDSGIYTRNVYYCDIPCNISDDHKHNVEDFNNCNTTINRTH
                     YIITVSSSRYSNRTNSHVATHVGWTATVVIIICVLTYVNVTTTLKHRLRTRNNVNHTM
                     "
     gene            complement(13045..13224)
                     /gene="UL2"
     CDS             complement(13045..13224)
                     /gene="UL2"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL2"
                     /protein_id="AAR31290.1"
                     /translation="MAEDSVTILIVEDDDAYPSFGSLPASHAQYGFRLLRGIFLIMLV
                     IWTAVWLKLLRDALL"
     gene            13655..14104
                     /gene="UL4"
     CDS             13655..14104
                     /gene="UL4"
                     /note="contains signal peptide; RL11 family"
                     /codon_start=1
                     /product="envelope glycoprotein UL4"
                     /protein_id="AAR31291.1"
                     /translation="MMLRTWILLPMVLLDAYCFCIFVSCSISTTTAPVEWKSPDRQIP
                     MNITCANYSGTVNGNVTFRGLQNKTEDFLHWLLGWGHKSICSFFPKLQGNKEQHYMYG
                     ITNLTYNCTYDRLTLLNLTTENSGKYYFKREDVNSTFYYSCYNLTVT"
     gene            14192..14689
                     /gene="UL5"
     CDS             14192..14689
                     /gene="UL5"
                     /note="contains potential transmembrane domain; RL11
                     family"
                     /codon_start=1
                     /product="protein UL5"
                     /protein_id="AAR31292.1"
                     /translation="MFLGYSDCVDPGFAVYCVSRSRLTLVFVVWLVGLRLHDCATFES
                     CCYDITEAESNKAISRDEAAFTSGMSTRTPSLAIAPPPDRSMLLSREEELVPWSRLII
                     TKQFYGGLIFHTTWVTGFVLLGLLTLFASLFRVPQSICRFCIDRLRDIARPLKYRYQR
                     LVATV"
     gene            14797..15636
                     /gene="UL6"
     CDS             14797..15636
                     /gene="UL6"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein UL6"
                     /protein_id="AAR31293.2"
                     /translation="MNGRAGVCLVTHCLNTRSRTYVALNMLAFARTPRGMTSCLFNKV
                     WVSRYVLVLILIVCAFKGSTSSVIIHRPLNCSTVTRTAGQNAELCGTLSPGCNVTQWG
                     RYENGSTLGPWCTLWGPYTRVSLRHRVAFGCSLTTFFIYNVSQNHSGTYYRKGDNCTD
                     KHITLSCFDLTVHPKAAQSTTTVVTPTVVTNATANVSPITSTLTVNSNAFEHVSYQRQ
                     RRVENGTLSKNITNLAFTYGSWGVAMLLFAAVMVLVDLGLPQSAWRRWRSHVDDEERG
                     LLT"
     gene            15696..16772
                     /gene="UL8"
     CDS             join(15696..16280,16383..16772)
                     /gene="UL8"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL8"
                     /protein_id="AAR31295.2"
                     /translation="MVSGAGSHLLTVPRFRWTVHHMYNKLLILTLFAPVILESVIYVY
                     APEGGNVTLVSNFTSNISVRWFRWNGNCSHLICFYKRGEGLSTPYVGLSLSCAASQIT
                     IFNLTLNDSGRYGAEGFVRSDENETFLWYNLTVKPNPLETTPVSNVTTIVTTIPTVTG
                     TKSNVTWNASFAPQLRAVAGFSNQTPLENNTHLALGEGFVPTMTSSRLSASENYDGNY
                     ELTETANTTRTNTSDWITLGSSASLLKSTETAVNLSNATTVIPQPVEYPAGEVQYQRA
                     ATHYSWMLIIVIILIIFIIICLRAPRKIYHHWKDSKQYGQVFMTDTEL"
     gene            15696..16364
                     /gene="UL7"
     CDS             15696..16364
                     /gene="UL7"
                     /note="type 1 membrane protein; modulates cytokine
                     production; involved in immune regulation; RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL7"
                     /protein_id="AAR31294.1"
                     /translation="MVSGAGSHLLTVPRFRWTVHHMYNKLLILTLFAPVILESVIYVY
                     APEGGNVTLVSNFTSNISVRWFRWNGNCSHLICFYKRGEGLSTPYVGLSLSCAASQIT
                     IFNLTLNDSGRYGAEGFVRSDENETFLWYNLTVKPNPLETTPVSNVTTIVTTIPTVTG
                     TKSNVTWNASFAPQLRAVAGFSNQTPLENNTHLALVGVVVFLILIVVCIMGWWKLLCS
                     KSEL"
     gene            16778..17479
                     /gene="UL9"
     CDS             16778..17479
                     /gene="UL9"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL9"
                     /protein_id="AAR31296.1"
                     /translation="MSKRLQVFPWITILFYTSKSQYWNYMTIPCTPTVGYGSHNISLH
                     PLNNSLFQDDVFEWYIDKPMVTNKLCLYQSNERIKSNLDSPNIMWQCTDNRTLILMNL
                     TTTYSRNYYFQSFKYLGQGVPKPNNLCYNVSVHFTHQTHCHTTTSSLYPPTSVHDSLE
                     ISQSFTSTNFTHTAVHYAAGNVEAQHDTATSHTMWIIPLVIVITIIVLICFKFPQKAW
                     NKFTQYRYSGMLAAA"
     gene            17607..18371
                     /gene="UL10"
     CDS             17607..18371
                     /gene="UL10"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein UL10"
                     /protein_id="AAR31297.1"
                     /translation="MRQLINHIVNHDLFRWSVVTAMIFYRYSETCMEVTVRVGDPVTL
                     GSGHGYHPGQKVHWYNQSCVGIGNGENTHPICTYDPPKPGRQKTMKTTPLPSPLLYEC
                     HNSTLSILHVNVSDPRNYCRRKCPPKGNCEFPTCFTLSLISRTTTRKPEQTTTLLRLK
                     TTPNKHTQHKRSTRRTSPKDYNVTGFPKGFADSFTGNVEAHRTKDAAHSAWILIIIII
                     IIVVILFFFKIPQRLREKWDTKGYLYKGTDGLPTTD"
     gene            18473..19291
                     /gene="UL11"
     CDS             18473..19291
                     /gene="UL11"
                     /note="type 1 membrane protein; disrupts T cell function
                     via inhibition of CD45; involved in immune regulation;
                     RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL11"
                     /protein_id="AAR31298.1"
                     /translation="MLFRYITFHREKVLYLTAACIFGVYISLHDACIPVVGKIGTNVT
                     LNAVDVLPPRDQVRWSYGPGGQGYMLCIFTGTSTTTFNNTRFNFSCLSNYSLLLINVT
                     TQYSTTYRTMTSLDHWLHQRHNHGSRWTLDTCYNLTVNENGTFPTTTTKKPTTTTRTT
                     TTTTQRTTTTRTTATAKKTTISTTHHKHPSPKKSTTPNSHVEHHVGFEATVAETPLQP
                     SPQHQHVATHALWVLAVVIVIIIIIIFYFRIPQKLWLLWQHDKHGIVLIPQTDL"
     gene            19489..20910
                     /gene="UL13"
     CDS             19489..20910
                     /gene="UL13"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein UL13"
                     /protein_id="AAR31299.2"
                     /translation="MLWAHCGRFLRYHLLPLLLCRLPFLLLFQRPQWAHGLDIVEEDE
                     WLREIQGATYQLSIVRQAMQHAGFQVRAASVMTRRNAVDLDQPPLWSGSLPHLPVYDV
                     RSPRPLRPPSSQHHAVSPELPSRDGIRWQYQELQYLVEEQRRRNQSRNAIPRPSFPPP
                     DPPSQPAEDARDADAERAESPHSAESTVRHDASENAVRRRHERRRYNALTVRSRDSLL
                     LTRIRFSNQRCFGRGRLRHPAGSGPNTGGPRPGGAGLRQLRQQLTVRWQLFRLRCHGW
                     TQQVSSQIRTRWEESNVVSQTATRVRTWFVERTTFWRRTWVPGQNPAAEAQELAVIPP
                     APTVLRQNEEPRQQLTGEETRNSTHTQREEVEDVSREGAREGNDGSRASGNDERRNNA
                     GRYDDDHEVQEPQVTYPAGQGELNRRSQEENEEGGPCESPPMTTNTLTVACPPREPPH
                     RALFRLCLGLWVSSYLVRRPMTI"
     gene            21060..22043
                     /gene="UL14"
     CDS             21060..22043
                     /gene="UL14"
                     /note="type 1 membrane protein; possibly involved in
                     immune regulation; UL14 family"
                     /codon_start=1
                     /product="membrane protein UL14"
                     /protein_id="ACS93359.1"
                     /translation="MGGGRLPPLWLPLLIAWSEWGNCCLDAPPVVRSPCLQPVRDRNR
                     ERNPGSPQLLPYGDRLEVACIFPAHDWPEVSIRVHLCYWPEIVRSLVVDARSGQVLHN
                     DASCYIAGGHWRFEDGGAAQRLSLSFRLITETAGTYTCVLGNETHSLATETTALVADV
                     HDLRHSDRSCDLAFGSRSQTRYLWTPDPSRLRSINCGWEGERHRVVHYIPGTSGLLPS
                     CEEDERELCVPFISQSIADNNCSRRHRVDGARRRYHLRRDYWLTDPKIGLLAAGSVAL
                     TSLCHLLCYWCSESYRRLNTEEESEAAEETAAGEASAVAAAAVSEEEQRRE"
     gene            22056..22364
                     /gene="UL15A"
     CDS             22056..22364
                     /gene="UL15A"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL15A"
                     /protein_id="ACS93360.1"
                     /translation="MKRMIRSHGRKTECQMTGAGERRGSAVGAPICGSGTRRGSGANE
                     RRDSDVGPIAHSSGTRRGSANETSACTRTDHQKADIGLWFMFLVFGLCSWLAMRYRAQ
                     "
     gene            22585..23277
                     /gene="UL16"
     CDS             22585..23277
                     /gene="UL16"
                     /note="type 1 membrane protein; inhibits NK cell
                     cytotoxicity; sequesters MICB, ULBP1 and ULBP2; acts on
                     activating receptor NKG2D; involved in immune regulation"
                     /codon_start=1
                     /product="membrane glycoprotein UL16"
                     /protein_id="ACS93361.1"
                     /translation="MERRRGTVPLGWVFFVLCLSASSSCAVDLGSKSSNSTCRLNVTE
                     LASIHPGETWTLHGMCISICYYENVTEDEIIGVAFTWQHNESVVDLWLYQNDTVIRNF
                     SDITTNILQDGLKMRTVPVTKLYTSRMVTNLTVGRYDCLRCENGTTKIIERLYVRLGS
                     LYPRPPGSGLAKHPSVSADEELSATLARDIVLVSAITLFFFLLALRIPQRLCQRLRIR
                     LPHRYQRLRTED"
     gene            23385..23699
                     /gene="UL17"
     CDS             23385..23699
                     /gene="UL17"
                     /note="possibly related to UL19"
                     /codon_start=1
                     /product="protein UL17"
                     /protein_id="ACS93362.1"
                     /translation="MDHALFTHFVGRPRHCRLEMLILDEQVSKRSWDTTVYHRRRKHL
                     PRRRAPCGPQRPAEIPKRRKKAAVLLFWHDLCWLFRRLFFPREDSEPLMSDPARSPEE
                     EE"
     gene            23808..24914
                     /gene="UL18"
     CDS             23808..24914
                     /gene="UL18"
                     /note="type 1 membrane protein; inhibits NK cell
                     cytotoxicity; acts on inhibitory receptor LIR-1 (ILT2);
                     involved in immune regulation; MHC family"
                     /codon_start=1
                     /product="membrane glycoprotein UL18"
                     /protein_id="ABA41586.1"
                     /translation="MMTMWCLTLFVLWMLRVVGMHVLRYGYTGIFDDTSHMTLTVVGI
                     FDGQHFFTYHVNSSDKASSRANGTISWMANVSAAYPTYLDGERAKGDLIFNQTEQNLL
                     ELEIALGYRSQSVLTWTHECNTTENGSFVAGYEGFGWDGETLMELKDNLTLWTGPNYE
                     ISWLKQNKTYIDGKIKNISEEDTTTQRNYLKGNCTQWSVIYSGFQTPVTHPVVKGGVR
                     NQNDNRAEAFCTSYGFFPGEINITFIHYGDKVPEDSEPQCNPLLPTFDGTFHQGCYVA
                     IFCNQNYTCRVTHGNWTVEIPISITSPDDSSSGEVPDHPTASKRYNTMTISSVLLALL
                     LCALLFAFLHYFTTLKQYLRNLAFAWRYRKVRSS"
     gene            24911..25207
                     /gene="UL19"
     CDS             24911..25207
                     /gene="UL19"
                     /note="possibly related to UL17"
                     /codon_start=1
                     /product="protein UL19"
                     /protein_id="ACS93363.1"
                     /translation="MTSNALYELFRRRLPRAPVNTVMFLTRRTRDGFCGRLTSIATNS
                     YYTMFVLDHGSVRIERPSQSEVDCASLMETLKRIRLRNSWVASEDELDVSRRDA"
     gene            25470..26486
                     /gene="UL20"
     CDS             25470..26486
                     /gene="UL20"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL20"
                     /protein_id="ACS93364.1"
                     /translation="MLGIRAMLVMLDYYWIQLITNNGTRSNNTDTIFVSLLTGPNGVT
                     RTAIGGLYSNYTNLTGAFGFTSTNMSATNSSAEDNWSVTNLTESCINRGESYVTTIWL
                     LDCTKNDTYWYYGNAYNHTCEGTISGYLLGMCKLWKSWVNNITSYNTVRVESLGNETR
                     CMLLPRQYTLNATVEWYNKSEGDVPEEFMDYVILTPLAVLTCGLQEAYILDKGRRYMY
                     LFSVSCVGITGTVSIILVSLSLLILICYYRCGRLLICPRGFELLPEFTEEEEEKEKLL
                     THNDIEVQVPIRTRRLLVPWIRESKMWVLPPPLPPRPPHLIEFPPSPPPSPGPMHMVV
                     CMPA"
     gene            complement(26633..27004)
                     /gene="UL21A"
     CDS             complement(26633..27004)
                     /gene="UL21A"
                     /note="facilitates viral DNA synthesis"
                     /codon_start=1
                     /product="protein UL21A"
                     /protein_id="ACS93365.1"
                     /translation="MGGSPVPQLTTVTQGLMPSVRMDFRARRPLRRLAFYAPRARRRL
                     FQNHIHPEQRRVLVGEGDEEMLPDLPMEIDIVIDRPPQQPLPNPLVLLLDDVPPHVPG
                     FAPYRVPRPHPMIPEEHWDQF"
     gene            27273..27674
                     /gene="UL22A"
     CDS             join(27273..27358,27443..27674)
                     /gene="UL22A"
                     /note="contains signal peptide; secreted protein; binds CC
                     chemokine RANTES; involved in immune regulation"
                     /codon_start=1
                     /product="glycoprotein UL22A"
                     /protein_id="ACS93366.1"
                     /translation="MARRLWILSLLAVTLTVALAAPSQKSKRSVTVEQPSTSTNSDGN
                     TTPSKNVTLSQGGSTTDGDEDYSGGDYDVLITDTDGGNHQQPQEKTDEHKEEHTKENE
                     KTQ"
     gene            complement(28041..28895)
                     /gene="UL23"
                     /note="beta gene"
     CDS             complement(28041..28895)
                     /gene="UL23"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein UL23"
                     /protein_id="ACS93367.1"
                     /translation="MSVIKDCFLNLLDRWRPPKTSRPWKPGQRVALVWPKDRCLVIRR
                     RWRLVRDEGRDAQRLASYLCCPEPLRFVGSICTYNFLKHKGDHNVPSELYLGASGAMY
                     LWTDHIYSDSLTFVAESITEFLNIGLRRCNFITVPEELPHTASLRALAGCMHIHAFAQ
                     WRATYRGRLMVMGDYSVIRVSTIRLYDWSEINDWRVMVGSNHVEPLGWLVSPYDVINL
                     FVDDCMRVFAANNQHVCIVADSLMEFVARGMTRCHENGIYYGTRSMRKLNQPTCPYGV
                     DHQLFDDA"
     gene            complement(29111..30187)
                     /gene="UL24"
                     /note="beta gene"
     CDS             complement(29111..30187)
                     /gene="UL24"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein UL24"
                     /protein_id="ACS93368.2"
                     /translation="MEETRVGRYIVRAGSGGQTEDTASGAESVLATLAAVRTRRRSVV
                     CDGPPGSPTDSARHMSDLASLALTAEFGLGCLEAYVRINAGQVLPVVWPPGWNLVLQE
                     IETDEDFKPEDVKAWSHYLCCQTRLAFVGRFVNEGVLSPDQQKKTAVCLISDEGYVFC
                     YVREDTAVYYLARNLMEFARVGLRAVETLHCMRYLTSSLVKRYFRPLLRAWSLGLDTM
                     ARFIIRHHGQFMPLTYPPGTELRLCNLRCFENSVEGGHLLRNIKTAFGMRVLGLGTVS
                     LKGENAPFPHLRWPVDLIPIVVAYTGAVYACDVRDDRYIRVGDNLNTFMCLGLNLLFE
                     NRRFSGHNGIYDRVPDCPKGRQHR"
     gene            30235..32205
                     /gene="UL25"
     CDS             30235..32205
                     /gene="UL25"
                     /note="UL25 family"
                     /codon_start=1
                     /product="tegument protein UL25"
                     /protein_id="ACS93369.1"
                     /translation="MSSRRRSSSRRSGEPSTVIYIPSSNEDTPADEEAEDSVFTSTRA
                     RSATEDLDRMEAGLSPYSVSSDAPSSFELVRETGGTGAAKKPSEKKRSSSRRQPQIAA
                     GAPRGSPATPKAGKSPKVSRPPSVPSLPENGAGGGGDDNSSSGGSSSRTTSNSSRSTS
                     PVAPGEPSAAEGDEFSFCDSDIEDFERECYRVSVADNLGFEPSVVAPQHVEYLKFVLQ
                     DFDVQHLRRLNECIPMPAFALTSLVDPVLNNVAPGERDLTRRIITHAVIINYYYVAQK
                     KARHMVEAIRTTVRGDTVRRVAAQVNNQSRSGRAAALALHFLTSRKGVTDGQYATSLR
                     RLDEELRHRGTPESPRLTEVYQTLRDYNVLFYTAHYTSRGALYLYRQNLQRLNENHRG
                     MLRLLSVEEICEEHTLNDLAFLVGVELMITHFQRTIRVLRCYLQHQLQSISELCYLIY
                     VQLPSLREDYAQLSDVIYWAVSQNYDYALYASTPALFDFLRVVRQQDAFICTDYVYCA
                     LRLLACPDRPIIGDTGGSSSSQRLVGEFMVRDPLLRDPRATHLRQKLITRDICVARLQ
                     AQPSSRHIPVEHTGVSSVTLLKIFSQVPPDEREEDTLREMALKAFMEANGNHPEQICR
                     SPPPPLPPRDYPQRDERDRHRRDRRDSGEYCC"
     gene            complement(32385..32951)
                     /gene="UL26"
     CDS             complement(32385..32951)
                     /gene="UL26"
                     /note="transcriptional activator of major immediate early
                     promoter; involved in gene regulation; US22 family"
                     /codon_start=1
                     /product="tegument protein UL26"
                     /protein_id="ACS93370.1"
                     /translation="MTSRRAPDGGLNLDDFMRRQRGRHLDLPYPRGYTLFVCDVEETI
                     LTPRDVEYWKLLVVTQGQLRVIGTIGLANLFSWDRSVAGVAADGSVLCYEISRENFVV
                     RAADSLPQLLERGLLHSYFEDVERAAQGRLRHGNRSGLRRDADGQVIRESACYVSRAL
                     LRHRVTPGKQEITDAMFEAGNVPSALLP"
     gene            complement(33007..34833)
                     /gene="UL27"
                     /note="beta gene"
     CDS             complement(33007..34833)
                     /gene="UL27"
                     /note="low-level resistance to maribavir"
                     /codon_start=1
                     /product="protein UL27"
                     /protein_id="ACS93371.1"
                     /translation="MNPVDQPPPPLPTQQPEEQAKEDHDDGDERLFRDPLTTYEYLDD
                     CRDDEEFCHQFLRAYLTPIRNRQEAVRAGLLCRTPEDLAAAGGQKKKTPAPKHPKHAM
                     VYIRRSCLVHSACATAHGKYDIRGLTLESDLAVWAALRGVPLPPDPQHFRWLNAGAFR
                     RLVHEAQYLPEISRAAKRIALAVATGQYVVCTLLDYKTFGTRTHYLRQLCSMTEELYL
                     RLDGTLCLFLEPEERELIGRCLPAALCRGLPVKYRTHRAAVFFHATFMARAEAALKDL
                     YAAFCECGDGRDDGGNHDGNHGGGDHSSLSLSAAASHHSRLEHAELRLERNRHLGAFH
                     LPAIRHLTAGDVARVQNSVSRDLGFADWSQTLVDDYFLLPAGWACANPRRGYAMYLAS
                     NAVLALRIIRLLRASIRHEYTACIRMLSGDVQRLIRLFKGEAALLRKGLAQNPVQRRE
                     LSRFRKHVHDLKRIRFTEDTFVETFCDFLELVQRIPDYRSVSLRIKRELLCLHVFKLR
                     RGCRAPPTPETARVQRLLWHSLRHGDAPQDRTRLPQFSSALSDAELSNHANRCRRKTP
                     LELGPAVVAAPGPSVRYRAHIQKFERLHVRRFRPHEVGGHAT"
     gene            complement(34930..37181)
                     /gene="UL29"
                     /note="beta gene"
     CDS             complement(join(34930..35956,36103..37181))
                     /gene="UL29"
                     /note="US22 family"
                     /codon_start=1
                     /product="protein UL29"
                     /protein_id="ACS93372.1"
                     /translation="MSGRRKGCSAATASSSSSSPPSRLPPLPGHARRPRRKRCLVPEV
                     FCTRDLADLCVRRDYEGLRRYLRRFEGSCVSLGWPSQCIYVVGGEHSPHSLTEIDLEH
                     CQNDFFGEFRALHLIGTVSHATCRYQVFVDAYGAVFAYDAQEDCLYELASDLAGFFAK
                     GMIRCDPVHESICARLQPNVPLVHPDHRAELCRRSRASARGRYLRSLLAFRELLACED
                     TAARCAYVEAHREAQLTLIWPEKHSLVLRTARDLGLSASMLRRFQRSLYTREPVMPLG
                     EIEGAEDKTFFHRVRILCGDTGTVYAALVGQDKLVRLARDLRGFVRVGLALLIDDFRY
                     ESIGPVDRSSLYEANPELRLPFKKRRLVVGYFDSLSSLYLRGQPKFSSIWRGLRDAWT
                     HKRPKPRERASGVHLQRYVRATAGRWLPLCWPPLHGIMLGDTQYFGVVRDHKTYRRFS
                     CLRQAGRLYFIGLVSVYECVPDANTAPEIWVSGHGHAFAYLPGEDKVYVLGLSFGEFF
                     ENGLFAVYSFFERDYVDEIVEGAWFKHTFAGMYELSQILHDRANLLRVCQLHAGSKIR
                     LGGSPACTFTFGSWNVAEADEANNFVIGVLEQAHFVVIGWMEPVNKAVFMDAHGGIHV
                     LLYGTMLVKLAETLRGFIRQGSFWFRCPRRFCFSPLDSSATVAAKPVSSHTSPAYDVS
                     EYVFSGRSVLDSVSGTGAS"
     gene            complement(37311..37676)
                     /gene="UL30"
     CDS             complement(37311..37676)
                     /gene="UL30"
                     /note="UL30 family"
                     /codon_start=1
                     /product="protein UL30"
                     /protein_id="ACS93373.1"
                     /translation="MTTSAMTAPDTRRQLQHVETLRRFLRGDSCFVHDLRGMMDYHEG
                     LSRRQQRAFCRASRVLTDPEPIQSEAEGENKQFTEHTHKVVSFFIKSVFVFPYLVLPN
                     CCQVSVDRSRVPETGGRWL"
     gene            complement(37722..37961)
                     /gene="UL30A"
     CDS             complement(37722..37961)
                     /gene="UL30A"
                     /note="UL30 family;
                     alternative start codon"
                     /codon_start=1
                     /transl_except=(pos:complement(37959..37961),aa:Met)
                     /product="protein UL30A"
                     /protein_id="AGL39521.1"
                     /translation="MACRDARWVRFIRLRTLWSVRPRAHVADLEDFAAFYRTLSDSEQ
                     QEFEQEAELASRSQRVRHLREARRQLKMDLMCHGG"
     gene            38155..39942
                     /gene="UL31"
                     /note="beta gene"
     CDS             38155..39942
                     /gene="UL31"
                     /note="DURP family"
                     /codon_start=1
                     /product="protein UL31"
                     /protein_id="ACS93374.1"
                     /translation="MGDKPTLVTLLTVAVSSPPPSSPLPLVSFTELLLPPPSVAAAAV
                     AATATSEVGEKTAEQEVAAAGPETGNERRENREDEGGETRTTGTTAVKRSHDGIPRQL
                     AERLRLCRHMDPEQDYRLPAQDVVTSWIEALRDADRDNYGRCVRHAKIHRSASHLTAY
                     ESYLVSITEQYNTASNVTEKASYVQGCIFLSFPVIYNNTQGCGYKYDWSNVVTPKAAY
                     AELFFLLCSTSESSVVLQPLITKGGLCSSMAVYDEETMRQSQAMQIGFLHTQLVMVPF
                     VPHACPHYAVPFTTPGKPGCGGAPSGVAGLEETAPFGRVSVTRHGATLLCRVDHLTWI
                     SKRVTTYGHKKITRYLAQFRGTMDDDEAALPGEDEAWIASKNVQYEFMGLIFTVNVDS
                     LCVDAEQRQLLGTVATSFCHRVSDKITARNMPRAFSFYLLTSPQRGYDLRFSRNPSLF
                     FSGDALNCPLLNEPNVFSLTVHAPYDIHFGVQPRQTVELDLRYVQITDRCFLVANLPH
                     EDAFYTGLSVWRGGEPLKVTLWTRTRSIVIPQGTPIATLYQITEGDGNVYSYNHHTVF
                     RQMHAAGTTTFFLGDMQLPADNFLTSPHP"
     gene            complement(40023..43172)
                     /gene="UL32"
                     /note="beta gene"
     CDS             complement(40023..43172)
                     /gene="UL32"
                     /note="major tegument protein; binds to capsids"
                     /codon_start=1
                     /product="tegument protein pp150"
                     /protein_id="ACS93375.1"
                     /translation="MSLQFIGLQRRDVVALVNFLRHLTQKPDVDLEAHPKILKKCGEK
                     RLHRRTVLFNELMLWLGYYRELRFHNPDLSSVLEEFEVRCAAVARRGYTYPFGDRGKA
                     RDHLAVLDRTEFDTDVRHDAEIVERALVSAVILAKMSVRETLVTAIGQTEPIAFVHLK
                     DTEVQRIEENLEGVRRNMFCVKPLDLNLDRHANTALVNAVNKLVYTGRLIMNVRRSWE
                     ELERKCLARIQERCKLLVKELRMCLSFDSNYCRNILKHAVENGDSADTLLELLIEDFD
                     IYVDSFPQSAHTFLGARSPSLEFDDDANLLSLGGGSAFSSVPKKHVPTQPLDGWSWIA
                     SPWKGHKPFRFEAHGSLAPAADAHAARSAAVGYYDEEEKRRERQKRVDDEVVQREKQQ
                     LKAWEERQQNLQQRQQQPPPPARKPSASRRLFGSSADEDDDDDDDDEKNIFTPIKKPG
                     TSGKGAASGGGVSSIFSGLLSSGSQKPTSGPLNIPQQQQRHAAFSLVSPQVTKASPGR
                     VRRDSAWDVRPLTETRGDLFSGDEDSDSSDGYPPNRQDPRFTDTLVDITDTETSAKPP
                     VTTAYKFEQPTLTFGAGVNVPAGAGAAILTPTPVNPSTAPAPAPTPTFAGTQTPVNGN
                     SPWAPTAPLPGDMNPANWPRERAWALKNPHLAYNPFRMPTTSTASQNTVSTTPRRPST
                     PRAAVTQTASRDAADEVWALRDQTAESPVEDSEEEDDDSSDTGSVVSLGHTTPSSDYN
                     NDVISPPSQTPEQSTPSRIRKAKLSSPMTTTSTSQKPVLGKRVATPHASARAQTVTST
                     PVQGRLEKQVSGTPSTVPATLLQPQPASSKTTSSRNVTSGAGTSSASSARQPSASASV
                     LSPTEDDVVSPATSPLSMLSSASPSPAKSAPPSPVKGRGSRVGVPSLKPTLGGKAVVG
                     RPPSVPVSGSAPGRLSGSSRAASTTPTYPAVTTVYPPSSTAKSSVSNAPPVASPSILK
                     PGASAALQSRRSTGTAAVGSPVKSTTGMKTVAFDLSSPQKSGTGPQPGSAGMGGAKTP
                     SDAVQNILQKIEKIKNTEE"
     gene            43243..44602
                     /gene="UL33"
                     /note="beta gene"
     CDS             join(43243..43266,43388..44602)
                     /gene="UL33"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     putative chemokine receptor; involved in intracellular
                     signalling; GPCR family"
                     /codon_start=1
                     /product="envelope glycoprotein UL33"
                     /protein_id="ACS93376.1"
                     /translation="MDTIIHNSTRNNTPPHINDTCNMTGPLFAIRTTEAVLNTFIIFV
                     GGPLNAIVLITQLLTNRVLGYSTPTIYMTNLYSTNFLTLTVLPFIVLSNQWLLPAGVA
                     SCKFLSVIYYSSCTVGFATVALIAADRYRVLHKRTYARQSYRSTYMILLLTWLAGLIF
                     SVPAAVYTTVVMHHDANDTNNTNGHATCVLYFVAEEVHTVLLSWKVLLTLVWGAAPVI
                     MMTWFYAFFYSTVQRTSQKQRSRTLTFVSVLLISFVALQTPYVSLMIFNSYATTAWPM
                     QCEHLTLRRTIGTLARVVPHLHCLINPILYALLGHDFLQRMRQCFRGQLLDRRAFLRS
                     QQNQRATAETNLAAGNNSQSVATSLDTNSKNCNQHAKRSVSFNFPSGTWKGGQKTASN
                     DTSTKIPHRLSQSHHNLSGV"
     gene            44970..46193
                     /gene="UL34"
     CDS             44970..46193
                     /gene="UL34"
                     /note="represses US3 transcription; involved in gene
                     regulation"
                     /codon_start=1
                     /product="protein UL34"
                     /protein_id="ACS93377.1"
                     /translation="MNFIITTRDFSNDDSVLRAAEMRDNVAGSISKAYKGTVRAEGKK
                     KLLLKHLPVPPGGCSRRNSNLFVFCTERDYRKFHQGIAQLKRAPAELDPHEIQQVTAS
                     IRCRLQPSLREPPTPADELQTAVSRVCALFNQLVFTAQLRHYCEHQDKVVSYARDELT
                     KRCGEKSALGVEVHQLVALLPHERHRELCHVLIGLLHQTPHMWARSIRLIGHLRHYLQ
                     NSFLHLLMNSGLDIAQVFDGCYHSEAYRMLFQIGHTDSVSAALELSHSAAAGPPEADE
                     NNDEGEEDDDELRHSDPAPLHESKKPRNARRPRTRMPPHEQKPEENEEEEEELFPSCK
                     ATAAFLRAEPSVSNDDGNGGERCDTLATALRHCADEEDGPLVSQTAVRVAATPSPSVT
                     PALTPVTSPITPLCI"
     gene            46272..48197
                     /gene="UL35"
                     /note="beta gene"
     CDS             46272..48197
                     /gene="UL35"
                     /note="UL25 family"
                     /codon_start=1
                     /product="tegument protein UL35"
                     /protein_id="ACS93378.1"
                     /translation="MAQGSRAPSGPPLPVLPVDDWLNFRVDLFGDEHRRLLLEMLTQG
                     CSNFVGLLNFGVPSPVYALEALVDFQVRNAFMKVKPVAQEIIRICILANHYRNSRDVL
                     RDLRTQLDVLYSEPLKTRLLRGLIRLCRAAQTGVKPEDISVHLGADDVTFGVLKRALV
                     RLHRVRDALGLRASPEAEAHYPRLTTYNLLFHPPPFTTVEAVDLCAENLSDVTQRRNR
                     PLRCLTSIKRPGSRTLEDALNDMYLLLTLRHLQLRHALELQMMQDWVVERCNRLCDAL
                     YFCYTQAPETRQTFVTLVRGLELARQHSSPAFQPMLYNLLQLLTQLHEANVYLCPGYL
                     HFSAYKLLKKIQSVSDARERGEFGDEDEEQENDGEPREAQLDLEADPTAREGELFFFS
                     KNLYGNGEVFRVPEQPSRYLRRRMFVERPETLQIFYNFHEGKITTETYHLQRIYSMMI
                     EGASRQTGLTPKRFMELLDRAPLGQESEPEITEHRDLFADVFRRPVTDAASSSSASSS
                     SSSASPNSVSLPSARSSSTRTTTPASTYTSAGTSSTTGLLLSSSSLSGSHGISSADLE
                     QPPRQRRRMVSVTLFSPYSVAYSHHRRHRRRRSPPPAPRGPAHTRFQGPDSMPSTSYG
                     SDVEDPRDDLAENLRNL"
     gene            complement(48424..49958)
                     /gene="UL36"
                     /note="beta gene; immediate early gene"
     CDS             complement(join(48424..49652,49757..49958))
                     /gene="UL36"
                     /note="inhibitor of caspase-8-induced apoptosis; involved
                     in apoptosis; US22 family"
                     /codon_start=1
                     /product="tegument protein vICA"
                     /protein_id="ACS93379.1"
                     /translation="MDDLRDTLMAYGCIAIRAGDFNGLNDFLEQECGTRLHVAWPERC
                     FIQLRSRSALGPFVGKMGTVCSQGAYVCCQEYLHPFGFVEGPGFMRYQLIVLIGQRGG
                     IYCYDDLRDCVYELAPTMKDFLRHGFRHCDHFHTMRDYQRPMVQYDDYWNAVMLYRGD
                     VESLSAEVTKRGYASYTIDDPFDECPDTHFAFWTHNTEVMKFKETSFSVVRAGGSIQT
                     MELMIRTVPRITCYHQLLGALGHEVPERKEFLVRQYVLVDTFGVVYGYDPAMDAVYRL
                     AEDVVMFTCVMGKKGHRNHRFSGRREAIVRLEKTPTCQHPKKTPDPMIMFDEDDDDEL
                     SLPRNVMTHEEAESRLYDAITENLMHCVKLVTTDSPLATHLWPQELQALCDSPALSLC
                     TDDVEGVRQKLRARTGSLHHFELSYRFHDEDPETYMGFLWDIPSCDRCVRRRRFKVCD
                     VGRRHIIPGAANGMPPLTPPHAYMNN"
     gene            complement(50092..52896)
                     /gene="UL37"
                     /note="beta gene; immediate early gene"
     CDS             complement(join(50092..51033,51138..51180,52409..52896))
                     /gene="UL37"
                     /note="type 1 membrane protein; involved in apoptosis;
                     involved in gene regulation; major isoform (mitochondrial
                     inhibitor of apoptosis, vMIA) encoded by unspliced mRNA"
                     /codon_start=1
                     /product="envelope glycoprotein UL37"
                     /protein_id="ACS93380.1"
                     /translation="MSPVYVNLLGSVGLLAFWYFSYRWIQRKRLEDPLPPWLRKKKAC
                     ALTRRSRHRLRRQHGVIDGENSETERSVDLVAALLAEAGEESVTEDTEREDTEEERED
                     EEEENEARTPEVNPIDAEGLSGLAREACEALKKALRRHRFLWQRRQRARMLQHNGPQQ
                     FHHAAGFCRVHGLRGFQVSVWLLLTLLWSTGNGVSVRCTYHGTDINITSNTTSMNCQL
                     NCTCNNTQIYNGPCVGTEARLPLNVTFNQSRRQWHSVMLKFGFQYHLEGWFPLRVLNE
                     SHETNVTEVHGEVACFKNDTNITVGQLMLNFTGHSYVLRAVAHTSPFESHVHWEETNA
                     TSNITSNVTSLENTTTVMLTLAKYAESDYIFLQDMCPRFLRRTLKLTKKKTRNATFTG
                     TNVTSLPMWTPQCEGWKYWITLSMMWRNRRSALLRAKSRALGHWALLSICTVAAGSIA
                     LLSLFCILLIGLRRDLLEDFRYICRDEGSSSTKNDVHRIV"
     gene            complement(51318..52313)
                     /gene="UL38"
                     /note="beta gene"
     CDS             complement(51318..52313)
                     /gene="UL38"
                     /note="involved in apoptosis"
                     /codon_start=1
                     /product="protein UL38"
                     /protein_id="ACS93381.1"
                     /translation="MTTTTHSTAAIMSLLDEAEWRQTQMDVGGLIQASALGKVALRYA
                     VRKLMKRGARLRHDSGLYVCICDPSYEFLQMNLSKISWLERHCPPLDQELIMFGVIEA
                     WEEASVRPTRQLVLFMTPKWDVFAYDSGILFFLAPSMAQFWHGAIVLEYWNALFPVEV
                     RSHVRQHAHTMDDLVMVFHQLDYEKQVLEARRDKNTEGPRTFAKSVNSYVRAILESER
                     RIREGKIPMTFVDRDSLRANSLAHIQATGAQPSHAPAQRVLSAPPSLPSPVSEEDPAA
                     AATPPSSAATTPPSSVVPASVESELSSSPPLPPVVVKDVMYTAGEGDVVQMVVVV"
     gene            complement(53410..54030)
                     /gene="UL40"
     CDS             complement(53410..54030)
                     /gene="UL40"
                     /note="type 1 membrane protein; sequence in signal peptide
                     inhibits NK cell cytotoxicity; upregulates cell surface
                     expression of HLA-E; acts on inhibitory receptor
                     CD94/NKG2A; involved in immune regulation; N-terminally
                     truncated due to 1 nt substitution in normal initiation
                     codon"
                     /codon_start=1
                     /product="truncated membrane glycoprotein UL40"
                     /protein_id="ACS93382.1"
                     /translation="MAPRTLLLTVGLLCMRIRSLLCSPAETTVTTAAVTSAHGPLCPL
                     VFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRAD
                     GVSCLDHFRAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRP
                     ATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKKA"
     gene            complement(54237..54473)
                     /gene="UL41A"
     CDS             complement(54237..54473)
                     /gene="UL41A"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL41A"
                     /protein_id="ACS93383.1"
                     /translation="MTLFCRTANSTAGYVDMNVCIGMIGVVCFVFGVFILIFCSTLKA
                     FYVRQKTYHLLGTESDDEETTVWEKRRMESDTDF"
     gene            complement(54578..54954)
                     /gene="UL42"
     CDS             complement(54583..54954)
                     /gene="UL42"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL42"
                     /protein_id="ACS93384.1"
                     /translation="MEPTPMLRDRDHDDAPPTYEQAMGLCPTTVSTPPPPPPDCSPPP
                     YRPPYCLVSSPSPRHTFDMDMMEMPATMHPTTGAYFDNGWKWTFALLVVAILGIIFLA
                     VVFTVVINRDSSNTTTGRQST"
     gene            complement(55018..56289)
                     /gene="UL43"
                     /note="beta gene"
     CDS             complement(55018..56289)
                     /gene="UL43"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein UL43"
                     /protein_id="ACS93385.1"
                     /translation="MEKTPAETTAVSAGNVPRDSIPCITNVSADTRGRTRPSRPATVP
                     QRRPARIGHFRRRSASLSFLDWPDDSVTEGVRTTSASVAASAARFDEIRRRRQSINDE
                     MKERTLEDALAVELVNETFRCSVTSDARKDLQKLVRRVSGTVLRLSWPNGWFFTYCDL
                     LRVGYFGHLNIKGLEKTFLCCDKFLLPVGTVSRCEAIGRPPLPVLIGEGGRVYVYSPV
                     VESLYLVSRSGFRGFVQEGLRNYAPLREELGYVRFETGGDVGREFMLARDLLALWRLC
                     MKREGSIFSWRDGNEALTTVVLNGSQTYEDPAHGNWLKETCSLNVLQVFVVRAVPVES
                     QQRLDISILVNESGAVFGVHPETRQAHFLARGLLGFFRVGFLRFCNNYCFARDCFTHP
                     ESVAPAYRATGCPRELFCRRLRKKKGLFARR"
     gene            complement(56336..57637)
                     /gene="UL44"
                     /note="core gene"
     CDS             complement(56336..57637)
                     /gene="UL44"
                     /note="dsDNA-binding protein; involved in DNA replication"
                     /codon_start=1
                     /product="DNA polymerase processivity subunit"
                     /protein_id="ACS93386.1"
                     /translation="MDRKTRLSEPPTLALRLKPYKTAIQQLRSVIRALKENTTVTFLP
                     TPSLILQTVRSHCVSKITFNSSCLYITDKSFQPKTINNSTPLLGNFMYLTSSKDLTKF
                     YVQDISDLSAKISMCAPDFNMEFSSACVHGQDIVRESENSAVHVDLDFGVVADLLKWI
                     GPHTRVKRNVKKAPCPTGTVQILVHAGPPAIKFILTNGSELEFTANNRVSFHGVKNMR
                     INVQLKNFYQTLLNCAVTKLPCTLRIVTEHDTLLYVASRNGLFAVENFLTEEPFQRGD
                     PFDKNYVGNSGKSRGGGGGGGSLSSLANAGGLHDDGPGLDNDLMNEPMGLGGLGGGGG
                     GGGKKHDRGGGGGSGTRKMSSGGGGGDHDHGLSSKEKYEQHKITSYLTSKGGSGGGGG
                     GGGGGLDRNSGNYFNDAKEESDSEDSVTFEFVPNTKKQKCG"
     gene            complement(57778..60498)
                     /gene="UL45"
                     /note="core gene"
     CDS             complement(57778..60498)
                     /gene="UL45"
                     /note="enzymatically inactive; tegument protein"
                     /codon_start=1
                     /product="ribonucleotide reductase subunit 1"
                     /protein_id="ACS93387.1"
                     /translation="MTPADADEEQRVSSVPVYRCRPGRIPSRGAETETEESSAEAVAD
                     TTGGDDSELEEGPLPGGDKEASAENTNVSSGVACVAGFTSGGGVVSWRPESPSPDGTP
                     SVLSLTRDSGPAVPSRGGRVSSGLSTFNPTGATRMELDSVEEEDDFGASLCKVSPPIQ
                     ATRMLMGKKCHCHGYWGKFRFCGVQEPARELPSDRNALWREMDTVSRHSAGLGSFRLF
                     QLIMRHGPCLIRHSPRCDLLLGRFYFKANWARESRTPLCYASELCDESVRRFVLRHME
                     DLPKLAEETARFVELAGCWGLYAAILCLDKVCRQLHGQDESPGGVFLRIAVALTAAIE
                     NSRHSRIYRFHLDARFEGEVLESVLKRCRDGQLSLSTFTMSTVGFDRVPQYDFLISAD
                     PFSRDASWAAMCKWMSTLSCGVSVSVNVTRLNADVNSVIRCLGGYCDLIREKEVHRPV
                     VRVFVDMWDVAAIRVINFILKESTSELTGVCYAFNVPSVLMKRYRAREQRYSLFGRPV
                     SRRLSDLGQESAFEKEYSRCEQSCPKVVVNTDDFLKKMLLCALKGRASVVFVHHVVKY
                     SIMADSVCLPPCLSPDMASCHFGECDMPVQRLTVNVARCVFARSDEQKLHLPDVVLGN
                     TRRYFDLSVLRELVTEAVVWGNARLDALMSASEWWVESALEKLRPLHIGVAGLHTALM
                     RLGFTYFASWDLIERIFEHMYFAAVRASVDLCKSGLPRCEWFERTIYQEGKFIFELYR
                     LPRLSIASARWEALRADMLEFGLRNCQFLAVGPDDEVAHLWGVTPSVWASRGTVFEEE
                     TVWSLCPPNRECYFPTVVRRPLRVPVVNYAWLEQHQEEGKATQCLFQAAPAIQNDVEM
                     AAVNLSVFVDQCVALVFYYDSGMTPDVLLARMLKWYHWRFKVGVYKYCAS"
     gene            complement(60644..61516)
                     /gene="UL46"
                     /note="core gene"
     CDS             complement(60644..61516)
                     /gene="UL46"
                     /note="complexed 1:2 with capsid triplex subunit 2 to
                     connect capsid hexons and pentons; involved in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid triplex subunit 1"
                     /protein_id="ACS93388.1"
                     /translation="MDARAVAKRPRDPADEDNELVTALKAKREVNTISVRYLYHADHQ
                     ALTARFFVPEGLVEFEAQPGALLIRMETGCDSPRHLYISLYLLGIRASNVSASTRCLL
                     ESVYTASAARAALQWLDLGPHLLHRRLETLGCVKTVSLGITSLLTCVMRGYLYNTLKT
                     EVFALMIPKDMYLTWEETRGRLQYVYLIIVYDYDGPETRPGIYVLTSSIAHWQTLVDV
                     ARGKFARERCSFVNRRITRPRQIPLCTGVIQKLGWCLADDIHTSFLVHKELKLSVVRL
                     DNFSVELGDFREFV"
     gene            61515..64466
                     /gene="UL47"
                     /note="core gene"
     CDS             61515..64466
                     /gene="UL47"
                     /note="complexed with large tegument protein; involved in
                     virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL37"
                     /protein_id="ACS93389.1"
                     /translation="MMARRTVDFKKLIEQLRARATDKAEALNTVSQLEIGAVDAQDVT
                     ASAVRAFVGALPSSGYHFGFVRQNVVFYLLSHATVQTARDPLYAAEQLHEQLDRFLRH
                     QHDGGGDEDRLPFYHNGATLTAFQKLLQTLREIQTVIAEQSGGTAAAADLIASNNAST
                     ERRGKKGGSSSGGQQPLVRRVITQLETAATEARPYVNCRAVAELLDLTYQRLIYWACT
                     LMPYVLFRRDTDTELDTVLLMHFFYTHYRSVNGDLAVEFQNYVKNSVRHMSSFVSSDI
                     DGDQKPGAEHMRDVSYKLFVGNLQARDASGLMFPIISTRISTVNLYLSPERMFFHPGL
                     ISRLLSEEVSPRANLDAYARVCDRVLEDHLHTPRRVQRLLDLTQMVTLLVELGFNHDT
                     CAAYAQMALIQPASQKSSLFVSEIREKLIQIIYNFYTFFMCLYVYSPTFLFDHRRRLI
                     LEQHRSTLIGSKEELQHVWSNVTLNVNTHFAVQYTEEDFEAHTKGATEAEREYLYRDL
                     HSKWGVHLFTLRPSRGAAGAASPLPPLDGVTRSDILRECALVNLNEGRVNYASLLAFS
                     HHPEFPSIFAQLVVVTEFSEIFGIPQGLFQAVGSPRLFALIQLCRVLLPEQVTLYQNL
                     VSIYNLTTFVKHIDAAVFKTVRDCVFDIATTLEHLSGVPVTPNVDLLAELMARSVAHN
                     LYTTVNPLIEDVMRSSAGSLRNYLRHTRLCFGLARGRARLSEDGVTVYVEVQGQYGLR
                     VPTTRFVEQLRELVRRDRLLAENLRGLNERLLSVRVRVRQISSDTEEVSRHAKGHRTV
                     AQMSKALKKTASKIKVLETRVTLALEQAQRSNGAVVTAVQRALAVFDVLSRENFERRG
                     AQLCLTEATSLLHRHRALAPMTWPAGTGVAAAAEADRALREFLEAPWESAPQPPRLRM
                     TPDTDHEESTAGATSVPEVLGARYEPAHLAASDLLNWYIVPVSQAQQDILSSIDPPAG
                     STSVSLPPASP"
     gene            64463..71185
                     /gene="UL48"
                     /note="core gene"
     CDS             64463..71185
                     /gene="UL48"
                     /note="complexed with tegument protein UL37;
                     ubiquitin-specific protease (N-terminal region); involved
                     in capsid transport"
                     /codon_start=1
                     /product="large tegument protein"
                     /protein_id="ACS93390.1"
                     /translation="MKVTQASCHQGDIARFGARAGNQCVCNGIMFLHALHLGGTSAVL
                     QTEALDAIMEEGARLDARLERELQKKLPAGGRLPVYRLGDEVPRRLESRFGRTVHALS
                     RPFNGTTETCDLDGYMCPGIFDFLRYAHAKPRPTYVLVTVNSLARAVVFTEDHMLVFD
                     PHSSAECHNAAVYHCEGLHQVLMVLTGFGVQLSPAFYYEALFLYMLDVATVPEAEIAA
                     RLVSTYRDRDIDLTGVVRESADTAATTTTAAPSLPPLPDPIVDPGCPPGVAPSIPVYD
                     PSSSPKKTPEKRRKDLSGSKHGGKKKPPSTTSKTLATASSSSAIAAASSSSAVPPSYS
                     CGEGALPALGRYQQLVDEVEQELKALTLPPLPANTSAWTLHAAGTESGANAATATAPS
                     FDEAFLTDRLQQLIIHAVNQRSCLRRPCGPQSAAQQAVRAYLGLSKKLDAFLLNWLHH
                     GLDLRRMHDYLSHKTTKGTYSTLDRALLEKMQVVFDPYGRQHGPALIAWVEEMLRYVE
                     SKPTNELSQRLQRFVTKRPMPVSDSFVCLRPVDFQRLTQVIEQRRRVLQRQREEYHGV
                     YEHLAGLITSIDIHDLDASDLNRREILKALQPLDDNAKQELFRLGNAKMLELQMDLDR
                     LSTQLLTRVHNHILNGFLPVEDLKQMERVVEQVLRLFYDLRDLKLCDGSYEEGFVVIR
                     EQLSYLMTGTVRDNVPLLQEILQLRHAYQQATQQNEGRLTQIHDLLHVIETLVRDPGS
                     RGSALTLALVQEQLAQLEALGGLQLPEVQQRLQNAQLALSRLYEEEEETQRFLDGLSY
                     DDPPTEQTIKRHPQLREMLRRDEQTRLRLINAVLSMFHTLVMRLARDESPRPTFFDAV
                     SLLLQQLPPDSHEREDLRAANATYAQMVKKLEQIEKAGTGASEKRFQALRELVYFFRN
                     HEYFFQHMVGRLGVGPQVTELYERYQHEMEEQHLERLEREWQEEAGKLTVTSVEDVQR
                     VLARAPSHRVMHQMQQTLTTKMQDFLDKEKRKQEEQQRQLLDGYQKKVQQDLQRVVDA
                     VKGEMLSTIPHQPLEATLELLLGLDQRAQPLLDKFNQDLLSALQQLSKKLDGRINECL
                     HGVLTGDVERRCHPHREAAMQTQASLNHLDQILGPQLLIHETQQALQHAVHQAQFIEK
                     CQQGDPTTAIMGSEFEGDFARYRSSQQKMEGQLQETRQQMTETSERLDRSLRQDPGSS
                     SVTRVPEKPFKGQELAGRITPPPADFQRPVFKTLLDQQADAARKALSDEADLLNQKVQ
                     TQLRQRDEQLSTAQNLWTDLVTRHKMSGGLDVTTPDAKALMEKPLETLRELLGKATQQ
                     LPYLSAERTVRWMLAFLEEALAQITADPTHPHHGSRTHYRNLQQQAVESAVTLAHQIE
                     QNAACENFIAQHQEATANGASTPRVDMVQAVEAVWQRLEPGRVAGGAARHQKVQELLQ
                     RLGQTLGDLELQETLATEYFALLHGIQTFSYGLDFRSQLEKIRDLRTRFAELAKRRGT
                     RLSNEGALPNPRKPQATTSLGAFTRGLNALERHVQLGHQYLLNKLNGSSLVYRLEDIP
                     SVLPPTHETDPALIMRDRLRRLCFARHHDTFLEVVDVFGMRQIVTQAGEPIHLVTDYG
                     NVAFKYLALRDDGRPLAWRRRCSGGGLKNVVTTRYKAITVAVAVCQTLRTFWPQISQY
                     DLRPYLTQHQSHTHPAETHTLHNLKLFCYLVSTAWHQRIDTQQELTAADRVGSGEGGD
                     VGEQRPGRGTVLRLSLQEFCVLIAALYPEYIYTVLKYPVQMSLPSLTAHLHQDVIHAV
                     VNNTHKMPPDHLPEQVKAFCITPTQWPAMQLNKLFWENKLVQQLCQVGPQKSTPPLGK
                     LWLYAMATLVFPQDMLQCLWLELKPQYAETYASVSELVQTLFQIFTQQCEMVTEGYTQ
                     PQLPTGEPVLQMIRVRRQDTTTTDTNTTTEPGLLDVFIQTETALDYALGSWLFGIPVC
                     LGVHVADLLKGQRVLVARHLEYTSRDRDFLRIQRSRDLNLSQLLQDTWTETPLEHCWL
                     QAQIRRLRDYLRFPTRLEFIPLVIYNAQDHTVVRVLRPPSTFEQDHSRLVLDEAFPTF
                     PLYDQDDNTSADNVAASGAALTPPVPFNRVPVNIQFLRENPPPIARVQQPPRRHRHRA
                     AAAADDDGQIDHVQDDTSRTADSALVSTAFGGSVFQENRLGETPLCRDELVAVAPGAA
                     STSFASPPITVLTQNVLSALEILRLVRLDLRQLAQSVQDTIQHMRFLYLL"
     gene            complement(71304..71531)
                     /gene="UL48A"
                     /note="core gene"
     CDS             complement(71304..71531)
                     /gene="UL48A"
                     /note="located externally on capsid hexons; involved in
                     capsid morphogenesis; possibly involved in capsid
                     transport"
                     /codon_start=1
                     /product="small capsid protein"
                     /protein_id="ACS93391.1"
                     /translation="MSNTAPGPTVANKRDEKHRHVVNVVLELPTEISEATHPVLATML
                     SKYTRMSSLFNDKCAFKLDLLRMVAVSRTRR"
     gene            complement(71524..73236)
                     /gene="UL49"
                     /note="betagamma gene"
     CDS             complement(71524..73236)
                     /gene="UL49"
                     /codon_start=1
                     /product="protein UL49"
                     /protein_id="ACS93392.1"
                     /translation="MGNRRLRHAPHTATDEFHQALRRLFAPLCVHEDHFHVQLVIGRG
                     ALQPEEAAVETSQPPAQFAAQTSAVLQQQLVHHVPRSCVLHLFVTDKRFLNRELGDRL
                     YQRFLREWLVCRQAEREAVTALFQRMVMTKPYFVFLAYVYSMDCLHTVAVRTMAFLRF
                     ERYDTDYLLRRLRLYPPERLHALLDGVTASLLGDLHRFLFGVDLRLPVLHPTSSPCLA
                     LLRAKRFDARADLAVYHRNQWCHQRQPRSPQLRGLIAALRRHAGKVPCGNPLYVLARQ
                     AVQTFCDTCPRYLVPLRALGLHDETRGGGSTAAAAAVGHAGAGQQARHVEPTKIVLFA
                     LSAALRGGLIGSVIDLPLWCLCRLKCERHLDARSLVAVVCRQCGHCLNLGKEKLHCQQ
                     NFPLNSMFYYRDRQEKSVIFNTHAELVHCSLCGSQRVVRQRVYELVSETLFGQRCVRV
                     GWKAVLGLNAACAVYDHRLAFDVILPCAARTCDSTVVVRGVTVPRLLRLTSHGHGLLC
                     ARCQTGEYRDSCLESEDGAPLCRGCALVKQTACHVGGHIVQQARGGLAATSSSSSPHG
                     LPHV"
     gene            complement(73193..74389)
                     /gene="UL50"
                     /note="core gene"
     CDS             complement(73193..74389)
                     /gene="UL50"
                     /note="type 2 membrane protein; interacts with nuclear
                     egress lamina protein; involved in nuclear egress"
                     /codon_start=1
                     /product="nuclear egress membrane protein"
                     /protein_id="ACS93393.1"
                     /translation="MEMNKVLHQDLVQATRRILKLGPSELRVTDAGLICKNPNYSVCD
                     AMLKTDTVYCVEYLLSYWESRTDHVPCFIFKNTGCAVSLCCFVRAPVKLVSPARHVGE
                     FNVLKVNESLIVTLKDIEEIKPSAYGVLTKCVVRKSNSASVFNIELIAFGPENEGEYE
                     NLLRELYAKKAASTSLAVRNHVTVSSHSGSGPSLWRARMSAALTRTAGKRSSRTASPP
                     PPPPRHPSCSPTMVAAGGAAAGPRPPPPPMAAGSWRLCRCEACMGRCGCASEGDADEE
                     EEELLALAGEGKAAAAAAGQDVGGSARRPLEEHVSRRRGVSTHHRHPPSPPCAPSLER
                     TGYRWAPSSWWRARSGSSRPQSGPWLPARFATLGPLVLALLLVLALLWRGHGQSSSPT
                     RSAHRD"
     gene            complement(74411..74884)
                     /gene="UL51"
                     /note="core gene"
     CDS             complement(74411..74884)
                     /gene="UL51"
                     /note="interacts with DNA packaging terminase subunit 2;
                     involved in DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging protein UL33"
                     /protein_id="ACS93394.1"
                     /translation="MSWAKQRVPFLDDDDGEEENDVQDDVDSPVPTRPLVIDEDAEPA
                     AGTSGGLEGGGGDDEDGEDGHALPDLDDDLLLQFEPMLPRVYDLLLPSLDARLNFVNA
                     GQKYAAFLKYVHGDCATCSHGEILREKTQLLTAIVSKLMDINGILEGKDEPAPGK"
     gene            74922..76928
                     /gene="UL52"
                     /note="core gene"
     CDS             74922..76928
                     /gene="UL52"
                     /note="involved in DNA encapsidation; possibly involved in
                     capsid transport"
                     /codon_start=1
                     /product="DNA packaging protein UL32"
                     /protein_id="ACS93395.1"
                     /translation="MNPSTHVSSNGPTTPPHGPHTTFLPPTSPAPSTSSVAAATLCSP
                     QRQAVSRYSGWSTEYTQWHSDLTTELLWHAHPRQVPMDEALAAAAAASYQVNPQHPAN
                     RYRHYEFQTLSLGTSEVDELLNCCAEETTCGGTQSTVLTNATNTTSCGGAVAGSSNAG
                     PAGASAACDLDAELAGLETSAADFEQLRRLCAPLAIDTRCNLCAIISICLKQDCDQSW
                     LLEYSLLCFKCSYAPRAALSTLIIMSEFTHLLQQHFSDLRIDDLFRHHVLTVFDFHLH
                     FFINRCFEKQVGDAVDNENVTLNHLAVVRAMVMGEDTVPYNKPRRHPQQKQKNNPYHV
                     EVPQELIDNFLEHSSPSRDRFVQLLFYMWAGTGVMSTTPLTELTHTKFARLDALSTAS
                     EREDARMMMEEEEDEEGGEKGGDDPGRHNGGGTSGGFSESTLKKNVGPIYLCPVPAFF
                     TKNQTSTVCLLCELMACSYYDNVVLRELYRRVVSYCQNNVKMVDRIQLVLADLLRECT
                     SPLGAAHEDVARCGLEAPTSPGGDSDYHGLSGVDGALARPDPVFCHVLRQAGVTGIYK
                     HFFCDPQCAGNIRVTNEAVLFGRLHPHHVQEVKLAICHDNYYISRLPRRVWLCITLFK
                     AFQITKRTYKGKVHLADFMRDFTQLLENCDIKLVDPTYVIDKYV"
     gene            76921..78051
                     /gene="UL53"
                     /note="core gene"
     CDS             76921..78051
                     /gene="UL53"
                     /note="interacts with nuclear egress membrane protein;
                     involved in nuclear egress"
                     /codon_start=1
                     /product="nuclear egress lamina protein"
                     /protein_id="ACS93396.1"
                     /translation="MSSVSGVRTPRERRSALRSLLRKRRQRELASKVASTVNGATSAN
                     NHGEPPSPADARPRLTLHDLHDIFREHPELELKYLNMMKMAITGKESICLPFNFHSHR
                     QHTCLDISPYGNEQVSRIACTSCEDNRILPTASDAMVAFINQTSNIMKNRNFYYGFCK
                     SSELLKLSTNQPPIFQIYYLLHAANHDIVPFMHAENGRLHMHVIFENSDVHIPCDCIT
                     QMLTAAREDYSVTLNIVRDHVVISVLCHAVSASSVKIDVTILQRKIDEMDIPNDVSES
                     FERYKELIQELCQSSGNNLYEEATSSYAIRSPLTASPLHVVSTNGCGPSSSSQSTPPH
                     LHPPSQATQPHHYSHHQSQSQQHHHRPQSPPPPLFLNSIRAP"
     gene            complement(78029..81757)
                     /gene="UL54"
                     /note="core gene"
     CDS             complement(78029..81757)
                     /gene="UL54"
                     /EC_number="2.7.7.7"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="DNA polymerase catalytic subunit"
                     /protein_id="ACS93397.1"
                     /translation="MFFNPYLSGGVTGGAVAGGRRQRSQPGSAQGSGKRPPQKQFLQI
                     VPRGVMFDGQTGLIKHKTGRLPLMFYREIKHLLSHDMVWPCPWRETLVGRVVGPIRFH
                     TYDQTDAVLFFDSPENVSPRYRQHLVPSGNVLRFFGATEHGYSICVNVFGQRSYFYCE
                     YSDTDRLREVIASVGELVPEPRTPYAVSVTPATKTSIYGYGTRPVPDLQCVSISNWTM
                     ARKIGEYLLEQGFPVYEVRVDPLTRLVIDRRITTFGWCSVNRYDWRQQGRASTCDIEV
                     DCDVSDLVAVPDDSSWPRYRCLSFDIECMSGEGGFPCAEKSDDIVIQISCVCYETGGN
                     TAVDQGIPNGNDGRGCTSEGVIFGHSGLHLFTIGTCGQVGPDVDVYEFPSEYELLLGF
                     MLFFQRYAPAFVTGYNINSFDLKYILTRLEYLYKVDSQRFCKLPTAQGGRFFLHSPAV
                     GFKRQYAAAFPSASHNNPASTAATKVYIAGSVVIDMYPVCMAKTNSPNYKLNTMAELY
                     LRQRKDDLSYKDIPRCFVANAEGRAQVGRYCLQDAVLVRDLFNTINFHYEAGAIARLA
                     KIPLRRVIFDGQQIRIYTSLLDECACRDFILPNHYSKGTTVPETNSVAVSPNAAIIST
                     AAVPGDAGSVAAMFQMSPPLQSAPSSQDGVSPGSGSNSSSSVGVFSVGSGSSGGVGVS
                     NDNHGAGGTAAVSYQGATVFEPEVGYYNDPVAVFDFASLYPSIIMAHNLCYSTLLVPG
                     GEYPVDPADVYSVTLENGVTHRFVRASVRVSVLSELLNKWVSQRRAVRECMRECQDPV
                     RRMLLDKEQMALKVTCNAFYGFTGVVNGMMPCLPIAASITRIGRDMLERTARFIKDNF
                     SEPCFLHNFFNQEDYVVGTREGDSEESSTLPEGLETSSGGLNERRVEARVIYGDTDSV
                     FVRFRGLTPQALVARGPSLAHYVTACLFVEPVKLEFEKVFVSLMMICKKRYIGKVEGA
                     SGLSMKGVDLVRKTACEFVKGVTRDVLSLLFEDREVSEAAVRLSRLSLDEVKKYGVPR
                     GFWRILRRLVQARDDLYLHRVCVEDLVLSSVLSKDISLYRQSNLPHIAVIKRLAARSE
                     ELPSVGDRVFYVLTAPGVRTAPQGSSDNGDSVTTGVVSRSDAIDGTDDDADGGGVEES
                     NRRGGEPAKKRARKPPSAVCNYEVAEDPSYVREHGVPIHADKYFEQVLKAVTNVLSPV
                     FPGGETARKDKFLHMVLPRRLHLEPAFLPYSVKAHECC"
     gene            complement(81900..84623)
                     /gene="UL55"
                     /note="core gene"
     CDS             complement(81900..84623)
                     /gene="UL55"
                     /note="type 1 membrane protein; putative membrane fusogen;
                     binds cell surface heparan sulphate; involved in cell
                     entry; involved in cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein B"
                     /protein_id="ACS93398.1"
                     /translation="MESRIWCLVVCVNLCIVCLGAAVSSSSTRGTSATHSHHSSHTTS
                     AAHSRSGSVSQRVTSSQTVSHGVNETIYNTTLKYGDVVGVNTTKYPYRVCSMAQGTDL
                     IRFERNIVCTSMKPINEDLDEGIMVVYKRNIVAHTFKVRVYQKVLTFRRSYAYIHTTY
                     LLGSNTEYVAPPMWEIHHINSHSQCYSSYSRVIAGTVFVAYHRDSYENKTMQLMPDDY
                     SNTHSTRYVTVKDQWHSRGSTWLYRETCNLNCMVTITTARSKYPYHFFATSTGDVVDI
                     SPFYNGTNRNASYFGENADKFFIFPNYTIVSDFGRPNSALETHRLVAFLERADSVISW
                     DIQDEKNVTCQLTFWEAPERTIRSEAEDSYHFSSAKMTATFLSKKQEVNMSDSALDCV
                     RDEAINKLQQIFNTSYNQTYEKYGNVSVFETTGGLVVFWQGIKQKSLVELERLANRSS
                     LNLTHNRTKRSTDGNNATHLSNMESVHNLVYAQLQFTYDTLRGYINRALAQIAEAWCV
                     DQRRTLEVFKELSKINPSAILSAIYNKPIAARFMGDVLGLASCVTINQTSVKVLRDMN
                     VKESPGRCYSRPVVIFNFANSSYVQYGQLGEDNEILLGNHRTEECQLPSLKIFIAGNS
                     AYEYVDYLFKRMIDLSSISTVDSMIALDIDPLENTDFRVLELYSQKELRSSNVFDLEE
                     IMREFNSYKQRVKYVEDKVVDPLPPYLKGLDDLMSGLGAAGKAVGVAIGAVGGAVASV
                     VEGVATFLKNPFGAFTIILVAIAVVIITYLIYTRQRRLCTQPLQNLFPYLVSADGTTV
                     TSGSTKDTSLQAPPSYEESVYNSGRKGPGPPSSDASTAAPPYTNEQAYQMLLALARLD
                     AEQRAQQNGTDSLDGRTGTQDKGQKPNLLDRLRHRKNGYRHLKDSDEEENV"
     gene            complement(84586..87138)
                     /gene="UL56"
                     /note="core gene"
     CDS             complement(84586..87138)
                     /gene="UL56"
                     /note="involved in DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 2"
                     /protein_id="ACS93399.1"
                     /translation="MEMNLLQKLCVVCSKCNEYAMELECLKYCDPNVLLAESTPFKRN
                     AAAIVYLYRKIYPEVVAQNRTQSSLLTLYLEMLLKALHEDTALLDRALMAYSRQPDRA
                     AFYRTVLRLDRCDRHHTVELQFTDNVRFSVSLATLNDIERFLCKMNYVYGILAPEAGL
                     EVCAQLLELLRRLCGISPVARQEVYVEGTTCAQCYEELTIIPNQGRSLNKRLQGLLCN
                     HIAVHRPSSQSDVNIQTVEQDLLDLTTRIPHLAGVLSALKSLFSSSSAYHSYIQEAEE
                     ALREYNLFTDIPERIYSLSDFTYWSRTSEVIVKRVGITIQQLNVYHQLCRALMNGISR
                     HLYGEDVEDIFVLGEKALDGEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKLH
                     ESNEMYTKIKHILEEIRRPLPDGTGGDGPEGEVIHLRGREAMSGTGTTLMTASNSSNS
                     STHSQRNNGGGGRARGGGKKAVGGGANGQDGDGSENGLRVRNCDEHEALDLVDARSRI
                     HNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLM
                     NGFLYRSQYHQDQDVVDVGNQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGP
                     LFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEGTVYPSEWMVVKYMGFFNF
                     SDCQDLNVLQKEMWMHVRELVLSVALYNETFGKQLSIACLRDELHPDRDVILTYNKEW
                     PLLLRHEGSLYKSKDLYLLLYRHLSRPDESGDVPTAPVAKPSTLTAAAAVSGAFREPD
                     RPWLPSPYPSSSTAGVSRRVRATRKRPRRASSLLDLARDEHGIQDLVPGSLR"
     gene            complement(87696..91403)
                     /gene="UL57"
                     /note="core gene"
     CDS             complement(87696..91403)
                     /gene="UL57"
                     /note="contains zinc-finger; involved in DNA replication;
                     possibly involved in gene regulation"
                     /codon_start=1
                     /product="single-stranded DNA-binding protein"
                     /protein_id="ACS93400.1"
                     /translation="MSHEELTALAPVGPAAFLYFSRLNAETQEILATLSLCDRSSSVV
                     IAPLLAGLTVEADFGVSVRTPVLCYDGGVLTKVTSFCPFALYFHHTQGIVAFTEGHGD
                     VHRLCEDARQKYALEAYTPEADRVPTDLVALCAAVGCQASETTVHVVVGNGLKEFLFA
                     GQLIPCVEEATTVRLHGGEAVRVPLYPPTLFNSLQLDAEADEVSLDARSAFVEARGFY
                     VPAVSETLFYYVYTSWCQSLRFSEPRVLIEAALRQFVHDSQQSVKLAPHKRYLGYMSQ
                     RLSSLEKDHLMLSDAVVCELAFSFASVFFDSAYQPAESMLFSEWPLVTNATDHRDLIR
                     ALTELKLHLSTHVAALVFSANSVLYQHRLVYLQSSARHPSAGGTASQETLLKAIQFTN
                     GLSAACEDVYNDARKVLKFQGAPLKDERYGPQHLALVCGTCPQLVSGFVWYLNRVSVY
                     NTGLSGSSTLTNHLVGCAAGLCEACGGTCCHTCYQTAFVRVRTRLPVVPKQPKKEPCV
                     ITVQSRFLNDVDILGSFGRRYNVDAKDGGLDGKGDDGVPGGGAGGGGGRDVSGGPSDG
                     LGGGRGGGGGGDSGGMMGRGGRMLGASVDRTYRLNRILDYCRKMRLIDPVTGEDTFSA
                     HGKSDFVAVFSALNKFVDDEALGFVSEVRLKSSRDEVAGATQAFNLDLNPYAVAFQPL
                     LAYAYFRSVFYVIQNVALITATSYIVDNPLTTNLVSKWMTQHFQSIHGAFSTTSSRKG
                     FLFTKQIKSSKNSDHDRLLDFRLYAQGTYAVVPMEIKLSRLSVPTLIMVRVKNRPIYR
                     AGKGNAGSVFFRRDHVPRRNPAKGCLGFLLYRHHERLFPECGLPCLQFWQKVCSNALP
                     KNVPIGDMGEFNAFVKFLVAVTADYQEHDLLDVAPDCVLSYVESRFHNKFLCYYGFKD
                     YIGSLHGLTTRLTTQNHAQFPHVLGASPRFSSPAEFALHVKGLKTAGVPAPMAATVTR
                     ESLVRSVFEHRSLVTVPVSVEKYAGINNSKEIYQFGQIGYFSGNGVERSLNVSSMSGQ
                     DYRFMRQRYLLATRLADVLIKRSRRENVLFDADLIKNRVMLALDAENLDCDPEVMAVY
                     EILSVREEIPASDDVLFFVDGCEALAASLMDKFAALQEQGVEDFSLENLRRVLDADAQ
                     RLTDAAGGEVHDLSALFAPSGVGAASGVGGGGLLLGESVAGNSICFGVPGETGGGCFL
                     VNASEDEAGGVGGSSGGGGGSGLLPAKRSRL"
     repeat_region   93841..94018
                     /note="OriLyt-associated repeat"
                     /rpt_unit_range=93841..93942
     gene            94117..99029
                     /gene="RL4.9"
     regulatory      94117..94122
                     /regulatory_class="TATA_box"
                     /gene="RL4.9"
     ncRNA           94146..99029
                     /ncRNA_class="other"
                     /gene="RL4.9"
                     /product="RNA4.9"
     regulatory      99004..99009
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RL4.9"
     gene            complement(99330..101570)
                     /gene="UL69"
                     /note="core gene"
     CDS             complement(99330..101570)
                     /gene="UL69"
                     /note="RNA-binding protein; shuttles between nucleus and
                     cytoplasm; inhibits pre-mRNA splicing; exports virus mRNA
                     from nucleus; exerts most effects post-transcriptionally;
                     involved in gene regulation; involved in RNA metabolism
                     and transport"
                     /codon_start=1
                     /product="multifunctional expression regulator"
                     /protein_id="ACS93401.1"
                     /translation="MELHSRGRHDAPSLSSLSERERRARRARRFCLDYEPVPRKFRRE
                     RSPTSPSTRNGAAASEYHLAENTVGAASHHHRPCVPARRPRYSKDDDTEGDPDHYPPP
                     LPPSSRHALGGTGGHIIMGTAGFRGGHRASSSFKRRVAASASVPLNPHYGKSHDNDDG
                     EPHHHGGDSTHLRRRVPSCPTTFGSSHPSSANNHHGSSAGPQQQQMLALIDDELDAMD
                     EDELQQLSRLIEKKKRARLQRGAASSGTSPSSTSPVYDLQRYTAESLRLAPYPADLKV
                     PTAFPQDHQPRGRILLSHDELMHTDYLLHIRQQFDWLEEPLLRKLVVEKIFAVYNAPN
                     LHTLLAIIDETLSYMKYHHLHGLPVNPHDPYLETVGGMRQLLFNKLNNLDLGCILDHQ
                     DGWGDHCSTLKRLVKKPGQMSAWLRDDVCDLQKRPPETFSQPMHRAMAYVCSFSRVAV
                     SLRRRALQVTGTPQFFDQFDTNNAMGTYRCGAVSDLILGALQCHECQNEMCELRIQRA
                     LAPYRFMIAYCPFDEQSLLDLTVFAGTTTTTASNHATAGGQQRGGDQIHPTDEQCANM
                     ESRTDPATLTAYDKKDREGSHRHPSPMIAAAPSTQPPSQPQQHYSEGELEEDEDSDDA
                     SSQDLVRATDRHGDTVVYKTTAVPPSPPAPLAGVRSHRGELNLMTPSPSHGGSPPQVP
                     HKQPIIPVQSANGNHSTTAIQQQQPPPPPPPPPPPVPQEDDSVVMRCQTPDYEDMLCY
                     SDDMDD"
     gene            complement(101670..104510)
                     /gene="UL70"
                     /note="core gene"
     CDS             complement(101670..104510)
                     /gene="UL70"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase primase subunit"
                     /protein_id="ACS93402.1"
                     /translation="MTLVLFATEYDSAHIVANVLSQTPTDHCVFPLLVKHQVSRRVYF
                     CLQTQKCSDSRRVAPVFAVNNETLQLSRYLAARQPIPLSALIASLDEAETRPLYRHLF
                     RTPVLSPEHGGEVREFKHLVYFHHAAVLRHLNQVFLCPTSPSWFISVFGHTEGQVLLT
                     MAYYLFEGQYSTISTVEEYVRSFCTRDLGTIIPTHASMGEFARLLLGSPFRQRVSAFV
                     AYAVARNRRDYTELEQVDTQINAFRERARLPDTVCVHYVYLAYRTALARARLLEYRRV
                     VAYDADAAPEAQCTREPGFLGRQLSTELLDVMQKYFSLDNFLHDYVETHLLRLDESPH
                     SATSPHGLGLAGYGGRIDGTHLAGFFGTSTQLARQLERINTLSESVFSPLERSLSGLL
                     RLCASLRTAQTYTTGTLTRYSQRRYLLPEPALAPLLERPLPVYRVHLPNDQHVFCAVA
                     SETWHRSLFPRDLLRHVPDSRFSDEALTETVWLHDDDVASTSPETQFYYTRHEVFNER
                     LPVFNFVADFDLRLRDGVSGLARHTVFELCRGLRRVWMTVWASLFGYTHPDRHPVYFF
                     KSACPPNSVPVDAAGAPFDDDDYLDYRDERDTEEDEDGKEDKNNVPDNGVFQKTTSSV
                     DTSPPYCRCKGKLGLRIITPFPACTVAVHPSVLRAVAQVLNHAVCLDAELHTLLDPIS
                     HPESSLDTGIYHHGRSVRLPYMYKMDQDDGYFMHRRLLPLFIVPDAYREHPLGFVRAQ
                     LDLRNLLHHHPPHDLPALPLSPPPRVILSVRDKICPSTEANFIETRSLNVTRYRRRGL
                     TEVLAYHLYGGDGATAAAISDTDLQRLVVTRVWPPLLEHLTQHYEPHVSEQFTAPHVL
                     LFQPHGACCVAVKRRDGARTRDFRCLNYTHRNPQETVQVFIDLRTEHSYALWASLWSR
                     CFTKKCHSNAKNVHISIKIRPPDAPMPPATAV"
     gene            104526..105611
                     /gene="UL71"
                     /note="core gene"
     CDS             104526..105611
                     /gene="UL71"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL51"
                     /protein_id="ACS93403.1"
                     /translation="MQLAQRLCELLMCRRKAAPVADYVLLQPSEDVELRELQAFLDEN
                     FKQLEITPADLRTFSRDTDVVNHLLKLLPLYRQCQSKCAFLKGYLSEGCLPHTRPAAE
                     VECKKSQRILEALDILILKLVVGEFAMSEADSLEMLLDKFSTDQASLVEVQRVMGLVD
                     MDCEKSAYMLEAGAAATVAPPTPPAVVQGESGVREDGETVAAVSAFACPSVSDSLIPE
                     ETGVTRPMMSLAHINTVSCPTVMRFDQRLLEEGDEEDEVTVMSPSPEPVQQQPPVEPV
                     QQQPQGRGSHRRRHKESVPQETLPTNHEREILDLMRHSPDVPREAVMSPTMVTIPPPQ
                     IPFVGSARELRGVKKKKPTAAALLSSA"
     gene            complement(105692..106858)
                     /gene="UL72"
                     /note="core gene"
     CDS             complement(105692..106858)
                     /gene="UL72"
                     /note="enzymatically inactive; DURP family"
                     /codon_start=1
                     /product="deoxyuridine triphosphatase"
                     /protein_id="ACS93404.1"
                     /translation="MLTMLTDRIDSQLVLSRLPRSRFQRFWETPTLIMKEESAPSSGS
                     IILAEKSVNMRYCVRFASDSDFQTTFTLPQSTEETYDKEQHPGEDEASSPLPSPLKVP
                     YKWMPSSFIVKQCHTQLAFYNKHIIWLSRERKVPTSLGVSLYIPEGFFGITFYKCLDA
                     QFVCMPELLESGLQVPQLDVVNLNDTFQSIFPGTIEGDIGVFPCFVPEPWQLMNLPPP
                     NEHRFFVLRTRQTLVIGPGHTQTVYFDAAYVHAPGICALIVGVRQFSQSDLIIRPTIW
                     LPGTAAGVTVVNTSHTTVCISPHTTVAKAVFTTHRFTYLPVGSHPLGQMIVPPTPDIG
                     FTHTPEHALLQRTPSPVDDDVDETEEDEKSSDAESPVNTSDVIFDVGPKPPRHP"
     gene            106874..107281
                     /gene="UL73"
                     /note="core gene"
     CDS             106874..107281
                     /gene="UL73"
                     /note="type 1 membrane protein; complexed with envelope
                     glycoprotein M; involved in virion morphogenesis; involved
                     in membrane fusion"
                     /codon_start=1
                     /product="envelope glycoprotein N"
                     /protein_id="ACS93405.1"
                     /translation="MEWNTLVLGLLVLSVVASSNNTSTASTPRPSSSTHASTTVKATT
                     VATTSTTTATSTSSTTSAKPGSTTHDPNVMRPHAHNDFYNAHCTSHMYELSLSSFAAW
                     WTMLNALILMGAFCIVLRHCCFQNFTATTTKGY"
     gene            complement(107253..108671)
                     /gene="UL74"
                     /note="beta gene"
     CDS             complement(107253..108671)
                     /gene="UL74"
                     /note="contains signal peptide; associated with envelope
                     glycoprotein H and envelope glycoprotein L; involved in
                     virion morphogenesis"
                     /codon_start=1
                     /product="envelope glycoprotein O"
                     /protein_id="ACS93406.1"
                     /translation="MGKKEMIMVKGIPKIMLLISITFLLLSLINCNVLVNSRGTRRSW
                     PYTVLSYRGKEILKKQKEDILKRLMSTSSDGYRFLMYPSQQKFHAIVISMDKFPQDYI
                     LAGPIRNDSITHMWFDFYSTQLRKPAKYVYSEYNHTAHKITLRPPPCGTVPSMNCLSE
                     MLNVSKRNDTGEKGCGNFTTFNPMFFNVPRWNTKLYIGSNKVNVDSQTIYFLGLTALL
                     LRYAQRNCTRSFYLVNAMSRNLFRVPKYINGTKLKNTMRKLKRKQALVKEQPQKKNKK
                     SQSTTTPYLSYTTSTAFNVTTNVTYSATAAVTRVATSTTGYRPDSNFMKSIMATQLRD
                     LATWVYTTLRYRNEPFCKPDRNRTAVSEFMKNTHVLIRNETPYTIYGTLDMSSLYYNE
                     TMSVENETASDNNETTPTSPSTRFQRTFIDPLWDYLDSLLFLDKIRNFSLQLPAYGNL
                     TPPEHRRAANLSTLNSLWWWSQ"
     gene            107965..108875
                     /gene="UL74A"
                     /note="beta gene"
     CDS             join(107965..107978,108677..108875)
                     /gene="UL74A"
                     /note="type 2 membrane protein"
                     /codon_start=1
                     /product="envelope glycoprotein 24"
                     /protein_id="ACS93472.2"
                     /translation="MALTRGGDPAPSVCLVVWLACVYSLLILVVLLLIYRCCIGFQDD
                     LVSRTLAVYRACIQGPICNQTHNSTS"
     gene            complement(109047..111275)
                     /gene="UL75"
                     /note="core gene"
     CDS             complement(109047..111275)
                     /gene="UL75"
                     /note="type 1 membrane protein; putative membrane fusogen;
                     complexed with envelope glycoprotein L; involved in cell
                     entry; involved in cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein H"
                     /protein_id="ACS93407.1"
                     /translation="MRPGLPSYLIVLAVCLLSHLLSSRYGAKAVSEPLDKAFHLLLNT
                     YGRPIRFLRENTTQCTYNSSLRNSTVVRENAISFNFFQSYNQYYVFHMPRCLFAGPLA
                     EQFLNQVDLTETLEKYQQRLNTYALVSKDLASYRSFSQQLKAQDSLGEQPTTVPPPID
                     LSIPHVWMPPQTTPHGWTESHTTSGLHRPHFNQTCILFDGHDLLFSTVTPCLHQGFYL
                     IDELRYVKITLTEDFFVVTVSIDDDTPMLLIFGHLPRVLFKAPYQRDNFILRQTEKHE
                     LLVLVKKDQLNRHSYLKDPDFLDAALDFNYLDLSALLRNSFHRYAVDVLKSGRCQMLD
                     RRTVEMAFAYALALFAAARQEEAGAQVSVPRALDRQAALLQIQEFMITCLSQTPPRTT
                     LLLYPTAVDLAKRALWTPNQITDITSLVRLVYILSKQNQQHLIPQWALRQIADFALKL
                     HKTHLASFLSAFARQELYLMGSLVHSMLVHTTERREIFIVETGLCSLAELSHFTQLLA
                     HPHHEYLSDLYTPCSSSGRRDHSLERLTRLFPDATVPTTVPAALSILSTMQPSTLETF
                     PDLFCLPLGESFSALTVSEHVSYVVTNQYLIKGISYPVSTTVVGQSLIITQTDSQTKC
                     ELTRNMHTTHSITAALNISLENCAFCQSALLEYDDTQGVINIMYMHDSDDVLFALDPY
                     NEVVVSSPRTHYLMLLKNGTVLEVTDVVVDATDSRLLMMSVYALSAIIGIYLLYRMLK
                     TC"
     gene            111470..112447
                     /gene="UL76"
                     /note="core gene"
     CDS             111470..112447
                     /gene="UL76"
                     /codon_start=1
                     /product="nuclear protein UL24"
                     /protein_id="ACS93408.1"
                     /translation="MPSGCGDDADSTGNALRRLPHVRKRIGKRKHLDIYRRLLRVFPS
                     FVALNRLLGGLFPPELQKYRRRLFIEVRLSRRIPDCVLVFLPPDSGSRGIVYCYVIEF
                     KTTYSDADDQSVRWHATHSLQYAEGLRQLKGALVDFDFLRLPRGGGQVWSVVPSLVFF
                     QQKADRPSFYRAFRSGRFNLCTDSVLDYLGRRQDESVAHLLAATRRRLLRAARGKRAA
                     LPRARASAVAGGRGGGNARRGLARGRAHGPGAQTVSASGAQGSGSQGADLLRGSRRAR
                     VRGGGAVEPAVRARRRTVAADAATTTVSSAFVVPRDRRGRSFRRPTRSL"
     gene            112050..113957
                     /gene="UL77"
                     /note="core gene"
     CDS             112050..113957
                     /gene="UL77"
                     /note="located on capsid near vertices; possibly
                     stabilizes the capsid and retains the genome; involved in
                     DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL25"
                     /protein_id="ACS93409.1"
                     /translation="MSLLHTFWRLPVAVFFEPHEENVLRCPERVLRRLLEDAAVATRG
                     GGWREDVLMDRVRKRYLRQELRDLGHRVQTYCEDLEGRVSEAEALLNQQCELDEGPSP
                     RTLLQPPCRPRSSSPGTGVAGASAVPHGLYSRHDAITGPAAPSDAATASAAAGASSTW
                     LAQCAERPLPGNVPSYFGITQNDPFIRFHTDFRGEVVNTMFENASTWTFSFGIWYYRL
                     KRGLYTQPRWKRVYHLAQMDNFSISQELLLGVVNALENVTVYPTYDCVLSDLEAAACL
                     LAAYGHALWEGRDPPDSVTAVLGELPQLLPRLADDVSREIAAWEGPVAAGNNYYAYRD
                     SPDLRYYMPLSGGRHYHPGTFDRHVLVRLFHKRGVLQHLPGYGTITEELVQERLSGQV
                     RDDVLSLWSRRLLVGKLGRDVPVFVHEQQYLRSGLTCLAGLLLLWKVTNADSVFAPRT
                     GKFTLADLLGSDAVAGGGLPGGRAGGEEEGYGGRHGRVRNFEFLVQYYIGPWYVRDPA
                     VTLSQLFPGLALLAVTESVRSGWDPSRREDSAGGGDGGGAVLMQLSKSNPVADYMFAQ
                     SSKQYGDLRRLEVHDALLFHYEHGLGRLLSVTLPRHRVSTLGSSLFNVNDIYELLYFL
                     VLGFLPSVAVL"
     gene            114046..115338
                     /gene="UL78"
                     /note="beta gene"
     CDS             114046..115338
                     /gene="UL78"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     putative chemokine receptor; possibly involved in
                     intracellular signalling; GPCR family"
                     /codon_start=1
                     /product="envelope protein UL78"
                     /protein_id="ACS93410.1"
                     /translation="MSPSAEKTTSVTDSIMLAIVNFKYMGPFEGYSMSADRAASDLLI
                     GMFGSVSLVNLLTIIGCLWVLRVTRPPVSVMIFTWNLVLSQFFSIVATMLSKGIMLRG
                     ALNLSLCRLVLFVDDVGLYSTALFFLFLILDRLSAISYGRDLWHHETRENAGVALYAV
                     AFAWVLSIVAAVPTAATGSLDYRWLGCQIPIQYAAVDLTIKMWFLLGAPMIAVLANVV
                     ELAYSDRRDHVWSYVGRVCTFYVTCLMLFVPYYCFRVLRGVLQPASAAGIGFGIMDYV
                     ELATRTLLTMRLGILPLFIIAFFSREPTKDLDDSFDYLVERCHQSCHGHFVRRLVQAL
                     KRAMYSVELAVCYFSTSVRDVAEAVKKSSSRCYADATSAAVVTTTTSEKATLVEHAEG
                     MASEMCPGTTIDVSAESSSVLCTDGENTVASDATVTAL"
     gene            complement(115393..116280)
                     /gene="UL79"
                     /note="betagamma gene"
     CDS             complement(115393..116280)
                     /gene="UL79"
                     /note="promotes accumulation of late transcripts"
                     /codon_start=1
                     /product="protein UL79"
                     /protein_id="ACS93411.1"
                     /translation="MMARDEENPAVPRVRTGKFSFTCANHLILQISEKMSRGQPLSSL
                     RLEELKIVRLICVLLFHRGLETLLLRETMNNLGVSDHAVLSRKTPQPYWPHLYRELRQ
                     AFPGLDFEAAVFDETRAARLSQRLCHPRLSGGLLTRFVQRHTGLPVVFPEDLARNGNI
                     LFSLGTLYGHRLFRLAAFFTRHWGAEAYEPLIRIICQKMWYFYLIGTGKMRITPDAFE
                     IQRSRHETGIFTFIMEDYRTFAGTLSRHPHRPHPQQQQHHHPGPPHPPLSHPASSCLS
                     PEAVLAARALHMPTLANDV"
     gene            116317..118443
                     /gene="UL80"
                     /note="core gene"
     CDS             116317..118443
                     /gene="UL80"
                     /EC_number="3.4.21.97"
                     /note="serine protease (N-terminal region); minor scaffold
                     protein (remainder of protein, clipped near C terminus);
                     involved in capsid morphogenesis"
                     /codon_start=1
                     /product="capsid maturation protease"
                     /protein_id="ACS93412.1"
                     /translation="MTMDEQQPQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLH
                     AQGQGQPSLSVALPLNINHDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEIVRRASE
                     KSELVSRGPVSPLQPDKVVEFLSGSYAGLSLSSRRCDDVEAATSLSGSETTPFKHVAL
                     CSVGRRRGTLAVYGRDPEWVTQRFPDLTAADRDGLRAQWQRCGSTVVDASGDPFRSDS
                     YGLLGNSVDALYIRERLPKLRYDKQLVGVTERESYVKASVSPEAACDIKAASAERSGD
                     SRSQAATPAAGARVPSSSPSLPVEPPSPVQPPALPASPSVLPAESPPSLSPSEPAEAA
                     SMSHPLSAAVPAATAPPGATVAGASPAVPSLAWPHDGVYLPKDAFFSLLGASRSAAPV
                     MYPGAVAAPPSASPAPLPLPSYPAPYGAPVVGYDQLAARHFAEYVDPHYPGWSRRYEP
                     APPLHSACPVPPPPSPAYYRRRDSPGGMDEPPSGWERYDGGHRGQSQKQHRHGGSGGH
                     NKRRKEAAAASSSSSDEDLSFPGEAEHGRARKRLKSHVNSDGGSGGHAGSNQQQQQRY
                     DELRDAIHELKRDLFAARQSSTLLSAALPAAASSSPTTTTVCTPTGELTSGGGETPTA
                     LLSGGAKVAERAQAGVVNASCRLATASGSETATAGPSTAGSSSCPASVVLAAAAAQAA
                     AASQSPPKDMVDLNRRIFVAALNKLE"
     gene            117322..118443
                     /gene="UL80.5"
                     /note="core gene"
     CDS             117322..118443
                     /gene="UL80.5"
                     /note="clipped near C terminus; involved in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid scaffold protein"
                     /protein_id="ACS93413.1"
                     /translation="MSHPLSAAVPAATAPPGATVAGASPAVPSLAWPHDGVYLPKDAF
                     FSLLGASRSAAPVMYPGAVAAPPSASPAPLPLPSYPAPYGAPVVGYDQLAARHFAEYV
                     DPHYPGWSRRYEPAPPLHSACPVPPPPSPAYYRRRDSPGGMDEPPSGWERYDGGHRGQ
                     SQKQHRHGGSGGHNKRRKEAAAASSSSSDEDLSFPGEAEHGRARKRLKSHVNSDGGSG
                     GHAGSNQQQQQRYDELRDAIHELKRDLFAARQSSTLLSAALPAAASSSPTTTTVCTPT
                     GELTSGGGETPTALLSGGAKVAERAQAGVVNASCRLATASGSETATAGPSTAGSSSCP
                     ASVVLAAAAAQAAAASQSPPKDMVDLNRRIFVAALNKLE"
     gene            complement(118609..120288)
                     /gene="UL82"
     CDS             complement(118609..120288)
                     /gene="UL82"
                     /note="upper matrix protein; involved in gene regulation;
                     transcriptional activator; targeted to ND10; targets Rb
                     proteins for ubiquitin-independent proteosomal
                     degradation; DURP family"
                     /codon_start=1
                     /product="tegument protein pp71"
                     /protein_id="ACS93414.1"
                     /translation="MSQASSSPGEGPSSEAAAISEAEAASGSFGRLHCQVLRLITNVE
                     GGSLEAGRLRLLDLRTNIEVSRPSVLCCFQENKSPHDTVDLTDLNIKGRCVVGEQDRL
                     LVDLNNFGPRRLTPGSENNTVSVLAFALPLDRVPVSGLHLFQSQRRGGEENRPRMEAR
                     AIIRRTAHHWAVRLTVTPNWRRRTDSSLEAGQIFVSQFAFRAGAIPLTLVDALEQLAC
                     SDPNTYIHKTETDERGQWIMLFLHHDSPHPPTSVFLHFSVYTHRAEVVARHNPYPHLR
                     RLPDNGFQLLIPKSFTLTRIHPEYIVQIQNAFETNQTHDTIFFPENIPGVSIEAGPLP
                     DRVRITLRVTLTGDQAVHLEHRQPLGRIHFFRRGFWTLTPGKPDKIKRPQVQLRAGLF
                     PRSNVMRGAVSEFLPQSPGLPPTEEEEEEEEEDDEDDLSSTPTPTPLSEAMFAGFEEA
                     SGDEDSDTQAGLSRALILTGQRRRSGNNGALTLVIPSWHVFASLDDLVPLTVSVQHAA
                     LRPTSYLRSDMDGDVRTAADISSTLRSVPAPRPSPISTASTSSTPRSRPRI"
     gene            complement(120477..122162)
                     /gene="UL83"
                     /note="beta gene"
     CDS             complement(120477..122162)
                     /gene="UL83"
                     /note="lower matrix protein; involved in immune
                     regulation; suppresses interferon response; inhibits NK
                     cell cytotoxicity; binds NKp30; DURP family"
                     /codon_start=1
                     /product="tegument protein pp65"
                     /protein_id="ACS93415.1"
                     /translation="MESRGRRCPEMISVLGPISGHVLKAVFSRGDTPVLPHETRLLQT
                     GIHVRVSQPSLILVSQYTPDSTPCHRGDNQLQVQHTYFTGSEVENVSVNVHNPTGRSI
                     CPSQEPMSIYVYALPLKMLNIPSINVHHYPSAAERKHRHLPVADAVIHASGKQMWQAR
                     LTVSGLAWTRQQNQWKEPDVYYTSAFVFPTKDVALRHVVCAHELVCSMENTRATKMQV
                     IGDQYVKVYLESFCEDVPSGKLFMHVTLGSDVEEDLTMTRNPQPFMRPHERNGFTVLC
                     PKNMIIKPGKISHIMLDVAFTSHEHFGLLCPKSIPGLSISGNLLMNGQQIFLEVQAIR
                     ETVELRQYDPVAALFFFDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGA
                     AQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTAGV
                     MTRGRLKAESTVAPEEDTDEDSDNEIHNPAVFTWPPWQAGILARNLVPMVATVQGQNL
                     KYQEFFWDANDIYRIFAELEGVWQPAAQPKRRRHRQDALPGPCIASTPKKHRG"
     gene            complement(122434..124197)
                     /gene="UL84"
                     /note="beta gene"
     CDS             complement(122434..124197)
                     /gene="UL84"
                     /note="involved in gene regulation; involved in DNA
                     replication; DURP family"
                     /codon_start=1
                     /product="protein UL84"
                     /protein_id="ACS93416.1"
                     /translation="MPRVDPNLRNRARRPRARRGGGGGVGSNSSRHSGKCRRQRRALS
                     TPPLTFLATTTTTTMMGVASTDDDSLLLKTPDELDKHSGSPQTILTLTDKHDIRQPRV
                     HRGTYHLIQLHLDLRPEELRDPFQILLSTPLQLGEANGESQTAPATSQEEETAASHEP
                     EKKKEKEEKKEEEDEDDRNDDRERGILCVVSNEDSDVRPAFSLFPARPGCHILRSVID
                     QQLTRMAIVRLSLNLFALRIITPLLKRLPLRRKAAHHTALHDCLALHLPELTFEPTLD
                     INNVTENAASVADTAESTDADLTPTLTVRVRHALCWHRVEGGISGPRGLTSRISARLS
                     ETTAKTLGPSVFGRLELDPNESPPDLTLSSLTLYQDGILRFNVTCDRTEAPADPVAFR
                     LRLRRETVRRPFFSDAPLPYFVPPRSGAADEGLEVRVPYELTLKNSHTLRIYRRFYGP
                     YLGVFVPHNRQGLKMPVTVWLPRSWLELTVLVSDENGATFPRDALLGRLYFISSKHTL
                     NRGCLSAMTHQVKSTLHSRSTSHSPSQQQLSVLGASIALEDLLPMRLASPETEPQDCK
                     LTENTTEKTSPVTLAMVCGDL"
     gene            complement(124229..125149)
                     /gene="UL85"
                     /note="core gene"
     CDS             complement(124229..125149)
                     /gene="UL85"
                     /note="complexed 2:1 with capsid triplex subunit 1 to
                     connect capsid hexons and pentons; involved in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid triplex subunit 2"
                     /protein_id="ACS93417.1"
                     /translation="MAAMEANIFCTFDHKLSIADVGKLTKLVAAVVPIPQRLHLIKHY
                     QLGLHQFVDHTRGYVRLRGLLRNMTLTLMRRVEGNQILLHVPTHGLLYTVLNTGPVTW
                     EKGDALCVLPPLFHGPLARENLLTLGQWELVLPWIVPMPLALEINQRLLIMGLFSLDR
                     SYEEVKAAVQQLQTITFRDATFTIPDPVIDQHLLIDMKTACLSMSMVANLASELTMTY
                     VRKLALEDSSMLLVKCQELLMRLDRERSVGEPRTPARPQHVSPDDEIARLSALFVMLR
                     QLDDLIREQVVFTVCDVSPDNKSATCIFKG"
     gene            complement(125311..129423)
                     /gene="UL86"
                     /note="core gene"
     CDS             complement(125311..129423)
                     /gene="UL86"
                     /note="6 copies form hexons, 5 copies form pentons;
                     involved in capsid morphogenesis"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="ACS93418.1"
                     /translation="MENWSALELLPKVGIPTDFLTHVKTSAGEEMFEALRIYYGDDPE
                     RYNIHFEAIFGTFCNRLEWVYFLTSGLAAAAHAIKFHDLNKLTTGKMLFHVQVPRVAS
                     GAGLPTSRQTTIMVTKYSEKSPITIPFELSAACLTYLRETFEGTILDKILNVEAMHTV
                     LRALKNTADAMERGLIHSFLQTLLRKAPPYFVVQTLVENATLARQALNRIQRSNILQS
                     FKAKMLATLFLLNRTRDRDYVLKFLTRLAEAATDSILDNPTTYTTSSGAKISGVMVST
                     ANVMQIIMSLLSSHITKETVSAPATYGNFVLSPENAVTAISYHSILADFNSYKAHLTS
                     GQPHLPNDSLSQAGAHSLTPLSMDVIRLGEKTVIMENLRRVYKNTDTKDPLERNVDLT
                     FFFPVGLYLPEDRGYTTVESKVKLNDTVRNALPTTAYLLNRDRAVQKIDFVDALKTLC
                     HPVLHEPAPCLQTFTERGPPSEPAMQRLLECRFQQEPMGGAARRIPHFYRVRREVPRT
                     VNEIKQDFVVTDFYKVGNITLYTELHPFFDFTHCQENSETVALCTPRIVIGNLPDGLA
                     PGPFHELRTWEIMEHMRLRPPPDYEETLRLFKTTVTSPNYPELCYLVDVLVHGNVDAF
                     LLIRTFVARCIVNMFHTRQLLVFAHSYALVTLIAEHLADGALPPQLLFHYRNLVAVLR
                     LVTRISALPGLNNGQLAEEPLSAYVNALHDHRLWPPFVTHLPRNMEGVQVVADRQPLN
                     PANIEARHHGVSDVPRLGAMDADEPLFVDDYRATDDEWTLQKVFYLCLMPAMTNNRAC
                     GLGLNLKTLLVDLFYRPAFLLMPAATAVSTSGTTSKESTSGVTPEDSIAAQRQAVGEM
                     LTELVEDVATDAHTPLLQACRELFLAVQFVGEHVKVLEVRAPLDHAQRQGLPDFISRQ
                     HVLYNGCCVVTAPKTLIEYSLPVPFHRFYSNPTICAALSDDIKRYVTEFPHYHRHDGG
                     FPLPTAFAHEYHNWLRSPFSRYSATCPNVLHSVMTLAAMLYKISPVSLVLQTKAHIHP
                     GFALTAVRTDTFEVDMLLYSGKSCTSVIINNPIVTKEERDISTTYHVTQNINTVDMGL
                     GYTSNTCVAYVNRVRTDMGVRVQDLFRVFPMNVYRHDEVDRWIRHAAGVERPQLLDTE
                     TISMLTFGSMSERNAAATVHGQKAACELILTPVTIDVNYFKIPNNPRGRASCMLAVDP
                     YDTEAATKAIYDHREADAQTFAATHNPWASQAGCLSDVLYNTRHRERLGYNSKFYSPC
                     AQYFNTEEIIAANKTLFKTIDEYLLRAKDCIRGDTDTQYVCVEGTEQLIENPCRLTQE
                     ALPILSTTTLALMETKLKGGAGAFATSETHFGNYVVGEIIPLQQSMLFNS"
     gene            129483..132308
                     /gene="UL87"
                     /note="betagamma gene"
     CDS             129483..132308
                     /gene="UL87"
                     /note="promotes accumulation of late transcripts"
                     /codon_start=1
                     /product="protein UL87"
                     /protein_id="ACS93419.1"
                     /translation="MAGAAPRRLGCDALIVVGGSAMPRRVLHVPVHVRACNLTQELST
                     GEDARFCRPRPVNVERVRAVFAALYRACPIHVRTEPERVKLVLGRLLLGPVAVPCFCD
                     GEVEGHGEHLVPTTQFCRGPLLYVHRRCCCGSVTAGRALSYHVLENHVATHVLRGLLS
                     LTEWNRELPSLFCDCPGGGGASGTEERYAMACLPRDLSLHLDDYPYLMVEIGRVLSVS
                     EVDDYVTAVSGYLGEAAAPRIQVHYKLLFGLNVRPQAPCALDATRDFFLLELQKLWLG
                     VEYHHEVTSEFFGRVLAQLHRDRARVMMALRLPEQTVCHLSTFVLSRFKRQVLYFKLQ
                     VSYGKCRTGHADRSGGGGNGGNQGHHNLLCYRRLSVTFADTDTVWRNLFYVYYELARD
                     LGSHGTGNRPVNRGYGVSCAPRTSRLSPSESTVVSANGHALSSTALPTTSAGHKLSLP
                     RDPAADRVRRYVCIISRLMYARYGERWRKHRQRRSETGEEEEEETLESGETDATPPFD
                     FTGQQLRRAYQEHRRRKHLAVQRYAPCRRKLIGGMEFAEVTGVSLDRIAVNAFNTNRV
                     INMKAALSSIAASGLGVRAPRLPKNMTHSFVMYKHTFKEPACTVSTFVSNDAVYINSL
                     NVNIRGSYPEFLYSLGVYRLHVNIDHFFLPAVVCNSNSSLDVHGLEDQAVIRSERSKV
                     YWTTNFPCMISHTNNVNVGWFKAATAIVPRVSGADLEAILLKELSCIKNMRDVCIDYG
                     LHRVFTQLELRNSYQIPFLAKQLVLFLRACLLKLHGREKRLQLDRLVFEAAQRGLFDY
                     SKNLTAHTKIKHTCALIGSRLANNVPKILARNKKVKLDHLGRNANVLTVCRHVEAHKI
                     PRTRLKVLVEVLGVLQSISGTPHTREVIHQTLFRLCSAAAATSGLCPSPPPLCVSSSS
                     SVPSVQTSVSVDGSSEPTSPRARFASR"
     gene            132305..133594
                     /gene="UL88"
                     /note="betagamma gene"
     CDS             132305..133594
                     /gene="UL88"
                     /codon_start=1
                     /product="tegument protein UL88"
                     /protein_id="ACS93420.1"
                     /translation="MMEAAAAAAAAFRPEERPTPGWHDAALLMDDGTVREHAFRNGPL
                     SQLIRRVLPPPPDAEDDVVFASELCFYCSGRFNRRSSVFSIYWQKHSDLVYALTGITH
                     CAKLVVECGQLGSSRLRWRDGDASGEERRGDDDSRDELYDMPGIYMIRVNDGGSTGPR
                     HVIWPGTSVLWAPDVVITTVQRRISAARALVNTFRQYFFLLERRSHEELVLCPPEMEE
                     RLAPLLQSATRGDSDMFDGVVASAYHRLRMSNIPRSSARLLEHCVGLAGAKKLLLLDV
                     PRLENYFLCQVCLYELDEDEMGEEMLGMLAGKPEDAAVSGASGGFLLHRKTMKLAACL
                     CLLLNSLHLHQEALEALDPPPPRVEENDLVNVVLRRYYRSHGGVQARTLAAARALLAD
                     YAETFSPLGSFTRLGYDRLVSADAGVSRRHLVALLRA"
     gene            complement(133591..139518)
                     /gene="UL89"
                     /note="core gene"
     CDS             complement(join(133591..134727,138631..139518))
                     /gene="UL89"
                     /note="contains ATPase domain; involved in DNA
                     encapsidation"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 1"
                     /protein_id="ACS93421.1"
                     /translation="MLRGDSAAKIQERYAELQKRKSHPTSCISTAFTNVAALCRKRYQ
                     MMHPELGLAHSCNEAFLPLMAFCGRHRDYNSPEESQRELLFHERLKSALDELTFRPCS
                     EEQRASYQKLDALTELYRDPQFQQINNFMTDFKKWLDGGFSTAVEGDAKAIRLEPFQK
                     NLLIHVIFFIAVTKIPVLANRVLQYLIHAFQIDFLSQTSIDIFKQKATVFLVPRRHGK
                     TWFIIPIISFLLKHMIGISIGYVAHQKHVSQFVLKEVEFRCRHTFARDYVVENKDNVI
                     SIDHRGAKSTALFASCYNTNSIRGQNFHLLLVDEAHFIKKEAFNTILGFLAQNTTKII
                     FISSTNTTSDATCFLTRLNNAPFDMLNVVSYVCEEHLHSFTEKGDATACPCYRLHKPT
                     FISLNSQVRKTANMFMPGAFMDEIIGGTNKISQNTVLITDQSREEFDILRYSTLNTNA
                     YDYFGKTLYVYLDPAFTTNRKASGTGVAAVGAYRHQFLIYGLEHFFLRDLSESSEVAI
                     AECAAHMIISVLSLHPYLDELRIAVEGNTNQAAAVRIACLIRQSVQSSTLIRVLFYHT
                     PDQNHIEQPFYLMGRDKALAVEQFISRFNSGYIKASQELVSYTIKLSHDPIEYLLEQI
                     QNLHRVTLAEGTTARYSAKRQNRISDDLIIAVIMATYLCDDIHAIRFRVS"
     gene            134963..135298
                     /gene="UL91"
                     /note="betagamma gene"
     CDS             134963..135298
                     /gene="UL91"
                     /codon_start=1
                     /product="protein UL91"
                     /protein_id="ACS93422.1"
                     /translation="MNSLLTELNRLGVAHATTEDVFIFVDRLFQHFSFLFQAEESGPR
                     RLELVASVFEHLTVECVNDILDACSHPDVNVVETSNTCRPCPSPVPSAPKTVSDAQTS
                     CATPRAPVT"
     gene            135268..135873
                     /gene="UL92"
                     /note="betagamma gene"
     CDS             135268..135873
                     /gene="UL92"
                     /codon_start=1
                     /product="protein UL92"
                     /protein_id="ACS93423.1"
                     /translation="MCDASGACDMRHVQNAFTEEIQLHSLYACTRCFRTHLCDLGSGC
                     ALVSTLEGSVCVKTGLVYETLYPVARSHLLEPIEEVALDDVNIISAVLSGVYSYLMTH
                     AGRYADVIQEVVERDRLKKQVEDSIYFTFNKVFRSMHNVNRISVPVISQLFIQLIIGI
                     YSKQTKYDACVIKVSRKKREDALLKQMRSEYGNAPVFGSGV"
     gene            135839..137623
                     /gene="UL93"
                     /note="core gene"
     CDS             135839..137623
                     /gene="UL93"
                     /note="capsid-associated; involved in DNA encapsidation;
                     involved in capsid transport"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL17"
                     /protein_id="ACS93424.1"
                     /translation="METHLYSDLAFEARFADDEQLPLHLVLDQEVLSNEEAETLRYVY
                     YRNVDSAGRSAGRAPGGDEDDAPASDDAEDAVGGDRAFDRERRTWQRACFRVLPRPLE
                     LLDYLRQSGLTVTLEKEQRVRMFYAVFTTLGLRCPDNRLSGAQTLHLRLVWPDGSYRD
                     WEFLARDLLREEMEANKRDRQHQLATTTNHRRRGGLRNNLDNGSDRRLPEAAVASLET
                     AVSTPFFEIPNGAGTSSANGGGRFSNLEQRVARLLRGDEEFIYHAGPLEPPSKIRGHE
                     LVQLRLDVNPDLMYATDPHDRDEVARTDEWKGAGVSRLREVWDVQHRVRLRVLWYVNS
                     FWRSRELSYDDHEVELYRALDAYRARIAVEYVLIRAVRDEIYAVLRRDSGALPQRFAC
                     HVPRNMSWRVVWELCRHALALWMDRADVRSCIIKALTPRLSRGAAAAAQRARRQRERS
                     APKPQELLFGPRNESGPPAERTWYADVVRCVRAQVDLGVEVRAARCPRTGLWIVRDRR
                     GRLRRWLSQPEVCVFYVTPDLDFYWVLPGGFAVSSRVTLHGLAQRALRDRFQNFEAVL
                     ARGMHVEAGRQEPETPRVSGRRLPFDDL"
     gene            137481..138518
                     /gene="UL94"
                     /note="core gene"
     CDS             137481..138518
                     /gene="UL94"
                     /note="possibly involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL16"
                     /protein_id="ACS93425.1"
                     /translation="MAWRSGLCETDSRTLKQFLQEECMWKLVGKSRKHREYRAVACRS
                     TIFSPEDDGSCILCQLLLLYRDGEWILCLCCNGRYQGHYGVGHVHRRRRRICHLPTLY
                     QLSFGGPLGPASIDFLPSFSQVTSSMTCDGITPDVIYEVCMLVPQDEAKRILVKGHGA
                     MDLTCQKAVTLGGAGAWLLPRPEGYTLFFYILCYDLFTSCGNRCDIPSMTRLMAAATA
                     CGQAGCSFCTDHEGHVDPTGNYVGCTPDMGRCLCYVPCGPMTQSLIHNEEPATFFCES
                     DDAKYLCAVGSKTAAQVTLGDGLDYHIGVKDSEGRWLPVKTDVWDLVKVEEPVSRMIV
                     CSCPVLKNLVH"
     gene            139517..141118
                     /gene="UL95"
                     /note="betagamma gene"
     CDS             139517..141118
                     /gene="UL95"
                     /note="promotes accumulation of late transcripts"
                     /codon_start=1
                     /product="protein UL95"
                     /protein_id="ACS93426.1"
                     /translation="MMAAAVVRAEVRRQRREERKKMASTRTTEDPPENHVVADVACGT
                     GAVTRSSSSSLVVSSSSASGSDESSSASPLSFPVSSPSTAVRSPGSAGVSTSLCSVER
                     MVELSAQSPAADFSVSEAWRFEEAVNMALVACEAVSPYDRFRLIETPDENFLLVTNVI
                     PRESAEVPVLDSSSSGGDSGPEDKKKNVGNKTAGEKNGGGSRAKRRRRRRAPKNDAAT
                     PSFLRRHDVLERFAAAAEPLPSLCVHDYALRNADRVTYDGELIYGSYLLYRKAHVELS
                     LSSNKVQYVEAVLRQVYTPGLLDHHNVCDVEALLWLLYCGPRSFCARDTCFGREKNGC
                     PFPALLPKLFYEPVRDYMTYMNLAELYVFVWYRGYEFPAPTPQATTAGGGGGGGSGGG
                     GGAGACAVETSASAGRVDDAGDEVHLPLKPVSLDRLREVLQAVRGRFSGREVPAWPAS
                     SRTCLLCALYSQNRLCLDLARDEARTVSYSPIVIQDCAAAVTDVTLSHILPGQSTVSL
                     FPVYHVGKLLDALSLNDAGLITLNL"
     gene            141115..141498
                     /gene="UL96"
                     /note="core gene"
     CDS             141115..141498
                     /gene="UL96"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL14"
                     /protein_id="ACS93427.1"
                     /translation="MTSVNKQLLKDVMRVDLERQQHQFLRRTYGPQHRLTTQQALTVM
                     RVAAREQTRYSQRTTQCVAAHLLEQRAAVQQELQRARQLQSGNVDDALDSLTELKDTV
                     DDVRATLVDSVSATCDLDLEVDDAV"
     gene            141620..143743
                     /gene="UL97"
                     /note="core gene"
     CDS             141620..143743
                     /gene="UL97"
                     /EC_number="2.7.11.1"
                     /note="involved in protein phosphorylation; resistance to
                     ganciclovir; high-level resistance to maribavir"
                     /codon_start=1
                     /product="tegument serine/threonine protein kinase"
                     /protein_id="ACS93428.1"
                     /translation="MSSALRSRARSASLGTTTQGWDPPPLRRPSRARRRQWMREAAQA
                     AAQAAVQAAQAAAAQVAQAHVDEDEVVDLMADEAGGGVTTLTTLSSVSTTTVLGHATF
                     SACVRSDVMRDGEKEDAASDKENQRRPVVPSTSSRGSAASGDGYHGLRCRETSAMWSF
                     EYDRDGDVTSVRRALFTGGSDPSDSVSGVRGGRKRPLRPPLVSLARTPLCRRRVGGVD
                     AVLEENDVELRAESQDSAVASGPGRVLQPLSGSAGEESATAVEADSTSHDDVHCTCSN
                     DQIITTSIRGLTCDPRMFLRLTHPELCELSISYLLVYVPKEDDFCHKICYAVDMSDES
                     YRLGQGSFGEVWPLDRYRVVKVARKHSETVLTVWMSGLIRTRAAGEQQQPPSLVGTGV
                     HRGLLTATGCCLLHNVTVHRRFHTDMFHHDQWKLACIDSYRRAFCTLADAIKFLNHQC
                     RVCHFDITPMNVLIDVNPHNPSEIVRAALCDYSLSEPYPDYNERCVAVFQETGTARRI
                     PNCSHRLRECYHPAFRPMPLQKLLICDPHARFPVAGLRRYCMSELSALGNVLGFCLMR
                     LLDRRGLDEVRMGTEALLFKHAGAACRALENGKLTHCSDACLLILAAQMSYGACLLGE
                     HGAALVSHTLRFVEAKMSSCRVRAFRRFYHECSQTMLHEYVRKNVERLLATSDGLYLY
                     NAFRRTTSIICEEDLDGDCRQLFPE"
     gene            143837..145591
                     /gene="UL98"
                     /note="core gene"
     CDS             143837..145591
                     /gene="UL98"
                     /note="involved in DNA processing"
                     /codon_start=1
                     /product="deoxyribonuclease"
                     /protein_id="ACS93429.1"
                     /translation="MWGVSSLDYDDDEELTRLLAVWDDEPLSLFLMNTFLLHQEGFRN
                     LPFTVLRLSYAYRIFAKMLRAHGTPVAEDFMTRVAALARDEGLRDILGQRHAAEASRA
                     EIAEALERVAERCDDRHGGSDDYVWLSRLLDLAPNYRQVELFQLLEKESRGQSRNSVW
                     HLLRMDTVSATKFYEAFVSGCLPGAAAADGSGGGGSHYTGSRAGVSPGIQFGIKHEGL
                     VKTLVECYVMHGREPVRDGLGLLIDPTSGLLGASMDLCFGVLKQGSGRTLLVEPCARV
                     YEIKCRYKYLRKKEDPFVQNVLRRHDAAAVASLLQSHPVPGVEFRGERETPSAREFLL
                     SHDAALFRATLKRARPLKPPEPLREYLADLLYLNKAECSEVIVFDAKHLNDDNSDGDA
                     TITINASLGLAAGDAAGGGADHHLRGSPGDSPPPIPFEDENTPELLGRLNVYEVARFS
                     LPAFVNPRHQYYFQMLIQQYVLSQYYIKKHPDPERIDFRDLPTVYLVSAIFREREESE
                     LGCELLAGGRVFHCDHIPLLLIVTPVVFDPQFTRHAVSTVLDRWSRDLSRKTNLPIWV
                     PNSANEYVVSSVPRPVSP"
     gene            145528..146100
                     /gene="UL99"
                     /note="core gene"
     CDS             145528..146100
                     /gene="UL99"
                     /note="envelope-associated; involved in virion
                     morphogenesis"
                     /codon_start=1
                     /product="myristylated tegument protein"
                     /protein_id="ACS93430.1"
                     /translation="MGAELCKRICCEFGTTSGEPLKDALGRQVSLRSYDNIPPTSSSD
                     EGEDDDDGEDDDNEERQQKLRLCGSGCGGNDSSSGSHREATHDGPKKNAVRSTFREDK
                     APKPSKQSKKKKKPSKHHHHQQSSIMQETDDLDEEDTSIYLSPPPVPPVQVVAKRLPR
                     PDTPRTPRQKKISQRPSTPGTKKPAAPLPF"
     gene            complement(146357..147478)
                     /gene="UL100"
                     /note="core gene"
     CDS             complement(146357..147478)
                     /gene="UL100"
                     /note="type 3 membrane protein; 8 transmembrane domains;
                     complexed with envelope glycoprotein N; involved in virion
                     morphogenesis; involved in membrane fusion"
                     /codon_start=1
                     /product="envelope glycoprotein M"
                     /protein_id="ACS93431.1"
                     /translation="MAPSHVDKVNTRTWSASIVFMVLTFVNVSVHLVLSNFPHLGYPC
                     VYYHVVDFERLNMSAYNVMHLHTPMLFLDSVQLVCYAVFMQLVFLAVTIYYLVCWIKI
                     SMRKDKGMSLNQSTRDISYMGDSLTAFLFILSMDTFQLFTLTMSFRLPSMIAFMAAVH
                     FFCLTIFNVSMVTQYRSFKRSLFFFSRLHPKLKGTVQFRTLIVNLVEMALGFNTTVVA
                     MALCYGFGNNFFVRTGHMVLAVFVVYAIISIIYFLLIEAVFFQYVKVQFGYHLGAFFG
                     LCGLIYPIVQYGAFTIGDDYRTGISWSFGMLFFIWAMFTTCRAVRYFRGRGSGSVKYQ
                     ALATASGEEVAALSHHDSLESRRLREEEDDDDDEDFEDA"
     gene            147656..150283
                     /gene="UL102"
                     /note="core gene"
     CDS             147656..150283
                     /gene="UL102"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase subunit"
                     /protein_id="ACS93432.1"
                     /translation="MTAQPPLHHRHHPYTLFGTSCHLSWYGLLEASVPIVQCLFLDLG
                     GGRAEPRLHTFVVRGDRLPPAEVRVVHRASYAALASAVTTDADERRRGLEQRSAVLAR
                     VLLEGSALIRVLARTFTPVQIQTDASGVEILEAAPALGVETAALSNALSLFHVAKLVV
                     IGSYPEVHEPRVVTHAAERVSEEYGTHAHKKLRRGYYAYDLAMSFRVGTHKYVLERDD
                     EAVLARLFEVREVCFLRTCLRLVTPVGFVAVAVTDEQCCLLLQSAWTHLYDVLFRGFA
                     GQPPLRDYLGPDLFETGAARSFFFPGFPPVPVYAVHGLHTLMRETALDAAAEVLSWCG
                     LPDIVGSAGKLEVEPCALSLGVPEDEWQVFGTEAGGGAVRLNATAFRERPAGGDRRWL
                     LPPLPRDDGDGENNVVEVSSSTGGAHPPSDDATFTVHVRDATLHRVLIVDLVERVLAK
                     CVRARDFNPYVRYSHRLHTYAVCEKFIENLRFRSRRAFWQIQSLLGYISEHVTSACAS
                     AGLLWVLSRGHREFYVYDGYSGHGPVSAEVCVRTVVDCYWRKLFGGDDPGPTCRVQES
                     APGVLLVWGDERLVGPFNFFYGNGGAGGSPLHGVVGGFAAGHCGGACCAGCVVTHRHS
                     SGGGGGGSGVGDADHASGGGLDAAAGSGHNGGSDRVSPSTPPAALGGCCCAAGGDWLS
                     AVGHVLGRLPALLRERVSVSELEAVYREILFRFVARRNDVDFWLLRFQPGENEVRPHA
                     GVIDCAPFHGVWAEQGQIIVQSRDTALAADIGYGVYVDKAFAMLTACVEVWARELLSS
                     STASTTTCSSSSVLSSALPSVTSSSSGTATVSPPSCSSSSATWLEERDEWVRSLAVDA
                     QHAAKRVASEGLRFFRLNA"
     gene            complement(150446..151195)
                     /gene="UL103"
                     /note="core gene"
     CDS             complement(150446..151195)
                     /gene="UL103"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL7"
                     /protein_id="ACS93433.1"
                     /translation="MEALMIRGVLEVHTDFTRQNVMIMEPQVLDFTVRGDKLWLHTEH
                     GLLVSMAEYRSELLCTSAFLGYSAVFLLETEDAVTQVRLSDLRLKHRCGIVKADNLLH
                     FALCTVISCVENCNLTRKCLHDLLQYLDAVNVRESFGRLLHHSARRLICSALYLLFEE
                     KEPHIVQYVPATFVLFQQTRHTCLQLVARFFFRLTGQDEAHSFSLKLTERKTVDGWPV
                     GLGLLDVLNANYPNLPSPPKLPPRWERGEEE"
     gene            complement(151143..153236)
                     /gene="UL104"
                     /note="core gene"
     CDS             complement(151143..153236)
                     /gene="UL104"
                     /note="dodecamer located at one capsid vertex in place of
                     penton; involved in DNA encapsidation"
                     /codon_start=1
                     /product="capsid portal protein"
                     /protein_id="ACS93434.1"
                     /translation="MERNHWNEKSSGAKRSRERDLTLSTIRSILAADERLRIKASSYL
                     GVGRGVDDEAVIDIFPTGQTMSFLRLLHGFLGTCRGQSMHQVLRDPCVLRKQLLYGVC
                     KTLFDTITVRRVAEEWKLHAALFPYRALDEEDLEQYLLVWSASLRQSVQTGVLGALRD
                     ILYQYADNDDYGLYVDWCVTVGLVPLLDVKTKPNEAAERAQFVRAAVQRATETHPLAQ
                     DLLQTNLALLLQVAERLGAVRVANAPEVRVFKKVRSERLEAQLRGKHIRLYVAAEPLA
                     YERDKLLFTTPVAHLHEEILRYDGLCRHQKICQLLNTFPVKVVTASRHELNCKKLVEM
                     MEQHDRGSDAKKSIMKFLLNVSDSKSRIGIEDSVESFLQDLTPSLVDQNRLLPARGPG
                     GPGVVGPGGAVVGGPAGHVGLLPPPPGPAAPERDIRDLFKKQVIKCLEEQIQSQVDEI
                     QDLRTLNQTWENRVRELRDLLTRYASRREDSMSLGARDAELYHLPVLEAVRKARDAAP
                     FRPLAVEDNRLVANSFFSQFVPGTESLERFLTQLWENEYFRTFRLRRLVTHQGAEEAI
                     VYSNYTVERVTLPYLCHILALGTLDPVPEAYLQLSFGEIVAAAYDDSKFCRYVELICS
                     REKARRRQMSREAAGGVPERGTASSGGPGTLERSAPRRLITADEERRGPERVGRFRNG
                     GPDDPRRAGGPYGFH"
     gene            153064..155934
                     /gene="UL105"
                     /note="core gene"
     CDS             153064..155934
                     /gene="UL105"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase helicase subunit"
                     /protein_id="AAR31538.2"
                     /translation="MSMTASSSTPRPTPKYDDALILNLSSAAKIERIVDKVKSLSRER
                     FAPEDFSFQWFRSISRVERTTDNNPSAATTAAATATVHSSASSSAAAAASSEAGGTRV
                     PCVDRWPFFPFRALLVTGTAGAGKTSSIQVLAANLDCVITGTTVIAAQNLSAILNRTR
                     SAQVKTIYRVFGFVSKHVPLADSAVSHETLERYRVCEPHEETTIQRLQINDLLAYWPV
                     IADIVDKCLNMWERKAASASAAAAAAACEDLSELCESNIIVIDECGLMLRYMLQVVVF
                     FYYFYNALGDTRLYRERRVPCIICVGSPTQTEALESRYDHYTQNKSVRKGVDVLSALI
                     QNEVLINYCDIADNWVMFIHNKRCTDLDFGDLLKYMEFGIPLKEEHVAYVDRFVRPPS
                     SIRNPSYAAEMTRLFLSHVEVQAYFKRLHEQIRLSERHRLFDLPVYCVVNNRAYQELC
                     ELADPLGDSPQPVELWFRQNLARIINYSQFVDHNLSSEITKEALRPAADVVATNNPSV
                     QAHGGGGSVIGSTGGNDETAFFQDDDTTTAPDSRETLLTLRITYIKGSSVGVNSKVRA
                     CVIGYQGTVERFVDILQKDTFIERTPCEQAAYAYSLVSGLLFSAMYYFYVSPYTTEEM
                     LRELARVELPDVSSLCAAAAATAAAPAWSGGENLINNHVDADSSQGGQSVPVSQRMEH
                     GQEETHDIPCLSNHHDDSDAITDAELMDHTSLYADPFFLKYVKPPSLALLSFEETVHM
                     YTTFRDIFLKRYQLMQRLTGGRFATLPLVTYNRRNVVFKANCQISSQTGSFVGMLSHV
                     SPAQTYTLEGYTSDNVLSLPSDRHRIHPEVVQRGLSRLVLRDALGFLFVLDVNVSRFV
                     ESAQGKSLHVCTTVDYGLTSRTAMTIAKSQGLSLEKVAVDFGDHPKNLKMSHIYVAMS
                     RVTDPEHLMMNVNPLRLPYEKNTAITPYICRALKDKRTTLIF"
     gene            complement(155933..161648)
                     /gene="RNA5.0"
     ncRNA           complement(155933..161616)
                     /ncRNA_class="other"
                     /gene="RNA5.0"
                     /product="RNA5.0"
     regulatory      complement(155962..155967)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RNA5.0"
     gene            160827..161519
                     /gene="UL111A"
     CDS             join(160827..161012,161089..161289,161373..161519)
                     /gene="UL111A"
                     /note="contains signal peptide; involved in immune
                     regulation"
                     /codon_start=1
                     /product="interleukin-10"
                     /protein_id="AAR31540.1"
                     /translation="MLSVMVSSSLVLIVFFLGASEEAKPATTTTTIKNTKPQCRPEDY
                     ATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGD
                     HVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLS
                     ELDALFSRLEEYLHSRK"
     regulatory      complement(161643..161648)
                     /regulatory_class="TATA_box"
                     /gene="RNA5.0"
     gene            161744..163953
                     /gene="UL112"
                     /note="beta gene"
     CDS             join(161744..162500,162659..163953)
                     /gene="UL112"
                     /note="involved in gene regulation; involved in DNA
                     replication"
                     /codon_start=1
                     /product="protein UL112"
                     /protein_id="AAR31539.2"
                     /translation="MDLPTTVVRKYWTFANPNRILHQSVNQTFDVRQFVFDTARLVNC
                     VDGDGKVLHLNKGWLCATIMQHGEASAGAKTQQGFMSIDITGDGELQEHLFVRGGIVF
                     NKSVSSVVGSSGPNESALLTMISENGNLQVTYVRHYLKNHGESSGGGGGCGAASTASA
                     VCVSSLGGSGGTRDGPSAEEQQRRRQEQRHEERRKKSSSSAGGGGGGGAGGGGGGGGS
                     GGQHSSDSANGLLRDPRLMNRQKERRPPPSSENDGSPPLREAKRQKTTAQHEGHGGGG
                     KNETEQQSGGAGGGGGGGSGRMSLPLDTSEAVAFLNYSSSSSAVSSSSNNHHHHHHHH
                     NAVTDVAAGTDGALLLPIERGAVVSSPSSPSSLLSLPRPSSAHSAGETVQESEAAATA
                     AAAGLMMMRRMRRAPAEAAEAPPQSEEENDSTTPVSNCRVPPNSQESAAPQPPRSPRF
                     DDIIQSLTKMLNDCKEKRLCDLPLVSSRLLPETSGGTVVVNHSSVARTAAAVSTAGVG
                     PPAAACPPLVTTGVVPSGSVAGVAPVAAAVETPAAPPRPVCEIKPYVVNPVVATAAAA
                     SNSSSSSSAPLPPPPPPPPGGRRGRARNNTRGGGGGGGGRNSRRQAASSSSSSSRRSR
                     RRNNRHEDEEDNDPLLRLSQVAGSGRRRGPSFLEDGLEIIDPSEEAAIAAASIAAFFD
                     D"
     gene            complement(164123..164875)
                     /gene="UL114"
                     /note="core gene"
     CDS             complement(164123..164875)
                     /gene="UL114"
                     /EC_number="3.2.2.3"
                     /note="involved in DNA repair"
                     /codon_start=1
                     /product="uracil-DNA glycosylase"
                     /protein_id="ACS93435.1"
                     /translation="MALKQWMLANIADNKGSLLTPDEQARVFCLSADWIRFLSLPDHD
                     TVLLRDTVAAVEGARQLEMVYPAPEHVHRWSYLCPPEQVRVVIVGQDPYCDGSASGLA
                     FGTLAGRPPPPSLNNVFRELARTVDGFQRPASGCLDAWARRGVLLLNTVFTVVHGQPG
                     SHRHLGWQTLSNHVIRRLSERREHLVFMLWGADAHTCEYLIDRRRHLVLKSCHPSPRN
                     TTRAFVGNDHFILANAYLDTHYQETMDWRLCG"
     gene            complement(164847..165683)
                     /gene="UL115"
                     /note="core gene"
     CDS             complement(164847..165683)
                     /gene="UL115"
                     /note="contains signal peptide; complexed with envelope
                     glycoprotein H; involved in cell entry; involved in
                     cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein L"
                     /protein_id="ACS93436.1"
                     /translation="MCRRPDCGFSFSPGPVILLWCCLLLPIVSSAAVSVAPTAAEKVP
                     AECPELTRRCLLGEVFQGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLD
                     EAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCR
                     GYDLTRLSYERSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEG
                     ITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVD
                     AR"
     gene            complement(165683..166630)
                     /gene="UL116"
     CDS             complement(165683..166630)
                     /gene="UL116"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein UL116"
                     /protein_id="ACS93437.1"
                     /translation="MKRRRRWRGWLLFLALCFCLLREAVETNTTTVTSTTAAAATTNT
                     TVATTGTTTTSPNVTSTTSNTVTTPTTVSSVSNLTSSATSIPISTSTVSGIRNTGNNN
                     TTTIGTNATSPSPSVSILTTVTPAATSTTSNNGDVTSDYTPTFDLENITTTRAPTRPP
                     AQDLCSHNLSIILYEEESQSSVDITVGEEESESEEDDDEEYDELWFPLYFEAECNLNY
                     TLQYVNHSCDYSVRQSSVSFPPWRDIDSVTFVPRNLSNCSAHGLAVIVAGNQTWYVNP
                     FSLAHLLDAIYNVLGIEDLSANFRRQLAPYRHTLIVPQT"
     gene            complement(166627..167904)
                     /gene="UL117"
                     /note="beta gene"
     CDS             complement(166627..167904)
                     /gene="UL117"
                     /codon_start=1
                     /product="protein UL117"
                     /protein_id="ACS93438.1"
                     /translation="MVMFSQDHVQIVYGSTRICKSLAPANKRKTHRTIVVAPRRGFLR
                     IPPDGQDVNHVKIVPTTTSSSLAPPRDDERRPIPPLRPPLTVYPYGTSLIRRSARDAK
                     LRSKLIVFHITRPALGQHPQNPGISGPAAMDHSEFLTSFRREVDRQTVLTAESAPATV
                     EVCLGDALPGGVMGSGGLPAGVGSASAAVAAAAAAVAGVPVAANPVMPATATVTTPPM
                     IDLTSHHRPLTLFTPASAAAAPAVATNGGNATYILPADCRYAPLFASKYKYVFEEVSR
                     LMRLHDSTAVQLQISASCGNAFQALKSALLKLHNVTVLAGQQLITQTMPHTPQAVATF
                     KFFHQDPNRVLDCIRPVVPRSTSYHETGVYQMWVSGATKKDLFDAVTLCASIVEKQPD
                     VFNINVSLLTYPSIAAPHLPLYNEFTSFRLPTS"
     gene            complement(168017..169137)
                     /gene="UL119"
                     /note="beta gene"
     CDS             complement(join(168017..168633,168717..169137))
                     /gene="UL119"
                     /note="type 1 membrane protein; IgG Fc-binding; similar to
                     OX-2; involved in immune regulation; possibly related to
                     UL120 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL119"
                     /protein_id="AAR31387.2"
                     /translation="MCPVLAIVLVVALLGDTHPGVESSTTSAVTSPSNTTATSTTSIS
                     TSNNVTSAVTTTVQTSTSSASTSVIATTQKEGHLYTVNCEASYSYDQVSLNATCKVIL
                     LNNTKNPDILSVTCYARTDCKGPFTQVGYLSAFPPDNEGKLHLSYNATAQELLISGLR
                     PQETTEYTCSFFSWGRHHNATWDLFTYPIYAVYGTRLNATTMRVRVLLQEHEHCLLNG
                     SSLYHPNSTVHLHQGDQLIPPWNISNVTYNGQRLREFVFYLNGTYTVVRLHVQIAGRS
                     FTTTYVFIKSDPLFEDRLLAYGVLAFLVFMVIILLYVTYMLARRRDWSYKRLEEPVEE
                     KKHPVPYFKQW"
     gene            complement(169192..169788)
                     /gene="UL120"
     CDS             complement(169192..169788)
                     /gene="UL120"
                     /note="type 1 membrane protein; UL120 family"
                     /codon_start=1
                     /product="membrane protein UL120"
                     /protein_id="AAR31388.1"
                     /translation="MYRAGVTLLVVAVVSLGRWDVVTVAAAIGWYEPQVSMAYMYEHN
                     DTNLTIFCNTTARNSPFLASGMMISIPHNTRFLTSKVNYSNDMNNIRKNYTHQLTYML
                     TGDPGTYVNGSVTCWGSNGIFGAGTFLVQSMVNDTTGNTSTSIHFVQQNELVENPAYF
                     RRSNHRAFMIVILTQVVFVVFIINASFIWSWTFKRHKR"
     gene            complement(169839..170381)
                     /gene="UL121"
     CDS             complement(169839..170381)
                     /gene="UL121"
                     /note="type 1 membrane protein; UL120 family"
                     /codon_start=1
                     /product="membrane protein UL121"
                     /protein_id="AAR31389.1"
                     /translation="MWGCGWSRILVLLPLMCIALMARGTYGAYICSPNPGRLRISCAL
                     SVLDQRLWWEIQYSSGRLTRVLVFHDDGEEGDDLHLTDTRHCTSCTHPYVISLVTPLT
                     INATLRLLIRDGMYGRGEKELCIVHLPTLRDIRTCRVDADLGLLYAVCLILSFSIVAA
                     ALWKVDYDRSVAVGSKSYKS"
     gene            complement(170510..173913)
                     /gene="UL122"
                     /note="beta gene; immediate early gene"
     CDS             complement(join(170510..171996,173544..173728,
                     173843..173913))
                     /gene="UL122"
                     /note="interacts with basal transcriptional machinery and
                     cellular transcription factors; specific DNA-binding
                     protein; involved in gene regulation"
                     /codon_start=1
                     /product="regulatory protein IE2"
                     /protein_id="AAR31391.1"
                     /translation="MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEV
                     NSQLSLGDPLFPELAEESLKTFEQVTEDCNENPEKDVLAELGDILAQAVNHAGIDSSS
                     TGPTLTTHSCSVSSAPLNKPTPTSVAVTNTPLPGASATPELSPRKKPRKTTRPFKVII
                     KPPVPPAPIMLPLIKQEDIKPEPDFTIQYRNKIIDTAGCIVISDSEEEQGEEVETRGA
                     TASSPSTGSGTPRVTSPTHPLSQMNHPPLPDPLGRPDEDSSSSSSSSCSSASDSESES
                     EEMKCSSGGGASVTSSHHGRGGFGGAASSSLLSCGHQSSGGASTGPRKKKSKRISELD
                     NEKVRNIMKDKNTPFCTPNVQTRRGRVKIDEVSRMFRNTNRSLEYKNLPFTIPSMHQV
                     LDEAIKACKTMQVNNKGIQIIYTRNHEVKSEVDAVRCRLGTMCNLALSTPFLMEHTMP
                     VTHPPEVAQRTADACNEGVKAAWSLKELHTHQLCPRSSDYRNMIIHAATPVDLLGALN
                     LCLPLMQKFPKQVMVRIFSTNQGGFMLPIYETAAKAYAVGQFEQPTETPPEDLDTLSL
                     AIEAAIQDLRNKSQ"
     gene            complement(172154..173913)
                     /gene="UL123"
                     /note="beta gene; immediate early gene"
     CDS             complement(join(172154..173373,173544..173728,
                     173843..173913))
                     /gene="UL123"
                     /note="enhances activation by IE2; interacts with basal
                     transcriptional machinery and cellular transcription
                     factor; disrupts ND10; involved in gene regulation"
                     /codon_start=1
                     /product="regulatory protein IE1"
                     /protein_id="AAR31390.1"
                     /translation="MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEV
                     NSQLSLGDPLFPELAEESLKTFEQVTEDCNENPEKDVLAELVKQIKVRVDMVRHRIKE
                     HMLKKYTQTEEKFTGAFNMMGGCLQNALDILDKVHEPFEEMKCIGLTMQSMYENYIVP
                     EDKREMWMACIKELHDVTKGAANKLGGALKAKARAKKDELNRKMIYMCYRNIEFFTKN
                     SAFPKTTNGCSQAMAALQNLPQCSPDEIMAYAQKIFKILDEERDKVLTHIDHIFMDIL
                     TTCVETMCNEYKVTSDACMMTMYGSISLLSEFCRVLCCYILEETSVMLAKRPLITKPE
                     VINVMKRRIEEICMKVFAQYILGADPLRVCSPSVDDLRAIAEESDEEDAIAAYTLATA
                     GASSSDSLVSPPESPVPATIPLSSVIVAENSDQEESEQSDEEQEEGAQEEQEDTVSVK
                     SEPVSEIEEVASEEEEDGAEEPTTSGGKSTHPMVTRSKADQ"
     gene            173946..174398
                     /gene="UL124"
                     /note="beta gene"
     CDS             173946..174398
                     /gene="UL124"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL124"
                     /protein_id="AAR31392.1"
                     /translation="MERNSLLVCQLLCLVARAAATSTAQTTLPSTVNSTATGVTSDSQ
                     QNTTQLPASSAAALSLPSASAVQAHSPSSFSDTYPTATALCGTLVVVGIVLCLSLAST
                     VRSKELPSDHEPLEAWEQGSDVEAPPLPEKSPCPEHVPEIRVEIPRYV"
     gene            complement(176001..176756)
                     /gene="UL128"
     CDS             complement(join(176001..176217,176335..176469,
                     176593..176756))
                     /gene="UL128"
                     /note="contains signal peptide; similar to CC chemokines;
                     complexed with envelope glycoproteins H and L; essential
                     in non-fibroblast cells; involved in cell entry; contains
                     1 nt substitution in splice donor site and may not be
                     expressed"
                     /codon_start=1
                     /product="envelope protein UL128"
                     /protein_id="AAO11755.2"
                     /translation="MSPKNLTPFLTALWLLLDHSRVPRVRAEECCEFINVNHPPDRCY
                     DFKMCNRFTVALRCPNGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLY
                     LEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLD
                     VCRAKMGYMLQ"
     gene            complement(176796..177440)
                     /gene="UL130"
     CDS             complement(176796..177440)
                     /gene="UL130"
                     /note="contains signal peptide; complexed with envelope
                     glycoproteins H and L; essential in non-fibroblast cells;
                     involved in cell entry"
                     /codon_start=1
                     /product="envelope glycoprotein UL130"
                     /protein_id="AAO11754.1"
                     /translation="MLRLLLRHHFHCLLLCAVWTTPCLASPWSTLTANQNPSPLWSKL
                     TYSKPHDAATFYCPFIYPSLPRSPLQFSGFQRVLTGPECRNETLYLLYNREGQTLVER
                     SSTWVKKVIWYLSGRNQTILQRMPRTASKPSDGNVQISVEDAKIFGAHMVPKQTKLLR
                     FVVNDGTRYQMCVMKLESWAHVFRDYSVSFQVRLTFTEANNQTYTFCTHPNLIV"
     gene            complement(177461..177958)
                     /gene="UL131A"
     CDS             complement(join(177461..177614,177723..177958))
                     /gene="UL131A"
                     /note="contains signal peptide; complexed with envelope
                     glycoproteins H and L; essential in non-fibroblast cells;
                     involved in cell entry"
                     /codon_start=1
                     /product="envelope protein UL131A"
                     /protein_id="AAO11753.1"
                     /translation="MRLCRVWLSVCLCAVVLGQCQRETAEKNDYYRVPHYWDACSRAL
                     PDQTRYKYVEQLVDLTLNYHYDASHGLDNFDVLKRINVTEVSLLISDFRRQNRRGGTN
                     KRTTFNAAGSLAPHARSLEFSVRLFAN"
     gene            complement(178063..178878)
                     /gene="UL132"
     CDS             complement(178063..178878)
                     /gene="UL132"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="envelope glycoprotein UL132"
                     /protein_id="AAO11756.2"
                     /translation="MPAPRGLLRVTFLALVAFGLLLHMDFSDATNMTSSTNVPTSTIS
                     RNTVESATSSEPTTETNMTTAHESSVHNAHNDEIMKVLAILFYIVTGTSIFSFIAVLI
                     AVVYSSCCKHPGRFRFADEEAVNLLDDTDDSGGSSPFGSGSRRGSQIPAGFCSSSPYQ
                     RLETRDWDEEEEEASAARERMKHDPENVIYFRKDGNLDTSFVNPNYGRGSPLTIESHL
                     SDNEEDPIRYYVSVYDELTASEMEEPSNSTSWQIPKLMKVAMQPVSLRDPEYD"
     gene            complement(178955..179905)
                     /gene="UL148"
     CDS             complement(178955..179905)
                     /gene="UL148"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL148"
                     /protein_id="AAR31397.1"
                     /translation="MLRLLFTLVLLVFHGPSVNASRDYVHVRLLSYRGDPLVFKHTFS
                     GVRRPFTELGWAACRDWDSMHCTPFWSTDLEQITDSVRRYSTVSPGKEVTLQLHGNQT
                     VQPSFLSFTCRLQLEPVVENVGLYVAYVVNDGERPQQFFTPQVDVVRFALYLETLSRI
                     VEPLESGRLAVEFDTPDLALAPDLVSSLFVAGHGETDFYMNWTLRRSQTHYLEEMALQ
                     VEILKPRGVRHRAIIHHPKLQPGVGLWIDFCVYRYNARLTRGYVRYTLSPKARLPAKA
                     EGWLVSLDRFIVQYLNTLLITMMAAIWARVLITYLVSRRR"
     gene            complement(179974..180201)
                     /gene="UL147A"
     CDS             complement(179974..180201)
                     /gene="UL147A"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL147A"
                     /protein_id="AAR31398.1"
                     /translation="MSLFYRAVALGTLSALVWYSTSILAEINEESCSSSSVDHEDCEE
                     PDEIVREEQDYRALLAFSLVICGTLLVTCVI"
     gene            complement(180204..180683)
                     /gene="UL147"
     CDS             complement(180204..180683)
                     /gene="UL147"
                     /note="contains signal peptide; putative secreted
                     glycoprotein; possibly involved in immune regulation; CXCL
                     family"
                     /codon_start=1
                     /product="chemokine vCXCL2"
                     /protein_id="AAR31399.1"
                     /translation="MMLRRLHHPILNPHTNILSVRYMQLTAYMLFAVCPLAVHLLELE
                     DYDKRCRCNNQILLNTLPVGTELLKPIAASESCNRQEVLAILKDKGTKCLNPNAQAVR
                     RHINRLFFRLILDEEQRIYDVVSTNIEFGAWPVPTAYKAFLWKYAKKLNYHHFRLRW"
     gene            complement(180727..181083)
                     /gene="UL146"
     CDS             complement(180727..181083)
                     /gene="UL146"
                     /note="contains signal peptide; putative secreted
                     glycoprotein; involved in immune regulation; CXCL family"
                     /codon_start=1
                     /product="chemokine vCXCL1"
                     /protein_id="AAR31400.1"
                     /translation="MRLIFGSLISLLMAFMYYHGVHSRELRCPCTHKALHHPIGGLFW
                     VGRDPPNPPECDKPQHYLLPPRGKPVCLAPDHHLSKWLDGKKDNSWHKVLVKVKDSNG
                     PHVEENAVTNKRPRWK"
     gene            complement(181363..181755)
                     /gene="UL145"
     CDS             complement(181363..181755)
                     /gene="UL145"
                     /note="RL1 family"
                     /codon_start=1
                     /product="protein UL145"
                     /protein_id="AAR31401.1"
                     /translation="MYGVLAHYYSFISSPSVMVNFKHHNAVQLLCARTRDGTAGWERL
                     THHASYHANYGAYAVLMATSQRKSLVLHRYSAVTAVALQLMPVEMLRKLDQSDWVRGA
                     WIVSETFPTSDPKGVWSDDDSPMGGSDD"
     gene            complement(181996..182526)
                     /gene="UL144"
     CDS             complement(181996..182526)
                     /gene="UL144"
                     /note="type 1 membrane protein; similar to TNFR; interacts
                     with BTLA and inhibits T cell proliferation; does not bind
                     TNF superfamily ligands; activates NFkappaB via
                     TRAF6-dependent mechanism to upregulate CCL22; involved in
                     immune regulation"
                     /codon_start=1
                     /product="membrane glycoprotein UL144"
                     /protein_id="AAR31402.1"
                     /translation="MKPLVMLICFAVILLQLGVTKVCQHNEVQLGNECCPPCGSGQRV
                     TKVCTDYTSVTCTPCPNGTYVSGLYNCTDCTQCNVTQVMIRNCTSTNNTVCAPKNHTY
                     FSTPGVQHHKQRQQNHTAHITVKQRKSGRHTLAWLSLFIFLVGIILLILYLIAAYRSE
                     RCQQCCSIGKIFYRTL"
     gene            complement(183164..184084)
                     /gene="UL142"
     CDS             complement(183164..184084)
                     /gene="UL142"
                     /note="type 1 membrane protein; inhibits NK cell
                     cytotoxicity; downregulates MICA; acts on activating
                     receptor NKG2D; involved in immune regulation; MHC family"
                     /codon_start=1
                     /product="membrane glycoprotein UL142"
                     /protein_id="AAR31403.1"
                     /translation="MRIEWACWLFGYFVSSVGSERSLSYRYHLESNSSANVVCNGNIS
                     VFVNGTLGVRYNITVGISSSSLIGHLTIQVLESWFTPWVQNKSYIKQPLGDTETLYNI
                     DSENIHRVSQYFHTRWIKSLQENHTCDLTNSTPTYTYQVNMNNTNYLTLTSSGWQDRL
                     NYTVINSTHFNLTESNITNIQRYLNTTCIERLRNYTLESVYITTVPQNVTTSQHATTT
                     LHTIPPNTITIQDTTQSHTVQTPSFNDTHNVTKHTLNISYVLSQKTNNTTSPWIYAIP
                     MGATASIGAGLYIGKHFTPVKFVYEVWRGQ"
     gene            complement(184157..185173)
                     /gene="UL141"
     CDS             complement(184157..185173)
                     /gene="UL141"
                     /note="type 1 membrane protein; inhibits NK cell
                     cytotoxicity; sequesters CD155; acts on activating
                     receptor DNAM-1, CD96; involved in immune regulation; UL14
                     family"
                     /codon_start=1
                     /product="membrane glycoprotein UL141"
                     /protein_id="AAR31404.1"
                     /translation="MCRRESLRTLPWLFWVLLSCPRLLEYSSSSFPFATADIAEKMWA
                     ENYETTSPAPVLVAEGEQVTIPCTVMTHSWPMVSIRARFCRSHDGSDELILDAVKGHR
                     LMNGLQYRLPYATWNFSQLHLGQIFSLTFNVSMDTAGMYECVLRNYSHGLIMQRFVIL
                     TQLETLSRPDEPCCTPALGRYSLGDQIWSPTPWRLRNHDCGTYHGFQRNYFYIGRADA
                     EDCWKPACPDEEPDRCWTVIQRYRLPGDCYRSQPHPPKFLPVTPAPPADIDTGMSPWA
                     TRGIAAFLGFWSIFTVCFLCYLCYLQCCGRWCPTPGRGRRGGEGYRRLPTYDSYPGVR
                     KMKR"
     gene            complement(185466..186041)
                     /gene="UL140"
     CDS             complement(185466..186041)
                     /gene="UL140"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL140"
                     /protein_id="AAR31405.1"
                     /translation="MTPAQTNATTTVHPHDAKNGSGGSALPTLVVFGFIVTLLFFLFM
                     LYFWNNDVFRKLLRCAWIQRCCDRFDAWQDEVIYRRPSRRSQSDDESRTNSVSSYVLL
                     SPASDGGFDNPALTEAVDSVDDWATTSVFYATSDETADTERRDSQQLLIELPPEPLPP
                     DVVAAMQKAVKRAVQNALRHSHDSWQLHQTL"
     gene            complement(186223..186645)
                     /gene="UL139"
     CDS             complement(186223..186645)
                     /gene="UL139"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane glycoprotein UL139"
                     /protein_id="AAR31406.1"
                     /translation="MLWILALLALTATASETTTGTSSNSSTSTNSSNSTVAPTTPSVA
                     CVQAFGGSNWTFPQLALLAASGWTLSGLLLLFTCCFCCFWLVRKICSCCGNSSESESK
                     TTHAYTNAAFTSSDATLPMGTTGSYTPPQDGSFPPPPR"
     gene            complement(187207..187716)
                     /gene="UL138"
     CDS             complement(187207..187716)
                     /gene="UL138"
                     /note="contains potential transmembrane domain; possibly
                     involved in latency"
                     /codon_start=1
                     /product="protein UL138"
                     /protein_id="AAR31407.1"
                     /translation="MDDLPLNVGLPIIGVMLVLIVAILCYLAYHWHDTFKLVRMFLSY
                     RWLIRCCELYGEYERRFADLSSLGLGAVRRESDRRYRFSERPDEILVRWEEVSSQCSY
                     ASSRITDRRAGSSSSSSVHVASQRNSVPPPDMAVTAPLTDVDLLKPVTGSATQFTTVA
                     MVHYHQEYT"
     gene            complement(187799..188521)
                     /gene="UL136"
     CDS             complement(187799..188521)
                     /gene="UL136"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL136"
                     /protein_id="AAR31408.1"
                     /translation="MSVKGVEMPEMTWDLDVGNKWRRRKALSRIHRFWECRLRVWWLS
                     DAGVRETDPPRPRRRPTWMTAVFHVVCAVLLTLMIMAIGALIAYLRYYHQDSWRDMLH
                     DLFCGCHYPEKCRRHHERQRRRRRTMDVPDPELGDPARRPLNGAMYYGSGCRFDTVEM
                     VDETRPAPPALSSPETGDDSNDDAVAGGGAGGVTSSATRTTSPNALLPEWMDAVHVAV
                     QAAVQATVQVSGPRENAVSPAT"
     gene            complement(188608..189534)
                     /gene="UL135"
     CDS             complement(188608..189534)
                     /gene="UL135"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL135"
                     /protein_id="AAR31409.1"
                     /translation="MVWIWLGVGLLGGTGLASLVLAISLFTQRRGRKRSDETSSRGRL
                     PGAASDKRGACACCYRNPKEDVVEPLDLELGLMRVATHPPTPQVPRCTSLYIGEDGLP
                     IDKPEFPPARFEIPDVSTPGTPTSTGRSPSHCSSSSSLSSSTSVDTVLHQPPPSWKPP
                     PPPGRKKRPPTPPVRAPTTRLSSHRPPTPIPAPRKNLSTPPTKKTPPPTKPKPVGWTP
                     PVTPRPFPKTPTPQKPPRNPRLPRTVGLENLSKVGLSCPCPRPRTPTEPTTLPIVSVS
                     ELAPPPRWSDIEELLEQAVQSVMKDAESMQMT"
     gene            complement(189711..190484)
                     /gene="UL133"
     CDS             complement(189711..190484)
                     /gene="UL133"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL133"
                     /protein_id="AAR31410.1"
                     /translation="MGCDVHDPSWQCQWGVPTIIVAWITCAALGIWCLVVSPNTFSGP
                     GIAAVVGCSVFMIFLCAYLIRYREFFKDSVIDVFTCRWVRYCSCSCKCSCKCISGPCS
                     RCCSACYKETMIYDMVQYGHRRRPGHGDDPDRVICEIVESPPVSAPTVSVPPPSEESH
                     QPVIPPQPPAPTSEPKPKKGRAKDKPKGRPKDKPPCEPTVSSQPPSQPTTMPGGPPDA
                     PPPAMPQMPPGVAEAVQAAVQAAVAAALQQQQQQHQTGT"
     gene            complement(190580..190822)
                     /gene="UL148A"
     CDS             complement(190580..190822)
                     /gene="UL148A"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148A"
                     /protein_id="AAR31411.1"
                     /translation="MGSSNNLDPWIPVCVVVVMTSVVLFAGLHVYLWYVRRQLVAFCL
                     EKVCVRCCGKDETTPLVKDAEPPAELEMVEVSDECY"
     gene            complement(190952..191194)
                     /gene="UL148B"
     CDS             complement(190952..191194)
                     /gene="UL148B"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148B"
                     /protein_id="AAR31412.1"
                     /translation="MALDTLAGLAICVGLVMGVTVIASCALLVFYYCDERGDGRPSKL
                     LQRSIRRWRHGLSTESLTAILPDGSSTEQEIYHTRL"
     gene            191284..191517
                     /gene="UL148C"
     CDS             191284..191517
                     /gene="UL148C"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148C"
                     /protein_id="AAR31413.1"
                     /translation="MLTPAVFPAVLYLLALVVWVEMFCLVAVAVVEREIAWALLLRML
                     VVGLMVEVGAAAAWTFVRCLAYQRSFPVLTAFP"
     gene            191898..192086
                     /gene="UL148D"
     CDS             191898..192086
                     /gene="UL148D"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148D"
                     /protein_id="AAR31414.1"
                     /translation="MTAPKCVTTSTYLVKTKEQPWWPDNAIRRWWISVAIVIFIGVCL
                     VALMYFTQQQARNGSGSG"
     gene            complement(192102..194021)
                     /gene="UL150"
     CDS             complement(192102..194021)
                     /gene="UL150"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein UL150"
                     /protein_id="AAR31415.1"
                     /translation="MLTLYLFTATCCFVYALPRQAQVDTAICHHTWPMCSVVPHPTSS
                     AHNTALSSPHAISIEHRLLHSPSPPRENIRHSMRCRRRDMASSASTPVSHTQPLAANH
                     RRSTITYATTDPTNSPTASPAKSDKLEADADTALHRRPASLLRHLFQPCHAQRGTSNR
                     ATSQRASLNAVHHKLCGAMISSSCSTTCTPLIMDLPSLSVELSAGHKKKETPTEGGWG
                     GEEGEDDVLATIRNTLSAPTSPAAATTHRLSFPGESTFCLTAVSECSQRRTSTAALTP
                     PPPAVAAAFSFSSTVSETGTFPQSITGRTRVNDTAVVTAGDPRSPVTHVTLLQIFRLR
                     SSLLTSRSGGALRGGEHEAIPKVASLFWTLLKATQIVDMTHKTPSADSHRNPQKYTDR
                     PQRLLLTALAIWQRTYNDTRAAHAPQVRLLGDILTYRRPQTATASTKAHTQQQPEEPK
                     GQQIWTQTAGQAAPHGDEPHSDGELRRESHSAPPTSRTLPDTILAVKRRSVAQRSHVR
                     LDAKPGLNERDGFRRRLLLPLSDYFRANELRNQQFMGYGTKNGLKNTWLTRPLGVAGG
                     VRETIGERQDRNVADSATQRIFHTLYAALQTVRVWYTALGTAWRTSGSRTRESLFDGP
                     RRRDRQAGRLRRSEL"
     gene            192961..193887
                     /gene="UL150A"
     CDS             join(192961..193303,193415..193887)
                     /gene="UL150A"
                     /codon_start=1
                     /product="protein UL150A"
                     /protein_id="AFP95500.1"
                     /translation="MASCSPPRRAPPDLLVSSELRRRNIWRRVTCVTGERGSPAVTTA
                     VSLTRVRPVMLCGKVPVSETVDEKENAAATAGGGGVNAAVDVRRCEHSETAVRQKVDS
                     PGNDSRCVVAAADSSTDSDGKSIISGVQVVEHDEEIIAPQSLWCTAFKEALWDVALLE
                     VPRWAWQGWKRWRNSEAGRRWSAVSASASSLSDLAGEAVGELVGSVVAYVIVERLWLA
                     ARGWVCETGVEAEEAMSRRRQRMLWRMFSRGGDGECSRRCSMEMACGEESAVL"
     repeat_region   194105..195322
                     /note="IRL"
                     /rpt_type=inverted
     repeat_region   194823..197281
                     /note="IRS"
                     /rpt_type=inverted
     repeat_region   194823..195322
                     /note="'a' sequence"
                     /rpt_type=inverted
     gene            195631..198174
                     /gene="IRS1"
                     /note="immediate early gene"
     CDS             195631..198174
                     /gene="IRS1"
                     /note="transcriptional activator; blocks phosphorylation
                     of eIF2alpha and host shutoff of protein synthesis; binds
                     dsRNA; involved in gene regulation; involved in
                     translational regulation; US22 family"
                     /codon_start=1
                     /product="tegument protein IRS1"
                     /protein_id="ACS93439.1"
                     /translation="MAQRNGMSPRPPPLGRGRGAGGPSGVGSCSSSVPSTAGTSTSTA
                     GTATPGHGVHRVEPRGPPGAPPGSGNNSNFWHGPERLLLSQIPVERQALTELEYQAMG
                     AVWRAAFLANSTARAMRKWSQRDAGTLLPLGRPYGFYARVTPRSQMNGVGATDLRQLS
                     PRDAWIVLVATVVHEVDPAADPTVGDKAGHPEGLCAQDGLYLALGAGFRVFVYDLANN
                     TLILAARDADEWFRHGAGEVVRLYRCNRLGVGTPRATLLPQPALRQTLLRAEEATALG
                     RELRRRWAGTTVALQTPGRRLQPMVLLGAWQELAQYEPFASAPHPASLLTAVRRHLNQ
                     RLCCGWLALGAVLPARWLGCAAGPATGTAAGTTSPTAGTTAMATGTTLLAGASGTETE
                     AAGGDAPCAMAGAVGSAVPVPPQPYGTSAGGHAVCVPNAEAHTVVGADAAAAPTVMVG
                     PAASDTVPRAMLVVVLDELGAVFGYCPLDGHVYPLAAELSHFLRAGVLGALALGRESA
                     PAAEAARRLLPELDREQWERPRWDALHLHPRAALWAREPHGQWEFMFREQRGDPISDP
                     VAFRVSDARTLGLDLTTVMTERQSQLPEKYIGFYQIRKPPWLMEQPPPPSRHTKPDAA
                     TMPPPLSAQASVSHALRYDDESWRPLSTVHDHKAWLDLDESHWVLGDSRPDDIKQRRL
                     LKATQRRGAEIDRPMPVVPEECYDQRFTTEGHQVIPLCASEPEDDDEDPTYDELPSRP
                     PQKHKPPDKPPRLCKTGPGPPPLPPKQRHGSTDGKVSAPRQSEHHKRQTRPPRPPPPK
                     FGDRTAAHLSQNMRDMYLDMCTSSGHRPRPPAPPRPKKCQTHAPHHVHH"
     misc_feature    197282..232695
                     /note="US"
     gene            complement(198198..198668)
                     /gene="US1"
     CDS             complement(198198..198668)
                     /gene="US1"
                     /note="contains duplicated TT virus ORF2 motif; US1
                     family"
                     /codon_start=1
                     /product="protein US1"
                     /protein_id="ACS93440.1"
                     /translation="MASGLGDLSVGVSSLPMRELAWRRVADDSHDLWCCCMDWKAHVE
                     YAHPASELRPGSGGWPEHAEAQWRQQVHAAHDVWCNCGDWQGHALRSRSRTAESGRSS
                     SSSSVSVLSDGDQQPWWRRLRVKRPKFPSWARRWTQRHDSEERASQQAENDSTS"
     gene            complement(198986..199585)
                     /gene="US2"
     CDS             complement(198986..199585)
                     /gene="US2"
                     /note="contains potential transmembrane domain; causes
                     selective degradation of MHC-I and MHC-II; involved in
                     immune regulation; US2 family"
                     /codon_start=1
                     /product="membrane glycoprotein US2"
                     /protein_id="ACS93441.1"
                     /translation="MNNLWKAWVGLWTSMGPLIRLPDGITKAGEDALRPWKSTAKHPW
                     FQIEDNRCYIDNGKLFARGSIVGNMSRFVFDPKADYGGVGENLYVHADDVEFVPGESL
                     KWNVRNLDVMPIFETLALRLVLQGDVIWLRCVPELRVDYTSSAYMWNMQYGMVRKSYT
                     HVAWTIVFYSINITLLVLFIVYVTVDCNLSMMWMRFFVC"
     gene            complement(200000..200560)
                     /gene="US3"
                     /note="immediate early gene"
     CDS             complement(200000..200560)
                     /gene="US3"
                     /note="type 1 membrane protein; inhibits processing and
                     transport of MHC-I and MHC-II; involved in immune
                     regulation; US2 family"
                     /codon_start=1
                     /product="membrane glycoprotein US3"
                     /protein_id="ACS93442.1"
                     /translation="MKPVLVLAILAVLFLRLADSVPRPLDVVVSEIRSAHFRVEENQC
                     WFHMGMLYFKGRMSGNFTEKHFVNVGIVSQSYMDRLQVSGEQYHHDERGAYFEWNIGG
                     HPVTHTVDMVDITLSTKWGDPKKYAACVPQVRMDYSSQTINWYLQRSMRDDNWGLLFR
                     TLLVYLFSLVVLVLLTVGVSARLRFI"
     gene            complement(201272..201823)
                     /gene="US6"
     CDS             complement(201272..201823)
                     /gene="US6"
                     /note="type 1 membrane protein; inhibits TAP-mediated
                     peptide transport; involved in immune regulation; US6
                     family"
                     /codon_start=1
                     /product="membrane glycoprotein US6"
                     /protein_id="ACS93443.1"
                     /translation="MDLLIRLGFLLMCALPTPGERSSRDPKTLLSLSPRQQACVPRTK
                     SHRPICYNDTGDCTDADDSWKQLGEDFAHQCLLAAKKRPKTHKSRPNDRNLEGRLTCQ
                     RVSRLLPCDLDIHPSHRLLTLMNNCVCDGAVWNAFRLIERHGFFAVTLYLCCGITLLV
                     VILALLCSITYESSGRGIRRCGS"
     gene            complement(202224..202901)
                     /gene="US7"
     CDS             complement(202224..202901)
                     /gene="US7"
                     /note="type 1 membrane protein; possibly involved in
                     immune regulation; US6 family"
                     /codon_start=1
                     /product="membrane glycoprotein US7"
                     /protein_id="ACS93444.1"
                     /translation="MRIQLLLVSTLVACIVAKRVEDMATFRTEKQWQQDLQYQREFVK
                     RQLAPKPKSNIVVSHTVSCVIDGGNMTSVWRFEGQFNPHIASEVILHDTSGLYNVPHE
                     VQNDGQVLTVTVKRTVHADIAKVLISLKPVKLSSREYECRPQLQLPWIPRPSSFMYDS
                     YRLWYEKRWLTIILYVFMWTYLVMLLQYCIVRFIGTRLFYFLQRNITIRFTGKPTYNL
                     LTYPVKG"
     gene            complement(203102..203785)
                     /gene="US8"
     CDS             complement(203102..203785)
                     /gene="US8"
                     /note="type 1 membrane protein; binds to MHC-I; involved
                     in immune regulation; US6 family"
                     /codon_start=1
                     /product="membrane glycoprotein US8"
                     /protein_id="ACS93445.1"
                     /translation="MRRWLRLLVGLGCCWVTLAHAGNPYEDDDYYYYREDEPRQHGEP
                     NYVAPPARQFRFPPLNNVSSYQASCVVKDGVLDAVWRVQGTFYPEKGIVARVGWSGRH
                     GRKWGRLHAPECLVETTEAVFRLRQWVPTDLDHLTLHLVPCTKCKPMWCQPRYHIRYF
                     SYGNSMDNLRRLHYEYRHLELGVVIAIQMAMVLLLGYVLARTVYRVSSAYYLRWHACV
                     PQKCEKSLC"
     gene            complement(203800..204543)
                     /gene="US9"
     CDS             complement(203800..204543)
                     /gene="US9"
                     /note="type 1 membrane protein; possibly involved in
                     immune regulation; US6 family"
                     /codon_start=1
                     /product="membrane glycoprotein US9"
                     /protein_id="ACS93446.1"
                     /translation="MILWSPSTCSFFWHWCLIAVSVLSSRSKESLRLSWSSDESSASS
                     SSGICPLSDSKSVRLPQYPRGFGDVSGYRVSSSVSECYVQHGVLVAAWLVRGNFSDTA
                     PRAYGTWGNERSATHFKVGAPQLENDGALRYETELPQVDARLSYVMLTVYPCSACNRS
                     VLHCRPASRLPWLPLRATPSDLERLFAERRYLTFLYVVLVQFVKHVALFSFGVQVACC
                     VYLRWIRPWVRGRHRATGRTSREEEAKDD"
     gene            complement(204926..205483)
                     /gene="US10"
     CDS             complement(204926..205483)
                     /gene="US10"
                     /note="type 1 membrane protein; delays trafficking of
                     MHC-I; involved in immune regulation; US6 family"
                     /codon_start=1
                     /product="membrane glycoprotein US10"
                     /protein_id="ACS93447.1"
                     /translation="MLRRGSLRNPLATCLLWWLGVVAAATEETREPTYFTCGCVIQNH
                     VLKGAVKLYGQFPSPKTLRASAWLHDGENHERHRQPILVEGTATATEALYILLPTELS
                     SPEGNRPRNYSATLTLASRDCYERFVCPVYDSGTPMGVLMNLTYLWYLGDYGAILKIY
                     FGLFCGACVITRSLLLICGYYPPRE"
     gene            complement(205559..206206)
                     /gene="US11"
     CDS             complement(205559..206206)
                     /gene="US11"
                     /note="type 1 membrane protein; causes selective
                     degradation of MHC-I; involved in immune regulation; US6
                     family"
                     /codon_start=1
                     /product="membrane glycoprotein US11"
                     /protein_id="ACS93448.1"
                     /translation="MNLVMLILALWAPVAGSMPELSMTLFDEPPPLVETEPLPPLPDV
                     SEYRVEYSEARCVLRSGGRLEALWTLRGNLSVPTPTPRVYYQTLEGYADRVPTPVEDI
                     SESLVAKRYWLRDYRVPQRTKLVLFYFSPCHQCQTYYVECEPRCLVPWVPLWSSLEDI
                     ERLLFEDRRLMAYYALTIKSAQYTLMMVAVIQVFWGLYVKGWLHRHFPWMFSDQW"
     gene            complement(206392..207237)
                     /gene="US12"
     CDS             complement(206392..207237)
                     /gene="US12"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US12"
                     /protein_id="ACS93449.1"
                     /translation="MVQIQFHQGEPLGHKKEKPPPVSPPSPPPIRRVTVITKDEDTLR
                     SVQHFLWMVRLYGTVVFQTSATIATTILFMLIPWRVTTPYLRDTLPFWSTLLPCALRC
                     HAYWLERQRRPGTLMLVMVYTTLTTISVSTIGLCFDRTVVIQAYVLSSMLCVWCTGLA
                     WLMAWNMQRRLAILCLLSFMLPILWLFIAVQSWEPYQRIILALTVSFIYGLKIVLIRD
                     TLTVLYRSPSNCYTDGDLLRTAMLLYMDQVIMFLLVVVPLTAPIWYPNYAGALGRTAH
                     WLFHK"
     gene            complement(207317..208102)
                     /gene="US13"
     CDS             complement(207317..208102)
                     /gene="US13"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US13"
                     /protein_id="ACS93450.1"
                     /translation="MDPPLPSLHSPQWASLLQLHHGLMWLRRFAVLVRVYALVVFHIA
                     ISTAFCGMIWLGIPDSHNICQHESSPLLLVFAPSLLWCLVLIQGERHPDDVVLTMGYV
                     GLLSVTTVFYTWCSDLPAILIDYTLVLTLWIACTGAVMVGDSFRAKRWELICSRVLTS
                     VFFITLWVIGDQTVFHHQRILLYGYGAIVFLMMTVTFYGTRYIRDELPAAQTLRGSLL
                     IYVGLVTMFKITLIVLSPNLWRLPWTTVFAAFRSSYCEGGGGS"
     gene            complement(208171..209103)
                     /gene="US14"
     CDS             complement(208171..209103)
                     /gene="US14"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US14"
                     /protein_id="ACS93451.1"
                     /translation="METVSTQRETASSETERTREAASAETTDATFRSLEEGSTISSRY
                     SETASTASEDAVCWLRRTAIVMRVYGLLTLETAFSVLISALVWLGYPSLGYECRDDPS
                     PLLLSCTPVLVLGALELTDHRHPSNGLVFALYVALLSFTTAGLNLCATAPIGVSSLIL
                     TWTLFVACNGVAWEHRLSSVWRDALFTSTLLTVMVSVLASTYTWLHKTLLCLYTVFVG
                     CILAVLFQDVRYIATKMPVSHIIRSSLVLYATETLIYHTTLLMLTPVVWSARWDQMFS
                     YLAKLGTYHHYRVDNGTLSVILNSTTATFQSRVA"
     gene            complement(209148..209936)
                     /gene="US15"
     CDS             complement(209148..209936)
                     /gene="US15"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US15"
                     /protein_id="ACS93452.1"
                     /translation="MRREKGFQVPTDGTVIYVPPGIQETRLATRSLAWVDCCRVALHT
                     YGAVGWQLAGLTALLSAFCYAAPATWFHHSRLCLTESSPSLVFVIPVTSVIFIHCYET
                     SHPSNIGVLLFYTLLHVPPLIVICLCLDGTLVISAALFTLLAFLSCTGVALLAPERTV
                     RRQIVVVHALITLTFTAIVVVILRRGWSWCFKIVLSFSVLITCLAVSHFHEAALAVRY
                     ETPLERALLAAVKVFLSLVFTLLMVLRIMTLRTFLQTYFSSDKL"
     gene            complement(209996..210925)
                     /gene="US16"
     CDS             complement(209996..210925)
                     /gene="US16"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US16"
                     /protein_id="ACS93453.1"
                     /translation="MGLRFPTATQRQIVFRRLFDSGNNDDYDEAAVVAVLGWVHRFEV
                     VVRIAGLLLFQISAAVAVLGSFSLVFPTATLKSRPGFPCHVVWAPEVLLLVPVASALF
                     VYFRYERPVLAQRNRHPRCRRPFRQLVLLLAGLLAHIPALGITCVCQEPREVLTSFVL
                     TLVITLLCAEVVFICRDNCTLSDQFTLINGVWVVVFLANVLIVFTRPWTWPLRLLLGF
                     YSTVGLIFAGHFSQQVLFVRHVLMPRDVAHTSLQLFITFISLFFLILRIRNCQDLLSD
                     LRLLELPSSDAMTLTPNDLSHASSSTPLSTLSP"
     gene            complement(211070..211951)
                     /gene="US17"
     CDS             complement(211070..211951)
                     /gene="US17"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US17"
                     /protein_id="ACS93454.1"
                     /translation="MSPNSEATETAWAPPPPRPSRGVIMISSVSTNDVRRFLLCMRVY
                     STVAVQGTCTFLLCLGLVLAFPHLKGTVFLCCTGFMPPLSLMVPTICLALLHGKRDEG
                     SFTSPPSPGLLTIYSVLTTLSVIVASACSSSTLVTFSGLLACVLFSLCSCVTGLAGHN
                     HRRWQVIVTLFVIGVIAFLIALYLQPVPLGHKLFLGYYAMALSFMLVVTVFDTTRLFE
                     IAWSEADLLTLCLYENLVYLYLLILILFTTEDSLDKLIAWMTWLSSRATGATNAASIS
                     GCDLLREVQRNLTRTMA"
     gene            complement(212219..213043)
                     /gene="US18"
     CDS             complement(212219..213043)
                     /gene="US18"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US18"
                     /protein_id="ACS93455.1"
                     /translation="MGDTASVSEHHESPTVTIVPLHRSHALVAEQQLFQWLKRFKLLM
                     EVYHGLVWQLACTLTVCLLAWLAFPDVQGQCANGIVPALSSIVPVSTLAMLRGFAEFR
                     PHTTNFAHLTVACLLINTGITVCTGFCGERRVIGLSFALVMVFFVLCSGLTYLAGNNP
                     TRWKVIGIGYGWSVIVFYLLLYFSPVLWVSKIYSGLYVLVVTAASAVLIYETLDLIYQ
                     RGTLSKNSVCVSVVLYTIVMSLLNMSVAIFSGHVWVQQYAEKHGGRIDGVSLLSLL"
     gene            complement(213181..213903)
                     /gene="US19"
     CDS             complement(213181..213903)
                     /gene="US19"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US19"
                     /protein_id="ACS93456.1"
                     /translation="MLHVVPLEWTVEEVVPYLERLAVWLRASVLVAFQLIATVALSVL
                     SWWLMPPPVAELCERGRDDDPPPLSHLSLVVPVGCLFLLLRGPSIDRCPRKLLLLLAY
                     CLPHALAFLTLLMCQPSLQAFLGAALLALAVDLGCLGASLLGCDPGASLRRLWLPSVL
                     SLLCATALGFWLLQAATPFFLGLHATTLLTVTLMLIHDLSLITCQSSFPESFQSSLRL
                     YVENVALFIGMYHLLRLWLWSP"
     gene            complement(213950..214714)
                     /gene="US20"
     CDS             complement(213950..214714)
                     /gene="US20"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US20"
                     /protein_id="ACS93457.1"
                     /translation="MQAQEANALLLSRMEALEWFKKFTVWLRVYAIFIFQLAFSFGLG
                     SVFWLGFPQNRNFCVENYSFFLTVLVPIVCMFITYTLGNEHPSNATVLFIYLLANSLT
                     AAIFQMCSESRVLVGSYVMTLALFISFTGLAFLGGRDRRRWKCISCVYVVMLLSFLTL
                     ALLSDADWLQKIVVTLCAFSISFFLGILAYDSLMVIFFCPPNQCIRHAVCLYLDSMAI
                     FLTLLLMLSGPRWISLSDGASLDNGTLTAASTTGTS"
     gene            complement(214821..215552)
                     /gene="US21"
     CDS             complement(214821..215552)
                     /gene="US21"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US21"
                     /protein_id="ACS93458.1"
                     /translation="MSLRGQVQIARSVFLLRIYILIWVQCLILMSVCAFCWLVLPHRL
                     EQLFSSVRLTLSCLMISIVCLGLLRWAEPNFPKNVWILLTYTLLTSVAVTASGFHFSH
                     HSVIYAMVATVTLFCFLTLATYLFARDVELQRSLLTGASTLILLLFAVFSLFPEAVSE
                     ILVMIAGLAVIVTSVVCDTQDILHDIEYESYIPGALCLYMDLMYLFVSVLYFMPSEPG
                     SAHTAQTTVATTVAATAAASPQFVS"
     gene            complement(215729..217459)
                     /gene="US22"
                     /note="putative beta gene"
     CDS             complement(215729..217459)
                     /gene="US22"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein US22"
                     /protein_id="ACS93459.1"
                     /translation="MSLLTKAAAEAWGTYLRQRDERCEDAIRCDYGVFQFRNTVFQKT
                     LSMLQGLYLRQYDPPALRTYVQRHQGTTVALRNPANWFLVMREQAAIPQIYARSLAAD
                     YLCCDDTLEAVGVLAVRPPDSDLTRNTKQAQELPCVLMLSHYGTVYVYDWETDGLYEV
                     ASDIKAFSKNGLLWCEYVYRHPQTPFATTEPRYHVQKFLCTDPTDAAAVAKTAREMSG
                     LNLVIRTPGRTEVEPLLMLGSIEGLRACRPFDHMPAADFRDLLNFIRQRLCCEWYVVG
                     LVGYYLAYGPFVPSGLVLLDKFGVVYLHKIEDSDLYRIADNFHMFLKCGLLKLRGLCR
                     FDRGLRGECRLEELPVCHHTLKRDVLRWHGALGTITRSQLESALDWFLRPTRGTDKVP
                     NNSSAWGRTDLLPTGALQDNQNWAFPSHSVETLPALQGGLWEDNDETTQTVDGQRCFR
                     MPKFFPPPMCRAPYNECGVELPGGDSSDEDESGRPRRIANRIGDTPETPCNSENEDDT
                     TVEGTSGGPEAMDSQTPYPSEDSPTTEKEAWLQRGRRAKAMHARGHTLKQVPIPEPDQ
                     MGDDGPDPGP"
     gene            complement(217573..219351)
                     /gene="US23"
     CDS             complement(217573..219351)
                     /gene="US23"
                     /note="US22 family"
                     /codon_start=1
                     /product="protein US23"
                     /protein_id="ACS93460.1"
                     /translation="MWRTRWEDGAPTFTRNDEFLYCHTRYETFLRVMGDFQGIFECQY
                     SADVLRDWVRNHVDQVLSLGIPHNWFLQVRPGSTMPELRDQLLDDVICCPERLIVLGK
                     CVIMVEDHYEETELVLCMGGGTRLYIYEPSQEILLLCARHLDELARYGMMYTEAVYRQ
                     PQTPFATRVPHDVVAMLLRHGHDADALAACVGEHHGRDVNFHTPGRHAKTLKLLTSFG
                     CLTDCWPFEVAPAARLAECEMYVTLQLRCRWYLLGAVGSYRAGGFFDTSFLIIFDRFC
                     RFYVVIVKSHLDRSPPLQRLAGEIYRLADSLEELFRAGLMKVYVRRRYEHGLRRAARL
                     ERNGGCVHMGEAARLHFTMFDSGVDRDYARQFRWLCRGDRFRAEMLNNWDGWDAFTIW
                     QARVVRGDFAERRRPRSLGDGEEEDERNDGRAMPVVRRRPPPMPRDDDEDNHVVPDNQ
                     NLEVIHDALTDDEEQGEDDDDSGAEPMEPEENNVVPNVERRGGEDAVAARMAAGHESD
                     DDEWEDLGFDLEEDTVFDLKDVDEWFEQRRLAEKERWHLGQRIVNAYRTEAEVSEAEV
                     EARRINLNTDLSPEWVKSFDFREHFV"
     gene            complement(219447..220952)
                     /gene="US24"
     CDS             complement(219447..220952)
                     /gene="US24"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein US24"
                     /protein_id="ACS93461.1"
                     /translation="MMDPAAGSGPDGAAVVPPELPALPVAAEDPMALYRQVLRDFKEL
                     FFCLEPMEITRYVHRNEGRCLSLGPPKGWHVMLRTEDGIITAAKQAASKLICCREPLT
                     PLGYAVILLPEPRRDHHDGMVATPYVVFMGRFSRVYAYDTREKYMVLVSHNLDELARY
                     GVSRSEIAYRDVIHTTLRRMTVPVPRRYPKGARTMHVLFLNDTTPEGSYATAERILGC
                     DVKLHTPGYGTVIMRLMKTVQQLHRIWPFCALTEVESRRWWWAVRANLATPWYVLGVT
                     GRPRPGRSFVAEVLVLLDWFGAVYAIQMDDPNHYVRRVANTITEFFRMGLLKMVFRHR
                     RFERERQRQTRMEHRHLCPHHHERAVDHKRDILFNEDAALPDERRERERRILQQQYDW
                     LCLTERFDPHEGAWERLDPNTLVLHRYDTNSQSYVLDPDIVGVEAAEREAAGHQDDTG
                     PRLHCLVTTRSSTREGAERVITALVHQSRLVTYSDPFPLKSLTGVREYIQI"
     gene            complement(221586..223397)
                     /gene="US26"
                     /note="putative beta gene"
     CDS             complement(221586..223397)
                     /gene="US26"
                     /note="US22 family"
                     /codon_start=1
                     /product="protein US26"
                     /protein_id="ACS93462.1"
                     /translation="MRQSYRYASGAVVRRTLKGLRKLILCQDLRQDIRHLVRSYADMN
                     ISLPVSAPPGWRLDFVEFEDIFGSAAVTDGPETPWGQLICCEESLESLGVLQFSTTVL
                     PRVHGPRSSSEDEDSDDDDFFVYVEEIEPPSQARLVLLLGRYETVWCLDRDCGVLYYL
                     AHSLDDFARHGLLHCEAIYGEQMRTPLLTTQPDHIICDLRLHDNSISELQRVTCRYRG
                     ECVPLRTPGEMTRPLLLCGQAENLKGVWPFICMETEQFNDLLKFFVDRLCCETMIMGV
                     VGESLPSGVFHADFVILVDRACEFFYFDVSRREIWRLADSVDMLLTVGLLKIYQAGRR
                     FHYAVDDAERLEVPGRCPHENFPFWDRFGTVERVRASTRHHELRYKWLIRKDRFIVRP
                     DWCSMRNSLDEVSGTADVSWDPRIRPDYPQTSDLECAKQYWQELNDHVREQTARYGPV
                     RRYSVWCGMSSRLERAVKRLQQRIPRQNLMNPSLMNQGLCVYYSDEEEDQEEDNTSDD
                     DDQEEETENPQNNIGSLTRTPSSPGSLEGVEERMLNVMKEAVAEQDRKKTQKKHKIDT
                     AQRRVLTRRAARAAVLEGRPAPKPTMPHPVSYLPFWM"
     gene            223763..224857
                     /gene="US27"
     CDS             223763..224857
                     /gene="US27"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     putative chemokine receptor; possibly involved in
                     intracellular signalling; GPCR family"
                     /codon_start=1
                     /product="envelope glycoprotein US27"
                     /protein_id="ACS93463.1"
                     /translation="MTTSTTTTTNIMLQVSNVTNHTLNSTEIYQLFEYTRFGVWLMCI
                     VGTFLNVLVITTILYYRRKKKSPSDTYICNLAVADLLIVVGLPFFLEYAKHHPKLSRE
                     VVCSGLNACFYICLFAGVCFLINLSMDRYCVIVWGVELNRVRNNKRATCWVVIFWILA
                     ALMGMPHYLMYSHTNNECVGEFANETSGWFPVFLNTKVNICGYLAPIVLMAYTYNRMV
                     RFIINYVGKWHMQTLHVLLVVVVSFASFWFPFNLALFLESIRLLAGTQNETLQTVITF
                     CLYVGQFLAYVRACLNPGIYILVGTQMRKDMWTTLRVFACCCVKQEIPYQDIDIELQK
                     DIQRRAKHTKRTHYDRKNAPMESGEEEFLL"
     gene            225063..226127
                     /gene="US28"
     CDS             225063..226127
                     /gene="US28"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     broad spectrum CC chemokine receptor; constitutive
                     signalling; mediates cellular migration; involved in
                     intracellular signalling; GPCR family"
                     /codon_start=1
                     /product="envelope protein US28"
                     /protein_id="ACS93464.1"
                     /translation="MTPTTTTAELTTEFDYDEAATPCVFTDVLNQSKPVTLFLYGVVF
                     LFGSIGNFLVIFTITWRRRIQCSGDVYFINLAAADLLFVCTLPLWMQYLLDHNSLASV
                     PCTLLTACFYVAMFASLCFITEIALDRYYAIVYMRYRPVKQACLFSIFWWIFAVIIAI
                     PHFMVVTKKDNQCMTDYDYLEVSYPIILNVELMLGAFVIPLSVISYCYYRISRIVAVS
                     QSRHKGRIVRVLIAVVLVFIIFWLPYHLTLFVDTLKLLKWISSSCEFERSLKRALILT
                     ESLAFCHCCLNPLLYVFVGTKFRQELHCLLAEFRQRLFSRDVSWYHSMSFSRRSSPSR
                     RETSSDTLSDEVCRVSQIIP"
     gene            226290..227678
                     /gene="US29"
     CDS             226290..227678
                     /gene="US29"
                     /note="contains potential transmembrane domains"
                     /codon_start=1
                     /product="membrane protein US29"
                     /protein_id="ACS93465.1"
                     /translation="MRCFRWWLYSGWWWLTFGCARTVTVGFVAPTVRAQSTVVRSEPA
                     PPSETRRDNNDTSYFSSTSFHSSVSPATSVDRQFRRTTYDRWDGRRWLRTRYGNASAC
                     VTGTRWSTNFFFSQCEHYPSFVKLNGVQRWTPVRRPMGEVAYYGGCCMVGGGNRAYVI
                     LVSGYGTASYGNALRVDFGRGNCTAPKRTYPRRLELHDGRTDPSRCDPYQVYFYGLQC
                     PEQLVITAHGGVGMRRCPTGSRPTPSRPHRHDLENELHGLCVDLLVCVLLLALLLLEL
                     VPMEAVRHPLLFWRRVALSPSTSKVDRAVKLCLRRMLGLPPPPSVAPPGEKKELPAQA
                     ALSPPLTTWSLPPFPSTRIPDSPPPPYQLRHATSLVTVPTLLLYTSSDIGDTASETTC
                     VAHATYGEPPEPARSTATVQECAVLTAPNCGIVNNDAAVSEGQDHGDAVHHSLDVVSQ
                     CAADTGVVDASE"
     gene            227482..228531
                     /gene="US30"
     CDS             227482..228531
                     /gene="US30"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein US30"
                     /protein_id="ACS93466.1"
                     /translation="MGNPRSPLDRRLRFRNVPFLPPQIAASSTTTPRSLKAKTMEMRF
                     TIAWMWFPSVLLILGLLTPPSNGCTVDVGRNMSIREQCRLRNGATFSKGDIEGNFSGP
                     VVVELDYEDVDITGERQRLRFHLSGLGYPTKENTRKDNESDVSGGIRWALYIQTGDAK
                     YGIRNQHLSIRLMYPGEKNTQQLLGSDFSCERHRKPSTPLGKNAEVPPATRTSSTYSV
                     LSAFVVWIGSGLNIIWWTGIVLLAADALGLGERWLRLALSHRDKHHASRTATLQCQRD
                     MLLRQRRRARRLHAVSEGKLQEEKKRQSALVWNVEARPFPSTHQLIVLPPPVASAPPA
                     VPSQPPEYSSVFPPV"
     gene            228646..229131
                     /gene="US31"
     CDS             228646..229131
                     /gene="US31"
                     /note="contains duplicated TT virus ORF2 motif; US1
                     family"
                     /codon_start=1
                     /product="protein US31"
                     /protein_id="ACS93467.1"
                     /translation="MSLLEREESWRRVVDYSHNLWCTCGNWQSHVEIQDEEPNCEQPE
                     PAHWLEYVAVQWQARVRDSHDRWCLCNAWRDHALRGRWGTAYSSGSSASSSGFVAESK
                     FTWWKRLRHSTRRWLFRRRRARYTPSNCGESSTSSGQSSGDESNCSLRTHGVYTRGEQ
                     H"
     gene            229249..229800
                     /gene="US32"
     CDS             229249..229800
                     /gene="US32"
                     /note="contains duplicated TT virus ORF2 motif; US1
                     family"
                     /codon_start=1
                     /product="protein US32"
                     /protein_id="ACS93468.1"
                     /translation="MAMYTSESERDWRRVIHDSHGLWCDCGDWREHLYCVYDSHFQRR
                     PTTRAERRAANWRRQMRGLHRLWCFCQDWKCHALYAEWDGKESDDESSASSSGEAPEQ
                     QVPAWKTVRAFSRAYHHRINRGLRGTPPPRNLPGYEHASEGWRFCNRRERREDDLRTR
                     AEPDRVVFQLGGVPPRRHRETYV"
     gene            230002..230175
                     /gene="US33A"
     CDS             230002..230175
                     /gene="US33A"
                     /codon_start=1
                     /product="protein US33A"
                     /protein_id="AFP95501.1"
                     /translation="MSLRFPERAGYEKLGHRPHAKRVRVHDPLGLTRFIMRQLMMYPL
                     VLPFTFPFYVPRS"
     gene            230344..230835
                     /gene="US34"
     CDS             230344..230835
                     /gene="US34"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein US34"
                     /protein_id="ACS93469.1"
                     /translation="MNLEQLINVLGLLVWIAARAVSRVGPHGSGLVYRELHDFYGYLQ
                     LDLLGPVVAGNRSVRTWREQADRARGTFARRSGLNTSHILPVGSMYRGSDTLSAGLYR
                     PEEEVFLLLNRCHGPLSTPKNACLAEVGVANATFLSRFNVGDFHGASWENGTAPDGEP
                     GVC"
     gene            230829..231023
                     /gene="US34A"
     CDS             230829..231023
                     /gene="US34A"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein US34A"
                     /protein_id="ACS93470.1"
                     /translation="MLKFFLKLRKRRRPVVVPRFVRFIVYVVLFTVAVQRVKQERNAH
                     LRRYEERLRKDRARRRQSFP"
     gene            complement(231977..234346)
                     /gene="TRS1"
                     /note="putative beta gene; immediate early gene"
     CDS             complement(231977..234346)
                     /gene="TRS1"
                     /note="transcriptional activator; blocks phosphorylation
                     of eIF2alpha and host shutoff of protein synthesis; binds
                     dsRNA; involved in gene regulation; involved in
                     translational regulation; US22 family"
                     /codon_start=1
                     /product="tegument protein TRS1"
                     /protein_id="ACS93471.1"
                     /translation="MAQRNGMSPRPPPLGRGRGAGGPSGVGSCSSSVPSTAGTSTSTA
                     GTATPGHGVHRVEPRGPPGAPPGSGNNSNFWHGPERLLLSQIPVERQALTELEYQAMG
                     AVWRAAFLANSTARAMRKWSQRDAGTLLPLGRPYGFYARVTPRSQMNGVGATDLRQLS
                     PRDAWIVLVATVVHEVDPAADPTVGDKAGHPEGLCAQDGLYLALGAGFRVFVYDLANN
                     TLILAARDADEWFRHGAGEVVRLYRCNRLGVGTPRATLLPQPALRQTLLRAEEATALG
                     RELRRRWAGTTVALQTPGRRLQPMVLLGAWQELAQYEPFASAPHPASLLTAVRRHLNQ
                     RLCCGWLALGAVLPARWLGCAAGPATGTAAGTTSPTAGTTAMATGTTLLAGASGTETE
                     AAGGDAPCAMAGAVGSAVPVPPQPYGTSAGGHAVCVPNAEAHTVVGADAAAAPTVMVG
                     PAASDTVPRAMLVVVLDELGAVFGYCPLDGHVYPLAAELSHFLRAGVLGALALGRESA
                     PAAEAARRLLPELDREQWERPRWDALHLHPRAALWAREPHGQLAFLLRPGRGEAEVLT
                     LATKHPAICANVEDYLQDARRRADAQALGLDLATVVMEAGGQMIHKKTKKPKGKEDGS
                     LMKGKHSRYTRPTEPPLTPQASLGRALRRDDEDWKPSRLPGEDSWYDLDETFWVLGSN
                     RKNDVYQRRWKKTVLRCGLEIDRPMPTVPKGCRPQTFTHEGIQLMGGATQEPLDTGLY
                     APSHVTSAFVPSVYMPPTVPYPDPAARLCRDMRRVTFSNIATHYHYNAQ"
     repeat_region   232696..235154
                     /note="TRS"
                     /rpt_type=inverted
     repeat_region   234655..235154
                     /note="'a' sequence"
                     /rpt_type=direct
                     /rpt_type=terminal
     misc_feature    235154
                     /note="unpaired T residue at 3'-end of upper strand;
                     complementary to unpaired A residue at 3'-end of lower
                     strand"
BASE COUNT        50399 a        66977 c        68198 g        49580 t
ORIGIN      
        1 ccattccggg ccgtgtgctg ggtccccgag gggcgggggg gtgtttttag cggggggggg
       61 gtgaaatttg gagttgcgtg tgtggacggc gacggcgaat agttgcgtgt ggtgcggtgg
      121 ggacggcggt cgcggacggc gaataaaagc gacgtgcggc gcgcacggcg aaaagcagac
      181 gcgcgtctgt gtctgtttaa ttccccgggg aaaagaggaa gaagtcccca ggggacggca
      241 gcgcgggtcc ctggggacac acgaagagac aagacgcaga aaagaggaag tccccgggga
      301 aaacgtgcga ccgcacccct gacacacccc gccagcacac ccccgacaca cccggcacac
      361 gcccgcgaca caccctgaca cacccggcac acgcccgcga cacacccgcg gcacaccctg
      421 acacacccgc cacacccggc acacacccac ccagccgcgc ccccgacaca ccccgatcgc
      481 cgccggtgcg ggacagggct cagggggtgt tgcgggccgt cgttgcgtgt ggctccacag
      541 cacttttcgt tccgccagtc cggcacggga cagggttgag gcagcgttgc gggacataag
      601 taagcacggc ggcgtcctca tcgcgtttgc ggcgtgctgt gtccggcgct ttgtgcgcac
      661 tgccggtgcg tggcgtcccg cggtgttttt tttttttttt tccgcggacc ggcgccgggg
      721 acggggtgtt gcgggcgctc gggggttggc ggcgggtgtt tctacggtgt ttgtgcggcg
      781 tttctacgca gcttttgcgc ggcgcttcgc ttttcggggc ggcgacggcg gtgttttcgg
      841 gcgtgctggg cgccggcgcc ggtaacggga gttacgctgg ggacggggac gggggttgcg
      901 ccggggacgg ggggtgtgcg gggacggggg ggtgtgcgtg gacggccacg ggggcctttt
      961 gcggcgggga cttgcgggct tttgcggcgg ggacagtagt ggggacgggg agctttggcg
     1021 ctggggacgg gggcctcctg cggcagggac ggggcgttgc ggggccgggg gcgtttgcgg
     1081 cggggacggg ggcctttcgc ggcggacaca gtggtgggga cgggggactc ttgcggcggg
     1141 gacggggacg ggggtggcgc cggggacggg ggcctttcgc ggcggggaac acacacggca
     1201 cgcacacgca gctcgcctat ttaacctcca cccactacaa cacacacatg ccgcacaatc
     1261 atgccagcca cagacacaaa cagcacccac accacgccgc ttcacccaga gcaccaacac
     1321 acgttaccct tacaccacag caccacacaa ccgcatgtcc aaccttcgga caaacacgcc
     1381 gacaaacaac accgcacgca gatggagctc gacgccgcgg actacgctgc ttgcgcacag
     1441 gcccgccaac acctctacgc tcaaacacaa ccccaactac acgcataccc caacgccaac
     1501 ccacaggaaa gcgctcattt ttgcacagag aatcaacatc aactcaccaa tctacttcac
     1561 aacataggcg agggcgcagc gctcggctac cccgtccccc gcgcagaaat ccgccgcggc
     1621 ggtggcgact gggccgacag cgcaagcgac ttcgacgccg actgctggtg catgtgggga
     1681 cggttcggaa ccatgggccg ccaacctgtc gtaaccttac tgttggcgcg ccaacgcgac
     1741 ggcctcgctg attggaacgt cgtacgctgc cgcggaacag gctttcgcgc acacgattcc
     1801 gaggacggcg tctctgtctg gcgtcagcac ctggtttttt tactcggagg ccacggccgc
     1861 cgtgtacagt tagaacgacc atccgcggga gaagcccaag ctcgaggcct attgccacgc
     1921 atccggatca cccccatctc cacatctcca cgcccaaaac caccccagcc caccacatcc
     1981 accgcatcgc acccacatgc cacggctcgg ccagatcaca cgctctttcc tgtcccttct
     2041 acaccctcag ccacggttca caatccccga aactacgccg tccaacttca cgccgaaacg
     2101 acccgcacat ggcgctgggc acgacgcggt gaacgtggcg cgtggatgcc ggccgagaca
     2161 tttacatgtc ccaaggataa acgtccctgg tagacggggt agggggatct accagcccag
     2221 ggatcgcgtc tttcgccgcc acgctgcttc accgatatcc aataaaccca tcccctcgcc
     2281 acgacgtctc cgcgtatctt tgtagcctca ggaatacgtc cccacgtcca cccatcccga
     2341 gcactccaca cgctatcaca gaccacggac acggcaaaaa atgcatgcaa acttctcatt
     2401 tattgtgtct actactctgt gttgctacag ggagtgaaag gggtgaaggc aaagaaaaaa
     2461 aaaaggaaca aaataataga ttagcagaag gaataatccg tgcgaccgag cttgtgcttc
     2521 ttttcttata aggaggcaaa tatactaggg aaaacataag aataggaaga aaccgaggtt
     2581 tgggagaaaa gctgagataa aatagcgcat tttccataca gaggttgttg tttttgtgga
     2641 tcctaagagg tttcaagtgc gaatctcaaa gttctcacga gaatattgtc ttcaagaatc
     2701 gacaactgtg gtccaagatt tttttttggt ctttttaggt tctgcgaggg acatcacgat
     2761 ggatcgttgc gatgaagtca cgcgtacgcc tctggtgtgg cgcggtgtcg tgacaggaga
     2821 gtgtgttttc agtgcagagc tgtcttgatt cctatatccg agtatctgtt ttctcgtaag
     2881 gacggtaatc ttctttggtg taagtacatc taaaagctgc aaactatatt ttaagggctg
     2941 tctctaggtg tactttgatg ctggagtttt tcgctgtgtt gatgtgaata aatctactac
     3001 tactattata tgcagaaaga gtgattatgc cgagacaaga ttgcattggc tgaactgttt
     3061 caaaaacgcc tacactctac ttatccgtaa acctaaggta atactatgtg taagttgttt
     3121 ttttttcttt ttgtagtaaa atggtgatac gtgcaattaa aactgtattc catgtttcca
     3181 tcctttcatt tcaactttaa aggcggcttt gagagcgaag aagtgcgagg ataaaaatgg
     3241 atgactcctt cgtgtccagg gagtcgacta ctgcaacgct gattgattaa aagatggtct
     3301 ccgatgatga tgttgttatt gatcgaatca tggtgcagaa cggcgacgga gaggagcgtg
     3361 tccgccgccg ggaaggtggt ctctttctct tttctttttt caagaaatct tccatgtgtt
     3421 tatcgtaatg atcgaaatcg actgatctcg ggttcttttt gttggtttct tttcggttaa
     3481 tcatgtattg ttttcttttt ttacagaaag atactttttt catgagcaat tcctcgcccg
     3541 gcgccggcat gccgaggtgg ggccactgcg atcagcggca tgccgacgcc gacccgggga
     3601 tcttggattc accgttttct ctcttctctc tctacataca gaccgggtgg caggagcggt
     3661 aaggaatcat cgtcgtcttt cattcttcga tgattatggt aatactaaat cttatctagg
     3721 agcatataca tctaagattg gagtactagt agtcgtttgt ggtttctatt tttttttata
     3781 tttatctatg acagtttttc tgtttttcgt tttgataata atataataaa aactcatgga
     3841 cgtgaaatct ggcttggttg tggtgatttc attctcatta ttgttgtttt ctttccgtct
     3901 tgcggatgaa gatgttgcga tgcggttgtt gttggtgttg ctatacaccg agagagatga
     3961 tctttttgtt cttctggttc atttcctatg attgtttggc tgctgaccga cgcgtcagga
     4021 tgtgcagggc atgcggggaa tcaggaccgg acacgggata atttcatcta cctatacgga
     4081 gatcgcggtc ctcgccatga ggatcgcgac aggcgcgtcg agggggcagg aacacccttg
     4141 cggattgaca ttcttggtgg tgtttcgttg ttgtcggtag ttgttgttga cgatgaggat
     4201 aaataaaaat gaccttgttt ttgttctgtt ttcttttgtt gggaatcgtc gactttgaat
     4261 tcttcgagtt atcggaaagc tgaggtaccc aaatgtctgt agcttttttc tttttaccct
     4321 cttgtttatc atctgcgatt cgtggtaggt aggagaggga aatgataatc cgagattaag
     4381 gaaaggagaa gataaaaaat aaaaaaaaaa taataaaaca gaagccgacc ggccgccgac
     4441 ccgttcccca ggaccagcct acgaggaacg gataacgcgg tggcgacggc agcggtggtg
     4501 gcgctggggg tggcggtagt ggtgctgctg atggtagtcg ggacggagga gagacgatgc
     4561 atgcatacat acacgcgtgc atgctgcatg ggtggatggt acggccggga gacgcggaag
     4621 agaaactcac ataaaaaggt gacaaaaaga gcggttgaaa aaagaaaacg agattcgacc
     4681 agacagaaga gaaggaccgg ggcttggcga cccttccacg actgctgttg tcatctcggc
     4741 tcctccgtct tctcccggcc acgggcggct aagtcaccgc cgttctcccc atccgtccga
     4801 gcgccgaccg accagccggc cgattcgccc gccggggctt ctggagaacg ccggggcagc
     4861 agcgatctgg gaaagccgct aaacccctgc gtttttatat ggtagctctg ccgagcgcgg
     4921 gctgacgcgt tgagtaagcg gaaagacgtg tgtgacgaaa aggggtccca tggtatttca
     4981 cgtgacgatg aggagatgcg gtttggagca catacggttt agaaaaaggg agttgtcgtg
     5041 acaagggctg agggacctct gtctccatgt gtgtataaaa agcaaggcac gttcataatg
     5101 taaaaaagaa cacgttgtaa acaagctatt gctgtatcat tcggctgact atgcttcatt
     5161 cggactgatt ttcttttcct aacggcgtaa cttaaagtga ttaacgtatg atatttgttc
     5221 cccagagtta tactatagtc atcatcctaa aattcagata taaatgaaca catgtcgtat
     5281 gggattatta agaaaccgaa actctccaca tttcaccatc ttcttcgtca ttcaaccgat
     5341 gacccactcc gtacaacgaa tcagtctgct gcgtcatatt gcaaagcaca agcgacgtat
     5401 gcgaacaact tgaaacacag actgtggtat taacgaccgt tgtaccatta ctagtcacat
     5461 tgcatagaga ccctccatcg ttatcccatc ttttccattc agtggaaaac cggccgctat
     5521 catcaactat agtaagattt ccaccctgcg tggtattcag tttcttcata tccataccct
     5581 ggattccatc attaaacccc aatattaagc acgttattag tacccccccc ccccaccaag
     5641 gaatgtgact ggaccggttc ttagcagctt tgggagccat cttcaagatg aaccacagct
     5701 acagcaaaac cgagtccagt gaccgataac cacgtgcaac cctgcgtatg taccagtcca
     5761 ggtacgtccg gtcattgttc cacacaggaa atctaactag gtcaacggac aaaaccaaac
     5821 tgtcaatcca ccatatgcgc aacacaaaag cactgacgtt tatttattga attatcaacg
     5881 ttacttagtt acaataagaa accaagtatc cacttgttca ggaccgttat caactctccg
     5941 ctttaaatca taagatcctt cgttgccttg cgttacgttg caaaacgtca atcctgtatg
     6001 actacaatta cacacaccgt gaatcggcgg cgttgctagc gtgtaattct tcgtcccctc
     6061 cacactacac acgtcggtat catttttacc atcaaaaaac gaccaaaccg ttttcaggtt
     6121 agcactaacg gttttatcat caccggtctt tacatgaaca ttagccattc cctcgactct
     6181 gtaattcaac gtcaaaatta tacacgctat aagtaccccc ccccccacaa tggaatgctg
     6241 ccaaactggt tctttcccgt tatagccata gcgttcccaa gcaaaagcta acgccgaacc
     6301 tagtgcagta aactgcgctt gcacccagaa ccagcttatg taccagccac aataacatcc
     6361 ggttattgtt tccacaggaa atcctaccag ggaaaacccc gcttttgttc ctgaccatct
     6421 tgtttcacaa ctcgtaaact gtcagcccag cgacgtccgt ttagatcaaa agtcacgtat
     6481 actgcgacgc tgtttacaac cgtttcccat cccgccgttt ccgaacaacc cacccgggtc
     6541 cagacaacca accaccaaca gaaacataca cacagaccac cgggagctca gttaaagatt
     6601 tcatcaggtt tattttggct gctgctagtc ttttgcttct tagaaaaaaa atacccatat
     6661 agagaaataa tgatagtttg acaacacata tggcagggat ttcttcttca tcaataagat
     6721 atgcaattcc cccagggaga gactttcaac aattgaattt acaaaaacaa aattacatca
     6781 ggagaaagag aggatacatt aacaaatata ttatatctgg tgtatatact gaatgctgct
     6841 ggttcataag gtaacgatgc tacttttttt aattccaaga tggtttttct ttgttagtct
     6901 tttgttgact tgctggttcc taaaagttcg caaaaacgat tgtgtgaaga ttttatgacg
     6961 ttggttgact agttcatgag attctgctgt acgtgtgatg gttattcgct ggttcgttct
     7021 aagatgagta tcgtactgtg tctgcgatgg tcgtctctta ctggcattct ctcggctgcc
     7081 tcttgctttc atgattgaaa aggaaaaaag gactccgagg gcgcggtcat cttttacttt
     7141 tcggttttct cgttggcggg tcagaggtag tcagatcatg agactgtcgt ggtcgatgaa
     7201 actgtgtctg cttaagtgac gtccatttct tgtacggaga aaaaagtcat cgggataaat
     7261 aaggctatac aaggcgttgt caagcgtgcg gctctaaaca aattaagcga tacaaaatta
     7321 cagtaatacg aataataaat taccccctcc ccctgtggtc cccccgaggc gagagccacc
     7381 catcgtgtac tctcgcacca cccacgacca cagggggaga cgggacgaag agacgacgca
     7441 gagcgccatc tcctcctgga ggccggcggc gttaactgct acagctgcgg cggcgacgac
     7501 agctgcgatt tgtcggccga catgccgatg gtatgggcgg cggcggcagt ggccgcggca
     7561 gcggggagga gaggagaaag aagaggagcg gggcgtccga aggcgaggat ggcatggtct
     7621 cgccggagcg cccggctttt atggaacact cgcgtccggt tgggtatcac ccacaggaag
     7681 atgagtcaca acttccaaac catcttgaga cccgagtaac ggtttacagg tcgcacgcca
     7741 gtctcagcta aaaacagcgg acagtcccac gctgtttctg ttgtggctct ctccagtttc
     7801 ctcatcgccg tcccggtctc cgtcgtcatc ggaagaatac cacccgctct catgcggcag
     7861 tcgatcggcc tcgacgaacg agacgcggcg acgcctctcc acggccgact ggttgtggtg
     7921 gtgaaagaag agcaccagca atcccaggag gagcaacaag ccctcacatg tccaggaggt
     7981 cggggagagg acctgtcgga gatggccgtg aggcatcacg tacggcagct gaggagaaac
     8041 ggagaagaaa ggaaaattac cgtcaggggc cggggttctt attagagaaa cagcacgtag
     8101 gtcaggatcc agatgctaat ggcaatcatg atgacgatga tcatgcaggc caagacgcgg
     8161 cgcaccaatg ccgaatccaa tagccgccgt gcctccggtt ggtggccggc ggcatctaga
     8221 gacatgattt gggggggacc ggcggcgcga aaagacaggg agatggacag tgtcacggtg
     8281 ttttgttatg attaggacat ggggaccgga agccgagaca gagtactaca gggtgttgaa
     8341 gggtaacgtg agggagatca tgtcatgggc gggctgaaga ccgtgcgggg aggatcgacg
     8401 tgtgcggtgc ttgtggaaca cggtgtttta atatgtatcc gcgtgtaatg cacgcggtgt
     8461 gctttttagc actcggcttg ataagctacg tggccgtttg cgccgaaaac acggttacca
     8521 ccaactgtct cgtgaaagca gaaaataccc acctgacatg taagtgcaat ccgaatacca
     8581 catctaatac caacaatggc agcaagtgcc acgcggtgtg caaatgccgg gtcacagaac
     8641 ccattaccat gctaggcgca tactcggcct ggggcgcggg ctcgttcgtg gccacgctga
     8701 tagtcctgct ggtggtcttc ttcgtaattt acgcgcgcga ggaggagaaa aacaacacgg
     8761 gcaccgaggt agatcaatgt ctggcctatc ggagcctgac acgcaaaaag ctggaacaac
     8821 acgcggctaa aaagcagaac atctacgaac ggattccata ccgaccctcc agacagaacg
     8881 acaactcccc gttgatcgaa ccgacgggca cagacgacga agaggacgag gacgacgacg
     8941 tctgacaagg aaggcgagaa cgtgttttgc accatgcaga cctacagcac ccccctcacg
     9001 cttgtcatag tcacgtcgct gtttttgttc acaactcagg gaagttcatc gaacgccgtc
     9061 gaaccaacca aaaaacccct aaagctcgcc aactaccgcg ccacctgcga ggaccgtaca
     9121 cgtactctgg ttaccaggct taacactagc catcacagcg tagtctggca acgttatgat
     9181 atctacagca gatacatgcg tcgtatgccg ccactttgca tcattacaga cgcctataaa
     9241 gaaaccacgc atcagggtgg cgcaactttc acgtgcacgc gccaaaatct cacgctgtac
     9301 aatcttacgg ttaaagatac gggagtctac ctcctgcagg atcagtatac cggcgatgtc
     9361 gaggctttct acctcatcat ccacccacgc agcttctgcc gagctttgga aacgcgtcga
     9421 tgcttttatc cgggaccagg gagagttgtg gttacggatt cccaagaggc agaccgagca
     9481 attatctcgg atttaaaacg ccagtggtcc ggcctctcac tccattgcgc ctgggtttcg
     9541 ggactgatga tctttgttgg tgcactggtc atctgctttc tgcggtcgca acgaatcggg
     9601 gaacaggacg ctgaacagct gcggacggac ctggatacgg aacctctgtt gttgacggtg
     9661 gacggagatt tggaataaaa gatgcgtgtt gaccgtcaaa aacgcaacaa cttcacgtat
     9721 cgacaaacgg tatatataat cctgaccttc tacattgtat ataggggcaa atgtaacagc
     9781 actgatacca ataattctac gtctacttca gatagcaccg tctctgatac tagtgtgtac
     9841 tctactccaa atcttcccag tacatttttt acaactcttg atacatctac tggctcacag
     9901 atatcaaccg cctcaaacac catatccagc actacaaata cattggccgc atcttctata
     9961 actacgttaa acacctcgac taacactacg tcttatacag cttcaactct tactgctctc
    10021 tccagtaccc acacaaattc cccaatactc tccaacaacg caacattata caccacatcg
    10081 ttggataata cgactacaga cataacgtcc agcgaaagtt cgatcaacgc gtcaaccatt
    10141 cataacacta cgtacagtcc tgtaacatcg attgctgtta attgtactgt cgcagctaat
    10201 gaaacaaaca attcaagttc aaaaaattgc caacaagata ttggaacaat acgtgttaaa
    10261 tcaactacat taacggcaga agaaggaaaa aacattacga tacagggcaa ttcaacatgg
    10321 aactgcccca atgtagtttg gtaccgacat tacaattggt ctacacatgg acaccacatt
    10381 tatcccaata gacgttacca aacgccaacg tatcgacaca agatcttaac atcacatccc
    10441 atatgtcatc ctgacgtctc atcacctgcg gcgtaccacg atctatgccg ttcgtgtaat
    10501 aagacagaac tacgtatata cgatttaaac actacaaatt caggcagata tagtcgacgg
    10561 tgttacaaag agtacaacca cgatggacca cacgaggatg aaaatttcgg actaactgta
    10621 aatcccagaa acgacactga caatcatacc accccactat gtcccagata cgtaggaaca
    10681 caatcagaag aagacgaaga cgacgattat acactaagca ctatcacaaa taataacatg
    10741 cgcaaaacaa gtcaccgtga catctcacat ggcacgcgca ctacatgggc tcttacacta
    10801 atctgcatag cctgcatact tctgtttttt gttcgacgag ccctcaataa aagataccgt
    10861 ccattacggg acgatattag tgaatctagc tttgttgtac gatatcatcc tgaacatgaa
    10921 gactgacgtt tccggacacg caacacatga aattaagtaa catatctacc atgaaataca
    10981 gcaaagatat actaatgtct atccatccaa tagcggtacc atgcactggc atcttgcgat
    11041 tacatggacg gtaatcatat taacgttttc ggaatgttac aaccaaactt gtccgtgccc
    11101 ctgcatttgt gtcaattcta caacagttag catatccacc agtgaaacaa cgtctaaaaa
    11161 catcactcca actaccacga caaattccaa aaaaacaacg tcaagtattg ctaccacact
    11221 acaccctcgt tagtaacgac tggcaaagtc gtttctactg cagcgtcgtc aaccataata
    11281 tctcaaacca accgcagtca tacgagtaat gctatcacaa ccccgaaaac gcgatttgaa
    11341 tataatatca cgggatatgt tggccaagaa gtgactctaa acttcactgg atcatggaat
    11401 tacattcaat ggttccggta cggttctcca ggctggcttt attcctcgga accaatatgc
    11461 accgttacca gcaattatca tcatactttc cctcgtggtg ctctttgctt tgattgtgac
    11521 atgacaaaac ttctaattta cgatctgacg ttaaacgatt ctggaaagta cgttgtcaag
    11581 agaacgcgcc atgacaatca atacgaagaa gcatgctaca gcctcacggt gatttttgcc
    11641 aacacgacat ccatagttac caacagaacg tgtgatagaa aacgaacaga aaatacagac
    11701 actactaacc atgaaatcgg gaaacatatt attgaaacta ttaagaaagc caacattcct
    11761 ctgggaattc acgctgtatg ggcgggtata gtagtatcgg tggcactcat agcgctatat
    11821 atgggcaacc gtcgcagacc caggaaaccg cgttatacca gacttcctaa atacgatcca
    11881 gatgagtctt ggactaaaac ctaatatgca catcaataaa cttttttatc tttagtcatt
    11941 aatgtttggg tgtgtttatt ctgagttaac cacttataag tcgggatatc catagacatt
    12001 taaaaacatg agtgtacgat gtaacagtaa actgctgcta ctagccgtac taataacaat
    12061 tatcctatct agcattctgg tacaggcaat tccacataaa caaaaaacat cctaccagca
    12121 gctcttgctg caaagtggac atgtacaaat acccatcaca gtagccgaag gagatacaat
    12181 ttgctttaac gttagtgata acccctgcaa cttttctagt tactggaatc acaataactg
    12241 cgaactttgc ggttggacac cattttactc ggaatatgct ggatattccg aaaacaagtc
    12301 gtgtcaccca cgatttacct gtcttcacga tactaaaggt ctgaaactac acaacgtaac
    12361 tacaaatgat tcaggaattt atacccgaaa cgtttattac tgtgacattc catgcaacat
    12421 cagcgatgat cataaacata acgtagagga ctttaacaac tgtaacacca ctataaatag
    12481 aactcactat attattactg tctcgtcttc acgttattct aaccgcacca attcccacgt
    12541 agccactcac gttggttgga cagccaccgt ggtgataatt atctgcgttt taacttacgt
    12601 taacgttaca acaaccctga agcacagact acgaactaga aacaacgtca accacacaat
    12661 gtgatcacaa agtaccaacg ctaatttatt tagggtacat ttttactact ttgtgtagtt
    12721 ctcaaaaact gtaaggtccc gcttttccac tccgtcatga aggatcgcaa taaaatactt
    12781 ctatgtatca tctttatttg catcatgtgc ctcatttgta tttactttaa acgtcattgt
    12841 gttcctactc cgtctccgga caaggcggat ttccgagtag aatttccttc gttactcccg
    12901 tgtatcggcg tacagtgcgc tgcatagaaa gacgcgtgac acataccgta ccccaggacg
    12961 gtacagtcta tgataacgta attgaaataa agtacaggtt cttagtgaca tgttatcata
    13021 aaacatagat ttttctacgt gtttttacaa aagagcgtct cgaagcagct tgagccacac
    13081 tgcggtccaa atgacaagca tgatcaaaaa tatgccgcgt agcagtcgaa agccgtactg
    13141 agcgtgcgag gcgggtaggc tgccgaacga cggatatgcg tcgtcatctt cgactataag
    13201 gatcgtgacc gagtcttcgg ccatgctaaa cgctaccctg tgtggctggt atgtagcgta
    13261 tccggtttgg aattgttctg ttccggctcg ggggatagtg aggaattctc aagggacaat
    13321 acgggaccca atgactggat atgagaaggg tttttccccg taagatgatc ctggtatcac
    13381 atgaggtctg gatatgtata aatgaggagt gaaatagata aagggaatca gatgccgcct
    13441 tcgtgatgca gccgctggtt ctctcggcga agaaactgtc gtctctactg atttgcaaat
    13501 acatcccgcc ttaagcgata agtccataaa acaccgttgt ccggatacgg tgaaggtgac
    13561 ccggattata gcacgttcct ttttttttgt ttttgcatca cttatcgcca ctatcagtgc
    13621 aatattttga ttgtgagact gaaagagtat cgttatgatg cttagaacgt ggatattatt
    13681 accgatggta ctgcttgacg cgtactgttt ttgtattttt gtgagttgtt caatcagcac
    13741 gacgactgct cccgtggaat ggaagtctcc cgaccgtcag attcctatga atattacttg
    13801 cgctaattac tcagggaccg tcaacggcaa cgttacattt cgaggtcttc agaacaaaac
    13861 ggaagatttt ttgcactggc tgttagggtg gggtcataag tccatttgtt cattttttcc
    13921 gaaactccaa ggcaataaag aacaacatta tatgtatgga ataacgaatc tcacgtataa
    13981 ctgtacctat gaccgcctga cgttgctgaa tctgacgacg gaaaacagcg gaaagtatta
    14041 tttcaaacga gaagatgtga attccacctt ttattactct tgttacaacc tgaccgtgac
    14101 ctaaacgcat gtaaagttcc acagagccgc gtggctgtag ctattgtgtt tacgttgctt
    14161 ttgaaatgtt aagcgtcctt acggcgctaa catgtttcta ggctactctg actgtgtaga
    14221 tcccggcttt gctgtgtatt gtgtatctag atcacgcttg acgctcgtgt ttgttgtatg
    14281 gttggtcggt ttgcgtctcc atgattgtgc cacgttcgag tcctgctgtt acgacatcac
    14341 cgaggcggag agtaacaagg ctatatcaag ggacgaagca gcattcacct ccggcatgag
    14401 cactcgcaca ccgtccctgg cgatcgcgcc gcctcctgac cggtcgatgc tgttgtcacg
    14461 ggaagaagag ctcgttccgt ggagtcgtct catcatcact aagcagttct acggaggcct
    14521 gattttccac accacctggg tcaccggctt cgtcttgcta ggactcttga cgcttttcgc
    14581 cagcctgttt cgcgtgccgc aatccatctg tcgtttctgc atagaccgtc tacgggacat
    14641 cgcccgtcct ctgaaatacc gctatcaacg tctcgtcgcc accgtgtagc taattagcta
    14701 gctgtgtata gtttgttttt cgcttttgcg tatttgtttt cagtcggaga gtctgaaacg
    14761 gggtgggagg gaccttttcg ggtaatgcat gctaagatga acgggcgggc tggggtatgc
    14821 ttagtaactc actgtttgaa tacgcgctca cgcacatatg tagcactcaa catgttagct
    14881 tttgcccgaa cgccccgggg catgacaagc tgccttttta ataaagtctg ggtttccaga
    14941 tacgtgctgg ttttgatttt gatagtttgt gcttttaaag gctccacgag ctctgtgata
    15001 attcacaggc cactcaactg cagcacggtg actagaacag caggacaaaa cgctgagttg
    15061 tgcggcacat tgtcaccagg ttgtaacgtg acccagtggg gacgttacga aaatgggagc
    15121 acgttggggc cgtggtgtac cctatgggga ccgtataccc gagtctcatt aagacaccgt
    15181 gtagcattcg gctgttcttt aacaacgttt tttatataca acgtttccca aaatcatagc
    15241 ggcacttatt atcgaaaagg tgacaactgt accgacaaac atataacact atcttgtttc
    15301 gacctgacag ttcatcctaa ggcggctcag agcacaacca ccgtagtaac acccacggta
    15361 gttacaaacg ccacggcaaa tgtatcaccc attacgtcga ctctaacggt aaattcgaac
    15421 gcgtttgaac acgttagtta tcaacgacaa cggcgtgtcg aaaacgggac gttatccaag
    15481 aacataacta acttggcatt cacctacggc agctggggtg ttgcgatgct gctgttcgcc
    15541 gccgtgatgg tgctcgttga tttgggtttg cctcaatcgg cttggcgacg ctggcgaagc
    15601 cacgtggacg atgaagaacg tggtttgtta acgtaggaaa taaaaggcac tgtttgagcg
    15661 tgactgtttc caaaccgtaa cgtggtaaat aaatcatggt ttccggcgcg ggttcccatc
    15721 ttctgacggt tccacgattc cgttggacag tgcatcatat gtacaataaa ctattgattt
    15781 tgacgttgtt tgcccccgtg attttggaat ccgtcatcta cgtgtatgca ccagagggag
    15841 ggaacgttac cctggtgtct aacttcactt cgaacatcag cgtacggtgg tttcgctgga
    15901 acggcaactg tagccacctc atttgcttct acaaacgtgg agagggtctc tctacgccct
    15961 atgtgggttt aagcctaagt tgtgcggcta gccagatcac cattttcaac ctcacgttaa
    16021 acgactccgg tcgttacgga gcagaaggtt ttgtgagaag cgacgaaaat gaaacgttcc
    16081 tgtggtataa cttaaccgtg aaacccaacc ctttggaaac taccccagtt agtaacgtaa
    16141 caaccatcgt cacgacgata ccgacggtga ccggcacaaa aagtaacgtt acgtggaacg
    16201 ccagtttcgc accacaacta cgtgccgtcg ctggattctc caatcagaca cctttggaaa
    16261 acaacacgca cctggccttg gtaggtgttg tcgtgttttt aattctgata gttgtttgta
    16321 ttatggggtg gtggaagttg ttgtgtagta aatcagagtt atagtaatgt cctttttatc
    16381 agggagaagg ttttgttccc acaatgacta gctcgagact atctgcgtcg gaaaattatg
    16441 acggaaatta tgaactcacg gaaactgcca atacaacgcg tacaaatacc agtgactgga
    16501 taacgttagg aagcagtgca tcgctgttga aaagcacgga gactgcagtc aacctcagca
    16561 acgcgactac ggtcatccca caacctgtag aatacccggc tggggaagta caatatcaaa
    16621 gagcggcaac gcattattct tggatgctaa tcattgtcat cattctcatc atttttatta
    16681 tcatctgtct acgagcacct cgaaaaatct accatcactg gaaagacagt aaacagtacg
    16741 gacaagtgtt tatgacagac acggaactgt gacagtgatg tctaagcgtt tgcaggtatt
    16801 tccatggata acaattttat tttacacatc aaaatcccag tattggaact atatgacaat
    16861 accatgtacc cctacagttg gatacggcag tcataatatt agcttgcatc cgcttaataa
    16921 ctcattattt caagacgatg tttttgaatg gtacatagac aaaccaatgg ttactaacaa
    16981 gttatgtctt tatcaaagta atgaacgcat aaaatccaat ctagactctc caaatattat
    17041 gtggcagtgc acagataatc gtacactaat tctcatgaac ttaaccacaa catacagtag
    17101 aaactattat tttcaatctt ttaaatatct cggacaagga gtaccaaaac cgaataactt
    17161 gtgttataac gttagtgtac actttaccca ccaaacacat tgccatacaa ctacatcatc
    17221 cctgtatcca cctacatctg tacacgattc attagaaata tcacagtcat tcacctcaac
    17281 caacttcaca cataccgcgg tccactacgc cgccggtaac gttgaagcac aacacgacac
    17341 tgccacttca catacaatgt ggatcatacc cctagttatc gttataacaa tcatcgtttt
    17401 aatttgtttc aagttccccc aaaaagcttg gaataaattc acacaatacc gatacagcgg
    17461 tatgctcgcc gccgcttaaa gaatcaacgc caaggaaatc aaaacgtaaa aagaatagat
    17521 atgtacgttt atttttcagc tcactgtttg aataccgtaa acataatgac gtacatatac
    17581 gtggttatac aacaggtgtt tgtgttatgc ggcaactgat taaccatatc gtgaaccatg
    17641 atcttttccg atggtccgtc gtgaccgcaa tgatatttta cagatattcc gaaacctgta
    17701 tggaggtcac tgtcagagta ggtgatccag ttaccctcgg tagtggacat ggttatcatc
    17761 caggacaaaa agtacactgg tataaccagt catgcgtcgg catcggcaac ggcgaaaata
    17821 cgcatcctat ctgcacctac gaccctccta aacctggtag acaaaagaca atgaaaacta
    17881 ctccgttgcc atcaccattg ttgtacgagt gtcacaattc cacattaagc attcttcatg
    17941 taaacgtctc agatcccaga aactattgca ggcgaaaatg tccaccaaag ggtaactgtg
    18001 agtttcccac atgttttaca ttatcgctga tttctagaac tacgaccaga aaacccgaac
    18061 aaacaactac gttgttgcga ttaaaaacca cgccaaataa acatacgcag cacaaaagat
    18121 ccacgcggag aacgtcacct aaagattaca atgtaacggg ttttccaaaa ggctttgcgg
    18181 actcgtttac cggtaacgta gaggcacatc gaaccaaaga tgccgcacac agcgcatgga
    18241 ttctcattat catcatcatt atcatagtcg tcattctatt cttcttcaag attcctcaaa
    18301 gactccgaga gaaatgggac accaagggat acctttacaa aggaaccgat ggcctgccca
    18361 ctacggacta attatcgtga gcggacggat atgttcggtt tcaaactcac tgtttgaata
    18421 tagggacagt ccctacggaa cctgagaaca tgtggaaatc acctgtggta gaatgctgtt
    18481 caggtacatt acctttcatc gcgaaaaggt actttaccta acggctgcat gcatctttgg
    18541 tgtctacatc agcctccacg atgcctgcat accggtggtc ggcaaaatag gtaccaacgt
    18601 tacgttaaac gcggtagatg ttcttccccc tcgcgatcaa gttcgttggt catacggtcc
    18661 aggtgggcaa ggctacatgt tatgcatttt cactggcaca tcaacaacaa catttaacaa
    18721 tacgcgcttt aacttttcat gtctaagcaa ttacagcctt ctcctcatta acgttaccac
    18781 gcagtatagc accacctatc gtactatgac atcactagac cattggcttc accaacgaca
    18841 taaccatggt tctcgatgga ctttagacac atgttacaat ctgacagtga acgaaaacgg
    18901 tacattcccc actaccacca ccaaaaagcc cactacgact acgagaacga caactaccac
    18961 aacacaaaga acaaccacca cgagaacaac cgccaccgcc aagaagacga cgataagcac
    19021 tacccatcat aaacacccca gtcccaaaaa atccaccacc cctaacagtc acgtagaaca
    19081 tcacgttggt tttgaagcca cagtagcgga aacaccgtta caaccaagcc cacagcacca
    19141 acacgtggct acacacgccc tctgggtttt agcggtcgta atcgttatta tcatcattat
    19201 cattttctac tttcgaatac cacaaaagct gtggttgctc tggcagcatg acaagcacgg
    19261 catcgtgctc atcccccaaa ccgatctgtg agcaagtcgc gtaggaaatg attgcatgaa
    19321 atcactgtga aacgccaact ccgtgccagc tggcgcggcg gacaggcctt tgacgtattt
    19381 gaagccaggc gcgctctcga taccgaaagg atccgagggg gctttccaaa gccgacgtcc
    19441 ctgattccct tcataaagct gttgaccggc cctagaaaga ccaagagcat gctgtgggcc
    19501 cactgcggtc gcttcttgcg ttatcatctg ctcccgctgc tgctgtgtag actgccattc
    19561 ttactccttt tccagcggcc gcagtgggcc cacggcttgg acattgtcga ggaggacgag
    19621 tggctacggg agatacaagg agcgacgtac cagctgtcca tagtgcgcca agccatgcag
    19681 cacgccggat tccaagtcag agcagcgtcg gtcatgacgc ggcgaaacgc cgttgacctg
    19741 gaccaaccgc cgctttggtc gggatcgctc ccgcatttgc ccgtctacga tgtgcgttcc
    19801 ccgcggccgt tgagaccgcc gtcatcacag catcacgccg tatcacccga actgccgtcg
    19861 cgagacggga tacgttggca gtaccaagag ctgcagtatc tggtggaaga acaacggcgg
    19921 cgaaatcagt cgcgcaatgc gattccgaga ccctcgttcc cccctccgga tccaccatcg
    19981 cagccggcag aggatgcacg agacgcggac gcagaacgtg ccgaatcacc acatagtgca
    20041 gaaagcaccg tcaggcacga cgcgagtgag aacgcagtgc ggcgacggca cgaaagacgg
    20101 cgctataacg ctctgacggt ccgcagccgg gactcgctgc tcctgacgcg aatacgcttc
    20161 tccaaccaac ggtgtttcgg acgcgggcgt ctgagacatc ccgcgggaag cggtcccaac
    20221 accggcggac cgcgacccgg cggtgcggga ctccgtcaac tacgccaaca actgacggtc
    20281 cgctggcagc tgttccgcct acggtgccac ggttggacac agcaggtctc tagccagatc
    20341 agaacccgct gggaggaaag caacgtcgtg agccagacgg ccacgcgagt acgtacgtgg
    20401 ttcgtggaaa gaaccacgtt ttggcgtcgc acgtgggttc cgggacagaa cccggcggcc
    20461 gaagcgcaag aactggccgt cataccgccg gcacccacgg tgctccggca gaacgaggaa
    20521 ccacgtcaac agcttacggg agaggagaca agaaattcaa cgcacactca acgtgaagaa
    20581 gtggaggacg tttcgagaga gggcgcgaga gaagggaatg atgggagccg agcaagtgga
    20641 aacgacgaga gaaggaataa tgcgggaaga tatgatgatg atcatgaggt tcaagagccg
    20701 caggtcactt atccagcggg acaaggagaa ctgaatagga ggtcacagga ggagaacgag
    20761 gaaggtggac cgtgtgaatc gccgccaatg acgacaaata cgctgaccgt ggcctgtccg
    20821 ccccgagaac ccccgcatcg tgccctgttt cgtctatgct taggactgtg ggtctcgagc
    20881 tacctggttc gacggcccat gacgatttag aatacaccga gccattcctt tatttccccc
    20941 catccccggt cgcttatgcg tgttaaacac taccaataaa gataatctgc caatcgcacc
    21001 ttatatataa tatgtggtcg cgtgtggtct ttttaaggag ctctgaaaca cagacaggta
    21061 tgggcggtgg tcggctgccg ccgctgtggc tgccgctact gatcgcctgg agcgagtggg
    21121 gcaactgctg cctcgatgcg cctccggtgg tgcgttcgcc ctgtctgcag ccggtgcgcg
    21181 accgcaaccg cgagcggaac ccgggctcac cgcagttgct gccttacggc gaccgtctgg
    21241 aggtggcctg catcttcccc gcgcacgact ggccagaggt ctctatccga gtccacctct
    21301 gctactggcc cgagatcgtg cgttcgctgg tggtggacgc acgcagcggt caggtgttac
    21361 acaacgacgc cagctgttac atcgccggcg ggcactggcg cttcgaggac ggcggcgcgg
    21421 cgcagcggct gagcctctcg tttcggctca tcaccgagac cgcgggcacc tacacctgcg
    21481 tgctgggcaa cgagacccac agcctggcga ccgagaccac ggcgctggtg gccgacgtgc
    21541 acgacctgcg ccactcggac cgctcctgcg acctggcttt cggatcgcgc tcacagacgc
    21601 ggtacctgtg gacgcccgat ccctccaggt tgcgcagtat aaactgcggt tgggagggtg
    21661 aacggcaccg cgtagtccac tacatccccg gcacctcggg tttgctgccc tcgtgcgagg
    21721 aggacgagcg cgaactgtgc gtgcccttca tcagccagag cattgcggac aacaactgca
    21781 gccgccggca tcgagttgac ggcgctaggc ggcgctatca tctacggagg gattactggc
    21841 tgacggatcc gaagatcggg ttgctggccg cgggatcggt ggccctgacc tccctctgcc
    21901 acctgctgtg ctactggtgt tccgaatcgt accggcgtct gaacaccgag gaggaaagcg
    21961 aggcggcgga ggaaactgcc gcgggagaag cctctgcggt agcggcggcg gccgtctctg
    22021 aggaagagca gcggcgggag taaacgagga gagccatgaa gcggatgatt cgcagtcacg
    22081 gcaggaaaac ggaatgtcag atgacgggcg ccggcgagcg acgcggctcc gccgtcggtg
    22141 cgcccatctg cggcagcggt acccgacgcg gcagcggcgc caacgaacgc cgcgactccg
    22201 acgtcggtcc catcgcccac agtagcggta ccagacgcgg ttcggcgaat gaaacgtccg
    22261 cctgtacgcg gaccgatcac cagaaggcgg acattgggct gtggttcatg tttctggttt
    22321 ttggactgtg ttcgtggttg gcgatgcggt atcgcgcaca ataaattttg aatcgatgtc
    22381 aaggaacgcg tgttttgtat tttattggga atattggcgg ggataaaccg gtttcggatg
    22441 tttaccctta atcttaccgg ggacctcgtt gtcctctcct ccttcttcct cggacaccgg
    22501 gctccatgct gacgtaggta ccgactgggg tcaaaagcct gggtacttat gaggagcgcg
    22561 cacaaaggac cgttaggcgc cggcatggag cgtcgccgag gtacggtacc gctgggatgg
    22621 gtgttttttg ttctttgctt atctgcctct tcctcgtgtg ctgttgacct gggtagcaag
    22681 tcctccaact cgacctgccg cttgaatgtg acggagttgg cctcgatcca tcctggggaa
    22741 acgtggacgt tacacgggat gtgtatttct atctgctact acgagaatgt gaccgaggac
    22801 gagatcatcg gcgtggcttt tacttggcag cataacgagt ctgtggttga cctgtggttg
    22861 taccagaacg acacggtgat ccgcaatttc agcgacatca ccactaacat cttgcaagac
    22921 ggactgaaaa tgcgaaccgt ccctgtgact aaactgtaca ccagccgcat ggtcactaat
    22981 cttaccgtgg gccgctatga ctgtttacgc tgcgagaacg gtacgacgaa aataatcgag
    23041 cgcctctacg tccgattggg ctcgctatat ccgagaccgc ccggatccgg gctcgccaaa
    23101 cacccctccg taagcgccga cgaggaactg tccgcgacct tggcgagaga catcgtgttg
    23161 gtctcagcca tcactctgtt cttcttcttg ttggccctac ggatccccca gcgactgtgt
    23221 cagcggctgc gcattcgcct gccgcatcga taccagcggt tacgcaccga ggactgaacg
    23281 gataaccgca aaggccacgt gcaacgttca cgctgctata agaaggccat gtcccccgtg
    23341 gacgggtctc tttgacacga gcgcggcacg ccgttgccac gagcatggat cacgcgctct
    23401 tcacacactt cgtcggccga ccccgtcact gtcggttgga aatgttgatt ctggacgaac
    23461 aggtgtctaa gagatcctgg gacaccacgg tttaccacag gcgccgcaaa catctacctc
    23521 gacgtcgcgc tccgtgcggc ccccagaggc ccgccgagat tcccaaaaga agaaaaaagg
    23581 cggccgtcct tctattttgg cacgatttgt gctggctgtt tcgacgactt ttctttcctc
    23641 gggaggactc agagccactg atgtcggatc cggcacggtc tcccgaagag gaggagtaaa
    23701 caacacacgg ctaagaggat acatcatcaa agaagatagg aggggtcaaa acgcggactg
    23761 aaagtatata acgccgatca tgtccgagga actgttaata aaacgccatg atgacaatgt
    23821 ggtgtctgac gttgtttgtg ctgtggatgt tgagagtggt gggaatgcac gtgttgcgtt
    23881 acgggtacac ggggattttc gatgatacat cgcatatgac gttgaccgtt gtggggattt
    23941 ttgacgggca acactttttt acctatcacg ttaattccag cgataaagcg tcaagtcggg
    24001 ccaacggtac catttcttgg atggctaacg tctcggcggc ctaccccacc tacctggacg
    24061 gggaaagagc caaaggtgac cttattttta accaaaccga gcaaaacctg ttagagctgg
    24121 aaattgcgtt gggttaccgg tcacagagcg tgctgacgtg gacgcacgag tgtaatacca
    24181 cggaaaacgg tagttttgta gccggttacg agggatttgg gtgggacggg gaaactttaa
    24241 tggagctcaa ggataacctg acactatgga cgggccccaa ttacgaaatt agttggttga
    24301 agcaaaacaa aacgtacatc gacggtaaaa ttaaaaacat cagcgaggaa gatactacga
    24361 cacagaggaa ctatctcaag ggtaattgca ctcaatggtc cgtcatctat agcgggtttc
    24421 agacccccgt cacccaccca gtggtgaagg gcggtgtccg aaaccagaat gacaacagag
    24481 ccgaagcgtt ctgtacatct tacgggttct ttccagggga aattaatatc acttttattc
    24541 attacggtga taaggtgccc gaggatagcg agcctcaatg caatccgcta cttcccacct
    24601 tcgatgggac tttccatcag gggtgttacg tagccatctt ttgcaatcaa aactacacct
    24661 gccgcgttac acacggtaat tggacggtgg aaatccccat cagcattacc tcacctgacg
    24721 acagttcctc gggggaggtc cctgatcacc ccacagctag caaacgctat aacaccatga
    24781 ccatcagcag tgtcctccta gccctgcttt tgtgcgcttt gctattcgcg ttcctgcact
    24841 actttaccac tttgaaacaa tacctacgta acctggcctt tgcgtggcgc tatcgcaagg
    24901 tccggtcgtc atgaccagca acgccctgta cgagctgttt cgacgtcggt taccgcgtgc
    24961 ccccgtcaac acggtcatgt ttctcacgcg acgcactcgt gatgggttct gtggtcgatt
    25021 gacgtccatc gccacgaatt cctactacac tatgttcgtg ttggatcacg ggtccgtgcg
    25081 catcgagcga ccgagtcagt cagaagtgga ttgcgccagt ttaatggaaa cgctgaagcg
    25141 gattcggtta cgaaattcgt gggtagcgtc agaagacgag ctagatgtga gtcgcaggga
    25201 cgcgtgacac gaaacgcgtt caggattaac gtaggttttc gaaataacct acgtccgtga
    25261 gtgacgcggt ttcgtgttga aacccgcgcc ggttctcacg gtggttcatg atgaaaccgg
    25321 cgttgcggat ctacgcgggt tcctcattca acctgcaaaa agaggaagtt gcggtaaaac
    25381 cacgtcaata aagacgtcaa tgacacctca atgttgcgtt ggaacggtct ttatatatac
    25441 aaacgccgtt atgatcagtg tccggcaaga tgctcgggat acgggctatg ctggtgatgc
    25501 tggattacta ctggatacag ttgataacga acaatggcac tcgaagcaac aataccgata
    25561 ccatctttgt atctctcctt accgggccca acggagttac tcgcacagcc atcggaggtc
    25621 tgtattcaaa ctacaccaac ttaactggag catttggctt cacttcaaca aacatgtcag
    25681 caaccaactc ttccgctgag gataattgga gcgtaaccaa cctgacggag agttgcatca
    25741 accgcggtga gtcctatgtg actaccatct ggcttctgga ctgcactaaa aacgatactt
    25801 attggtacta tggaaatgcc tacaatcata catgtgaagg tacaatttcg ggatatctcc
    25861 tgggcatgtg caagctatgg aaaagttggg tcaataatat tacttcttat aacactgtca
    25921 gagtcgaatc gctgggaaat gaaacacggt gcatgctgct ccctagacag tatactctca
    25981 acgccacggt ggaatggtac aacaaatctg aaggtgacgt accagaagaa ttcatggact
    26041 atgttatcct gacccccttg gctgtgctta catgcggact gcaggaagct tatatactcg
    26101 acaaaggtcg tagatacatg tatttgtttt ccgtgtcctg cgtgggaatc acaggtaccg
    26161 tatctattat actcgtctcc ctatcgctgc tcatcctcat ctgttactat cgctgtggcc
    26221 ggcttctgat atgcccacgc ggctttgaac tcttgccaga attcactgag gaagaggagg
    26281 aaaaagaaaa attgttaacg cataatgaca ttgaagtcca agtgcctatt cgcacgcggc
    26341 gactactcgt cccttggatc cgggagagca aaatgtgggt actaccaccc ccgttgcctc
    26401 cacgacctcc ccacttaata gaattcccgc cgtctcctcc gccatcgcct gggcccatgc
    26461 acatggtggt ctgcatgcca gcatgacgaa ctttggactc tgagccccaa gcggtacgaa
    26521 ctacatattt tccataaatc tacactgaac ttgagcacaa aaatactgac aatagactgg
    26581 atatacagac ttttatatga tccctgtaca gatgtaaata aaatgctttt atttaaaact
    26641 ggtcccaatg ttcttcggga atcatggggt ggggacgggg gacgcggtag ggagcaaaac
    26701 cgggtacatg ggggggaaca tcgtccagca gtagcaccag cggattgggt aggggttgct
    26761 gcggaggtcg gtcgatgacg atgtcgatct ccatcggcag atccggcaac atctcttcat
    26821 ctccctcacc gaccagcact cggcgctgtt ctggatgtat atgattctgg aaaagcctcc
    26881 gacgagctcg cggcgcgtag aaagccaagc ggcgcaaggg ccggcgagcc cgaaagtcca
    26941 tgcgcacaga tggcatgagt ccttgagtga cggtggtgag ctggggaaca gggctacctc
    27001 ccatcgcgac ggtgacagtg gatccatgag agaggcgccg cacgctgcat ggctaaatac
    27061 cgtgaatccc ctgacgtcgt ctttcgtccc gaacgcgtca tgttgggggc gaggcgtaaa
    27121 ccgtcgaggt tgaaaaaccg cgtatctgcg acccgtccgg actacgttgt tttttagaag
    27181 cggccacatg acctcgagat gtcgtcaccc aaggtattta acggcacaca gccagacgcg
    27241 ttcgtcagca gcgacgccga caagacctca gcatggctcg gaggctatgg atcttgagct
    27301 tactagccgt gaccttgacg gtggctttgg cggcaccttc tcagaaatcg aagcgcaggt
    27361 aaacggaatc tggggaattc aacacaggta agaaatacaa aaaaataacg tgattgtgaa
    27421 cgcggttatc gtgtttttgc agcgtgacgg tggaacaacc cagtaccagc actaactccg
    27481 atggtaatac cacccccagc aagaacgtaa ctctcagtca gggggggtcc accaccgacg
    27541 gagatgaaga ttactccggg ggagactatg acgttttgat tacggataca gatggaggta
    27601 accatcagca accacaagag aagaccgacg aacacaagga agaacacacc aaggaaaatg
    27661 aaaagaccca gtagcagcag cagatcccaa gggttaaaga ccatgttgac tatcttgttt
    27721 tttattaaaa agctgtaagg ttctgctcta aaaacacccc cgcctccggt cttttttctt
    27781 tcgtattcgg cacgcgaaac atggtttctt cccatagcct gtctaactag ccttcccgtg
    27841 agagtttata aacatgtatc tcaccagaat gctagtttgt agaggctatg cgggatgctg
    27901 cggcggcgcg accttccctc cccacccagc cccgtcaaaa cacacgcaac tcgagcggtt
    27961 cgtatgaaaa ataaaaaaac agctttttat ttacaggaac ggggaaaaaa aaaggcacac
    28021 ggtccgtggg agacgcgggt tcacgcgtcg tcaaaaagtt ggtggtccac tccgtaagga
    28081 caggtaggct gatttagctt ccgcatgctc ctggttccgt aataaatgcc gttttcgtgg
    28141 cagcgtgtca tgccgcgagc cacaaactcc atcaaactgt cggccacgat gcaaacgtgc
    28201 tgattgttgg cagcaaagac gcgcatacag tcgtccacga agaggttgat cacgtcgtag
    28261 gggctcacca accagcctaa aggttccacg tggttactgc cgaccatgac cctccagtcg
    28321 ttaatctcgc tccagtcgta cagccgaatc gtggagacgc gaatgacgct gtaatcaccc
    28381 atgaccatga gtcggccgcg atacgtagca cgccactgcg cgaacgcgtg gatgtgcatg
    28441 cagccggcca gcgctctaag cgaggcggtg tgcggcagct cctctgggac ggtgatgaag
    28501 ttgcagcgtc gcaaaccgat gttgagaaat tcagtgatgc tctcggccac aaaggtcaac
    28561 gagtcagagt agatgtggtc ggtccacagg tacatggcgc ccgaggcgcc caggtacagt
    28621 tcagacggca cgttgtgatc gcccttgtgt ttaagaaagt tgtaggtgca gatgctgccg
    28681 acgaaacgca gcggctcggg gcagcagagg tagctggcca gacgctgtgc atcccgtcct
    28741 tcgtcgcgca ccaagcgcca gcgacgccgg ataacgaggc agcggtcttt gggccagacc
    28801 agggccacgc gttgcccggg tttccacggt cgcgacgtct taggaggcct ccagcggtcg
    28861 agcagattga gaaaacagtc cttgattacc gacatcgcgg tcgcgcgtcg gtggacaaaa
    28921 agaaatcggg ccgatccgga aaaaaaaaac gacggcaaaa caccgccgtg ctcgagcgaa
    28981 gggtggcgga gggccagaag aggcggcctt gacggcgttg gcagcgaaaa aattggcacg
    29041 cgagtcaaac gggaagtagc gtcggtgttt tatgccccaa gcagcgtcgt cgtcactcgt
    29101 ggcgtcacag tcaacggtgc tgacgtcctt tggggcagtc gggcacgcga tcgtagatgc
    29161 cgttgtggcc gctgaaacgt cggttttcaa acagcaggtt aagtcccaga cacatgaacg
    29221 tgttgagatt atctcccacc cggatgtagc ggtcgtcgcg cacgtcgcag gcgtagacgg
    29281 ccccggtata ggcgacgacg atggggataa ggtcgacggg ccagcgcaag tgaggaaagg
    29341 gcgcgttctc gcccttgagg ctgacggttc ccaggccgag aacgcgcatt ccgaaagcgg
    29401 ttttgatgtt gcgcagcaag tgaccgcctt ccacgctgtt ttcgaaacac ctgaggttgc
    29461 atagacgcag ttccgttccc ggcgggtacg tcagcggcat gaactgcccg tggtggcgga
    29521 tgatgaatcg cgccatggta tccaaaccga ggctccaggc gcgcaacagc gggcgaaagt
    29581 agcgcttaac caacgacgag gtcaggtagc gcatgcagtg cagggtctcg acggcgcgca
    29641 gcccgacgcg cgcaaactcc atgaggttgc gggccaggta gtagacggcg gtgtcctcgc
    29701 gtacatagca aaaaacatag ccctcgtccg agatgaggca cacagcggtt ttcttctgct
    29761 gatccggcga caacacgccc tcgttcacga agcgacccac gaaggccagg cgcgtctggc
    29821 aacacaggta gtgactccaa gccttcacgt cctccggttt gaagtcctcg tccgtctcga
    29881 tctcctgcag cactaggttc cagcccggcg gccagaccac gggcaacacc tggcctgcgt
    29941 tgatgcgcac gtaagcttcc agacagccca ggccgaactc ggccgtgagc gccaggctag
    30001 ccagatcgct catgtgacgc gccgagtcag tgggcgagcc cgggggcccg tcgcacacca
    30061 cgctccgtct tcttgtcctc accgcggcca gcgtggcgag gacactttcc gcgcccgagg
    30121 ctgtatcttc ggtttgcccg ccggagccgg ccctcactat ataacgtccc acccgggtct
    30181 cctccatgta tgcaggtaag caactgagcc gaacgcacct cagcagacga gaggatgtcg
    30241 tcgcggcgtc gcagctcgtc acgtcgctct ggcgaaccct cgacggtgat ttatatcccc
    30301 tcgagcaacg aggacacgcc ggcggatgag gaggcggagg acagcgtttt cacgagcacg
    30361 cgggcgcgca gcgccacgga agatctggat cgcatggagg ccggtttgtc gccctacagc
    30421 gtctcctcgg acgctccgtc gtccttcgag ctcgtgcgcg agaccggcgg caccggcgcc
    30481 gccaagaaac cgagcgaaaa gaaacgatcg tcgtcgcgtc ggcaaccgca gatcgcagcg
    30541 ggcgcgcctc ggggctcgcc ggcgacaccc aaggccggca agtcgcctaa agtctcgcga
    30601 ccgcctagtg tgccctcgct gcccgagaac ggcgccggcg gcggtggcga cgataacagc
    30661 agcagcggcg gtagcagcag tcgcaccacc agtaacagta gcagaagtac cagtcccgtg
    30721 gcgccaggtg agccgtccgc tgccgagggc gatgagtttt ccttctgcga cagcgacatc
    30781 gaagactttg agcgcgaatg ttaccgggtc agcgtggccg acaatctggg cttcgagccc
    30841 agcgtggtcg cgccgcagca cgtcgagtat ctcaaattcg tgctgcaaga ctttgacgtg
    30901 cagcacctcc gccgcctcaa cgaatgcata cccatgccgg ccttcgcgct caccagcctc
    30961 gtcgaccccg tcttaaacaa cgtagcgcct ggcgagcgcg atctcacgcg tcggataatc
    31021 acgcacgcgg tgatcatcaa ctattactac gtggcgcaaa agaaagcgcg ccacatggtg
    31081 gaggccatac ggaccaccgt gcggggcgac acggtacgcc gggtagccgc gcaggtcaac
    31141 aaccagagcc gttcggggcg tgcggccgcg ctagcgcttc attttctcac gtcacgaaaa
    31201 ggagtgacgg acggccagta cgccacgtct ctgcggcggc tggacgaaga gctgcggcat
    31261 cgcggcacgc ccgaatcgcc gcggctcacc gaggtttacc agacgctacg cgattacaac
    31321 gtgctcttct ataccgccca ctacacctcg cgcggcgcgc tctacctcta tcggcaaaac
    31381 ctgcagcggc tcaacgagaa ccaccggggc atgctccggc tgctttcggt cgaagagata
    31441 tgcgaagagc acacgctcaa cgatctggcg ttcctagtag gcgtcgagct tatgatcacg
    31501 cactttcaac gcaccattcg cgtgctgcgc tgctatctcc agcaccagct gcagagcatc
    31561 tcggagctgt gttacctcat ctatgtacaa ctgccgtcgt tgcgcgaaga ctacgcgcag
    31621 cttagtgacg tgatctactg ggccgtcagt caaaactacg actacgcgct ctacgcgagc
    31681 acgccggcgt tatttgactt tttacgcgtc gtgcgtcagc aggacgcctt catttgcacc
    31741 gactacgtgt actgcgccct gcgtctgctg gcctgtcccg acagacctat tatcggtgac
    31801 accggcggca gcagtagctc ccaacgcctc gtaggcgagt ttatggtgcg cgatccgctg
    31861 ttgcgcgacc cgcgcgccac ccacctgcgc cagaaactca tcacccgcga catatgcgtg
    31921 gcgcggttgc aagcgcagcc ctcgagtcga cacattccgg tcgaacacac gggtgtctcc
    31981 tccgtcaccc tgctcaaaat ctttagccag gtcccccccg acgaacgcga agaagacacg
    32041 ttacgcgaga tggctcttaa agcgtttatg gaagcgaacg gtaatcaccc cgaacaaatc
    32101 tgccgatccc caccaccccc gctgccaccg cgcgactatc ctcaacgcga cgagcgggac
    32161 cgtcaccgtc gcgaccgccg cgacagcggg gagtactgtt gctgatggtg ggacgaagca
    32221 gcagggcgga acagtttatg gtaaaaagtc acaagaaagt atgtgtttgc tttttaatgt
    32281 accaagaata aaaagtacgt ctacgaccaa agcggtgtgt ggacgctcgt cctctctgtc
    32341 ttctccgggt ttttcatgtg tgtgtttttt tccttcctgt tttgttacgg caacagcgct
    32401 gatggcacgt tgccggcttc gaacatcgcg tcggtgattt cttgcttgcc cggcgtcaca
    32461 cggtgacgta gcagcgcgcg gctcacgtag caggccgact cgcggatgac ttggccgtcg
    32521 gcgtcgcgtc gcaggcccga gcggttgccg tgacgcagtc tgccctgcgc agcgcgctcc
    32581 acgtcttcaa agtagctgtg tagcaggccg cgctccagca gctgcggcag cgagtcggcg
    32641 gcgcgcacca caaagttctc acggctgatc tcgtagcaca gcacgctgcc gtcagccgcc
    32701 acgccggcca cgctgcggtc ccaactgaaa aggttggcga gtccgatggt gccgatgacg
    32761 cgcaactgac cctgggtcac caccagcagc ttccagtatt ctacgtcgcg cggggtgagg
    32821 atggtctcct ccacgtcgca gacaaacagc gtgtagccgc gcggataggg cagatccagg
    32881 tggcgaccgc gctggcggcg cataaaatcg tctaaattca aaccgccgtc gggtgcgcgc
    32941 ctgctcgtca tcgccgcgcc tcgtcggtcg atgaccccac ggtgcttata acgcgccgcc
    33001 gcggcttcat gtggcgtgac ctccgacctc gtgaggccga aaacggcgta catgaagacg
    33061 ctcaaacttt tgaatgtggg cccggtagcg caccgagggc cccggggcgg cgacgacggc
    33121 gggtccgagt tccagcgggg tcttgcggcg gcagcggttg gcgtggttgc tcagctcggc
    33181 gtccgagagc gccgagctga actgcggcag ccgcgtgcga tcctgcggcg cgtccccgtg
    33241 tcgcagcgag tgccagagca ggcgctggac gcgcgccgtc tcgggcgtcg gcggcgcgcg
    33301 acagccccgg cgcagcttga aaacgtgcag gcacagcagc tcgcgcttga tgcgcagcga
    33361 cacgctgcgg tagtcgggaa tccgctgcac cagctcgaga aagtcgcaga aggtctccac
    33421 gaacgtgtcc tcggtgaagc gaatgcgctt cagatcgtgg acgtgtttgc ggaaccgcga
    33481 cagttctcga cgttgcacgg ggttctgagc gagtcccttg cgcagcagcg cagcctcgcc
    33541 tttaaacagc ctgatgagcc gctgcacgtc cccgctcaac atacgtatac acgccgtgta
    33601 ctcgtgacgt atactggcgc gcagcagccg aatgatacgc agggccagca cggcgttgga
    33661 ggccaggtac atggcgtagc cgcgacgcgg gttggcacag gcccagcccg cggggagcag
    33721 aaagtagtcg tcgaccagcg tctgcgacca gtcggcgaag cccaggtcac gtgatacgct
    33781 gttctggacg cgggccacgt cgccggccgt gaggtggcga atcgccggca ggtgaaacgc
    33841 acccaggtgt cggttgcgct ccagcctcag ctcggcgtgc tccaaacggg aatggtgaga
    33901 cgccgccgcg gaaagcgaca aagaggagtg gtcgccgccg ccgtggttac cgtcgtggtt
    33961 accgccgtcg tcgcgcccgt cgccgcactc gcaaaaggct gcgtagaggt ccttcaacgc
    34021 cgcttcggct cgcgccataa acgtggcgtg gaaaaaaacg gcggcgcggt gcgtccggta
    34081 cttgacgggc aacccgcggc acagggccgc cggcaggcaa cggccgatga gttcgcgctc
    34141 ctcgggctcc agaaacaggc acagggtgcc gtccaagcgt aggtacagct cctcggtcat
    34201 cgagcatagc tgccgcaagt aatgggtgcg cgtcccaaag gtcttgtaat cgagcaacgt
    34261 gcacaccacg tattgccccg tggccacggc cagagcgatg cgtttggcgg cgcgactgat
    34321 ctctggcaag tactgtgcct cgtgcaccag acggcggaaa gcgccggcgt tgagccagcg
    34381 aaaatgctgc ggatcgggcg gcaagggcac gcctcgaagc gcggcccaga cagcgaggtc
    34441 cgactcgagc gtcagaccgc ggatgtcgta cttgccgtgc gccgtagcgc aggccgaatg
    34501 gaccagacag ctgcggcgaa tgtacaccat ggcgtgcttg gggtgtttgg gcgccggagt
    34561 tttctttttc tgaccgccgg cggccgccag atcctcgggc gtgcgacaca acaggccggc
    34621 gcgcacagcc tcctgtcgat tacgaatcgg cgtcaggtag gcgcgcagga actggtgaca
    34681 aaactcctca tcatcacgac agtcgtcgag atactcgtac gtggtgagcg gatcgcgaaa
    34741 taggcgctcg tcaccgtcgt catggtcttc tttagcctgc tcctccggct gctgggttgg
    34801 cagtggaggc ggcggctgat ccacggggtt catgactgag aggaagaaga aggtggcggc
    34861 gaagcgacgc ggagcgacgg cggtaaagcc agacagcggc tatatagcta gtcatcacag
    34921 tctcctcctt cacgacgccc ccgtgccgct cacgctatcc agcacgctac ggcccgaaaa
    34981 cacgtactcg ctgacgtcgt acgcgggcga tgtatggctg ctcaccggtt tcgcggcgac
    35041 ggttgcgctc gagtccaacg gcgagaagca aaaacgccgt gggcaacgaa accagaagga
    35101 accctgacgg ataaaaccgc gcagcgtctc ggccaactta accagcatcg taccgtacag
    35161 cagtacgtga atgccgccgt gcgcgtccat aaatacggct ttgttcacgg gttccatcca
    35221 tccgatgact acaaagtggg cctgttctag cacgccgatc acaaaattgt tggcctcgtc
    35281 ggcctcggcc acgttccacg agccgaaagt gaaagtacaa gcgggcgagc cgcccagacg
    35341 gatcttgcta ccggcgtgga gctgacatac gcgcagcaga ttggcgcggt cgtgcagtat
    35401 ctgggagagt tcgtacatgc ccgcgaaggt gtgcttaaac cacgcgccct ctacgatttc
    35461 atccacgtag tcgcgctcaa agaagctata cacggcaaag aggccgttct caaaaaactc
    35521 gccgaacgag agccccagca cgtacacctt gtcctcgccg ggcaggtacg caaaggcgtg
    35581 cccgtgcccg gagacccaga tctcgggcgc cgtgtttgcg tccggcacgc attcgtacac
    35641 actgacgagg ccgataaagt acaagcggcc agcctggcgc aggcacgaga agcgccggta
    35701 ggtcttgtga tcgcgcacca ccccaaagta ctgagtgtcg cccagcatga tgccgtgcag
    35761 cggcggccag cacagcggga gccaacgacc cgccgtggcg cgcacgtagc gctgcaggtg
    35821 aaccccgctc gcacgctcgc gcggcttcgg gcgcttgtgg gtccaggcat cacgcaaacc
    35881 gcgccagatg ctgctgaact tgggctgccc gcgcagatag agcgacgaga gcgagtcaaa
    35941 gtagcccacg acgagcctgt cgggagacac aagagcgcga aaatcaaacc tagagtgacg
    36001 acggtgaaaa aaccgattat aagcgcgtgt ctcaaacacg ctactttcgg ttataaaaac
    36061 accgtcgccc tatttctggg cgcgtgtaca ctgatgactc acctacgctt tttgaacggc
    36121 agtctcagct cgggattggc ctcgtacagc gagctgcggt ccacggggcc gatgctctcg
    36181 tagcgaaagt cgtcgatgag cagcgccagc cccacgcgca cgaagcccct gaggtcgcgc
    36241 gccagccgca ccaacttatc ctgccccacc agcgctgcgt acacggtgcc cgtgtcgccg
    36301 cagagaatcc gcacgcggtg aaagaaggtc ttgtcctcgg cgccctcgat ctcgcccagc
    36361 ggcatgacgg gctcgcgcgt gtacaacgaa cgttgaaagc ggcgcagcat cgaggccgag
    36421 agccccagat cgcgcgccgt gcgcagcacc agggaatgct tctcgggcca gatgagggtc
    36481 agctgcgcct cgcgatgcgc ctctacgtag gcgcagcgag cggcggtgtc ctcgcaagcc
    36541 agcaactcgc ggaaagccag cagcgaacgt aggtagcggc cgcgagcgga ggcgcgcgag
    36601 cggcggcaca gctcggcccg atgatcggga tgcaccaagg gcacgttggg ttgcagacgc
    36661 gcgcagatgg attcgtgcac cgggtcgcag cggatcatgc ccttggcaaa aaatccggcc
    36721 agatccgagg ccaactcgta caggcagtcc tcttgcgcgt cgtaggcgaa cacggcgccg
    36781 tacgcgtcca cgaacacctg gtaccggcag gtggcgtgcg agaccgtgcc aatgagatgc
    36841 agagctcgga attcgccgaa aaagtcgttc tggcagtgct ccagatcgat ctcggtcagc
    36901 gagtgcggcg aatgctcgcc cccgaccacg tagatgcact gcgagggcca gcccagcgac
    36961 acgcacgagc cctcgaagcg ccgcaagtaa cgccgcaggc cctcatagtc gcgtcgcacg
    37021 cacaggtcgg ccaagtcgcg cgtgcaaaag acctcgggta ccaagcagcg tttgcgacgc
    37081 ggccgacgcg cgtgcccggg cagaggagga aggcgcgacg gcggcgacga cgaggaggaa
    37141 gacgccgtgg ccgccgagca gcccttgcga cggccggaca tgccggcagt ccgcgacgat
    37201 ccacaggaga caaaaaagca gaagcagcag tagcctcggc gacccgctcc accccgtcct
    37261 ccacacgctc agccgcgact gaacgccggg gcgcgccgct acttgggttt ttatagccat
    37321 ctgccccccg tctcgggcac ccgggagcga tctacggaga cctgacagca gttgggcaac
    37381 acaagatagg gaaatacaaa gacactttta ataaaaaacg agactacttt gtgtgtgtgc
    37441 tccgtaaact gtttattctc cccctccgct tcgctctgga tgggctccgg gtccgtcaac
    37501 acgcgactcg cgcggcaaaa ggcacgctgt tgacggcgcg agagcccttc gtgatagtcc
    37561 atcatgcccc ggagatcgtg cacaaagcag ctgtcgccgc gcagaaaccg acgcagcgtc
    37621 tccacgtgct gcagctgccg gcgcgtatca ggagccgtca tcgctgatgt cgtcatcgcc
    37681 ctgacaggcg cgtagatggc tccgcgagat catgcgcgtt ttcaaccgcc gtgacacatc
    37741 aggtccatct tgagctggcg ccgggcctcg cgcaggtgtc gcacgcgttg tgagcgggag
    37801 gcgagttcgg cttcttgctc gaactcctgc tgctcactgt ccgagagggt gcgataaaag
    37861 gcggcaaagt cctccaagtc ggctacatgc gccctgggtc tgacgctcca cagcgtacgc
    37921 agtctgatga agcggaccca tcgagcgtca cggcacgccg tcttgaacgc agggcccggg
    37981 aagaggttct tctccccggc gcgctcgggc cggcgaggcc gacgcggttt atatacaccg
    38041 tctcggacag cgggacgccg agcccgcgcc gcggccgctc atccggagac ggcggaaacc
    38101 gcggcgccgg aggaaacggg gaccggcaac gacggcggtg gcggcgacca aattatggga
    38161 gacaagccca cgcttgtgac cctgttgacc gtcgccgtgt cgtcgccgcc accgtcgtcg
    38221 ccgttgccgc tcgtcagctt cacggagctg ctgttaccgc cgccgtccgt cgccgccgct
    38281 gcggtggcgg caacagcgac gagcgaggtg ggcgagaaaa ccgcggagca agaggtagcg
    38341 gctgcgggtc cggagaccgg gaatgagaga agagaaaaca gggaggacga aggaggggag
    38401 acgaggacga cgggcaccac cgcggtcaaa aggtcgcacg acggtatccc tcgccaacta
    38461 gcagagcgcc tgcggctgtg ccgccacatg gaccccgagc aggactatcg tctaccggcg
    38521 caggacgtgg tgacctcgtg gatcgaagcg ctacgcgacg cggaccgcga caactacggt
    38581 cgctgcgtgc gccacgccaa gattcaccgt tcggcctcgc acctgacggc ctacgagtcg
    38641 tacttggtgt ccatcaccga gcagtacaac acggcctcga acgtgacgga gaaagcttcg
    38701 tacgtgcagg gctgcatctt tctctcgttt cccgtcattt acaacaacac gcagggctgc
    38761 ggctacaagt acgactggtc caacgtggtg acgcctaagg cggcgtacgc cgagctcttc
    38821 tttctgctct gctccaccag cgagagctcc gtggtgctgc aaccgctcat caccaagggc
    38881 gggctctgct cgtccatggc ggtttacgac gaggaaacca tgcggcagtc gcaggcgatg
    38941 cagatcggtt ttctgcacac acaactggtc atggtgccct tcgtgccgca cgcctgcccg
    39001 cattacgccg tgcccttcac gacgccggga aagccgggct gcggcggcgc cccgagcggc
    39061 gttgcggggt tagaggagac ggcgcccttt ggacgggtca gcgtcacgcg gcatggcgcg
    39121 acgctgctgt gtcgcgtgga ccatctgacc tggatcagca agcgcgtaac cacgtacgga
    39181 cacaaaaaaa ttacgcgcta ccttgcgcag ttccgcggca cgatggacga cgacgaggcg
    39241 gcgctacccg gcgaggacga ggcgtggatc gcgtccaaaa acgtgcagta cgaattcatg
    39301 ggtctcattt tcaccgtcaa cgtggattca ctatgcgtgg acgcggaaca gcgccaactg
    39361 ctgggcaccg tggccacctc cttttgtcac cgcgtctcgg acaagatcac ggcgcgcaac
    39421 atgccgcgcg ccttttcctt ctacttgcta acgagccctc agcgcgggta cgacctgcga
    39481 tttagccgca acccgtcact cttttttagc ggcgacgcgc tcaactgtcc gcttctcaac
    39541 gagcccaacg tgttttcgct cacggtgcac gcgccttacg atatccactt cggggtgcaa
    39601 ccgcggcaga cggtggagtt ggacttgcgc tacgtgcaga tcacagaccg gtgtttcttg
    39661 gtggccaact tgccacacga ggacgccttt tacacggggc tcagcgtgtg gcgcggcggc
    39721 gagccgctca aagtcacgct gtggacgcgc acgcgttcca tcgtgatccc gcagggcacc
    39781 cccatcgcca cgttgtatca aatcaccgag ggcgacggta acgtgtactc gtacaaccac
    39841 cacacggtgt ttcggcagat gcacgccgcc ggaacaacca cgttctttct gggcgacatg
    39901 caattgcccg cggacaactt tctcacgtct ccccatccct gaccctccgt ccgtcctcct
    39961 ttcccgacac gtcactatcc gatggtttca ttaaaaagta cgtctgcgtg tgtgtttctt
    40021 aactattcct ccgtgttctt aatcttctcg atcttttgga ggatgttctg cacggcgtcc
    40081 gacggcgttt tggcgccccc catgccggca gaacccggtt gcggccccgt accgctcttc
    40141 tggggcgacg ataggtcgaa agccaccgtt ttcatgcccg tcgtgctctt gacgggggaa
    40201 cctacggcgg cggtccccgt cgagcggcgt gattgcaaag ccgcgctcgc ccccggtttc
    40261 aggatggagg gggaggccac aggcggcgca ttcgatacgc tgcttttggc cgtagacgac
    40321 ggtgggtaaa cggtggttac cgcgggatac gtcggcgtgg tcgaggcggc ccggctgctg
    40381 ccggacaggc gacccggcgc gctaccgctc acggggaccg agggcggtcg acctaccacc
    40441 gccttgccgc ccaaagtagg tttcaaggaa ggaacaccga cgcggctgcc ccggcctttc
    40501 accggagacg ggggggcact cttagccggg gacggagagg ctgacgaaag catggacagc
    40561 ggcgatgtgg cgggggacac gacatcatcc tccgtgggcg acaaaacgga cgccgaggct
    40621 gacggctgtc gagccgaaga agcggaagag gttcccgcgc cagaagtcac gttccttgat
    40681 gacgtcgttt tagacgaagc cggttgaggt tgcaacagcg tggcgggtac cgtcgacggc
    40741 gtgcccgaca cctgtttctc tagccttccc tgaaccggcg tcgacgtcac cgtctgcgct
    40801 cgggcggacg cgtgcggcgt cgcgactcgc ttgcccagca ccggtttctg gctcgtggat
    40861 gtcgtcgtca ttggagacga taacttagct ttacgtattc tggacggcgt cgactgctcg
    40921 ggcgtctgac tgggaggcga aatgacgtcg ttgttgtaat cggacgacgg tgttgtgtgt
    40981 cccaggctga cgacggagcc ggtgtccgag gagtcgtcgt cttcctcctc gctgtcttcg
    41041 accggtgact ctgcagtttg gtcccttaaa gcccaaacct catcagcggc gtcccgagac
    41101 gctgtttgtg tcaccgcggc gcgtggagtc gacggcctcc gaggggtggt ggacacggtg
    41161 ttttgagaag ccgtggaagt cgtaggcatc ctgaagggat tgtaagccag gtgaggattc
    41221 ttgagggccc acgcgcgttc gcgcggccag ttggcggggt tcatatcccc gggcaacggc
    41281 gccgtcggag cccagggcga gttaccgttg accggggttt gggtacccgc gaaggtaggt
    41341 gtcggggccg gagcgggggc cgtggaagga ttgacaggcg tcggcgtgag gatggcagcg
    41401 ccggcgccag caggaacgtt aactccggcg ccgaacgtca acgtcggttg ctcgaacttg
    41461 tacgcggtgg tgacgggcgg tttggcgctc gtctcggtat ccgtgatgtc caccagcgtg
    41521 tcggtgaaac gcggatcttg acggttgggg ggatagccat ccgagctgtc ggaatcctcg
    41581 tcgcccgaga aaagatcccc tctggtctcc gtgagcggcc tcacgtccca cgcgctgtcc
    41641 cgacggaccc ttcccgggct ggccttggtc acctgcgggg agacgagact gaaagccgcg
    41701 tgacgctgtt gttgctgcgg gatgttcaag ggaccactgg tcggtttctg actgcccgag
    41761 gataacaggc cgctgaaaat gctggaaaca ccgccaccac tagcggcgcc cttgccgcta
    41821 gttcccggtt tcttgatggg cgtaaagatg tttttctcgt catcatcatc gtcgtcgtcg
    41881 tcctcatcgg cactggagcc aaagagcctc cgggaggcgc tcggtttacg tgccgggggc
    41941 ggtggttgct gctgacgttg ctgcaggttc tgctgcctct cctcccaagc cttcagctgc
    42001 tgtttctcac gctgcaccac ctcgtcgtcc acccgtttct gccgctcgcg acgcttttcc
    42061 tcttcgtcgt aatagccgac ggccgccgaa cgggcagcgt gggcgtcggc ggccggtgcc
    42121 agagaaccat gggcctcgaa gcggaacggt ttgtgtccct tccagggact agcgatccag
    42181 ctccagccgt ccagcggctg cgtggggaca tgtttcttgg gtaccgacga gaaggctgaa
    42241 ccgccgccga gcgagaggag attggcgtca tcatcaaact ccaacgacgg cgagcgcgcg
    42301 cccaaaaagg tgtgcgccga ctgcgggaag ctgtccacgt agatatcaaa gtcctcgatg
    42361 agcagctcca gcagcgtgtc ggccgagtcg ccgttttcca cggcgtgctt gaggatattg
    42421 cgacagtagt tggaatcaaa ggaaaggcac atgcgcagct ccttgaccag cagcttgcag
    42481 cgctcttgaa tgcgcgccag acatttgcgc tccagctcct cccaagacct tcgcacgttc
    42541 atgatgagac ggcccgtgta cacgagcttg ttgacggcgt tgaccagcgc cgtgttggcg
    42601 tgccggtcca ggttaaggtc gagcggtttc acacagaaca tgttacggcg cacaccctcc
    42661 aggttttctt caatgcgctg cacctccgta tctttgaggt gcacaaaggc gatgggttcc
    42721 gtctggccga tggctgtgac cagcgtctcg cgcaccgaca tcttggccag aatgaccgcg
    42781 cttacgagcg cgcgctccac gatctcggca tcgtggcgca cgtccgtatc gaattcggta
    42841 cggtctagca cagccaggtg gtcacgcgcc ttaccacgat caccgaacgg gtaagtgtag
    42901 ccgcgacgcg ccacggccgc gcaacgcacc tcgaactcct cgagcaccga ggagaggtcg
    42961 ggattgtgga aacgcagctc gcggtagtat cccaaccaaa gcatgagctc gttgaacagc
    43021 accgtacgcc ggtgcaggcg tttttcgcca cattttttca ggatcttggg gtgtgcctcg
    43081 agatccacgt cgggcttttg cgtgagatgg cgcagaaagt tgaccagggc caccacatcg
    43141 cgccgctgta gaccgataaa ctgcaaactc atgctggctt ttctccagaa cccggaagcg
    43201 tcgtcgcccc ggactgcgcc cgcggtctgc tattcgccca cgatggacac catcatccac
    43261 aactcggtga gcgccccacc tagagggagg gggggtagtt taatagcgga ggcggatacg
    43321 cggttttctt ttaagcgccg ctgacttgtt tcttctgttt tttcgccccg tgtgctgttc
    43381 cgcccagacc cgcaacaaca ctcctccgca catcaatgac acttgcaaca tgacagggcc
    43441 gctattcgcc attcgaacca ccgaagccgt actcaacaca ttcatcatct tcgtgggcgg
    43501 tccacttaac gccatagtgt tgatcacgca gctgctcacg aatcgcgtgc ttggctattc
    43561 gacgcccacc atttacatga ccaacctcta ctctactaat tttctcacgc ttactgtgct
    43621 accctttatc gtactcagca accagtggct gttgccggcc ggcgtggcct cgtgtaaatt
    43681 tctatcggtg atctactact caagctgcac agtgggcttt gccaccgtag ctctgatcgc
    43741 cgccgatcgt tatcgcgtcc ttcataaacg aacatacgca cgccaatcat accgttcaac
    43801 ctatatgatt ttgctattga catggctcgc tggactaatt ttttccgtgc ccgcagctgt
    43861 ttacaccacg gtggtgatgc atcacgatgc caacgatacc aataatacta atgggcacgc
    43921 cacctgtgta ctgtacttcg tagctgaaga agtgcacaca gtgctgcttt cgtggaaagt
    43981 gctgctgacg ctggtatggg gtgccgcacc cgtgataatg atgacgtggt tctacgcatt
    44041 cttctactca accgtacagc gcacgtcaca gaaacaaagg agtcgtacct taacctttgt
    44101 tagcgtgcta ctcatctcct tcgtggcgct acagactccc tacgtctctc tcatgatctt
    44161 caacagttat gccacaaccg cctggcccat gcagtgtgaa cacctcacac tgcgacgcac
    44221 cattggcacg ctggcgcgtg tggtgcccca tctacactgc ctcattaatc ccatcctgta
    44281 cgcgctgctg ggtcatgatt ttctgcaacg catgcggcag tgtttccgcg gtcagttgct
    44341 ggaccgccgc gctttcctga gatcgcagca gaatcagcga gctacagcgg agacaaatct
    44401 agcggctggc aacaattcac aatcagtggc tacgtcatta gacaccaata gcaaaaactg
    44461 caatcagcac gccaaacgca gcgtgtcttt caattttccc agcggtacgt ggaaaggcgg
    44521 ccagaaaacc gcgtccaacg acacatccac aaaaatcccc catcgactct cacaatcgca
    44581 tcataacctc agcggggtat gagctttcct gttactttat tcagaaagca ccagaacccg
    44641 tcgccatttc ccctcatata cggtacacgt ccccctgatc tgtcatcacg gtacacagat
    44701 ttcgcccgac tgcggacgcc gacggccaat cgcgtggcgt aggagtggcg ccccggcttc
    44761 attataacgc cacgtcggag cccctgcgcg ccacaacgcc gtccggcgca acttctgtct
    44821 cggcacggta cgataaaaac aacgtccccc gtcgacgttg ttttctccga gcggtgatcg
    44881 ttcccgtccc tctcctccct ccgcggcccc cacggcggcg gcctgctcgc acggacctat
    44941 actattaccg ccccaccgcc gtcgtcgtca tgaacttcat catcaccacc cgagacttct
    45001 ccaacgacga ttcagtcctg cgagccgccg agatgcgtga caacgtggca ggctcgattt
    45061 ccaaagcgta caagggcacg gtacgcgccg aaggcaagaa gaagctgctg ctgaagcact
    45121 tgcccgtgcc gcccggcggc tgctcgcgcc gcaacagcaa cctcttcgtt ttctgcaccg
    45181 agcgcgacta ccgcaagttc caccagggca tcgcacagct caagcgcgcg ccggccgaac
    45241 tggaccccca cgagatccag caagtcacgg ccagtatccg ctgccgcctg cagcccagtc
    45301 tccgcgagcc gcccacgccg gccgacgagc tgcagacggc tgtgtcgcgc gtgtgcgcgc
    45361 tcttcaacca gctggttttc acggcccagc tgcgccacta ctgcgagcac caggacaagg
    45421 tggtgagcta cgcgcgcgac gagctgacta aacgctgcgg cgaaaaatcg gcgctgggcg
    45481 tggaagtgca tcaactggta gccctgctgc cacacgagcg ccaccgcgaa ctgtgccacg
    45541 tcctcatcgg cttgttgcac cagacgccgc acatgtgggc gcgctccatc cgtctcatcg
    45601 gacacctgcg ccactacctg cagaacagct tcctacacct gttgatgaac tcaggtttgg
    45661 atatcgcaca agttttcgac ggctgttacc acagtgaggc ctaccgcatg ctcttccaga
    45721 tcggtcatac ggactcggtg tcggcggccc tggaactctc acacagcgca gcggccgggc
    45781 cgcccgaggc cgatgagaac aacgacgagg gagaggagga cgacgacgag ctccgtcaca
    45841 gcgacccagc gccgcttcac gagtccaaga agccccgcaa cgcccgccgt ccccgcacac
    45901 gcatgccgcc tcacgagcaa aagcccgaag aaaacgagga ggaagaagag gagctgtttc
    45961 cctcctgcaa ggcaaccgca gcattcctgc gagcagaacc ctccgtctcc aacgacgacg
    46021 gcaacggcgg cgaacgctgc gacacgctag cgaccgccct gcggcattgc gccgacgaag
    46081 aagacggacc tctagtcagc cagaccgctg tgcgggtcgc cgcgaccccc tcaccttcag
    46141 tcaccccagc ccttaccccc gtcacgtccc ccataacccc gttgtgtatt taacgtcact
    46201 ggagaacaat aaagcgttga tttctcaagt tccgctctgg ttttggtttc gttttcaaag
    46261 ggagccccat catggcccaa ggatcgcgag ccccatcggg cccgccactg cccgttctcc
    46321 ccgtggacga ctggctcaac tttcgggttg acctgtttgg ggacgagcac cggcgcctgc
    46381 tgctcgaaat gttgacccag ggctgctcca actttgtggg gctgctcaac tttggcgtgc
    46441 ccagccccgt atacgcgctg gaggccctgg tggacttcca ggtgcgcaac gcttttatga
    46501 aggtaaagcc cgtggcccag gagattatcc gtatctgcat cctcgctaac cactaccgca
    46561 acagtcgcga cgtgttgcgg gacctgcgca cgcagctcga cgtgctgtac tcggagccgc
    46621 ttaagacacg gctgcttaga gggctcatcc ggctctgccg cgctgcgcaa accggcgtca
    46681 agcccgagga catcagcgtg cacctgggcg ccgacgatgt gacattcggc gtgctaaaac
    46741 gagcgctggt ccggctgcac cgggtacgcg acgcgctggg gctgcgcgcg tctcccgagg
    46801 ccgaggcgca ctatccgcgc ctcaccacct acaacctgct gttccaccca ccgcccttca
    46861 ccacggtcga ggcggtggat ctgtgcgccg agaacctgtc cgacgtaaca caacgtcgca
    46921 accgaccgtt acgctgcctc acctccatca aacgcccggg ctcacgcact ctggaggacg
    46981 cgctaaacga tatgtatctg ttgttgacgc tgcgacactt gcagctgcga cacgcgctgg
    47041 agctacaaat gatgcaggac tgggtggtgg aacgctgcaa ccggctttgc gacgcgcttt
    47101 acttttgtta cacgcaagcc cccgagacgc ggcagacttt cgtcacgctg gtgcgtgggt
    47161 tagaacttgc gcggcaacac agcagtccgg ccttccagcc gatgctgtac aatctgttgc
    47221 agctactgac gcaactgcac gaggccaacg tgtacctctg cccgggatat ttacatttca
    47281 gcgcgtacaa gctgctgaaa aagatccaat cggtctcgga cgcccgcgag cgcggcgagt
    47341 tcggggacga ggacgaagag caggagaacg acggcgagcc gcgcgaggct cagctcgatc
    47401 tcgaagccga tcccacggcg cgcgagggcg agctcttttt cttctccaag aacctgtacg
    47461 gcaacggtga ggttttccgc gtgccagaac agcccagccg ctacctgcgc cgacgtatgt
    47521 tcgtggaacg gcccgaaacc ctgcagatct tctataactt ccacgaaggc aagatcacca
    47581 ccgagacgta tcacctccag cgcatctata gcatgatgat cgagggcgcc tctcggcaga
    47641 cgggcctgac acccaagcgc ttcatggaac tcctcgacag agcgcctctg ggccaggagt
    47701 cggaacccga gatcacagaa catcgcgatt tatttgccga tgtttttcgc cgtcctgtga
    47761 ccgacgcagc ttcttcgtcg tccgcgtctt cgtcgtcgtc ctcagcatct ccgaattctg
    47821 tttcgctgcc gtccgccagg tcgtcatcca cacgaaccac cacgcccgcg tccacgtaca
    47881 cctcggccgg gacttcttct accacgggtc tcttactctc ctcttcttcc ttgtcggggt
    47941 cacacggcat tagctccgcg gacctggagc agccgccccg gcaacgacgc cgcatggtca
    48001 gcgtgaccct cttttcgccc tactcggtag cctacagcca ccaccgacgt caccgaaggc
    48061 gacgcagccc accacccgca ccccgagggc cagcccacac acgcttccag ggacccgaca
    48121 gcatgccgag cactagctac ggcagcgacg tcgaagaccc gcgggacgat ctggccgaaa
    48181 acctacggaa tctctgaacg cggtttttcc tctttttcta cgtgtttgtc tcaggtcgag
    48241 acgtcgatat caataaaaat accgtcgacg tggttttcta acagtgtggt tttctttatt
    48301 gaccagcgga gtacacagtt tacgagtaaa aaagacaggg aaaggttata taaaatgctg
    48361 tgttatatac aaaaacatgc acatagacag acagaaccac cgtgctcgtc gtcccctcct
    48421 taatcagttg ttcatgtagg cgtgtggcgg ggtgaggggc ggcatgccgt tggcggcgcc
    48481 gggaataatg tgccgtcgac cgacgtcgca caccttgaaa cgccgtcggc gcacgcagcg
    48541 gtcgcaggac gggatatccc agaggaagcc catataggtc tcggggtcct cgtcgtgaaa
    48601 gcggtaggag agttcaaagt ggtgcaacga gcccgtccga gctcgcagct tctggcgaac
    48661 accctccacg tcatcggtgc acagcgacag tgctgggctg tcacacaggg cctgaagctc
    48721 ctgcggccac aggtgcgtgg ccaggggcga gtccgtcgtc accagtttga cgcagtgcat
    48781 caggttctcg gtgatggcgt cgtacaggcg actctcggcc tcctcgtgcg tcatcacgtt
    48841 tcgaggcagc gacagctcgt cgtcgtcatc ctcgtcaaac atgatcatgg ggtcaggggt
    48901 ttttttggga tgttgacagg tgggtgtctt ttccagacgc acgatggcct cacgccggcc
    48961 gctgaaacgg tggtttcggt gtcccttctt tcccatgacg caggtgaaca taaccacgtc
    49021 ctcggccaga cggtagacgg cgtccatggc ggggtcgtag ccgtagacga cgccgaaagt
    49081 gtccaccaag acgtactggc gtacgaggaa ctctttgcgt tctggcacct cgtggcccag
    49141 cgcgcccaac aactggtggt aacaggtgat gcgcggcacg gtacggatca tgagctccat
    49201 ggtctggatg ctgccgcccg cgcggacgac gctgaaggat gtttccttga acttcataac
    49261 ctctgtgttg tgggtccaga aggcgaaatg ggtgtcggga cactcatcga aagggtcgtc
    49321 gatggtgtag gaagcgtagc cccgcttggt cacctcagcc gacaggctct ccacgtcacc
    49381 gcggtagagc atgacggcgt tccagtagtc gtcgtactgc accatgggcc gctggtagtc
    49441 gcgcatagtg tggaagtggt cgcagtgacg aaagccatgc cgcagaaagt ccttcatggt
    49501 gggtgccagc tcgtagacgc agtcgcgcag gtcatcgtag cagtagatgc cgccgcgctg
    49561 cccgatgagc acgatgagtt ggtagcgcat aaagcccgga ccctcgacga agccaaaggg
    49621 atgcagatac tcctgacagc agacgtaagc acctggtgga gaaataagaa aaatccacgc
    49681 acgttgaaaa cacctggaaa gaacgtgccc gagcgaacgt cctctttcca ggtgtcttca
    49741 acgacgtggg gcttaccttg cgaacagacg gtgcccatct tgcccacgaa gggccccagg
    49801 gcgctgcgcg aacggagctg gatgaagcag cgttcgggcc aggccacgtg cagccgggtg
    49861 ccgcattcct gctccagaaa gtcgttgaga ccgttaaagt ccccggctcg aatggcgatg
    49921 cagccgtagg ccatcagcgt gtcccgtagg tcgtccatga cggactcctc taccttcgct
    49981 cgccgacgct gcgcttctcc agccaccgct gcggtcgaca gactcctccg tccgccttcg
    50041 gagaactacg gcgcggcggc acggccttta tagacactat cagcgttgac gtcagacgat
    50101 ccgatgaacg tcgttttttg tgctggaact cccctcgtcc cgacaaatgt agcggaaatc
    50161 ttcaagcaaa tcgcgacgaa gtccgatgag gaggatgcaa aagaggctga gcaacgcgat
    50221 gctgcccgcc gctacagtac atatgctcaa caacgcccag tgtcccaacg cgcgactttt
    50281 ggcccggagc agagccgaac ggcggtttct ccacatcatg gatagcgtga tccaatactt
    50341 ccatccttcg cattgcggtg tccacatggg aagcgacgtc acattagttc ccgtaaatgt
    50401 tgcgtttctt gttttctttt ttgtaagctt aagggttctt ctaagaaacc gcgggcacat
    50461 gtcttgtaga aagatgtaat cactttccgc gtatttcgcc agtgttaaca tcacagtggt
    50521 agtgttttcc aaagaagtta cgttactagt gatgttacta gtagcgttgg tttcttccca
    50581 atgtacgtgt gattcgaacg gactcgtatg tgctaccgct cgcaacacgt aactgtggcc
    50641 ggtgaagttg agcatcaatt gtcccacggt tatgtttgtg tcatttttaa agcacgcgac
    50701 ttctccgtga acttccgtga cgttggtctc gtggctctcg ttcaacacac gcaagggaaa
    50761 ccagccttcc agatgatact gaaaaccaaa tttaagcatg acgctgtgcc attgccgtcg
    50821 tgattggtta aacgttacgt tcaagggtag tctggcttcg gtcccgacac aggggccgtt
    50881 gtagatttgc gtattattgc acgtgcagtt taactgacag ttcatactcg tagtgttgga
    50941 agtgatgtta atgtccgtgc cgtggtacgt acagcggacc gaaacaccgt ttcccgtgct
    51001 ccaaagcagc gtcaacaaca gccacacaga cacctacgtg gggacgacac gggacttttt
    51061 attgacggag actcatgttt acaccctccc ctttcccata ggtaaaaacc cacgtttata
    51121 acacacgttg tttttacctg aaacccgcgc agcccgtgga cgcgacaaaa acccgcggca
    51181 ctagaaagaa aatgaaacaa gtatgtttat taagcagcat gtggggctaa taggggggat
    51241 aactgaggta tagcaactat gaaaaaatac tacaaaaaaa aagctgaaca tggtcatcta
    51301 gcagcaaagt tctccttcta gaccacgacc accatctgta ccacgtcgcc ctccccggcc
    51361 gtgtacatca catccttcac cacgaccggc ggcaacggcg gcgacgagga caactcgctc
    51421 tcgacggagg ccgggacgac agaggacggg ggggtggtgg cggcggagga cggaggggtg
    51481 gcggcggcag cggggtcttc ttccgacacg ggcgacggca ggctcggcgg cgcggacagc
    51541 acccgttgcg ccggggcgtg agaaggctga gccccggtgg cctggatgtg ggccaacgaa
    51601 ttggctcgca gcgagtcgcg atccacgaag gtcataggaa ttttcccttc gcggatccgc
    51661 cgctcagatt ccaggatggc gcgcacgtag ctgttcaccg atttggcaaa agtgcgcggt
    51721 ccctccgtat tcttgtcgcg acgcgcttcc agcacctgct tttcgtagtc cagctggtgg
    51781 aagaccatca ccaggtcgtc catagtgtgc gcgtgctgac ggacgtggga acgcacctcc
    51841 accgggaaca aagcgttcca atactccagc acgatggcac cgtgccagaa ctgcgccatg
    51901 ctgggcgcca ggaaaaacag gataccggag tcgtaggcga acacgtccca cttgggtgtc
    51961 atgaacaaca ccagctgacg cgtgggccgc accgaagctt cctcccaggc ctcgatgacc
    52021 ccgaacatga tgagctcctg gtccaacggg gggcagtgtc gctccagcca actgatcttg
    52081 ctcaggttca tctgcagaaa ctcgtacgaa gggtcgcaga tgcacacgta gagacccgag
    52141 tcgtgccgca gcctggctcc gcgcttcatc agtttcctca ccgcgtagcg aagcgccacc
    52201 ttgcccaacg ccgacgcctg gatcagtccc cccacgtcca tctgcgtctg tcgccactcg
    52261 gcctcgtcca gcaggctcat gatagcggca gtgctatgcg tagtcgtagt catcctttct
    52321 atccttctct atgaatagca gcaatagcgg taaagtccct tcttatacta tcccggagtc
    52381 tgtggttttt ttgtttaccc ctgcttactg gtgaaactgc tgggggccgt tgtgctgcag
    52441 catccgagct cgttgccgcc gttgccacag gaaccggtgc ctccgcaggg cctttttgag
    52501 ggcctcgcag gcttctcgcg caagtcctga gaggccctcg gcgtcgatgg ggttcacctc
    52561 gggcgtccga gcctcgtttt cttcttcttc atcctccctt tcctcctccg tgtcctcccg
    52621 ctctgtgtcc tccgttacgc tctcctcccc ggcctcggcc aagagcgcgg ccaccaggtc
    52681 cacggaccgc tcggtctccg agttctcacc gtcaattacg ccatgttggc ggcgtaaccg
    52741 gtgccgagaa cgccgggtga gcgcacatgc ttttttcttt cttaaccaag gcgggagagg
    52801 atcttcaagg cgttttcgct ggatccagcg gtagctaaag taccaaaagg ccagcaggcc
    52861 cacgctacct aacagattca cgtagactgg agacataatt aaagaaagaa gtgaaacccg
    52921 cgtgtgggtc tcacgtcgtc ttgaaacacc gtcttatata catgaagatg ccggacatga
    52981 cgcgcccaag acacgtgggg ttttcccctt aggcgacccg gtttcttaag atgtttttca
    53041 tcttcgcacg cgatgtacta catcaaaggg tcggctgacc gaccgcattg acgcacagtt
    53101 tccgagtacg cgcgtctcgg agcacctgac ggtgagccac ccagctcacg cggatagggg
    53161 acaacactga cgtgaggggc gattcacgtc actgacggct gacgggaata agacgggtga
    53221 aggatttcca cctttttctt aagtgtgact ctccttacgg taaatcgcac ctgtgacctc
    53281 ttaacccctc ctccctggta cccgataaca gtgaaaaaca cacaccacac gtcacgacac
    53341 cgatcgattt tctttattct tagtgtgatg ataggtaagg gcactcgtga ggatgtgcag
    53401 ttatcattat caagccttct tcaaggcgta gtgatgatcg ttgggcagaa cccccaggct
    53461 cctagcgatc tgggaataga aggaggagaa cgaccccaag gccagaatgc ccacagtgta
    53521 catggcccag gtctccagac cgaacgtggc gggtcgcagc ttcagatggt aggccacccg
    53581 ctccgagagt tgtgaatgct cgttcaggca acaggactgc aggtgggtga gcccaaaagc
    53641 gctttcgttt acgccgcgca cgtgcaccgt ctgggccggg caatcctggt gttgcgcgcg
    53701 aaaatggtcc aggcaggaga ctccatctgc gcggcgatgt gtgttgttac ccacttcaat
    53761 caacagcgtg ttaacggcaa gatgacgcga gaacgcgacg gcggtgttgt tggaggtctg
    53821 gcggcaacag tacacgtcga gcgtcatgag ggccatgtcg ccttggtggt acacggcgta
    53881 cgcccaaccc tggaacacga gcggacataa cggaccgtga gcggacgtca cggcggcggt
    53941 tgttaccgtc gtctcggcag gagaacacaa taaactcctg atcctcatac acaggagtcc
    54001 aaccgtcaga agtaaagtcc gcggagccat aaccgcgcaa gtgaagccga tacgagtgtt
    54061 gctgaatttg ttcgttctgc cgactgttgc tcacgagcgt tcggaggcgg tgccacaggc
    54121 tgttggccat taaaaagtcc tggcccgaat gacgacgaga cagagcccga ggcgaggaaa
    54181 aaggcgcccg tcatgaagac gtaggcaggg gaattcccat atttttatgg cttcttttaa
    54241 aagtctgtat ccgactccat ccggcgcttt tcccaaaccg tggtctcctc gtcgtccgac
    54301 tcggtaccca ggaggtggta agtcttttgc cgcacgtaga aagctttcaa cgtggagcaa
    54361 aagatgagaa taaagacccc gaaaacgaaa caaaccacgc cgatcatgcc gatgcagacg
    54421 ttcatgtcga cgtagccggc ggtgctattg gcggtgcggc aaaagagtgt catgtcgtgc
    54481 gtgcacaaaa aacaacacac accacaggcc aggtcgtagc gtagttatta ttccgtagca
    54541 gcaatgatgg tacagtcaag cacatgctct atccccgtta ccctatgttg attgtctccc
    54601 cgttgttgta ttggaactgt cccggttaat caccacggtg aacaccacgg ccaagaaaat
    54661 gatccctaat atagcgacca ctaagagagc aaaagtccat ttccagccgt tgtcaaagta
    54721 cgcccccgtg gtgggatgca tggtggcggg catttccatc atatccatgt cgaacgtgtg
    54781 tcgcggcgac ggcgaactaa ccaggcagta cgggggtcga tagggcggtg ggctgcagtc
    54841 gggtggcggc ggtggtggcg tggaaaccgt cgtcgggcac agacccatgg cctgctcgta
    54901 ggtggggggc gcgtcgtcgt gatcccggtc gcgcagcatc ggcgtgggct ccatgtcggt
    54961 ggcagtgacg gcgacggtgg taactgtggt ggagacgata ccgacggcgt ccgcggatca
    55021 ccttcgagca aagagcccct tctttttgcg caaacgacgg caaaacagtt ctctgggaca
    55081 gccggtggcg cggtaagcgg gtgccacgct ttcagggtgg gtaaaacagt cgcgggcgaa
    55141 gcagtagttg ttgcagaacc gcaagaaccc gacgcgaaag aagcccagga gtccgcgcgc
    55201 cagaaagtgc gcctgccgcg tctcgggatg cacgccgaag acggcgccgc tctcgttcac
    55261 caatatggag atgtccaggc gctgctgcga ctccaccggc acggcccgca ccacaaatac
    55321 ctgcagcacg ttcagcgagc acgtctcttt taaccagttg ccgtgggccg gatcctcgta
    55381 agtctggctc ccgttcaaga cgaccgtcgt cagcgcctca ttaccgtctc gccagctgaa
    55441 gatggaaccc tcgcgcttca tgcacaggcg ccacagggcc agcaggtcgc gcgccaacat
    55501 gaactcgcga cccacgtcgc cgccggtctc gaagcggaca tagcccagtt cttcgcgcag
    55561 cggcgcgtag ttgcgcaggc cctcctgcac gaagccgcgg aaaccggacc gcgacaccag
    55621 gtacagcgat tccaccacag gcgagtagac gtagacgcga ccgccctcgc cgatgagtac
    55681 gggtagcggt gggcggccga tggcttcgca acgactcaca gtgcccaccg gcagcaagaa
    55741 cttgtcgcag cacaggaagg tcttctccaa acctttaata ttgagatgtc caaagtagcc
    55801 gacgcgtaac aggtcgcagt aggtgaagaa ccaaccgttt ggccagctga gacgcagcac
    55861 cgtgccgctg acgcgacgaa ccagcttctg caagtccttg cgggcgtcgg aggtgacaga
    55921 gcagcggaag gtctcgttga ccagctcgac agccagcgcg tcctccagcg tgcgttcctt
    55981 catctcgtcg ttgatgctct ggcggcgccg ccggatttcg tcgaaacggg ccgcggaggc
    56041 ggcgaccgac gcggaggtcg tccgaacgcc ctctgtgacg ctgtcgtccg gccagtcaag
    56101 aaagctaagg ctggcgctgc gccgcctaaa gtgtccgatc cgcgcgggac gtcgctgagg
    56161 gacggtggct ggtctgctgg ggcgggtacg gccgcgggtg tccgcggaca cgttagttat
    56221 acacggaatt gagtcacgtg gcacgttgcc agctgaaacc gccgtcgtct ccgccggcgt
    56281 tttctccatc gcgggaccgc gccgtgcgcg cgttcccagg cacgcggccc acgctctagc
    56341 cgcacttttg cttcttggtg ttagggacga actcgaacgt tacagaatcc tcgctgtcgc
    56401 tctcctcttt cgcgtcgttg aagtaattgc cggagttgcg atccaaaccg ccgcctcctc
    56461 ctccgccgcc gccgcccgat ccacctttgg acgtcaggta gctggtgatc ttgtgctgct
    56521 cgtatttttc cttggaggaa agaccgtggt cgtgatcacc gccgccgcca ccgctgctca
    56581 ttttccgcgt accggaacca ccgccgccac cgcggtcgtg cttcttgccg ccaccgccgc
    56641 cacctcctcc cagaccgccg agacccatgg gctcgttcat gagatcgtta tccagacccg
    56701 ggccgtcgtc gtgcagaccg cctgcattgg ccagcgaaga gaggctgccg ccaccaccgc
    56761 cgccgccacg cgatttgccg ctgttaccga cgtaattttt gtcgaaggga tcgccacgct
    56821 ggaaaggttc ctcagtgaga aaattctcca cggcgaacag accgttgcgg ctggccacgt
    56881 acaacagcgt gtcgtgctcc gtaactatac gcaacgtgca cggcagtttg gtgacggcgc
    56941 aattgagcag cgtctggtag aagttcttca gctgcacgtt gatacgcatg tttttcacgc
    57001 cgtggaaact gacgcggtta ttagccgtga attccagctc gctgccgttg gtcaggatga
    57061 acttgatggc cggcggaccg gcgtgcacca aaatctgcac ggtgcccgta gggcagggcg
    57121 cttttttaac gttacgcttg acgcgggtat gcggcccgat ccacttaagc aggtcggcca
    57181 ccacgccgaa atctagatcc acgtgcacgg ccgaattctc gctttcgcgc acaatgtctt
    57241 ggccgtgcac gcaggccgag ctgaactcca tattgaaatc gggcgcgcac atggagatct
    57301 tggccgaaag gtccgagatg tcctgcacgt agaacttggt caggtccttg ctggaagtca
    57361 ggtacatgaa attaccgagc agcggcgtgg aattgttaat ggtcttgggc tgaaacgact
    57421 tgtcagtgat gtagaggcat gagctgttaa aagtgatttt tgacacgcag tgactgcgta
    57481 ccgtttgcaa gataagtgac ggcgtgggca agaaggtaac cgtggtgttc tccttgagcg
    57541 cacggatcac agatcgcagc tgctggatag ccgtcttgta cggcttcagc cgcagcgcca
    57601 gcgtcggcgg ctccgagagg cgcgtcttgc gatccatccc ggacagcgtg caagtctcga
    57661 ctaaggagcg ggcgcgagcg agcgaaagtt ttatagagag cacacacgac gaccgggaac
    57721 gctgcgaaga cgcccggcgt ctaataatac agccgcgccg agccagcggg cccccgacta
    57781 agaggcacag tacttatata ctccgacctt aaagcgccag tggtaccact tgagcatcct
    57841 ggccagaagc acgtcgggcg tcatccccga gtcatagtag aaaaccaggg ccacgcactg
    57901 gtccacaaac acgctcaggt tcacggccgc catttccacg tcgttttgga tcgccggcgc
    57961 cgcctggaac agacactgcg tcgccttgcc ctcctcctgg tgctgctcca accacgcgta
    58021 attcaccacg ggcacgcgca gcggcctccg caccacggtg gggaagtaac actcacggtt
    58081 gggcgggcac aatgaccaca ccgtctcctc ctcgaacacg gtgccgcgcg aagcccatac
    58141 tgacggcgtc acgccccaca gatgcgccac ctcgtcgtcg ggacccaccg ccagaaactg
    58201 acagttgcgc aatccgaact cgagcatgtc ggcgcgcagc gcttcccagc gcgcgctggc
    58261 gatggagagc cgcggcaacc gatacaattc gaaaatgaat ttgccctctt gatagatggt
    58321 gcgttcgaac cattcgcagc gtggcaaacc cgacttgcac aaatcgacgc tagcgcgcac
    58381 cgcggcaaag tacatgtgct caaagatgcg ctcgatcaag tcccaagagg caaagtacgt
    58441 aaaccctaac cgcataagcg ccgtgtgcag gccagccacg ccgatgtgca gcggacgcag
    58501 tttttccagc gcgctctcta cccaccattc ggacgccgac attagcgcat ccaagcgcgc
    58561 gttgccccaa accaccgcct cggtcaccaa ctcgcgcagc acgctcaaat caaagtaacg
    58621 tcgcgtgttc cccaaaacca cgtcgggtag atgcagcttc tgctcgtcgc tacgcgcaaa
    58681 cacgcagcga gccacgttca ccgtcagccg ctgcaccggc atgtcacact cgccaaagtg
    58741 gcacgacgcc atatcgggac tcaagcacgg cggcaggcac acgctgtcgg ccataatcga
    58801 gtacttgact acgtgatgga caaagaccac cgaggcacgg cccttgagcg cgcacagcaa
    58861 catctttttc agaaaatcgt ccgtgttcac gaccaccttg gggcacgatt gctcgcagcg
    58921 cgaatactct ttctcgaaag ccgactcctg acccaggtcc gagagccgcc gggagacagg
    58981 ccgcccgaac agcgagtagc gctgctcacg cgcacggtag cgcttcatta acacgctagg
    59041 cacgttgaaa gcgtagcaaa cccccgtcaa ctccgacgtg ctttctttga gaataaagtt
    59101 gatcacgcgg atagcggcca cgtcccacat gtccacaaac acacgtacca cgggtcgatg
    59161 cacctctttc tcgcgtatca aatcgcagta tccccccagg caacgaatca cgctgttcac
    59221 atcggcgtta agtcgcgtta cgttcaccga cacagaaacg ccgcaactca aggtgctcat
    59281 ccatttgcac atagccgccc aactggcgtc acgcgaaaaa gggtcggccg agatcagaaa
    59341 gtcgtactgc ggcacgcgat cgaaacccac ggtagacatg gtgaaggtgg acagcgacag
    59401 ctgcccatcg cgacagcgct tcaacaccga ttccaacacc tcgccctcga aacgcgcatc
    59461 cagatggaaa cgatagatgc gcgagtgcct actgttctcg atagccgccg tcaacgccac
    59521 ggcgatgcgc aaaaacacgc cgcccggact ctcgtcctgt ccgtgcagtt ggcgacacac
    59581 cttatccaaa cacaaaatgg ccgcgtacaa gccccagcaa ccggccaatt ccacaaaacg
    59641 cgccgtctct tcggccagct tgggtagatc ctccatgtga cgcagcacaa aacggcgcac
    59701 cgactcatcg cacagctccg aagcgtaaca cagtggcgtg cggctttcgc gcgcccagtt
    59761 ggctttgaaa taaaagcgac ccaacagcag atcgcaacgc ggcgagtgac gaatcagaca
    59821 gggaccgtgg cgcatgatga gctgaaacag cctgaaactg cccaaaccgg cactgtgtcg
    59881 cgacacggtg tccatctcgc gccacaacgc gttcctgtca gacggcagct cccgcgccgg
    59941 ctcctgtacg ccacaaaagc gaaacttgcc ccaatagccg tgacaatgac actttttgcc
    60001 catcaacatg cgcgtagcct gtatcggcgg cgacactttg cagagcgaag ccccgaaatc
    60061 gtcctcctcc tcgacactgt ccagctccat cctggtcgcg ccggtcggat tgaaggtgct
    60121 cagaccgcta ctcacgcgtc caccacgact gggcacggcg ggaccgctat cacgcgtcaa
    60181 cgacagcaca gacggcgtgc cgtcgggaga cggcgactcg ggacgccaac tgacgacgcc
    60241 gccaccactc gtaaaacccg ctacacacgc tacgccgctc gacacgttgg tattttcagc
    60301 ggacgcttcc ttgtcacccc cgggaagcgg cccttcctcg agctcgctgt catctccccc
    60361 ggtagtatca gcgacggcct ctgccgacga ttcctccgtc tcggtttccg cgccgcggct
    60421 cggaatccta cctggccggc accgatacac gggcaccgag gacacccgct gttcctcgtc
    60481 cgcgtcagcc ggagtcataa gtttacgagg aaaagaacaa ataaatcagg tagatttcaa
    60541 taaagtgagt ctatatggca ccgataacta cggtttataa agtctgtgtg cgctgtgttt
    60601 attttttctt ctgtgtctcc tcctcgtatg ctgtcagcgc cgctcagacg aattctcgaa
    60661 agtctcccaa ttcgacgcta aagttgtcca aacggacgac ggacagtttg agttctttgt
    60721 gtaccaggaa cgaggtgtga atgtcgtcag ccaggcacca gcccagcttt tgtatgaccc
    60781 cggtacacag aggaatctgg cgtgggcgcg tgatgcgacg gttgacaaag ctacagcgct
    60841 cgcgggcgaa ctttccgcgt gcaacgtcga ccagggtctg ccaatgtgcg atgctggagg
    60901 tgagcacgta gatgccggga cgtgtttcgg gcccgtcata gtcatagacg atgattaaat
    60961 acacgtattg cagccgtccc cgggtctctt cccacgtcag gtacatgtct ttcggtatca
    61021 tcaacgcgaa cacctccgtt ttgagcgtgt tgtaaaggta gccgcgcatg acgcaggtga
    61081 gcaacgaggt gatgcccagc gagacggtct tgacgcagcc cagcgtctcg aggcggcggt
    61141 gcagcagatg cgggcccagg tccagccact gcagcgcggc gcgcgcggcc gaggccgtgt
    61201 acacgctttc gagcaggcag cgcgtgctgg ccgagacgtt ggaggcgcga atgcctaaca
    61261 ggtagaggct aatgtagagg tgtcgcggcg agtcgcaacc cgtctccatg cggatgagca
    61321 gcgcgcccgg ctgcgcctcg aactctacca ggccctcggg cacgaagaaa cgcgccgtga
    61381 gcgcctggtg atcggcgtgg tagaggtagc gcaccgatat agtatttacc tcgcgtttgg
    61441 ctttgagcgc cgtcactagt tcattgtcct cgtcggccgg gtcgcgcggc cgtttggcca
    61501 ccgcgcgcgc gtccatgatg gcaaggcgca cggtagattt caaaaagttg atagagcagc
    61561 tgcgggcacg ggccacggac aaagcggagg cgttaaatac cgtgagccaa ttggagatcg
    61621 gcgcggtgga tgcccaggac gtgaccgcga gcgccgtgcg cgccttcgtg ggtgcgttgc
    61681 cgagctcggg ttaccacttt ggcttcgtgc gtcagaacgt ggtcttttac ctcctaagcc
    61741 acgccacggt acagacggcg cgcgacccgc tgtacgccgc cgagcagttg cacgaacagc
    61801 tggaccgctt cctgcgacac cagcacgacg gcggcggaga cgaggaccgg ttgccgttct
    61861 accacaacgg ggccacgctg acggctttcc agaagctgtt gcagaccctg cgcgagatcc
    61921 agaccgtaat agccgaacag agcggcggca ccgcggcggc ggcggacttg atcgccagta
    61981 acaacgcgtc gaccgagcgc cgcggcaaga agggcggttc gagttccggg ggccagcagc
    62041 cgctggttcg ccgggtgatc acgcagctgg aaacggctgc cacggaggcg cggccctacg
    62101 tcaattgtcg cgccgtggcc gaactcctgg acctgaccta ccagcggctc atctactggg
    62161 cctgcacgct catgccctac gtgttgtttc ggcgcgacac cgacaccgaa ctggacacgg
    62221 tgcttctgat gcattttttt tacacacact accgttcggt taacggcgat ttggccgtgg
    62281 agtttcaaaa ctacgtcaag aacagcgtgc ggcacatgag ctctttcgtc agttccgata
    62341 tcgacggcga ccagaagccc ggtgccgaac acatgcgtga cgtcagctac aagctgttcg
    62401 tgggtaatct gcaggcgcgt gacgccagcg gcctcatgtt tcccatcatt agcacgcgca
    62461 tctccaccgt gaacctttac ctgtcgcccg aacgtatgtt tttccacccg ggtctgatct
    62521 cgcgtctgtt gagtgaggaa gtttcgccgc gcgccaacct agacgcttac gcgcgcgtgt
    62581 gcgatcgcgt gctggaagac cacttgcata cgccgcgacg cgtgcagcgg ctactggatc
    62641 tgacgcagat ggtaacgcta ctggtggaac tgggtttcaa tcacgatacc tgcgcggcct
    62701 acgcacaaat ggcgctgatc cagccggcca gtcagaagag ctcgctcttt gtcagcgaga
    62761 ttcgcgagaa actcatacag atcatctaca atttttacac gtttttcatg tgcctctatg
    62821 tgtacagccc cacgttcctg ttcgaccacc ggcggcggtt gattttggag cagcatcgat
    62881 ccacgttgat cggctccaag gaggaactac agcacgtctg gagcaacgtg acactgaacg
    62941 tcaatacgca ctttgcggtt cagtacacgg aagaagactt tgaggcacat acgaagggtg
    63001 ccacggaggc agagcgcgag tacctgtatc gggacctgca cagcaagtgg ggcgtgcacc
    63061 tgtttacctt gcgtccgtct cgcggcgcgg ccggcgcggc ctcgcctttg cctccgcttg
    63121 acggcgtcac acgctccgac atcttacgcg aatgcgcgct cgttaatctg aacgaaggcc
    63181 gcgtcaacta cgcctccctg ctagccttca gccatcatcc cgagttcccc agcatcttcg
    63241 cgcagttggt ggtggtaact gaattttcgg agatctttgg tatcccgcag ggcctgtttc
    63301 aagccgtggg ttcgccgcgt cttttcgcgc tcattcagct gtgtcgtgta ttgttgcccg
    63361 agcaggtgac gctgtaccag aacctggtct ccatttacaa cctgaccacc tttgtcaagc
    63421 acatcgacgc cgcggttttt aagacggtac gcgattgcgt cttcgacatc gccacgaccc
    63481 tcgagcacct cagcggtgta cccgtcacgc ccaatgtgga cctgctggcc gagctcatgg
    63541 cgcgctccgt agcgcataac ctgtacacca ccgtcaatcc gctgatcgag gacgtgatgc
    63601 gcagcagcgc cggcagtctg agaaactatc tgcgacacac gcgactctgt ttcggtctgg
    63661 cgcgcggccg ggcgcgcctc tcggaggacg gcgtgacggt gtacgtggag gtacagggtc
    63721 agtacggact gcgcgtacct accacgcgtt tcgtagaaca gttgcgcgaa ctggttcgcc
    63781 gcgatcggct gttggccgag aatctgcgcg gcttaaacga gcgcctgctg agtgttcgcg
    63841 tgcgcgtacg tcagatcagc agcgacacag aggaagtaag ccgacacgcc aagggtcacc
    63901 gcacggtggc ccagatgagc aaggcgctca aaaagacggc ctccaaaatc aaagtgttgg
    63961 aaacacgcgt gacattggcg ctcgagcagg cgcaacgttc caatggcgcc gtcgttaccg
    64021 cggtgcaacg cgcgctagcc gtctttgacg tactaagtcg cgagaacttc gaacgccgcg
    64081 gcgcacagct ctgtctgacg gaagcgacga gcctactgca ccgacatcgc gcgctagcgc
    64141 cgatgacctg gcccgcgggc acgggcgttg cggcggcggc cgaagcggat cgcgccttac
    64201 gcgagttctt ggaggcgccc tgggaatcgg cgccccaacc gccgcgactc cgcatgacgc
    64261 ccgacaccga tcacgaagaa tcgacggcag gcgcgacgtc cgtaccggag gtcctgggtg
    64321 cgcgctacga acccgcacac ctggccgcga gcgacctatt aaactggtac atcgtccccg
    64381 taagccaggc gcagcaggac atcttgtctt cgatcgaccc gcccgccggc tcgacatcgg
    64441 tgtccctgcc gccggcctcg ccatgaaagt cacgcaggcc agctgccacc agggcgacat
    64501 cgctcgcttt ggagcgcgag cgggcaatca atgcgtctgc aacggcatca tgttcctaca
    64561 cgccttgcac ctgggtggaa cgagcgccgt cctgcagacc gaggcgctgg acgccatcat
    64621 ggaagagggc gcgcgtctgg acgcgcggct agagcgcgag ttgcaaaaga agctgcccgc
    64681 cggcgggcgg ctgccggtct accgactggg cgacgaagtg ccgcgccgcc tggagtcgcg
    64741 gttcggccgg accgtgcacg cgctctcgcg gcccttcaac ggcaccaccg agacgtgcga
    64801 cctggacggc tacatgtgtc cgggcatctt cgactttctg cggtacgcgc acgccaaacc
    64861 gcgtcccacc tacgtactcg tcaccgtcaa ctcgttggcg cgcgccgtgg tcttcaccga
    64921 ggaccacatg ttggtctttg atccgcacag ctccgcggaa tgtcacaacg ccgccgtgta
    64981 tcactgcgag ggtctccatc aggtgctgat ggtgctcacg ggcttcggcg tgcagctatc
    65041 gcccgctttc tactatgagg ccctttttct ctacatgctg gatgtggcga ccgtgccaga
    65101 ggctgagatc gccgcacgtt tggtctccac ctatcgcgac cgcgatatcg acctcaccgg
    65161 cgtcgttcga gaaagcgcgg acacggcggc gacaacgacc accgccgcac cttccttacc
    65221 tccgctgccc gaccccatcg tcgacccggg ctgccctcct ggcgtggcgc ccagcattcc
    65281 cgtctacgat ccctcgtcct cacccaaaaa aacacccgag aaacgccgca aggacctcag
    65341 cggtagcaaa cacggaggca aaaagaaacc cccgtccacg acgtccaaaa cactggccac
    65401 cgcctcctcc tcctcagcga tagcggcggc ctcttcttcg tccgcggtac caccgtccta
    65461 cagctgcggc gaaggggccc tgccggccct gggccgctac caacagctgg tcgacgaggt
    65521 agagcaggag ttgaaggctc tgacgctgcc gccgttgcct gccaacacca gcgcctggac
    65581 gttgcacgcg gcgggtaccg aaagcggcgc taacgcggca acggccacgg cgccgtcctt
    65641 cgacgaagct ttcctcaccg atcgtctcca gcagctcatc atccatgccg tcaatcagcg
    65701 ctcgtgtctg cgtcgcccct gcggtccgca atcggcggcg cagcaggcgg tacgcgccta
    65761 tctgggccta tccaagaaac tggatgcctt tctgctcaac tggctgcacc acggcctgga
    65821 tctgcggcgc atgcacgact acctgagcca caagaccacc aaaggcacgt actcgacgct
    65881 ggatcgcgca ctgctggaga agatgcaagt cgtcttcgat ccctacggac gtcagcacgg
    65941 cccggcgctc atcgcctggg tggaggagat gctacgctac gtggaaagca agcccactaa
    66001 cgaactgtct caacgactgc aacgtttcgt aaccaagcga ccgatgcccg ttagcgacag
    66061 cttcgtctgc ctgcgacccg tagactttca gcgtctgacg caggtcatcg aacagcgacg
    66121 tcgggtgttg caacgtcaac gcgaggagta ccacggcgtt tacgagcact tggccggcct
    66181 catcaccagc atcgacattc acgacctgga cgccagcgat ctgaaccgac gcgaaattct
    66241 gaaagcgctg cagccgttgg acgacaacgc caagcaggaa ctctttcgcc tgggcaacgc
    66301 caaaatgcta gagttgcaga tggacctgga ccgtctaagc acgcagctgc tgacgcgcgt
    66361 gcacaatcac atcctcaacg gctttttgcc ggtagaggac ctgaagcaga tggaacgcgt
    66421 cgtcgagcag gtactgagac tcttttacga cctgcgcgac ctaaaactgt gtgacggcag
    66481 ctacgaagag ggattcgtcg tcatacgtga acaactgagc tacctcatga cgggcactgt
    66541 gcgcgacaac gtaccgctac tgcaagagat cctgcagctg cgacacgcgt accagcaagc
    66601 cacgcagcaa aacgagggtc gcctcacgca gatccacgac ctgcttcatg tcatcgagac
    66661 gctggtgcgc gacccgggca gccgcggctc ggcgctgaca ctggccttgg tacaggagca
    66721 gctagcgcag ctggaagcgc taggcggcct gcagctaccc gaagtgcagc agcgcctaca
    66781 gaacgcgcaa ctcgcgctaa gccgcctcta cgaagaggaa gaggaaacgc agcgtttcct
    66841 cgacggactc tcgtacgacg atccgcccac cgaacagacc atcaagcgac acccacaatt
    66901 acgcgagatg ttacgtcgcg acgaacagac gcgtctgcga ctcatcaacg ccgtactgag
    66961 catgttccac acattagtga tgcgactggc gcgcgacgag tcgccgcgac cgacgttttt
    67021 tgacgccgtc agtctgttgt tgcagcaact gccacccgac tcgcatgaac gtgaggatct
    67081 gcgtgccgcc aacgccacgt acgcgcagat ggtcaagaaa ctggagcaga tcgagaaagc
    67141 cggtaccggc gcatccgaaa aacgcttcca agcgttacgg gagttggttt actttttccg
    67201 taaccatgaa tatttctttc aacatatggt cggacgactg ggcgtcggac ctcaggtaac
    67261 ggaactctac gagcgatatc aacacgagat ggaagaacag cacctggaac ggctagaacg
    67321 tgaatggcaa gaagaggccg gcaagctcac ggtaacttct gtggaggacg tgcagcgtgt
    67381 cttggcccgg gcaccgagcc atcgtgtcat gcatcaaatg caacaaacgc taaccaccaa
    67441 gatgcaagac tttttagaca aggagaaacg taaacaggaa gaacagcaac ggcagctact
    67501 ggacggctac caaaaaaagg tgcagcagga tttgcaacgc gtggtggacg ccgttaaggg
    67561 cgagatgctc tccaccatcc cgcaccaacc actggaggcc acactcgagc tgctcttggg
    67621 cctagatcaa cgcgcccaac cgttactaga caagttcaac caggacttgc tgtcggcgct
    67681 gcagcagctg agcaaaaaac tagacgggcg aatcaacgag tgtctgcacg gcgtgctgac
    67741 gggtgatgta gagcggcgct gtcacccgca ccgagaagcg gctatgcaaa cccaagcctc
    67801 gctaaaccac ttggaccaaa ttttaggtcc acaactcctg atccatgaga cgcagcaggc
    67861 cctgcaacac gccgtccatc aagcgcagtt catcgagaag tgtcaacagg gcgatccaac
    67921 tacagccatc atgggtagcg aattcgaggg cgactttgca cgctaccgca gcagtcaaca
    67981 gaagatggag ggacaattac aagagactag acaacagatg accgagacta gcgagcggct
    68041 agatcgctcg ctgcgccagg atcccgggag cagctccgtc acgcgtgtac ccgagaaacc
    68101 cttcaagggt caggagctgg cgggtcggat cacgcccccg cccgccgact tccagcggcc
    68161 cgtcttcaaa acgctgctag atcagcaggc cgacgcggcc cggaaagcgc tcagcgacga
    68221 ggccgatctg ctgaatcaga aagtacagac gcagttgcga caacgcgacg agcagctgag
    68281 cacggcgcag aacctgtgga ctgatctggt cacgcgccac aaaatgagcg gcggactgga
    68341 cgtgaccacc cccgacgcca aggcgctgat ggaaaagccg ctggagacac ttcgcgagct
    68401 gttgggcaaa gccacgcaac aactgccgta cctgtcggcg gagcgcacgg tgcgctggat
    68461 gctggccttt ctggaggaag cccttgcgca aatcaccgcg gaccctacgc acccgcatca
    68521 cggaagcagg acccactacc ggaacctgca acagcaagct gtcgagagcg ccgtgacgct
    68581 agcgcatcaa atcgaacaaa acgcggcctg tgaaaatttt attgcacagc atcaagaggc
    68641 gactgccaac ggcgcgtcca cgccgcgggt cgacatggtc caggcggtgg aagcggtctg
    68701 gcagcgactg gaacccggac gcgtagccgg cggcgccgcg cgtcatcaaa aagtgcagga
    68761 actgttgcag cgcttgggtc agacgctagg cgacctagaa ctgcaggaaa cgttggcgac
    68821 ggaatacttt gcgctgttac acggaatcca gaccttcagc tacgggctgg actttcggtc
    68881 gcagttggaa aaaatccgcg atctgcggac tcgttttgcg gaactggcca agcgacgcgg
    68941 tacgcgtctc tccaacgagg gagccttgcc caacccccgg aaaccgcaag cgacgacttc
    69001 gctgggcgcc tttacacgcg ggttgaacgc gctggaacga cacgtccagc tgggtcacca
    69061 gtatctgctc aacaagctca acggctcatc gctagtctat aggctggaag acattcctag
    69121 cgtgcttccg ccaacgcacg agaccgatcc cgcgctgata atgcgcgacc gcctgcgtcg
    69181 cctatgcttc gcgcgtcacc acgacacctt ccttgaagtg gtagacgtct tcggcatgcg
    69241 gcaaatcgtc acgcaggccg gcgaacccat tcacctggtc accgattacg gcaacgtagc
    69301 ctttaagtac ttggcgctgc gagacgatgg ccggcccctg gcatggcggc gccgctgtag
    69361 cggcggagga ctcaagaacg tcgtcaccac acgttataaa gccatcacgg tagccgtggc
    69421 cgtctgtcag acattgcgca ctttctggcc gcagatctcg cagtacgacc tacgacccta
    69481 cctcacgcag catcagagcc acacgcaccc cgcggagact cacacgttgc ataaccttaa
    69541 gctcttttgt tatctggtga gcaccgcctg gcaccagcgc atcgacacgc agcaggagct
    69601 gacggccgcc gatcgcgtag gaagcggcga gggtggtgac gtaggggaac agagaccggg
    69661 ccgcggtacc gtgctgcgcc tgagtctgca agagttttgt gtactcatag cagctctgta
    69721 cccagagtac atctacaccg tcctcaagta cccggtgcaa atgtcactac cctccctcac
    69781 agctcaccta catcaggatg tgatacacgc ggtagtcaat aacacacaca aaatgccccc
    69841 cgaccacctc cccgaacagg tcaaggcctt ctgtatcacc cccacccaat ggcccgccat
    69901 gcagctcaat aaactgtttt gggaaaataa actggtacag caactgtgcc aggtaggccc
    69961 gcaaaaaagc acaccacccc taggcaagct atggctctac gccatggcca cgctggtctt
    70021 tccacaagac atgctgcaat gtctgtggct agaactgaaa ccccagtacg ccgagaccta
    70081 cgcctcggtg tccgaattgg tacagacgtt gtttcagatt ttcacgcaac aatgcgagat
    70141 ggtgaccgag gggtacacgc aaccgcagct ccccaccgga gagccggtgc ttcagatgat
    70201 ccgcgtgcga cgccaagaca caaccaccac agacacaaac acgaccacgg agccaggact
    70261 tttagatgtt tttattcaaa cagaaaccgc cctagactac gcgctgggct cctggctttt
    70321 cggcataccc gtgtgtctcg gcgtgcacgt agccgacctg ctgaaaggtc aacgtgtatt
    70381 agtagcgcgc cacctcgaat acacgtcgcg agaccgcgac ttcctccgca tccaacgctc
    70441 ccgggacctc aatctcagtc aactgctcca ggacacgtgg accgaaacgc cgctggagca
    70501 ctgctggcta caagcccaaa tcagacggct acgcgattac ctgcgtttcc ccacccgctt
    70561 agagtttatt cccctggtca tttacaacgc acaggaccac accgtcgtac gtgtgctgcg
    70621 accgccctcc acgttcgaac aggaccacag tcggctggtg ttggacgagg ccttccccac
    70681 cttcccgctg tatgaccaag atgataacac atccgcggac aacgtcgctg cgtctggcgc
    70741 cgccctaaca ccgccggtac ctttcaaccg cgtaccagtc aatattcagt ttctgcgtga
    70801 aaacccgcca cccatcgcac gagttcagca gccgccgcgc cgacatcgtc atcgagcggc
    70861 cgcggccgca gacgacgacg gacagataga tcacgtacaa gacgatacat caaggacagc
    70921 cgactctgca ttagtctcca ccgcctttgg cgggtccgtc tttcaagaaa accggctggg
    70981 agaaacacca ctatgtcgcg atgaacttgt ggccgtggca cccggcgccg ccagcaccag
    71041 tttcgcctcg ccgcctatca cggtgctcac gcagaacgtc ctcagtgctc tagaaatatt
    71101 gcgactagtg cgattggacc tgcgacaact ggcgcaatcc gtacaggaca ctattcaaca
    71161 catgcggttt ctctatcttt tgtaaccgac actgacagta gcgggcaata aaaacaggag
    71221 gattattatc gttttttatg atacaaaaca acgtgtcact ttcacggtga tttattattg
    71281 ctattacttt tccccatggg ctgtcagcgt cgggtgcgcg acacggctac catgcgcaac
    71341 aggtccagct taaaggcgca cttgtcgtta aacagactgg acatgcgcgt atacttgctc
    71401 agcatggtgg ccagcaccgg gtgggtggcc tctgagatct cggtcggcaa ctccaaaacg
    71461 acgttgacga cgtgacggtg tttttcgtcc cgcttgttgg ccaccgtggg tcccggcgcg
    71521 gtgttagaca tggggcaggc cgtgggggga ggacgaggag gacgtcgctg ctaaaccgcc
    71581 gcgcgcctgc tgcacaatgt ggccgccgac gtggcaggcg gtctgtttaa ccagcgcgca
    71641 gcctcgacac agcggggcgc cgtcttcgct ttccaaacag ctgtcgcggt actcgcccgt
    71701 ctgacagcgc gcgcacagca ggccgtgccc gtgcgaagtg aggcgcagga gacgcgggac
    71761 cgtcacgccg cgtaccacca cagtggagtc gcaggtgcgt gccgcgcagg gcagaatgac
    71821 gtcgaaagcc agccggtgat cgtacacggc acaagccgcg ttgaggccca gcacggcttt
    71881 ccagcccacg cgtacgcagc gctgtccaaa gagcgtctcg gagacgagct cgtagacgcg
    71941 ctgccgcacc acccgctgac tgccgcagag cgagcagtgt acgagctcgg cgtgcgtgtt
    72001 gaagatgacg ctcttttctt gacggtcccg ataatagaac atcgagttga gcggaaaatt
    72061 ttgctggcag tgtagctttt ccttacccag gttgaggcag tgtccgcact gccgacagac
    72121 cacggccacc agcgagcgcg cgtccagatg gcgctcgcac ttgagtcgac acagacacca
    72181 gagcggcagg tcgatgacgc tgccgatgag gccgccgcgc agcgcggcgc tgagtgcaaa
    72241 gaggacgatc ttggtgggct ctacgtgacg cgcctgctgt ccggcgcccg cgtgtcctac
    72301 cgccgcagct gccgccgtcg agcctcctcc gcgcgtctcg tcgtgcagac ccagtgcccg
    72361 caacggcacc aggtatcgcg gacacgtgtc gcaaaacgtc tgcaccgctt gtcgggccag
    72421 tacgtagagc gggtttccgc agggtacctt cccggcgtgc cggcgcaagg ctgcgatgag
    72481 gccccgcagc tgcggcgacc gcggctgccg ttggtgacac cactggttac ggtggtatac
    72541 ggccaaatca gcgcgggcgt cgaagcgctt ggcgcgtagt agcgctaggc acggcgagct
    72601 ggtggggtga agcacgggca gccgaaggtc caccccgaaa aggaaacggt gaaggtcacc
    72661 tagcagcgag gcggtgacac cgtccaacaa cgcgtgcagc cgctcgggcg ggtagagccg
    72721 cagacggcgc agcaggtagt cggtgtcgta gcgttcgaaa cgcagaaagg ccatcgtgcg
    72781 gacggccacg gtgtgcagac agtccatgct gtagacgtaa gcgagaaaca caaagtaggg
    72841 cttggtcata accatacgct gaaagagcgc cgtcaccgcc tcccgctcgg cctgccgaca
    72901 caccagccat tcgcgcagga agcgttggta gagacggtcg cccagctcgc gattcagaaa
    72961 gcgcttatcc gtcacgaaga gatgaaggac gcaagaacgt ggcacgtgat gcaccagctg
    73021 ctgctggagg accgccgacg tctgcgccgc aaactgcgcc ggtggctgcg acgtttctac
    73081 cgccgcttcc tccggctgca gcgcaccgcg gccgatcacc agctgcacat ggaaatggtc
    73141 ctcgtgaacg cagaggggcg cgaagagacg gcgcagagcc tggtggaact catcagtcgc
    73201 ggtgtgcgga gcgtgtcgga gacgacgatt gcccatgacc gcgccacagc agagccagca
    73261 ccagcagaag agccagcacc agcggcccca gagtcgcaaa gcgcgcgggc agccacggcc
    73321 cagactgcgg tcgcgatgac ccggagcgcg ctcgccacca cgatgacggt gcccaacgat
    73381 aaccagtccg ctccaaggac ggcgcgcacg gcggagacgg cggatgacgg tgatgggtcg
    73441 acacccctcg ccgacgactc acgtgctcct ccagaggccg acgcgcggac cctccgacgt
    73501 cctggcccgc cgctgccgct gccgccttcc cttctcccgc cagagccagc aactcctcct
    73561 cctcttcatc agcgtctccc tcgcttgcgc atccgcatcg tcccatacag gcctcacaac
    73621 gacacagccg ccacgacccc gccgccatgg gtggcggcgg cggccgaggc ccggcagcgg
    73681 cgccgccagc ggcgaccatg gtgggagagc aactcggatg acgaggagga ggaggagggg
    73741 gagatgcggt ccgagacgac cgctttcccg ccgttcgcgt gagcgcggcc gacatgcggg
    73801 cgcgccacag agacggaccg ctgccgctgt gactgcttac ggtgacgtgg ttccggaccg
    73861 ccaacgacgt cgacgcggct tttttggcgt acagctcgcg cagcagattc tcgtactcgc
    73921 cctcgttttc gggtccgaag gcgatgagct cgatgttgaa caccgacgcc gaattggatt
    73981 tgcgcaccac gcacttcgtc agcactccgt aggccgaggg cttgatctcc tcgatgtcct
    74041 tgagcgtgac gatgagcgac tcgttcacct taagcacatt gaactcacct acatggcgcg
    74101 ccggcgagac gagcttgacg ggcgctcgca caaaacagca gagggagacg gcgcagccag
    74161 tgtttttaaa gataaaacaa ggcacgtggt ctgtgcggct ctcccagtag ctgagcagat
    74221 actcgacaca atagaccgtg tctgtcttga gcatggcgtc gcacaccgag taattgggat
    74281 ttttacagat aaggccggcg tcggtgacgc gcagctcgct aggacccaac ttgaggatac
    74341 gccgcgtggc ctgcaccaga tcctgatgga gaaccttgtt catctccatc gcaccgacgc
    74401 caccgccgat ttatttaccc ggcgccggct cgtcttttcc ctccaggatt ccgttaatgt
    74461 ccatgagctt gctgacgatc gccgttaata gttgcgtctt ctcacggagg atctctccgt
    74521 gactgcaggt cgcgcagtcg ccgtgcacgt acttgaggaa ggcggcgtac ttctgacccg
    74581 cgttcacgaa atttaagcgc gcgtccagag agggcagcaa cagatcgtag acgcgcggca
    74641 gcatcggctc gaactgtaat agcagatcgt cgtcaagatc gggtagcgcg tgtccgtctt
    74701 caccgtcctc gtcgtcacca cctcccccct cgagcccacc gctcgtacca gccgcgggct
    74761 ccgcgtcctc gtcgatcacc agcggtcgcg tcggcaccgg agaatccacg tcatcctgca
    74821 cgtcgttttc ctcctctccg tcgtcatcgt ccagaaacgg cacccgctgc ttagcccagg
    74881 acattctttt tccgcgtcct caatcagcgg cgccgatcgc catgaatccg agtacccacg
    74941 tgagcagtaa cggcccaacg actccccctc acgggcccca caccacgttt cttcccccga
    75001 ccagcccggc cccgtccacc agctccgtcg ccgccgctac cttgtgcagt ccgcaacgac
    75061 aggccgtttc gcgttacagc ggctggagca ccgagtacac ccagtggcac tcggacttga
    75121 caactgagct gctatggcac gcgcacccgc gtcaagtacc tatggacgaa gcgctggccg
    75181 ccgcggcggc cgcctcatac caggtgaatc ctcaacaccc cgccaaccgt taccgtcact
    75241 acgaattcca gacgctcagc ctcggcacct cggaggtaga cgaactgctc aactgctgtg
    75301 cggaagaaac cacgtgcggc ggcacgcaat ccaccgtact caccaatgcg accaacacca
    75361 ctagctgcgg cggagccgtc gccggcagta gcaacgcagg acccgccggc gcttcggccg
    75421 cctgcgacct agatgcagaa ctggccggcc tcgaaacctc ggcggccgac tttgaacaac
    75481 tgcggcgact gtgcgcgccg ctggccatcg acacgcgctg taacctatgc gccatcatca
    75541 gcatctgcct caaacaggac tgcgaccaga gctggctcct cgagtacagc ttgctgtgct
    75601 tcaaatgcag ttacgcgccc cgtgcggcgc tcagcacgct catcatcatg tccgagttta
    75661 cgcatctgct gcagcagcac ttttccgatc tgcgcatcga cgacctgttc cgacaccacg
    75721 ttctcacggt cttcgatttc cacctgcact ttttcataaa tcgttgcttt gaaaaacaag
    75781 tgggcgacgc ggttgataac gagaatgtca ccctgaacca tctagccgtg gtgcgggcca
    75841 tggtcatggg cgaagacacg gtgccttaca acaagcctcg acgccacccg caacagaagc
    75901 aaaaaaacaa cccttatcac gtcgaagtgc cgcaagaact gatcgacaac tttctagaac
    75961 acagctcacc tagccgcgac cgcttcgtgc agctgctttt ctatatgtgg gccggcaccg
    76021 gcgtcatgag caccacgcca ctcacggaac ttacgcacac taagttcgcg cgactagacg
    76081 cgttatccac ggcctcggaa agagaagacg caaggatgat gatggaagaa gaggaggatg
    76141 aagaaggagg agaaaaagga ggagacgatc cgggccgtca caacggcggt ggcaccagcg
    76201 gggggttcag cgagagcacg ctaaaaaaga acgtgggtcc catttaccta tgtcccgtac
    76261 ccgccttttt taccaagaac caaactagta ccgtgtgtct gctgtgcgaa ctcatggcct
    76321 gctcctatta cgataacgtc gtcctgcgcg agctgtaccg ccgcgtcgtc tcgtactgtc
    76381 agaacaatgt gaagatggtg gaccgcattc agctggtatt ggccgacctg ttgcgcgaat
    76441 gcacgtcgcc gcttggcgcg gcgcacgagg acgtggcgcg ctgtggactc gaagcgccca
    76501 cctcgcccgg aggcgactcg gactatcacg gcctgagcgg cgtcgacggc gcactggcgc
    76561 gacccgaccc ggtattttgc cacgtcctgc gtcaggcggg cgtcacgggc atctacaagc
    76621 actttttctg cgacccgcag tgcgccggca acatccgcgt caccaacgag gccgtgctct
    76681 tcggacgcct gcacccccac cacgtccagg aggtgaaact ggccatctgt cacgacaatt
    76741 actatataag tcgacttccg cgacgtgtgt ggctctgcat cacactcttc aaggcctttc
    76801 agattacaaa acgcacctac aaaggcaaag tgcacctggc ggactttatg cgcgatttca
    76861 cgcagctgtt ggagaattgc gacatcaagc tggtggaccc cacgtacgtg atagacaagt
    76921 atgtctagcg tgagcggcgt gcgcacgccg cgcgaacgac gctcggcctt gcgctccctg
    76981 ctccgcaagc gccgccaacg cgagctggcc agcaaagtgg cgtcaacggt gaacggcgct
    77041 acgtcggcca acaaccacgg cgaaccgccg tcgccggccg acgcgcgccc gcgcctcacg
    77101 ctgcacgacc tgcacgacat cttccgcgag caccccgaac tagagctcaa gtacctcaac
    77161 atgatgaaga tggccatcac gggcaaagag tccatctgct tacccttcaa tttccactcg
    77221 caccggcagc acacctgcct cgacatctcg ccgtacggca acgagcaggt ctcgcgcatc
    77281 gcctgcactt cgtgcgagga caaccgcatc ctgcccaccg cctccgacgc catggtggcc
    77341 ttcatcaatc agacgtccaa catcatgaaa aatagaaact tttattacgg gttctgtaag
    77401 agcagcgagc tactcaagct ctccaccaac cagccgccca tcttccaaat ttattacctg
    77461 ctgcacgccg ctaaccacga catcgtgccc tttatgcacg ccgagaacgg ccggttgcac
    77521 atgcacgtca tcttcgaaaa ctccgacgtg cacatcccct gcgactgcat cacgcagatg
    77581 ctcacggcgg cgcgcgaaga ctacagcgtc acgctcaaca tcgtgcgcga ccacgtcgtt
    77641 atcagcgtgc tgtgtcacgc cgtctcggcc agcagcgtca agatcgacgt gactattttg
    77701 caacgcaaga ttgacgagat ggacattccc aacgacgtga gcgagtcctt tgagcgctac
    77761 aaagagctca ttcaggagct gtgtcagtcc agcggcaaca acctatacga ggaggccacg
    77821 tcgtcctacg caatacggtc tcccttaacc gcgtcgccgt tgcacgtagt ttccaccaac
    77881 ggctgcggcc cctcctcctc gtctcagtcc acgccgcctc atctccaccc gccgtcgcag
    77941 gcgacgcagc cccaccacta ctctcaccac cagtctcagt ctcagcagca tcatcaccgt
    78001 ccccagtcac caccgccgcc gctgtttctc aacagcattc gtgcgccttg acactgtacg
    78061 gcagaaaagc cggctccaag tgcaagcgcc gcggcagcac catgtgcaaa aacttgtcct
    78121 tgcgcgcggt ttcgccgccg ggaaagacgg gcgacagcac gttggttaca gccttgagaa
    78181 cctgctcaaa gtacttgtcg gcgtgaatgg gcacgccgtg ctcgcgcacg tagctcggat
    78241 cttcggctac ctcgtagttg cacacggccg acggtggttt ccgcgccctc ttctttgccg
    78301 gctctcctcc tctcctgttg ctctcctcta ccccgccgcc gtcagcgtcg tcgtccgtgc
    78361 catcaatcgc gtccgaccgg gaaaccacgc cggtggttac agaatcaccg ttgtcggagg
    78421 aaccctgcgg cgccgtccgg acaccgggcg ccgtcaggac gtaaaagacc cgatccccga
    78481 ccgagggtag ctcctcagaa cgggccgcca atcgcttaat gacggcaatg tgcggcaggt
    78541 tagattgacg gtacaacgag atgtccttag aaagcaccga cgaaagcacc aggtcctcaa
    78601 cacacacacg gtgcaggtac agatcgtcgc gggcctgcac caggcggcgc aagatacgcc
    78661 agaaaccgcg tggcacgccg tatttcttga cttcatcgag tgagaggcgc gacaggcgca
    78721 cggctgcttc cgagacctcg cgatcctcaa agagcagcga gaggacgtca cgcgtgacgc
    78781 ccttgacgaa ctcgcaggcc gtcttgcgca ccagatccac gcccttcatg ctcagacccg
    78841 aggcgccctc cactttgccg atgtaacgtt tcttgcagat catcataaga gagacgaaga
    78901 ccttttcaaa ctccagcttg acgggctcca caaaaagaca agccgtcacg tagtgcgcca
    78961 ggctgggccc acgcgccacc agagcctgcg gcgtcaggcc acgaaagcgg acaaacacgc
    79021 tgtccgtgtc cccgtagatg acccgcgcct ccacccgccg ttcgtttaag ccccctgatg
    79081 atgtttcgag cccctccggt aacgtgctgc tctcctccga atccccctcc cgcgttccta
    79141 ctacatagtc ttcctgatta aaaaaattgt gcaaaaaaca cggctctgaa aagttgtctt
    79201 tgatgaaccg cgccgtgcgc tctagcatgt cgcgaccgat gcgcgtaatg ctggcggcga
    79261 tgggcagaca cggcatcatg ccgttgacca cgccggtaaa accgtagaaa gcgttgcacg
    79321 ttactttgag cgccatctgt tccttgtcga gcagcatacg gcgcacgggg tcttgacact
    79381 cgcgcatgca ttcgcgcacg gcacgccgct gcgaaaccca cttgttgagc agttccgaaa
    79441 gcaccgagac gcgcaccgaa gcacgcacaa agcggtgtgt cacgccgttc tctagcgtga
    79501 cgctgtatac gtcggcaggg tccacggggt actcgccacc cggcaccagc agggtggagt
    79561 agcagaggtt gtgagccatg atgatggaag ggtagaggct ggcaaagtcg aacacggcca
    79621 cggggtcgtt gtagtaaccc acctcgggct caaacaccgt ggcgccctgg tacgaaaccg
    79681 ccgcagtacc accggcgccg tgattgtcgt tggaaacgcc gacgccgcca ctactgccgg
    79741 agccgacgct gaaaacgccg acgctgctac tactgttact gccggagccg ggtgaaacgc
    79801 cgtcctgact ggacggcgca gattgcaagg gcggcgacat ctgaaacata gccgccacag
    79861 aacccgcgtc gccgggcacg gcggcggtag agatgatagc ggcgttaggt gacacggcaa
    79921 cactattcgt ttcgggcacc gtcgtacctt tgctgtagtg gttgggcagg ataaaatcgc
    79981 ggcaggcgca ctcgtccagc agcgaggtgt agatacggat ctgctgtccg tcaaagatga
    80041 cacgccgcaa cggaatttta gccagccgcg cgatggcccc ggcctcgtag tgaaaattaa
    80101 tggtgttgaa cagatcgcgc accaatacgg cgtcctgcag acagtaacgg cctacctggg
    80161 cgcggccctc ggcattagcc acgaaacaac gcgggatgtc cttgtaggac aggtcatcct
    80221 tgcgttgccg caggtaaagc tcggccatag tgttgagctt atagttgggc gagttagtct
    80281 tggccatgca tacggggtac atgtcgataa ccaccgaacc cgcaatatac accttggtgg
    80341 cggccgtgct ggccggattg ttgtgagaag ccgagggaaa ggcggcggcg tactgccgct
    80401 taaaacccac ggcggggctg tgtaaaaaga aacggccgcc ctgcgccgta ggcaacttgc
    80461 agaagcgctg cgagtccacc ttatacaggt actcgaggcg cgtgaggatg tacttcaagt
    80521 caaaagagtt gatgttgtaa ccggtcacaa aggccggcgc gtaccgttga aagaaaagca
    80581 taaagcccag cagcagctcg tattcggaag ggaactcgta gacgtccacg tctgggccca
    80641 cctgcccgca ggtgccgatc gtgaagagat gaagacccga gtgcccaaag atcacaccct
    80701 ccgaagtgca gccccggcca tcgttcccgt ttgggatccc ctgatccacg gcggtgtttc
    80761 cccccgtctc gtagcacacg cacgagatct gaatgacaat gtcatcggac ttctcggcgc
    80821 agggaaaacc accctcgccg ctcatgcact cgatatcgaa ggacaggcat cgatagcgcg
    80881 gccacgagct gtcgtcgggc acggccacca ggtcagagac atcgcagtcg acctcgatat
    80941 cacaagtcga cgcgcgaccc tgctgccgcc agtcgtaacg attcacggag caccagccga
    81001 acgtggtgat ccgccgatcg atgaccaaac gcgtcagcgg atccacacgg acctcgtaca
    81061 cgggaaaacc ctgctccagc agatactcgc cgatttttct ggccatggtc cagttgctga
    81121 tagacacaca ctgcaaatcg ggcacgggtc gcgtcccgta cccgtagatc gaggttttgg
    81181 tggccggcgt gacagacacg gcgtatggcg tccgcggttc gggcactagt tcgcccacgc
    81241 tggcaatgac ctcacgcagc ctatcggtgt cgctgtactc acagtaaaag tagctgcgct
    81301 gcccgaaaac gttgacgcag atactgtagc cgtgttctgt ggccccgaag aaacgcaaca
    81361 cgttccccga aggcaccaga tgctgacgat agcgcggcga cacgttttcg ggcgagtcga
    81421 agaagagcac ggcgtccgtc tgatcgtagg tgtgaaaacg aataggtccc accacgcgac
    81481 ccaccagggt ctcgcgccaa ggacacggcc aaaccatgtc atgactcaac aaatgtttaa
    81541 tctctcgata gaacatgaga ggcagccgtc ccgttttatg cttgatcaac cccgtctgac
    81601 cgtcgaacat gacgcctcgc ggcacgatct gcaaaaactg tttctgtggc ggccgcttgc
    81661 ccgagccctg cgcggagccg ggctgcgaac gctgacgccg gccacccgcg accgcaccgc
    81721 cggtcacgcc gccgctcaga tacgggttga aaaacatagc ggaccgtgag aggctgacag
    81781 cttacgaagc aaaatcacaa agaaaataca catgcagcac ctagatatcc agtttaaccc
    81841 cgtatatcac aagtctctgt gtcacttttt tttgtctgtt ttttttttct tctcctggtt
    81901 cagacgttct cttcttcgtc agagtctttc aagtgtcggt agccgttttt gcgatgtcgc
    81961 agtcggtcta gtaggttggg cttctgtccc ttgtcctgcg tgccagtccg tccgtccaaa
    82021 gaatctgtac cgttctgctg cgctcgctgc tctgcgtcca gacgggccag ggccagaagc
    82081 atctggtaag cctgctcgtt ggtgtaaggc ggagccgccg tggatgcatc agacgacggt
    82141 ggtcccggtc ctttgcgacc agaattataa acactttcct cgtaggaagg cggagcctgt
    82201 aacgacgtgt ctttggtgct gcccgacgtc acggtggtcc cgtcggcgga caccagatag
    82261 ggaaagaggt tctgcagcgg ctgcgtgcac aaacgccgct gtcgagtata gatcaaataa
    82321 gtgataatga ctacagctat ggccacgagg atgatggtga acgctccgaa ggggtttttg
    82381 aggaaggtgg caacgccttc gaccacggag gccaccgcgc cacccacggc cccaatggct
    82441 acgccaacgg cctttcccgc ggcgcccagg ccgctcatga ggtcgtccag acccttgagg
    82501 tagggcggta gcgggtcgac taccttgtcc tccacgtact ttacccgctg cttgtacgag
    82561 ttgaattcgc gcatgatctc ttcgaggtca aaaacgttgc tggaacgcag ctctttctgc
    82621 gagtaaagtt ccagtaccct gaagtcggta ttttccagcg ggtcgatatc cagggcgatc
    82681 atgctgtcga cggtggagat actgctgagg tcaatcatgc gtttgaagag gtagtccacg
    82741 tactcgtagg ccgagttccc ggcgatgaag atcttgaggc tgggaagctg acattcctca
    82801 gtgcggtggt tgcccaacaa gatttcgttg tcctcgccca gttgaccgta ctgcacgtac
    82861 gagctgttgg cgaaattaaa gatgaccacg ggtcgtgagt agcagcgtcc tggcgactcc
    82921 ttcacgttca tatcacgcag caccttgacg ctggtttggt tgatggtcac gcagctggcc
    82981 aggcccaaga catcacccat gaaacgcgcg gcaatcggtt tgttgtaaat ggccgagaga
    83041 atggctgacg ggttgatctt gctgagttcc ttgaagacct ctagggtgcg ccgttgatcc
    83101 acacaccagg cttctgcgat ttgcgccagc gcccggttga tgtaaccgcg caacgtgtca
    83161 taggtgaact gcagctgggc gtagaccaga ttgtgcaccg attccatgtt ggataaatga
    83221 gttgcattgt tgccatctgt acttcttttg gttctattat gagtaagatt cagactggag
    83281 cggttggcca aacgttcgag ttccaccaga gatttttgct tgataccttg ccagaacact
    83341 accaaaccac cagtggtttc aaagacggac acgtttccat atttttcata tgtttgattg
    83401 tatgaagtat tgaaaatctg ctgtaactta tttatagcct catcacgtac gcagtccagc
    83461 gcagagtcgg acatgttcac ctcttgcttc ttagataaga aagtggcggt cattttggca
    83521 gaagaaaagt gatacgagtc ctcggcttcg gaacgaatgg tgcgttccgg ggcttcccag
    83581 aaagtgagtt gacaagtgac attcttttcg tcctgtatat cccaggagat caccgagtcc
    83641 gcacgttcaa gaaaagccac caacctgtgg gtctctaacg cagaattcgg tcttccaaag
    83701 tcagagacga tagtgtagtt cggaaaaatg aaaaacttgt cggcgttttc tccaaagtag
    83761 ctggcattgc gattggttcc gttgtagaaa ggagaaatgt caaccacgtc acccgtggaa
    83821 gtggcgaaaa aatgataagg atatttggag cgcgcagtag tgatggtcac catacaattc
    83881 agattacagg tctcacgata gagccaggtg ctgccgcggc tgtgccattg atccttgacc
    83941 gtcacgtaac gggtactgtg ggtgttggaa taatcgtcgg gcattaattg catggttttg
    84001 ttttcatagc tgtccctatg ataagccacg aaaaccgtgc ctgctataac gcggctgtag
    84061 gaactgtagc actgactgtg gctgttgata tgatgaatct cccacatagg aggcgccacg
    84121 tattccgtgt tgctgcccag cagataagtg gtgtggatgt aagcgtagct acgacgaaac
    84181 gtcaaaacct tctggtagac tcgtacctta aaggtgtgcg cgacgatgtt gcgtttgtag
    84241 accaccatga tgccctcgtc caggtcttca ttgatgggct tcatcgaggt gcagacgata
    84301 ttacgttcaa agcgaataag atccgtaccc tgggccatag aacacacgcg ataggggtac
    84361 ttggtggtat tcacccccac cacatctccg tacttgaggg tagtgttgta gatggtctcg
    84421 ttaacaccat ggctgaccgt ttgggaagaa gttacgcgtt gagagactga accggatcga
    84481 gagtgagcag cagacgtcgt atgagaggaa tggtgactgt gagtagcaga agttccacga
    84541 gtagaagatg aggaaaccgc agcacccaga cagacgatac acaagttaac gcagactacc
    84601 aggcaccaga tcctggattc catgttcgtc gcgggccaaa tccagcagcg atgaggcgcg
    84661 tcgtggtctc ttgcgtgttg cgcggaccct ccgggaaacg cccgcggtcg aggaggaggg
    84721 gtacggactt ggcagccaag gtcggtccgg ctccctgaag gcacccgaga cggccgcggc
    84781 ggccgtcagg gtggagggct tggccacggg agctgttggc acgtcgccac tctcatccgg
    84841 tctggacaga tgcctgtaga ggaggagata tagatctttg gacttataaa gacttccttc
    84901 gtgacgaagc agcagcggcc actctttgtt atacgtgaga atcacatctc tgtccgggtg
    84961 cagttcgtcg cgcaggcacg cgatcgagag ttgtttcccg aaagtttcat tatatagtgc
    85021 gacggagagc acgagctccc gcacgtgcat ccacatctcc ttctgcagca cgtttaggtc
    85081 ctgacagtcc gaaaaattga aaaaacccat gtacttcacc accatccact cactgggata
    85141 cacggtacct tccgcgcatt tgaccaaatc gtccttgacg tggggtagta cgcccgcgtt
    85201 gtcgcaggca taggccatgt ccacattgtg agagagggga tagcgatcgg tacagtgtgt
    85261 gaagaggggc ccgttacaca actcgtagat ctgctgaccc agtagcggga gggattccac
    85321 gggcagactc ttgtggatca ggttattgac cacatacagg tgctcatcgt acgtgaactg
    85381 attccccacg tccaccacgt cttggtcctg gtggtattgg ctgcggtata gaaacccatt
    85441 catgagctta gagataaagt ccagacacaa gggccccact aggttgacat cgatgagttt
    85501 gctagtcaga cgctcctgcg ttttgatgca acggatcacc ttgccatagc ccacctccga
    85561 gaccttctgc aggtaagcgc gtttgcgcac gttcacctcg cgggtgacgt tgtggatgcg
    85621 ggaacgcgcg tccaccaagt cgagagcttc gtgttcgtcg cagttgcgca cccgtaagcc
    85681 gttctcgctg ccgtcgccgt cctgcccatt cgcccctccc cctacagctt tcttgcctcc
    85741 tccacgggcc cggccgccgc caccgttatt cctctgactg tgagtactgc tgttgctgct
    85801 gttgctggcc gtcatcaaag tcgtacccgt ccccgacatc gcctcccgtc cacgcaggtg
    85861 aataacctcg ccctcggggc cgtcgccccc cgtgccatcg ggcagcggac gtcgaatctc
    85921 ctcgagaata tgcttgattt tggtgtacat ctcgttgctt tcgtggagct tgttgaacac
    85981 cgggttgtcc tcgaaagctt gaatgctgag ggatgtgatg aggtcgatga tcctgttggg
    86041 ggcggcaaag accgacccca cgaacatgcg ctcctccccg tccaacgcct tttccccgag
    86101 cacgaagatg tcctccacgt cctccccgta cagatggcga ctgatgccgt tcatgagcgc
    86161 ccggcacagc tggtgataca catttagctg ctggatggtg atgcccaccc gcttgacgat
    86221 aacctccgag gtacgggacc agtaggtaaa atccgacaag gaatatattc gttccggtat
    86281 atccgtaaac aggttgtact ccctcagcgc ctcctccgcc tcctggatgt agctgtggta
    86341 ggccgatgaa gaagagaata ggcttttgag ggccgaaagg actccagcca agtgggggat
    86401 gcgcgttgtc aggtccagca ggtcctgctc caccgtctgg atattcacat cggactggct
    86461 tgacggacgg tggaccgcta tatggttgca cagcaagccc tgcagccgct tgttcagcga
    86521 gcggccctga ttcgggatga tggtcagctc ctcgtagcat tgggcgcatg tcgtcccttc
    86581 gacgtacact tcctgacgcg ccaccggcga gatgccgcat aggcgacgga ggagctccag
    86641 cagctgcgcg cagacctcca ggccggcctc cggtgccagg atcccgtaca cgtagttcat
    86701 tttgcacagg aagcgctcga tgtcgttgag tgtggccaga ctgacgctga aacggacgtt
    86761 gtccgtaaac tggagctcca cggtgtgatg gcgatcgcag cgatccaaac ggaggacggt
    86821 acggtagaag gccgcccggt ccggctggcg cgagtaggcc atcagcgccc gatccagcaa
    86881 agccgtatcc tcgtgcagcg ccttcagcag catctccaga tagagcgtca gcagcgaact
    86941 ctgcgtacga ttctgcgcca ccacctccgg gtagatcttc cggtacagat acactatagc
    87001 cgccgcgttt ctcttgaacg gcgtggactc cgccagtaac acgttcggat cgcagtactt
    87061 tagacactcc agctccatgg cgtattcgtt gcatttcgaa cacactacgc atagtttctg
    87121 taacaaattc atctccatga ctcgactcgc tcacgtacga gacgctgtcg tccggtctgg
    87181 cgccggccag agacatggag tcggtgcaca aataactcgc gggccgctcg ctatgccgac
    87241 tgacgttgac gttaatatat aacgacgtcg tcgacgacgc gggttctgct cccgaagctg
    87301 ttgccgccgc ttgcggcgca acctcctcca ccaccgccgc cgccggctcc tccgcctcgg
    87361 gcgacggggg ctcggagatg accggctgtg tctgatactc ctccccttcc tcaggcggcc
    87421 cgggcgccga cgcgaatgtc gaagtttgcc agcgcggcgg cggtctctgt ctctggtgcc
    87481 gcggcgctaa ccttcggggc tgttgctgct gttgatgatg cgacgccgtc tgtcgccgct
    87541 gttgcggcgg tagctgatac ggtgtcgcct ggtgctgctg tgtcggtggc tgctgttgct
    87601 gcggtctgaa aagcggccac gggggctgcg actgttgctg ctgttgttgc gatgctcgtg
    87661 gctgcggcgg ccgttgtcgc ggcgtttgct ggcggttaca accggctgcg tttggccggc
    87721 aataacccgc tgcccccgcc gcccccgcta ctcccgccga cgccgccagc ctcgtcttcg
    87781 ctggcgttca cgagaaagca gccacctccc gtctcgccgg gcacgccgaa gcaaatggag
    87841 ttgcccgcga cggactcgcc gagaagaaga ccgccacccc cgacgccgga cgccgcgccg
    87901 acgccactgg gcgcgaagag cgccgacagg tcgtgcacct cccccccggc ggcgtccgtt
    87961 aatcgctggg cgtcggcgtc cagcacgcgt cgcaagttct ccagcgaaaa gtcctccacg
    88021 ccctgctctt gcaacgcggc aaacttgtcc atcagcgacg cggccagcgc ctcgcagcca
    88081 tccacgaaga agagcacatc gtcggacgcg gggatctcct cgcgcacgct cagaatctcg
    88141 tacacggcca tcacttcggg gtcgcaatcc aagttctcgg cgtccagcgc cagcatgacg
    88201 cggtttttta taagatccgc gtcaaaaagc acgttctcgc ggcgcgagcg tttgatgagc
    88261 acgtcggcca gacgcgtagc caagaggtag cgctggcgca tgaaacgata atcttggccg
    88321 ctcatagagc tcacgttaag gctgcgttct acaccgttgc ccgaaaagta gccgatctgc
    88381 ccaaactgat agatctcctt gctgttgttg atacccgcat atttttccac gctcacgggc
    88441 acggtcacca aggaacgatg ctcaaaaacg ctccgtacca acgattcacg cgtcacagtg
    88501 gcggccatgg gcgccggcac gcctgcggtc ttcaagccct tgacatgcaa cgcaaattcg
    88561 gcgggcgacg agaaacgcgg actagcacct aacacgtgag gaaactgcgc gtggttctgc
    88621 gtcgttaagc gcgtcgtcaa cccgtgcagc gagccgatgt agtctttgaa gccgtagtag
    88681 cagaggaatt tgttatggaa acggctttcc acgtaactca gcacacagtc tggcgccaca
    88741 tccagcagat cgtgctcctg atagtcagcc gtcacagcca ccagaaattt gacgaaagca
    88801 ttgaactcgc ccatgtcacc tatgggcaca ttcttgggca acgcgttgga acagaccttc
    88861 tgccaaaact gtaagcaggg gagaccacat tcaggaaaga gtcgctcgtg atgtcgatac
    88921 agcagaaatc ccaagcagcc cttagccgga ttacgacgcg gaacgtgatc gcggcgaaaa
    88981 aacacgctac ccgcgttgcc cttgcccgcg cggtagatgg gtcggttttt cacccgcacc
    89041 atgatcaacg tgggtaccga cagccgcgag agcttgatct ccatgggcac cacggcgtac
    89101 gtgccctgcg cgtacagcct aaagtccagc aggcggtcgt gatccgaatt cttggacgac
    89161 ttgatctgct tggtgaagag aaagcccttg cgcgacgacg tggtggagaa cgcgccgtga
    89221 atggattgaa aatgctgcgt catccatttg gataccaagt tggtggtcaa cggattgtcc
    89281 acaatgtatg aggtagcggt aataagcgcc acgttctgga tcacgtaaaa gacggatctg
    89341 aaataggcgt aggccagcag cggctggaag gccacggcgt agggattcag atccaggttg
    89401 aaggcctgcg tggcgcccgc cacctcgtcg cggctgctct tgaggcgcac ctccgaaacg
    89461 aaacccaggg cctcgtcgtc cacaaacttg ttgagcgccg aaaagacggc cacaaagtcg
    89521 cttttgccgt gcgcgctaaa ggtatcctcg cccgtcacgg ggtcgatgag ccgcatcttg
    89581 cggcagtaat ccaaaatgcg attgagccga taggtacggt ccacgctagc gcccagcatg
    89641 cgaccgccgc gccccatcat tcccccggaa tccccgccac ccccaccacc acgaccgccg
    89701 cccagaccgt cgctcgggcc cccgctcacg tcccgtccac cacccccgcc agcaccgccg
    89761 cccggaaccc cgtcgtcacc tttgccgtcc aaacccccgt ccttggcgtc gacgttgtaa
    89821 cgccgaccga agctgcccaa aatatccacg tcgttgagaa aacgcgactg gacggtgatc
    89881 acgcagggct ccttcttggg ctgcttgggc accacgggca agcgggtgcg cacccgcacg
    89941 aaggccgtct gataacacgt gtggcaacaa gtacccccac aggcctcgca cagccccgcg
    90001 gcgcagccca ccaggtgatt cgtgagcgtc gacgaacccg acaagcccgt gttatacacc
    90061 gagacacgat ttagatacca gacgaagccc gaaactagct gcggacacgt gccacacacc
    90121 aacgccaaat gctgcggccc atagcgttcg tccttgagcg gcgcgccttg aaatttgagc
    90181 accttacgcg cgtcgttgta gacgtcttcg caggccgccg acaacccgtt ggtgaactga
    90241 atagccttga gcaacgtctc ctgactggcc gtaccgccgg cgctgggatg ccgcgccgac
    90301 gactggagat acaccagcct gtgctggtag agcaccgaat tagcgctgaa gaccaaggcg
    90361 gccacgtgcg tcgagagatg caacttgagc tcggtcagcg cgcggatcag atcgcggtga
    90421 tcggttgcgt tggtcactaa aggccactcg gaaaagagca tagactcggc aggttggtag
    90481 gccgaatcga aaaataccga ggcaaaactg aaggccaact cgcaaaccac cgcgtcactc
    90541 agcatcagat gatccttttc cagactgctg agtcgctggc tcatgtaccc caagtagcgc
    90601 ttatgtggcg ccagcttcac cgactgctga ctgtcgtgca caaactgccg caacgccgcc
    90661 tcgatcagca cacgcggctc cgagaagcgc agcgattgac accatgacgt gtacacgtag
    90721 tagaaaagcg tctcgcttac ggccggcacg tagaaccctc gcgcctccac aaaagcgctg
    90781 cgcgcatcca gcgagacctc gtcggcttcg gcgtcaagct gcagcgaatt aaagagcgta
    90841 ggcgggtaca acggcacgcg caccgcctcg ccgccgtgca gtcgcaccgt ggtcgcctcc
    90901 tccacgcatg gaatcagctg accggcaaag agaaactcct tcaagccgtt gcccaccacc
    90961 acgtgcacag tcgtctcgga cgcctgacag cccaccgccg cgcacaacgc caccagatcg
    91021 gtaggcacgc gatccgcctc gggcgtgtag gcctccaacg cgtacttctg gcgggcgtcc
    91081 tcgcacagcc gatgcacgtc tccgtgaccc tcggtaaaag ccacgatgcc ttgcgtatga
    91141 tgaaagtaga gcgcaaaagg acagaaggac gtgactttcg taagcacccc gccgtcgtaa
    91201 caaagcacag gcgtgcgcac agaaacgccg aaatccgcct ccaccgtgag ccccgccaac
    91261 agaggagcga tcaccacgct cgaggaacgg tcgcatagcg agagagtggc cagaatctcc
    91321 tgcgtttctg cgttcaacct gctgaagtag agaaaagccg cgggccccac cggcgctagc
    91381 gcggttagtt cctcgtggct catggtggat gaacggaaga caatggctac gccgccactg
    91441 agtgaatttt ataccaagga aaagttcagc acgtcatgtt tgacgcacga cgtctgatac
    91501 accaccgtgg ccaccactgc ggtctggctg cggttgcgga ccaccaaagg cgacaaccgc
    91561 aacgatccca gcaattcgta agaaaagcta accgttacgg tcgggcagcc tctcgcagcc
    91621 agaccgctag ccgacgcacc cgcccgcgaa aatagcgtga tgttcgggac ggcttcgcgt
    91681 caccgcaaac taacgtcggt agtcgcgcac gtcgtttatc ctcagcacac cgtccgatca
    91741 caacccgttt tcccactcag tcgcacaagc agcacataaa aaccccacac agagcacgtg
    91801 aaaacaacgt ccctagaaaa cggtgttttc tgtcctaccg tcaccgggcc acacaggcaa
    91861 atcccgagcc cgatccccgg aaacaccgta cggtgtttgt ggcctctaaa atcacatcag
    91921 ctaacaaacc gtgaaaagtc acgtttcacg aacacggtgt ttttaaatca caaagaacca
    91981 cctgacggtt tacaagcaga aacaccgcac cacggtggta caagcgcggt ggatctggtc
    92041 tcgcaacctc aatcgccgct atcaccaccg actttcgctg cgctccgccg acaaaacgcc
    92101 gtacaagtta cacaccccaa aaacctgcgc gcctatgggc gccaaacgtg tgtattatct
    92161 caacgttaca acacgacaca aaccgcgtaa cgtggtttcc cgaacacgta cgcggcacag
    92221 acccccgaca cgtactcgaa gaccttacag tttacgagtc aataaaacag gaaaagatcc
    92281 gaactttaaa attgtgtatt tttattttcc catccccctc tttttaccaa aaaacacatt
    92341 tttcgtcttg taaaaagtaa ctttcgccca ttgccatgaa acaccgtgat ggggaacggt
    92401 gttgtgtgtc gactgacgtc actacggcga tcagtatcga cgtcgtgtat acataacggt
    92461 gcccggtgtt tttattcggg gcgttgtcgc gtcttgatgt aatgtaacct gaaaccgccg
    92521 tgcctaagaa tgcggaagcc agcgtgtaat cataacgggg ttttgggtac aatctgacga
    92581 catctggcgg cgagcgtaca ccatcgaatg tggcgatcgc cggctctacg tcacaatgac
    92641 gcaaaaacac tgtaaaactc gcgtagacag ctttcctggt caatgagcgc catctggtgt
    92701 cggcataaga acaggcatca accccgtggc cggcgaggcg gtgagcactt ttgttggtca
    92761 cgtgaccatc tgcgcaggaa gcgaggcccg tagaaccgcc caagaggcgg tgccagatgc
    92821 caacgtcata atcacaaggt gatttgttac gtcacgcgca cacgcacgcg cgcgcacgca
    92881 cgcgcgcggt agaatacagc gatccctagt gaagccacac ccattacgtg tagccatatc
    92941 cgcttacgta tacagccaca cccctaggta cgccacctta tctaccaatc acagaaacgg
    93001 atataaaatg acccctccct agactccacc ccttgtacgg aaatttcaga taggtggaac
    93061 ccgttagggt tccaccgtcc tcggtgtacg tacaggcttc tccgtctact ggaaatatac
    93121 acctgctgac gtagacgcta ctcccggata cgcgtcataa gctactggac cctagggggg
    93181 agtgtctaca gggctacgtg cacgccccct tacttagggt atccgcccct ttcctctgtt
    93241 ttggcctaat aaacttaacg ccgccgcttc tcacgtgacc cctgacaagc ctacgtcaca
    93301 ctcgcgtgac cacacccact ccggatatac gtcatcctgt ggaattccgg acatacggtg
    93361 acgtagcgag cgtagcgagc tacgtcaccg tatgcgtgcg tcatctccgg cggaaatcat
    93421 ctctgatgac gtagcgagcg aagcgagcta cgtcatcagt ccgttttacg tataccggat
    93481 gctaggcgac gccccgtagg ggcggagcct agcttccacc cctaggatgc ataccctata
    93541 tagcataatt cttctaacga aacgttctac gaaaacggac tggcggaacg ggaaccaccg
    93601 taaccccccc ccctcacccc cccccttctc ctccggaacc ggggggggca aatttttacc
    93661 aaatttgggc aaccatgatt tccaatggga cggcgtttcc gtgcgcatgc gcagtcgggg
    93721 cgagtttttg gttgtcaggg cgttgccacg cggattatgg gatggtgact cgagtgcgca
    93781 tgcgccgggg atgccgcatg gaaagcctat atataaggag gggcgaatca ggggccccgg
    93841 tgcgcatgcg cgggccaggg cccgcaggag ggtcgccctg cgcatgcgcc ggtaaaattc
    93901 caccgtgtgt gtgtcgtgcg catgcgccag tatttttcca ctagaggcgg tcagtgcgca
    93961 tgcgtcggta aaattccact ggatgtgcgc cgtgcgcatg cgccggtatt tttccactgg
    94021 gcggccgcac ctagggagcg cgagccccgt gccgggcatg ggccgcggcg gtggaaaatt
    94081 accgctccgc ccacctaggc ggggcatctg aaaacctata aaacccggcg tgcccgccgc
    94141 cccccggcgc agtccgcggc agggttccgg ccgtgctgcg gtccgcacgc tgcgcccgct
    94201 cccgcctgcc tcccgcccta ccccccaccc tccccggccg aggcccggcg ccggtccgtc
    94261 cgcgggcccg tcccaccgcc ctggagcacc atccggggcc gtgggccggg caccgggcgc
    94321 ggcccgctcc ggacctcggc cgggggtccc tcccctcccc ccgctcgacc ccccatccga
    94381 cggcccggcc gggctgggac ccccgcaccg gggtcccggt tcccgtccgc ggcccggggg
    94441 gacccgagcg ggggcttccc acccctaccc cgctcctccc cgggctccgg cccgggatcc
    94501 ctcgctgctc ccggcgacct ccgccggctt cccggtccac ccgccgcgga acggacggga
    94561 cccggggtcc gcgcccttcc cctcccccca cggggggctg ggtcgcggac cccgggtcct
    94621 aggctcgttc cgcggtgggc gaccggggat cccccaccca gctccccttc tcggcccgcc
    94681 ccgctggctt ttgggcccct ccgggctttt ttccggctgg gggtcgcggc ggtcggccga
    94741 cgacggtagg tgggccgggt ggacggtggt ggggacgggc gacgccccgg ctcgacggca
    94801 gtcggtcctg gaaggttggg ggctgggggc ccggtcagga gctccgggag cggggtcgac
    94861 cgcgacggct tccgggtctc gcgacggctc cctctcggcg gctccggttg ggctcccctc
    94921 ccccttctcg agggtccggc cgccagtcgt gaccgggggt ccctcggcct agccgccggc
    94981 tctcgggccg ccttatcctg ggcgttggcc ggtcccgtga cgctcccttc ccccgctgct
    95041 ccccaaaaaa gtccgcccga accgtcgcgg cttgctggcc ctgggcgtgg tcccccactc
    95101 ccctcccccc atcggccgcc cagccggggt cggcgcttcg gaccccacca ggctgtggcg
    95161 tgtgtgctgg ccgatgcggc ggcgaggttg ggtgtggccg gaagcgctcg gggtcgacgg
    95221 tgggccgcca tgacacctca attgtcgtca gtacacccct ccacaatcac cgtccccaca
    95281 cgatgggccc ggcaggtcac ccaacgttgg ttcaggccca gtcgggtttt tccccgacac
    95341 gaacgcacgt ccccgtgggc tccacgcgtt ttccaccctt tcctggaggg gtccggaaca
    95401 ccgtgaatcc acggggaggg tcccggcacg ggccgaggag accacgaccg tcccacccgg
    95461 cgtgtcgacc cgtccgagac ccgggaaggg aacaggcccc accatttttt ttcccttctc
    95521 cgatttgccg tggaaaaccc gtgaaccgat acgggtacag acggccgaaa aaaattcgag
    95581 acaatacgac ggcaaggcgt gattttttcc cccatccgac aaaaccgtgt cccttaaaat
    95641 tccccacctt tctctgttca aatggccccg aaactgtaaa acaccgtttg accgcacccc
    95701 aaccggcgcc atcttggtga ccttctcgac ggttctctcg ctcgtcatgc cgttctgagc
    95761 tccgacatgg cggacgagag aaaatggcgt cgagagccta ggagcgtttt cgctccaggc
    95821 gggtaaaaaa atagcacgat aacttttctg tgctttgaga cgttttagaa gagctttttt
    95881 ctgctcagag cgaaaaaatg atagccctga aaatctcgac gagtctggcc gagcggcgcc
    95941 atcttggagg aggggcgagt cgcgggcacc gcctcggtac cccctggccg aggcgagtcc
    96001 gcggtcgccg cctgttccgt gatgctacct agagggcgct gtcgaggcga ctcttcctgt
    96061 tttcgccctg agggctaacg gtcgctgacg tcaaaccatc tcgtgctcgc tgagtcacat
    96121 ccggttgttg acaagcgatg gaggaccgca cccaaagtgc gccctctagt catcgcgcct
    96181 gacccctttt ataaactgct cgaagaaaag aacaccttat gtgaaaaaat acagaatgat
    96241 gacaagttca tccaacacaa ccgctcaaca acgccatatc tatcagtgtc caaaaactat
    96301 cttctatcct ttgaaactat aaatgctgcc tatatacata tttagtatcc aagactctta
    96361 ccacgtagac gaaaagaagt gatacaatga tcttgacgtg tatcgtctat atcgtgctag
    96421 atatattcag ataagacgcg caaaccatag atttctcatc agtatcatga aagacctata
    96481 gctctatata cgaacctagt cattttagga cagccgccgg agaagccgac gagggatcgg
    96541 gcgggtgcag ccagaacctc gcgcccgatc ccgcctccgg taggcgattt gcatctgttt
    96601 ggtaaaaagc tcataagtct gtatgtgacc tatatatata ttatacgcta tgtacaccga
    96661 actgtcgctg ttgtataaga agaaaaaact ctccatattt atatcgtctg aatttttgct
    96721 tgatagacac gtgtttggaa ctctgtcccc ccacgttttc actgtgtata acaaaaatat
    96781 gtgtttctca aaagatcttg aggtgtttga aaacggggga aacctgcgtt tgggtgcgct
    96841 aagccccgga ctgggacgta gccggcgtcc ggcacctata tttttctatt tttttttaca
    96901 aaatatatga tgaaccaaga ataaaactct agctctcgtc tatttttaat atgctctact
    96961 tagaaccttt ttaatgacag aatgaactcc atgttatacg ctctttatat agtttctctg
    97021 cactaacctt taaaaccgta tccttccctg ttgtacaaat catcttttga tacacaatga
    97081 tgacctgata tccctccata tatatgatcg gatattattc cgttagactt gtcctccttt
    97141 tttttcctca tctcctatat ctggagatat atgttgacca ccaccgccat gaccaccaaa
    97201 aagctagccg tcacgactag aaatgtgtag gattcggact ttccgttcga gaagaaagag
    97261 accgcgtctc tggacgctct ttttgtcggt ctgaatcgac ccgggatacg taagagagcg
    97321 gccctacatc ggggggcgct cgagaccgac gacgttccat ctgaccagaa aaaaaaaggc
    97381 acccctcggt agcgacctct caccatcgtt tgcccgtccg cccgtccttc gtagccatca
    97441 tcatcatcat ctcaggctct atcggtacca tcgttgtcat ctgaaaaaaa aactgcctca
    97501 cccacctgcg taaaaacacc atctttccgg aggtgcggta agacgggcaa atacggtcgt
    97561 gccgaggcaa aaaaacgcac catcgacacc acaccctcat gagcaccacc tgtcggtgtt
    97621 ggtcgtcctc catcgttctc tacgaacatc tcgacgcccg ggtgacggac gacggcaaga
    97681 cgtcccggag aagacggtgt tctctcgggc ggtacgctct ctggatctat aatatctata
    97741 gtagctaaac gagactgtga gtacgacgaa ccacatcatc ttttttttat gttgcttctt
    97801 tagaaaatga cttatgtcga cgacactcgg catcagccat cttgtgaaac acgctcgctt
    97861 ttcgtctctc caaggaacac tgggtccgct gaaagggacc gtgtaccgac caaagcaaaa
    97921 aacacacacg tagtaacatg atcaaccacg tctgaatgac acgaaaacac aatcgtataa
    97981 cgctctattc atggaacgaa cttggaataa aaaaaccatc gcaggccaga ggctaagccg
    98041 aaaccgtccg gggaagcggg cgcgagtttt ccgacttagt ctctggtgct cgttgagcct
    98101 cttttttttt tttctgattc tctgaagaat caccgtcaca gccctatgac gcgaaatcaa
    98161 ttgctagaac ataaacgttc tcaacaggta tgaaatgaac aaactagatg atgctataac
    98221 cttatattgt gtgtatatag ataggtgtga aatttgtagg ataaaaagtg tcgttgtatg
    98281 atgcacaacg atcgtgaaac tggagactgt agctctctac cgaatgcaaa tacacaaatg
    98341 acatcgattc ccgtccccac ataaagaaat gtgctttact gtgaaagaat gaagaagatt
    98401 cttgttcctc gtacgacggg gccctcgctc gtcgtgcctc ttcccccctc cgggagaggg
    98461 gacgtcgggg ccctccgtcg caccgggccg aagccagtga aatgtttact acactgtcat
    98521 cagaatatat gatgtatatt atttcctcca aactcctcac catagccacc aattcgcatc
    98581 acttaagaaa gtagtagcaa ccgcggcggc ggcgaccggc cggtcgtcgt ctcctcgtcc
    98641 tcaaatgttg tacatgtgca gaaaaatgtg taaatacgtg ttatttatcc catgcgtctt
    98701 gtacatagat atatgttttt atatacgcta tttatacttt atatatcctt ttgcataacc
    98761 atagacagtc aaggatttta atgatttgct catccgcctt tgagccatcg cttaggagtt
    98821 agttcctcta tgttctcggc ccaccttttc gactacagta gcaaaccctt gtactaccac
    98881 cccgataaaa accacatcat catcgtcacc acgacctgga aacgacacac gttctccccc
    98941 aatcttgggc atgtgtatat atatataaag aatgggaggg agaggacgtg gggctcgaga
    99001 agaaataaac gccaagctcg attcgaacca aaaaaccaca tgtgtattgt gctttgtttt
    99061 ttttttttac ggtggggaaa aggagggggc cgtcattaac ggaaaccgtg tatggggtcc
    99121 ggacacgaac agtacacagc ttatggggaa aaaagctcac agagagaaaa aaaaacacca
    99181 agctcaggca cgcgtacatc attatcatca tcggatatct caccacgagt catagtagta
    99241 ccaaggagtg tgtaacacca ttttttcttt tttctttgta acgggataag ggacagcaat
    99301 catcacgcac aacacccctc actctctttt tagtcatcca tatcatcgct gtaacacagc
    99361 atgtcctcgt aatcgggcgt ctggcagcgc attaccaccg agtcgtcttc ttgcggtacc
    99421 ggtggtggtg gcggcggcgg cggcggcggc ggctgctgct gctggattgc cgtcgtactg
    99481 tgattaccgt tggcggactg caccgggatg atgggctgct tgtggggaac ctggggtgga
    99541 ctgccgccgt gagaaggcga cggcgtcatc aagttaagct caccacggtg actacggaca
    99601 ccggcgaggg gcgccggggg actgggaggg accgcggtcg tcttgtagac gacggtgtcc
    99661 ccgtgtcgat ccgtggctcg taccagatct tgactgctag cgtcgtcact gtcttcgtcc
    99721 tcttccagct cgccctcaga gtagtgctgc tgtggttgcg acggtggctg ggtggaagga
    99781 gcggcggcga tcattggaga aggatgtcga tgactccctt ctctgtcctt tttatcgtag
    99841 gctgtcagcg ttgctgggtc cgtcctgctt tccatatttg cgcattgctc atcggtggga
    99901 tgaatttggt ctcctccccg ctgttgtccg ccggcagtgg catggttgct ggcggttgtc
    99961 gttgtcgtac cggcaaagac ggtgagatcc aatagcgact gctcgtcgaa gggacagtac
   100021 gctatcatga aacgataggg tgccaacgcg cgttggatgc gcagttcgca catctcgttc
   100081 tgacactcgt ggcactgcag ggcgcctagg atcaggtccg agacagcgcc gcagcggtag
   100141 gtacccatgg cgttgttagt atcgaactgg tcaaaaaatt ggggcgtacc ggtgacttgc
   100201 aacgcgcgac ggcgtagcga gacggccacg cgcgagaaag agcacacgta ggccatggcg
   100261 cggtgcatgg gttgcgagaa ggtctcgggc ggacgcttct gcagatcgca gacgtcgtcg
   100321 cgtagccagg cgctcatttg accgggcttc ttgactaacc gtttgagcgt gctgcaatgg
   100381 tcgccccagc cgtcctggtg gtccaggatg cagcccaggt ccaggttgtt gagtttgttg
   100441 aagagcagct gacgcatgcc gcccaccgtc tccagataag gatcgtgcgg gttgacgggt
   100501 agcccgtgca ggtggtggta cttcatgtag ctgagcgttt cgtcgatgat ggccagcaac
   100561 gtgtgcaagt tgggagcgtt gtacacggcg aagatctttt ccaccaccag cttgcgcagc
   100621 aacggttcct ccagccaatc gaactgttga cggatgtgca acaggtagtc ggtgtgcatg
   100681 agctcgtcgt gtgacagcag gatgcgaccg cgcggctgat gatcttgcgg gaaggcggtg
   100741 gggaccttga gatcggcggg gtagggtgcc agacgtagac tctcggccgt gtagcgctga
   100801 aggtcgtaga cgggcgaggt agaactcggt gaggtacccg acgaggcggc gccgcgctgc
   100861 agacgcgctc tttttttctt ttcgattaaa cggctgagtt gctgtagttc gtcctcgtcc
   100921 atggcgtcca gttcgtcgtc aataagcgcc agcatctgtt gttgttgcgg tccggcggac
   100981 gatccgtgat gattattggc tgaagagggg tgagaagaac cgaaagtcgt aggacaactg
   101041 ggaactcggc gacgaagatg cgtcgaatcg ccgccgtgat ggtgcggttc gccgtcatcg
   101101 ttgtcgtgag acttaccgta gtgggggtta aggggcaccg aggcggatgc ggccacgcgt
   101161 cgcttgaaag aggaggacgc cctatgtccg ccacggaagc ccgcggtgcc catgatgatg
   101221 tgtccgccgg tgcccccgag tgcgtggcgg gaggagggtg gaaggggagg aggatagtgg
   101281 tccggatcgc cttcggtatc atcgtctttg ctgtagcggg gtcgtcgtgc ggggacgcag
   101341 ggtcggtgat gatgcgaggc ggcgccgacg gtattttccg cgagatggta ttcgctggcg
   101401 gctgctccgt tccgtgtcga cggcgaggtt ggacttcgct cgcgtcggaa cttccgtggc
   101461 acgggttcgt aatccagaca gaagcgccgt gcgcgacggg cgcggcgttc gcgctcgctc
   101521 agggaagata acgacggagc gtcgtgacgg ccgcgtgagt gcagctccat ggccgccgtc
   101581 gctaggaagg tcacgttcgg gcacgctgat gtatatatag atgagaccgc tgccgggggg
   101641 cgggtcaccg gcgccgtgga aagtgaggct cagacggcgg tcgccggcgg catgggcgcg
   101701 tcgggcggtc tgattttgat ggaaatgtgg acgtttttgg cgttggagtg acactttttg
   101761 gtgaaacagc ggctccagag gctggcccag agcgcgtagc tgtgctcggt gcgcaggtcg
   101821 atgaacacct gcacggtctc ttgcgggttg cggtgcgtgt agttgagaca gcgaaaatcc
   101881 cgcgtgcgcg cgccgtcgcg ccgcttgacg gccacgcagc aggcgccgtg gggctgaaag
   101941 aggaggacgt ggggcgcggt aaactgctcg ctgacgtgcg gttcgtagtg ttgcgtgagg
   102001 tgctcgagca gcggcggcca cacgcgggtg acgacgagcc gctgcaagtc cgtgtcggaa
   102061 atcgcagcgg cagtggcgcc gtcgccaccg tacaggtgat aggcgagcac ctcggtgaga
   102121 ccgcggcgtc gataacgcgt cacgttaagc gagcgcgtct cgataaagtt ggcttcggtc
   102181 gaggggcaga ttttgtcgcg tacgctgaga atgacgcgtg gcggcggtga caggggcaac
   102241 gcgggcaggt cgtgcggcgg gtggtggtga agcaggttac gcagatccag ttgggcgcgc
   102301 acaaagccta gcgggtgttc gcggtaggcg tcgggcacga tgaacagcgg caacagacgg
   102361 cgatgcatga aatagccgtc gtcttggtcc attttataca tgtagggcag acgtacagag
   102421 cgtccatggt ggtagatgcc tgtgtctagg ctgctctcgg gatgcgagat ggggtccagc
   102481 agcgtgtgca gttcggcgtc gagacagacg gcgtgattga gcacctgcgc cacggcgcgt
   102541 aaaacgctgg ggtgtacggc gacggtgcag gcggggaacg gcgtgatgat gcgcagcccc
   102601 agtttgccct tgcagcggca gtaagggggt gacgtgtcaa cggaggacgt tgttttttgg
   102661 aaaacgccgt tatccgggac gttattttta tcctctttcc cgtcttcgtc ttcctctgtg
   102721 tcgcgctcgt cccggtaatc gagatagtcg tcgtcatcga aaggcgcgcc ggccgcgtcc
   102781 acgggcacgc tgttgggtgg gcacgcgctt ttgaagaaat agaccgggtg ccggtcgggg
   102841 tgcgtgtagc caaagaggct cgcccatacg gtcatccaga cgcgtcgtag tccgcgacat
   102901 aactcaaaga cggtgtgtcg cgccagaccg gagacgccgt cgcgtagccg taaatcaaag
   102961 tcggccacaa aattgaagac gggcagacgt tcgttgaaga cttcgtgtcg cgtgtagtag
   103021 aactgtgtct cggggctggt gctggccacg tcgtcgtcgt gtagccacac ggtctcggtc
   103081 agggcctcgt ccgagaaacg gctgtcgggt acgtgacgga gcaggtcgcg cggaaagagg
   103141 ctgcgatgcc aggtttcgga ggccacggcg cagaagacgt gctggtcatt gggcaggtgt
   103201 acgcggtaga cgggcagcgg tcgctccagc agcggtgcca gcgcgggctc gggtagcagg
   103261 tagcgacgtt gcgagtaacg cgttagcgtg ccggtggtgt aggtctgagc tgtgcgcagc
   103321 gaagcgcata gacgtaacaa gccggacagg gagcgttcca gcggcgagaa gacagactcg
   103381 gaaagcgtgt tgatgcgttc gagctggcgc gccagctgcg tggaggtgcc gaagaagccc
   103441 gccaggtgcg tgccgtcgat gcggccgccg tagccggcca gccccaggcc gtgcgggctg
   103501 gtcgccgagt ggggggattc gtcgagacgc agtaggtgcg tctccacgta gtcgtgtaga
   103561 aagttgtcga gcgagaagta tttttgcatg acgtccagca gctcggtgga aagctggcgg
   103621 cccagaaaac ccggttcgcg cgtgcactgc gcttcgggcg ccgcgtcagc gtcgtaagcc
   103681 accacgcgcc ggtactcgag caaccgcgcg cgtgccagcg ccgtgcggta ggccaggtag
   103741 acgtagtgca cgcagaccgt gtcgggcaga cgcgcacgtt cgcggaacgc gttgatctgc
   103801 gtgtccacct gctctagctc ggtgtagtcg cggcggttgc gcgccacggc gtacgccacg
   103861 aaagcggaca cgcgctgacg gaagggcgag cccagtagca gacgcgcgaa ctcgcccatg
   103921 gaggcgtgcg tggggatgat agtgcccagg tcgcgcgtgc agaaactgcg cacgtactct
   103981 tccacggtgg agatggtgct gtactggccc tcgaataggt agtaggccat ggtcagcagc
   104041 acctggccct cggtgtgccc gaagacgctg atgaaccacg agggcgaggt ggggcagagg
   104101 aagacctggt tgaggtgacg tagcacggcc gcgtggtgaa agtacaccag gtgcttgaat
   104161 tcgcgcacct cgccgccgtg ttcgggcgag agcacgggcg tgcggaagag atgccggtag
   104221 agcggccgcg tctcggcctc gtccagactg gcgatgagcg ccgagagggg gatgggctgg
   104281 cgcgcggcca ggtagcgcga gagctgcagc gtttcgttgt tcacggcgaa gacgggcgcc
   104341 acccgccgcg agtccgagca cttttgcgtc tgtaggcaga aataaacacg tcgcgagacc
   104401 tggtgtttga ccagcagggg gaagacgcag tgatccgtcg gtgtctgcga gagtacgttg
   104461 gcgactatat gagcagaatc atactctgtt gcgaacagaa cgagcgtcat cgtcgcgccg
   104521 gcacgatgca gctggcccag cgcctgtgcg agctgctgat gtgccgtcgc aaagccgcgc
   104581 ctgtggccga ttacgtgctg ctgcagccta gcgaggacgt ggagctgcgc gagctgcagg
   104641 cgtttctgga cgagaacttt aagcagctgg agatcacccc ggccgacctg cgaacctttt
   104701 ctcgcgacac ggacgtggtg aaccacctgc tgaagctgct gccgctctat aggcaatgcc
   104761 agagcaagtg cgcgttcctc aagggctatc tctcggaggg ctgtttgcct cacacgcggc
   104821 cggcggccga ggtggagtgc aagaaatcgc agcgtatcct agaggccctg gacattctca
   104881 tcctcaaact ggtggtgggc gagtttgcca tgtccgaggc cgacagcctg gagatgttgc
   104941 tggacaagtt ctccacggat caggcctcgc tggtggaggt gcagcgcgtt atgggcctgg
   105001 tggatatgga ctgcgagaaa agcgcgtaca tgctcgaggc cggcgcggct gcgacggttg
   105061 caccaccgac gccaccggcg gtcgttcagg gggaaagcgg cgtccgcgag gacggggaaa
   105121 cggtcgccgc cgtgtcggcc tttgcctgtc cctcggtttc ggactcgctg atccccgagg
   105181 aaacgggggt cacacgtcct atgatgagtt tggctcacat taacaccgtc tcctgtccca
   105241 ccgttatgag gttcgaccag cggctgctgg aagagggcga cgaggaggat gaagtgaccg
   105301 tgatgtcgcc gtcacccgag cccgtgcaac agcagccgcc ggtcgagccc gtgcagcagc
   105361 agccccaggg acgcgggtct caccgtcggc gccacaagga gtcggtgccg caggagacgc
   105421 tgcctacgaa tcacgaacgc gagattttgg atctcatgcg acacagcccc gacgtgcctc
   105481 gggaggcggt gatgtcaccg accatggtca ccatacctcc tccccagata ccctttgtgg
   105541 gttccgcgcg tgaactcagg ggcgtgaaga aaaagaaacc cacggcggcg gccttgctgt
   105601 cctccgcgtg aacagcctgg cacgttttgg aaaacgtacg tgatcacgga cacgacgagt
   105661 acggggtttc tcatggacgt actttattag gtcaaggatg acggggaggt ttcgggccga
   105721 cgtcaaaaat aacgtcactc gtgttgacag ggctttctgc gtcggagctc ttttcatcct
   105781 cttctgtctc gtcgacgtca tcgtctaccg gcgagggtgt ccgttgcagc aacgcgtgct
   105841 cgggcgtgtg ggtgaaaccg atgtcggggg tgggcggcac gatcatttgt cctagggggt
   105901 gactgcccac cggcagatag gtaaagcggt gggtggtaaa aaccgctttg gctacggtgg
   105961 tgtgtgggga gatgcagacg gtggtgtgcg aagtgttgac caccgtcacg ccggccgcgg
   106021 tacccgggag ccagatggtg ggtcggatga tgagatccga ctgactaaac tggcgcacgc
   106081 ccactatgag ggcgcagata ccgggcgcgt gcacgtaggc cgcgtcaaaa tagacggttt
   106141 gcgtgtgacc cggaccgatc accagcgtct gacgggtacg taacacaaag aaacggtgtt
   106201 cgttgggcgg tggcaggttc atgagctgcc agggttctgg cacaaaacag gggaaaacgc
   106261 cgatgtcgcc ttcgatggtg cccggaaaga tggactgaaa agtgtcgttg aggttgacga
   106321 catccaactg cgggacttgc agcccggatt ccagcagctc gggcatgcaa acgaattgcg
   106381 cgtccaggca tttgtaaaag gtaatgccga aaaaaccttc ggggatatag aggctgacgc
   106441 ccagcgaggt gggtactttg cgctcgcgtg acagccaaat gatgtgttta ttgtaaaagg
   106501 ccagctgcgt gtggcactgt ttgacgatga aactggaagg catccacttg tagggaactt
   106561 tgagcggcga cggtaatggc gacgacgctt catcttctcc cggatgctgc tctttgtcgt
   106621 atgtctcctc ggtcgattgg ggcagcgtaa atgtggtttg aaaatcgcta tcgctagcga
   106681 aacgcacgca gtaacgcatg ttgacggatt tctcggctag gatgatggag cctgatgacg
   106741 gtgcggactc ttccttcatt attaacgtag gggtctccca gaatcgctga aaacgggagc
   106801 gcggcagccg cgacagtacc agttgagagt cgattcggtc ggttaacatc gtaagcatcg
   106861 tggcggtggt gtgatggagt ggaacacact agtattaggt cttttggttt tatcggtagt
   106921 ggcaagttcc aacaatacgt caactgctag cacaccgcgt ccctctagtt ctactcacgc
   106981 ctcaacaacc gtgaaggcaa cgactgttgc gacaactagt acaactacgg cgacaagtac
   107041 ttcatcgacg actagtgcca aacctggttc cactactcac gaccccaacg tgatgagacc
   107101 acatgctcac aatgattttt acaatgcgca ttgtacatcg catatgtatg agctttcact
   107161 gtccagcttt gcagcctggt ggactatgct taacgctctc attctgatgg gagctttttg
   107221 tatcgtatta cgacattgct gcttccagaa ctttactgcg accaccacca aaggctattg
   107281 agggtggata gatttgcagc ccggcggtgt tccggcgggg taagatttcc atacgcgggt
   107341 aactggaggc taaagttacg gattttatct agaaacagca gcgagtctag atagtcccat
   107401 aggggatcta tgaacgttct ctgaaacctc gtcgatggtg acgtaggtgt agtttcgtta
   107461 ttatcggaag ccgtttcgtt ttccacggac atggtttcgt tgtaatataa ggagctcatg
   107521 tcaagagtgc cataaatagt gtacggcgtt tcgttacgaa tcagtacgtg cgtgtttttc
   107581 ataaattctg acacggcggt acggttacgg tctggtttac aaaagggttc attccgatac
   107641 cgcagagtag tatataccca tgttgcgaga tctcttaact gcgtggccat aatggatttc
   107701 ataaagttac tatcaggacg ataacctgtc gtagatgtgg caacccgcgt tacagcagcg
   107761 gtagcactat aagtcacgtt agtggtgacg ttgaaagcgg tagacgttgt ataggaaaga
   107821 tatggcgtag tagtactttg agatttctta ttcttttttt gtggttgttc tttgacaagc
   107881 gcttgtttac gtttgagttt tcgcatagtg tttttcaact tggtgccgtt aatatacttg
   107941 ggaacgcgga ataaatttcg gctcatggcg ttaaccaggt agaaactgcg agtgcagtta
   108001 cgttgcgcgt atcgtaaaag tagggcggtt aggcccaaaa agtagattgt ctgactatcc
   108061 acgttgactt tgttggaacc tatgtacagt tttgtgttcc aacgtggtac gttgaaaaac
   108121 ataggattaa acgtggtgaa attaccgcaa cctttttcgc cggtatcatt gcgtttggaa
   108181 acatttaaca tttcggatag gcagttcata gagggcactg tgccacaagg tgggggtcgt
   108241 aacgttattt tgtgggccgt gtgattatat tcggaatata cgtacttggc tggttttcgg
   108301 agttgagtac tgtaaaagtc aaaccacata tgggtaatgc tatcatttct aatgggaccc
   108361 gctaaaatgt agtcttgagg aaatttatcc atgctaataa cgatggcatg aaatttttgc
   108421 tgactggggt acattaaaaa ccggtatccg tcagatgatg tagacatcaa tcgttttaag
   108481 atatcttcct tctgtttctt cagaatctct ttacctcgat aagatagcac ggtatacggc
   108541 caggaacgtc ttgttcctct ggagtttacc aatacattac aatttatgag ggaaaggagc
   108601 aagaacgtta tagagatcag gagcataatt ttaggaatgc ctttcaccat tatcatctct
   108661 tttttcccca ttacagagga ggagaccccg caccgtccgt ctgccttgtg gtttggcttg
   108721 cctgcgtgta ctcactgctg attctggtcg ttttgctgct catctaccgt tgttgcatcg
   108781 gcttccaaga cgacctagtc tcccgcacct tggctgtgta ccgagcttgt atacagggcc
   108841 cgatatgtaa ccaaacccac aacagtacct cgtaaataaa gacgcacaaa cctcacgcat
   108901 atagtatcat cacaccgtgt ggcgtgtact ttattacaat gagcaagagt gcccctaagt
   108961 attggggccc gtaccgtttt agaaggtttt gtgcgaatgt ctttaacttc tctgtccctt
   109021 ttttcataaa ctgtcaggtc ctacaatcag catgtcttga gcatgcggta gagcagatag
   109081 atgccgatga tggccgatag cgcgtagacg gacatcatga ggagacgact gtcggtggcg
   109141 tccacgacga cgtcagttac ttctaatacc gtaccgtttt tcaaaagcat gaggtagtga
   109201 gttcgcggag atgagaccac cacttcgttg tagggatcca gggcgaaaag gacgtcgtcc
   109261 gagtcgtgca tgtacatgat gttgatgacg ccttgcgtgt cgtcgtattc tagcagggcg
   109321 ctttggcaaa aggcgcagtt ttctagggaa atgttgagcg ccgctgtgat gctgtgtgtg
   109381 gtatgcatgt tgcgcgtcag ttcgcattta gtttgactgt ccgtctgggt gatgatgagg
   109441 ctctggccta cgacggtggt ggagacaggg taggagatac ctttgatcag gtactggttt
   109501 gttacgacat aactgacgtg ttcggagacg gtcagcgcgg agaaggattc gcctagtggc
   109561 agacaaaaca ggtcggggaa ggtttccagc gtgcttggtt gcatggtaga taggatggag
   109621 agggcggcgg gaacggtagt ggggacggtg gcatcgggga agagacgtgt gaggcgttcg
   109681 agcgagtgat cgcgtcgccc gctactggaa cagggtgtgt acaggtcgct gaggtattcg
   109741 tggtgcggat gagctagcaa ctgcgtaaag tgtgatagct cggccaatga acagagaccc
   109801 gtttctacga tgaagatttc gcgtctctcc gtcgtatgta ccagcatgga gtggacgagg
   109861 ctacccatga ggtagagttc ttgacgcgcg aaggctgaaa gaaaagaggc caggtgcgtt
   109921 ttgtgtagtt ttagggcaaa gtcggcgatc tgtcgtagtg cccactgggg gatgagatgt
   109981 tgctgattct gtttagagag tatgtagacc aggcgtacga ggctggtgat gtcggtgatc
   110041 tgattcggtg tccaaagggc tcgtttggcc aggtccacgg ccgtgggata cagtagcaac
   110101 gtggtgcgtg gtggtgtttg tgagaggcag gtgatcataa attcttgtat ttgtaagagt
   110161 gcggcctggc ggtctagggc ccgtgggacg gagacttggg cgccggcctc ttcttgtcgg
   110221 gctgctgcga acagtgctaa tgcgtaggcg aaggccattt ctaccgtgcg gcggtccagc
   110281 atctgacatc gaccgctctt gagtacatcc acggcgtaac ggtgaaagct gttacgtagt
   110341 agtgcgctga ggtctaggta gttaaagtca agtgcggcgt caagaaagtc cgggtctttg
   110401 agataagagt gacggttcag ttgatctttc ttaactagca ccaggagctc gtgtttttca
   110461 gtttgtcgta gtataaagtt gtcgcgttga tagggcgctt tgaaaagtac gcgtggaaga
   110521 tggccgaaga taagcagcat gggtgtgtcg tcgtctatgg acaccgtaac tacgaagaag
   110581 tcctcggtca gtgttatttt aacgtaacgt agttcgtcga tgaggtaaaa gccttggtgc
   110641 aaacaaggtg tgacggtgct gaatagtaga tcgtgtccat caaagaggat acacgtctgg
   110701 ttaaagtgtg gtcggtgtag tcctgaggtg gtatgtgatt ctgtccagcc gtgtggagtg
   110761 gtttgcggtg gcatccaaac gtgaggtatt gacaggtcaa tgggcggtgg cacagtggtg
   110821 ggctgctcac ctaggctgtc ttgtgccttt agctgctgcg aaaaagatcg gtagctggcc
   110881 aggtctttgg ataccagcgc gtaagtgtta agtctctgtt ggtatttttc tagggtttcg
   110941 gtcagatcta cctggttcag aaactgctcc gccagaggac ccgcaaaaag acatcgaggc
   111001 atatggaata catagtattg attatagctt tggaaaaagt tgaaactgat ggcgttttcc
   111061 ctgacgaccg tgctgttacg gaggctgctg ttgtaggtac actgggtggt gttttcacgc
   111121 aggaagcgga tgggtctccc gtaggtgttg agcagtaggt gaaacgcttt gtccagcggt
   111181 tcggatacgg cttttgcgcc atatcgtgac gaaagtaggt ggctgaggag acagacggcg
   111241 aggacgatga ggtaggaggg gaggcctggc cgcatagcgc ggccgcgccg ctgggttcag
   111301 cggcgtgatc caggtggtgg ttggcgttac acccgagaga aggagagaaa ggatcccagg
   111361 aaggagcacc cgggtgtggc gctacgggtt acaaaagtcg cgtctccgtc tatttaatac
   111421 gatgtcattg gccgctgcga agggagaaga ggggacacgc gagtaagcca tgccgtccgg
   111481 gtgtggggac gacgctgatt cgacggggaa cgctctgcgg agattgcctc acgtgcgtaa
   111541 gcggatcggt aagcgcaagc acctggacat ctaccgtcgc ctgctacggg tctttccctc
   111601 gtttgtggcg ctcaaccgcc tgttgggagg ccttttccca cccgagttgc aaaagtaccg
   111661 tcgccgtctt ttcatcgaag tacgattaag tcggcggatt cccgactgcg tgttggtgtt
   111721 tttaccgccg gactctgggt cgcgcggcat cgtgtattgc tacgtgattg agttcaaaac
   111781 cacgtactca gacgccgacg atcagtccgt gcggtggcac gccacccaca gcctgcagta
   111841 cgccgagggc ctgcgccagc tcaagggcgc cctggtggac tttgattttc tgcgtctgcc
   111901 gcgcggtggc ggtcaagtct ggagcgtagt gcctagtttg gttttttttc agcaaaaggc
   111961 cgatcgccca tccttttatc gggctttccg ctcaggccgt tttaacctgt gtaccgattc
   112021 tgtcctggac tatctgggac ggcgtcagga tgagtctgtt gcacaccttt tggcggctac
   112081 ccgtcgccgt cttcttcgag ccgcacgagg aaaacgtgct gcgctgcccc gagcgcgtgc
   112141 ttcggcggtt gctggaggac gcggcggtgg caacgcgcgg cgggggctgg cgcgaggacg
   112201 tgctcatgga ccgggtgcgc aaacggtatc tgcgtcagga gctcagggat ctgggtcaca
   112261 gggtgcagac ttactgcgag gatctcgaag ggcgcgtgtc cgaggcggag gcgctgttga
   112321 accagcagtg cgagctcgac gaaggaccgt cgccgcggac gctgctacaa ccaccgtgtc
   112381 gtccgcgttc gtcgtcccca gggaccggcg tggcaggagc ttccgccgtc ccacacggtc
   112441 tttatagtcg gcacgatgcc atcacgggac ccgccgcccc gtctgacgcg gcgaccgcgt
   112501 cagcggccgc cggtgcttct tctacctggc tggcgcagtg cgccgagcgg ccgttgcccg
   112561 ggaacgtacc tagctacttt ggaatcacgc agaacgatcc ctttatccgc tttcacaccg
   112621 attttcgcgg cgaggtggtc aacaccatgt tcgagaatgc ctctacttgg actttctcct
   112681 ttggtatctg gtactatcgg ctcaagcggg ggttgtacac gcaaccacgg tggaaacgag
   112741 tgtaccatct ggcgcagatg gacaactttt ccatttcgca ggagctgctg ctcggcgtgg
   112801 tcaacgcttt ggaaaacgtg acggtgtatc cgacgtacga ctgcgtactc tccgatttgg
   112861 aagccgccgc ctgtctgctg gccgcctacg gacacgcgct ttgggagggc cgcgatccgc
   112921 cggactccgt gacggcggtg ttgggtgagc tccctcagct gttgccgcgt ctggccgacg
   112981 acgtgagtcg tgagattgcc gcttgggaag gccccgtcgc cgcgggtaac aactattacg
   113041 cgtatcgcga ctcgcccgat ctacgctact acatgcccct aagcggtggt cgccactatc
   113101 atccgggcac ttttgatcgt cacgtgctgg tgcggctttt ccacaaacgc ggcgttcttc
   113161 agcatttgcc gggctacggg acgataacgg aggagctggt gcaagagcgt ctgtcgggcc
   113221 aggtgcgcga cgacgtgctt tctctctgga gccgacgtct gctggtcggc aagctgggtc
   113281 gcgacgtgcc cgtctttgtg cacgaacagc aatatctgcg ttcgggtctg acctgcctgg
   113341 ctggcctgct gctgttgtgg aaggtgacca acgcggatag cgtcttcgct ccgcgcacgg
   113401 gcaaatttac gttggccgac ctgctgggtt cggatgccgt agccggcggc gggttgcccg
   113461 gggggcgcgc gggcggcgaa gaggagggct acggggggcg acacgggcgg gtacgtaact
   113521 ttgagtttct ggtgcagtac tacatcgggc cgtggtacgt gcgcgacccc gcggtcacgc
   113581 tgtcgcagct ctttcccggc ctggctctgt tggccgtgac cgagagcgtg cgcagcggct
   113641 gggatccctc acgtcgcgag gacagcgccg gaggtggcga cggcggcggc gccgtgctca
   113701 tgcagctcag caagagcaac cccgtggccg actatatgtt cgcgcagagc tctaaacagt
   113761 acggcgattt acgtcgcttg gaagtacacg atgccctgct ctttcactac gagcacgggc
   113821 tagggcggct gttgtcagtg accctgccgc gtcaccgtgt gtccactctg ggctcgtccc
   113881 tctttaacgt caacgatatt tacgaactgt tgtacttttt agtgttgggt tttcttccga
   113941 gcgtggcggt gttgtaattt ccaccacgtg tcgctcgctg cataaagggc gagcgtcccc
   114001 ggagagggta tattcgtttg gcgagagcgg gcagtggtgg tgggtatgtc cccttctgcg
   114061 gagaagacta cttcagtcac cgattccatc atgctcgcta tcgtgaattt caaatacatg
   114121 ggcccgttcg aaggctactc tatgtcggcc gatcgtgccg cttcggacct gctcatcggc
   114181 atgttcggct ccgttagcct ggtcaacctg ctgaccatca tcggttgcct ctgggtgttg
   114241 cgtgttacgc ggccgcccgt gtccgtgatg atttttactt ggaatctggt acttagtcag
   114301 tttttttcca tcgtggccac catgttgtcc aagggtatca tgctgcgtgg cgctctaaat
   114361 ctcagcctct gtcgcttagt gctctttgtc gacgacgtgg gcctatattc gacggcgttg
   114421 tttttcctct ttctgatact ggatcgtctg tcggccatct cttatggccg tgatctctgg
   114481 catcatgaga cgcgcgaaaa cgccggcgtg gcgctctacg cggtcgcctt tgcctgggtt
   114541 ctttccatcg tagccgctgt gcccaccgcc gctacgggtt cactggacta ccgttggcta
   114601 ggctgtcaga tccctataca gtatgccgcg gtggacctca ccatcaagat gtggtttttg
   114661 ctgggggcgc ccatgatcgc cgtactggct aacgtggtag agttggccta cagcgatcgg
   114721 cgcgaccacg tctggtccta cgtgggtcgt gtctgcacct tctacgtgac gtgtctcatg
   114781 ctttttgtgc cttactactg cttcagagtc ctacgcggtg tattgcagcc cgctagcgcg
   114841 gccggcatcg gtttcggcat tatggattac gtggaattgg ctacgcgtac ccttctcacc
   114901 atgcgtcttg gcattctccc actctttatc attgcgttct tctcccgcga gcccaccaag
   114961 gatctggatg actcctttga ttatctggtc gagagatgtc atcagagctg ccacggtcat
   115021 ttcgtacgtc ggttggtgca ggcgttgaag cgggctatgt atagcgtgga gctggccgtg
   115081 tgttactttt ctacgtccgt ccgagacgtc gccgaggcgg tgaaaaagtc ctccagtcgt
   115141 tgttacgccg acgcgacgtc ggcggccgtt gtaacgacaa ccacgtcgga gaaagccacg
   115201 ttggtggagc acgcggaagg catggcttcc gaaatgtgtc ctgggactac gatcgatgtt
   115261 tcggccgaaa gttcctccgt cctctgcacc gacggcgaaa acaccgtcgc gtccgacgcg
   115321 acggtgacgg cattatgagc ggcggcgctg tacggcagcg gggagaaaag tggcagataa
   115381 atcacgtcag gttcacacgt cgttagccag cgtcggcata tgaagggcgc gggcggccag
   115441 tacggcctct gggctgagac aggacgaggc agggtgagaa agaggaggat gggggggacc
   115501 ggggtggtgg tgctgctgct gttgtgggtg cggacggtgc gggtgccggg acagcgtgcc
   115561 ggcgaacgtt ctgtaatctt ccataataaa ggtaaaaatg cccgtctcgt gtcgactccg
   115621 ctggatctcg aaggcgtcgg gggtaatgcg catcttgccg gtgccgatga gataaaagta
   115681 ccacattttt tgacagatga tgcgaatcaa gggttcgtac gcttcggcac cccagtggcg
   115741 cgtgaagaag gccgccagac gaaacaaacg gtgtccgtag agcgtgccta gggagaagag
   115801 gatgttgccg ttgcgcgcca ggtcttcggg gaaaacgacc ggcaggccgg tgtggcgctg
   115861 cacaaagcgc gtcagcagtc cgccgctcaa gcgcgggtga cacaggcgct ggctgagacg
   115921 ggcggcgcgc gtttcatcga acacggccgc ctcaaagtcc agccccggga aggcctggcg
   115981 cagttcgcgg tacagatgag gccagtaggg ttgcggcgtc ttgcggctaa gcacggcgtg
   116041 gtccgagaca cccaggttgt tcatggtttc gcgcagtagc agcgtttcga gaccgcggtg
   116101 aaagaggagg acgcagatga ggcgtacgat tttgagttct tccaaacgca gcgagctcag
   116161 cggctgtccg cgcgacatct tctcgctaat ctgtaatatt agatgattgg cgcaagtaaa
   116221 ggagaatttg cccgtgcgga cccgcgggac ggcggggttc tcttcgtcgc gggccatcat
   116281 cgttcgctcg gtgagcgggt agcgacggtg aggacaatga cgatggacga gcagcagccg
   116341 caggctgtgg cgccggtcta cgtgggcggc tttctcgccc gctacgacca gtctccggac
   116401 gaggccgaat tgctgttgcc gcgggacgta gtggagcact ggttgcacgc gcagggccag
   116461 ggacagcctt cgttgtcggt cgcgctcccg ctcaacatca accacgacga cacggccgtt
   116521 gtaggacacg ttgcggcgat gcagagcgtc cgcgacggtc ttttttgcct gggctgcgtc
   116581 acttcgccca ggtttctgga gattgtacgc cgcgcttcgg aaaagtccga gctggtttcg
   116641 cgcgggcccg tcagtccgct gcagccagac aaggtggtgg agtttcttag cggcagctac
   116701 gccggcctct cgctctccag ccggcgctgc gacgacgtgg aggccgcgac gtcgctttcg
   116761 ggctcggaaa ccacgccgtt caaacacgtg gctttgtgca gcgtgggtcg gcgtcgcggt
   116821 acgttggccg tgtacgggcg cgatcccgag tgggtcacac agcggtttcc agacctcacg
   116881 gcggctgacc gtgacgggct acgtgcacag tggcagcgct gcggcagcac tgttgtcgac
   116941 gcgtcgggcg atccctttcg ctcagacagc tacggcctgt tgggcaacag cgtggacgcg
   117001 ctctacatcc gtgagcgact gcccaagctg cgctacgaca agcaactagt cggcgtgacg
   117061 gagcgcgagt cgtacgtcaa ggcgagcgtt tcgcctgagg cggcgtgcga tattaaagcg
   117121 gcgtccgccg agcgttcggg tgacagccgc agtcaggccg ccacgccggc ggctggggcg
   117181 cgcgttccct cttcgtcccc gtcgcttcca gtcgaaccgc catctcctgt ccagccgcct
   117241 gcgcttccag cgtcgccgtc cgttcttccc gcggaatcac cgccgtcgct ttctccctcg
   117301 gagccggcag aggcggcgtc catgtcgcac cctctgagtg ctgcggttcc cgccgctacg
   117361 gctcctccag gtgctaccgt ggcaggtgcg tcgccggctg tgccgtctct agcgtggcct
   117421 cacgacggag tttatttacc caaagacgct tttttctcgc tacttggggc cagtcgctcg
   117481 gcagcgcccg tcatgtatcc cggtgccgta gcggctcctc cttctgcttc gccagcaccg
   117541 ttgcctttgc cgtcttatcc cgcgccctac ggcgcccccg tcgtgggtta cgaccagttg
   117601 gcggcacgtc actttgcgga atacgtggat cctcattatc ccgggtggag tcggcgttac
   117661 gagcccgcgc cgcctttgca ttcggcttgt cccgtgccgc cgccaccatc accagcctat
   117721 taccgtcggc gcgattctcc gggcggtatg gatgaaccac cgtccggatg ggagcgttac
   117781 gacggtggtc accgtggtca gtcgcagaag cagcaccgtc acgggggcag cggtggacac
   117841 aacaaacgcc gtaaggaagc tgcggcggcg tcgtcgtcgt cctcggacga agacttgagt
   117901 ttccccggcg aggccgagca cggccgggcg cgaaagcgtc taaaaagtca cgtcaatagc
   117961 gacggtggaa gtggcgggca cgcgggttcc aatcagcagc agcaacaacg ttacgatgaa
   118021 ctgcgggatg ccattcacga gctgaaacgc gatctgtttg ccgcgcggca gagttctacg
   118081 ttactttcgg cggctctccc cgctgcggcc tcttcctccc caactactac taccgtgtgt
   118141 actcccaccg gcgagctgac gagtggcgga ggagaaacac ccacggcact tctatccgga
   118201 ggtgccaagg tagctgagcg cgctcaggcc ggcgtggtga acgccagttg ccgcctcgct
   118261 accgcgtcgg gttctgagac ggcaacggcc gggccctcga cggcaggttc ttcttcctgc
   118321 ccggctagtg tcgtgttagc cgccgctgct gcccaagccg ccgcagcttc ccagagcccg
   118381 cccaaagaca tggtagatct gaatcggcgg atttttgtgg ctgcgctcaa taagctcgag
   118441 taagagagac gctatattta gggcttccct ctcttttttt ttttcctaca ccgtgatacc
   118501 ctaataaagc acaccgcggt tattatcaac gtctctgtgt ttttattatt tagaaataaa
   118561 tacagggaat gggaaaaaca cgcgggggaa aaacaaagaa gtctctctct agatgcgggg
   118621 tcgactgcgt ggggtgctgg aagtggaagc ggtgctgatg ggtgagggtc gtggcgcggg
   118681 cacggaccgc aacgtgctgc tgatgtctgc cgcggtacgc acgtcgccgt ccatgtcgct
   118741 gcgcagataa gaggtaggtc gtaatgcggc gtgctgcacg ctcaccgtta atggtaccaa
   118801 gtcgtcaaga ctcgcaaaga cgtgccacga ggggatgacg agcgtgagag ccccgttgtt
   118861 accgcttcga cgtctttgtc cggtcaggat cagtgcccgg gacagtccgg cttgggtgtc
   118921 cgagtcctcg tcgccgctgg cctcctcgaa gccggcaaac atggcttcgg acaggggggt
   118981 cggcgtcggt gtggatgaga ggtcatcttc gtcgtcctct tcctcttctt cctcctcttc
   119041 ctcggtgggt ggtaatccgg gggactgcgg gagaaactcg gagacggcgc cgcgcatgac
   119101 gttgctccgt ggaaagagac cggcgcgcag ctgcacctgg ggacgcttga ttttgtccgg
   119161 tttaccgggt gtgagagtcc aaaacccacg gcggaaaaag tggatgcggc ctagcggctg
   119221 tcggtgttcc aaatgaacgg cctgatcgcc ggtcagcgtg acgcggaggg tgattcgcac
   119281 acgatcgggt agcgggccgg cttctatgga gacgcccggg atgttttccg ggaaaaagat
   119341 ggtgtcgtga gtctgattgg tctcgaaagc attctggatc tgcacgatgt actcgggatg
   119401 tatgcgcgtc agcgtaaaac ttttgggaat caacagctgg aagccgttgt ccggcaagcg
   119461 tcgtaggtgc gggtacggat tgtgtcgcgc caccacctcg gcgcgatgcg tgtaaaccga
   119521 aaagtgcaga aacacgctgg tcggcgggtg cggtgagtcg tgatgcagaa acagcatgat
   119581 ccattggcct cgctcgtccg tctccgtttt gtggatgtac gtattagggt ccgaacaggc
   119641 cagctgctcc agggcgtcta ccaacgtcag cgggatagcg ccggcgcgaa aggcgaactg
   119701 gctgacaaag atctgcccgg cctccaaact gctgtcggtt ctgcggcgcc agttcggcgt
   119761 tacggtcagt cgcacggccc agtggtgagc cgtgcggcgg atgatggcgc gcgcttccat
   119821 tcgcggccga ttttcttcgc cgccgcgccg ctggctctga aagaggtgca gtccgctgac
   119881 gggcacgcgg tctagcggca gcgcaaaggc cagcaccgag accgtgttgt tttctgagcc
   119941 tggcgtcagg cgtcgtgggc caaagttgtt gaggtctacc agcagtcggt cctgttcgcc
   120001 caccacgcag cggcccttga tgtttaggtc ggtcaggtct acggtgtcgt gcggagattt
   120061 gttctcctga aaacagcaga gaaccgaggg tcggctcacc tctatgttgg tacgcaggtc
   120121 caggagtcgc agacgaccgg cttccagcga gccgccttcc acgttggtga tgagccgaag
   120181 cacctggcag tgcaggcgac caaagctgcc gctggcggct tcggcctcgc tgatcgcggc
   120241 cgcttccgac gagggtccct caccgggcga ggacgatgct tgagacatcg cgaaggcggg
   120301 atggggggag ggtcagggga tgcgcaaagg tgaacgggtc ttcgtgggag gtcgggaagg
   120361 gttccggcaa ctgtcgcaaa tatagcagcg gcgacaggtg tggcggccaa aagttgcgtg
   120421 tctgagtgga cgtgggtttt tatagagtcg tcctaagcgc gtgcgcggcg ggtggctcaa
   120481 cctcggtgct ttttgggcgt cgaggcgatg catggcccgg gcaaggcgtc ttgccggtgg
   120541 cggcgacgtt tgggttgcgc agcgggctgc catacgcctt ccaattcggc gaagatgcgg
   120601 tagatgtcgt tggcgtccca gaagaactcc tggtacttca gattctgacc ctgaaccgta
   120661 gccaccatgg gcaccaggtt gcgggccagg atgccggcct gccagggcgg ccaggtgaac
   120721 acggccggat tgtggatttc gttgtcggaa tcctcgtcgg tgtcctcttc gggcgcgacg
   120781 gtggactcgg ccttaaggcg gccgcgtgtc ataacgcccg ccgtgcacgc cgtcgccgag
   120841 gatgctgatt tgcgtttgcg gcccgcggaa gtggaggcgc ccgccatggc gccgccgccg
   120901 gtgacgcggg gcgtcttgcg ctcggtggtt acgagttctt cgtcggagtc cgatccgctg
   120961 gtccagacgt cgtcgtcgcc ctgggcggca ccctcgtcgt gccggtccca ggtgtgtcgg
   121021 tactcaagct tgccctggat gcgatactgg ctggtgaagg tggggtgctc gctgtactga
   121081 ggcccacgct gcagcagcaa gtcgatatcg aaaaagaaga gcgcagccac gggatcgtac
   121141 tgacgcagtt ccacggtctc gcgtatcgct tgtacctcca ggaagatttg ctgcccgttc
   121201 atcaacaggt tacctgagat gctcaggccc gggatgctct tgggacacag cagcccaaaa
   121261 tgctcgtgtg aggtaaaagc cacatccagc atgatgtgcg agatcttgcc cggtttgatt
   121321 atcatatttt tgggacacaa caccgtaaag ccgttgcgct cgtgggggcg catgaagggt
   121381 tgcgggttgc gggtcatcgt caggtcctct tccacgtcag agcccagcgt gacgtgcata
   121441 aagagcttgc cggagggcac gtcctcgcag aaggactcca ggtacacctt gacgtactgg
   121501 tcacctatca cctgcatctt ggttgcgcgc gtgttctcca tggagcaaac cagctcgtgc
   121561 gcgcacacca cgtgccgcag tgccacgtcc ttggtgggaa acacgaacgc tgacgtgtag
   121621 tagacgtcgg gctctttcca ctggttctgc tgacgcgtcc aggccagtcc cgagaccgtg
   121681 agacgcgcct gccacatctg cttgcccgac gcgtgaatca cagcgtcagc tacgggcagg
   121741 tgtcggtgtt tgcgctcggc cgccgacggg tagtggtgca cgttgatgct ggggatgttc
   121801 agcatcttga gcggcagcgc gtacacatag atcgacatgg gctcctggct ggggcagatg
   121861 cttcggcccg tggggttgtg cacgttgacc gacacgttct ccacctcgct gcccgtaaag
   121921 tacgtgtgct gcacctgcag ctgattgtcg ccgcggtggc atggcgtcga gtcgggcgtg
   121981 tactgcgata ccaggatcag cgagggctgg ctcacgcgta cgtggatacc cgtctgcagg
   122041 agtcgcgtct cgtgcggcag caccggcgta tcgccgcgac taaacacggc tttcagcacg
   122101 tgccccgaaa tgggacccag tacggatatc atttcgggac aacggcgacc gcgcgactcc
   122161 atgctgcctg cgcgtacggg tgtaggcgac tgagcggcgc gccctctgcg gccgccgcct
   122221 tacataggca ggcgaccaaa cgcggaaccc gaaataaaaa cgttctacac agagacgacc
   122281 gcggattatt gagtgtcttt ttttattaca aaaaaaagag gcgaagcccc accgtcacca
   122341 caccccatca cacaccacca ccgatttttt tttgttttaa tcccgtatgg cgcggacgcc
   122401 tagtgtccgt ttcccattat cagggtcctc tgtttagaga tcgccgcaga ccatggctaa
   122461 agtgacagga ctcgtcttct ctgtcgtatt ttccgtaagc ttacagtctt gcggttccgt
   122521 ctccggggac gccagtcgca tgggcagcag gtcctccagc gcgatggaag cgcccagcac
   122581 cgagagctgc tgttgcgacg gcgaatggga tgtggaccgc gagtgtagcg tggatttgac
   122641 ttggtgcgtc attgctgaca ggcaaccccg attcagcgta tgctttgacg agataaaata
   122701 gaggcgcccc aggagcgcgt cccgtgggaa cgtggcgccg ttctcgtcgc tcaccagtac
   122761 ggttaattcc aaccaggagc gcggtagcca gaccgtaacg ggcattttga gtccctgacg
   122821 gttgtgtggt acaaaaacac ccagataagg cccgtaaaag cggcggtaga tacgtaacgt
   122881 gtgcgagttc ttcagcgtca attcgtaagg gacgcgcacc tccagtccct cgtccgccgc
   122941 gccggagcgt ggcggtacaa agtaaggcag tggcgcgtcc gaaaagaagg gtcgtcgcac
   123001 cgtttcgcgt cgcagccgca ggcgaaacgc cactgggtcg gctggcgcct cggtgcggtc
   123061 gcaggtcacg ttgaaacgta atatgccgtc ttggtatagc gtgagtgacg acagcgtcag
   123121 gtccggcggt gattcgttcg ggtctagctc caatcgtcca aagacggagg gtcccaatgt
   123181 cttggccgtg gtttccgaga ggcgcgccga gatacggctg gtgagtccac gcggccccga
   123241 gatgccgcct tccactcgat gccagcacag cgcgtgtcgt acgcgcaccg tcagcgtggg
   123301 cgtcagatcc gcgtccgttg attccgcggt atcagcgacg gaagccgcgt tctccgttac
   123361 gttgtttata tccagcgtcg gctcgaacgt gagttctggc agatgcagcg ccagacagtc
   123421 gtgtaacgcc gtgtgatgcg cggctttacg tcgtagcggt agccgtttca acagcggcgt
   123481 gatgatacgg agcgcgaaga gattgagtga taggcgcacg atggccatgc gcgtcagttg
   123541 ttggtcaatt accgagcgca ggatatggca gcctgggcgt gcgggaaaga gagagaaggc
   123601 cgggcgcacg tcagaatcct cgttagagac cacgcataga atgccgcgtt cacgatcgtc
   123661 gttgcggtca tcctcgtcct cttcttcttt cttctcttct ttttcctttt ttttctcggg
   123721 ctcgtgagaa gccgccgttt cttcttcttg cgacgtcgcg ggggcggttt gagactcgcc
   123781 gttcgcttcc cccaattgca gcggcgtaga gagcagaatc tggaagggat cccgcaattc
   123841 ttcgggtcgg aggtcgaggt gcaactggat cagatggtag gtgccgcggt gcacccgagg
   123901 ctgacggatg tcgtgtttat ccgtcagtgt gaggatggtc tgcggtgagc cgctgtgctt
   123961 gtccagctcg tccggcgttt tcaggaggag actgtcgtcg tcggtactgg cgacgcccat
   124021 catggtcgtg gtggtagtag tggcgaggaa agtgagcggc ggcgtcgaca gagctcggcg
   124081 ttggcggcgg catttgccgc tgtgtcggct gctattgctg ccaacgccac cgccgccgcc
   124141 tcgtctggct cgtggccggc gggcccgatt ccgaaggttg gggtcgacgc gtggcatgct
   124201 tggtgtctgc gggcgcgaga gggccggctc agcctttaaa tatgcaggtc gcggatttgt
   124261 tatcgggtga aacgtcacac accgtgaaga cgacctgttc gcggatgagg tcatccagct
   124321 gtcgcagcat gacgaaaagc gccgacagcc gcgcgatctc gtcgtcgggc gacacgtgct
   124381 gcggccgcgc gggcgtgcgc ggctcgccga cgctgcgctc gcggtccagc cgcatcagca
   124441 gctcctggca cttgacgagc agcatggagc tgtcctctag cgccaacttg cgcacatagg
   124501 tcatggtcag ctccgaggct aggttggcca ccatggacat ggagaggcag gcggtcttca
   124561 tgtcgatcag caggtgctgg tcgatgaccg gatcggggat ggtgaaggtg gcgtcgcgaa
   124621 aagtaatggt ctgcagctgc tgcacggcag cctttacctc ctcgtacgaa cggtcgagcg
   124681 agaagaggcc catgatgagt agtcgctggt tgatttccag cgccagtggc atgggtacga
   124741 tccagggcag caccagctcc cactggccca gcgtcagcag gttctcgcgc gccagcggtc
   124801 cgtggaagag cggcggcagc acgcatagcg cgtcgccctt ctcccaagtc acgggtcccg
   124861 tgttgaggac ggtgtagagc agtccgtgcg tcggtacgtg taggaggatc tggttgcctt
   124921 ctacgcgccg catcaacgtc agcgtcatat tgcgcagcag gccgcgcagt cgtacgtagc
   124981 cgcgggtgtg atctacgaac tggtgtaggc ccagctggta gtgcttgatg agatgtagac
   125041 gctgcggaat gggcacaacg gccgctacta gcttggtcag tttgcctacg tcggcgatgc
   125101 tgagcttgtg gtcgaaagtg cagaagatgt tggcctccat ggccgccata gcggcggtga
   125161 aatcctggcc gcgacggagg agaagcagag acgaacaacg tctgcaccgg gcgcggcgtc
   125221 agagcgagcg tggcgcgtcc gggcccgcgt ttgcgtctag gtgactcgcc gctaacctgc
   125281 ggtcgtcgcc gtcctcctca ccggacggcc tcacgagtta aataacatgg attgctgcag
   125341 cgggatgatt tcgcctacga cgtagttacc aaagtgcgtt tcggacgtag caaaagcccc
   125401 ggcgccaccc ttgagtttgg tctccatcag cgccagcgtg gtggtgctga ggatcggtag
   125461 cgcttcctgc gtcagacggc acgggttttc gatgagttgt tccgtgcctt cgacgcagac
   125521 gtactgcgtg tccgtgtcgc cgcggatgca gtccttggcg cgtagcaggt actcgtcgat
   125581 ggttttgaag agcgttttgt tggccgcgat aatctcttct gtgttaaagt actgcgcgca
   125641 agggctgtag aatttggagt tgtagcctag acgttcgcga tgtcgggtgt tgtagagtac
   125701 gtcgctcaga cagccggctt gcgaggccca ggggttgtgt gtggccgcga aagtctgtgc
   125761 gtccgcttcg cgatggtcgt agatggcctt ggtggcggcc tccgtgtcgt acggatcgac
   125821 ggccagcatg caggaggcac gcccgcgcgg gttgttgggg atcttaaagt aattaacgtc
   125881 aatcgtcacc ggcgtaagga ttagttcgca cgcggccttt tgtccgtgca ccgtggcggc
   125941 ggcattgcgc tcggacatgc tgccgaacgt cagcatggag atggtctccg tgtctaacag
   126001 ttgcggccgt tctacgccgg ccgcgtgccg gatccagcgg tccacctcgt cgtgccggta
   126061 cacgttcata gggaagacgc gaaagaggtc ctgcacgcgg acgcccatgt cggttcgcac
   126121 gcggtttacg taggctacgc aggtatttga cgtgtaaccc agacccatgt ctacggtgtt
   126181 aatgttctgc gtgacgtggt acgtggtgct gatgtcgcgt tcctccttgg tcacgatagg
   126241 gttgttgatg ataactgacg tgcatgattt gccgctgtag agcagcatgt ccacctcgaa
   126301 ggtgtcggtg cgtacggccg tgagtgcgaa tcccgggtgg atgtgcgcct tggtctgcag
   126361 caccagtgaa actggtgaga ttttgtataa catggcggcc agcgtcatga ctgagtgcaa
   126421 cacgttggga caggtggccg agtaacgcga aaagggcgag cgcagccagt tgtggtactc
   126481 gtgcgcgaag gctgtgggta gcgggaaacc accgtcgtga cggtgatagt gcgggaactc
   126541 ggtcacgtag cgtttaatgt cgtcgctcaa cgccgcgcag atggtggggt ttgagtagaa
   126601 acggtggaaa ggtacgggta ggctgtactc gatcaacgtc ttaggcgccg tcacgacgca
   126661 gcagccgttg taaagcacgt gctgacgtga gataaagtcc ggcaggccct gacgctgcgc
   126721 gtggtccaga ggcgcgcgca cttcgagcac cttgacgtgc tcgcccacga attgcacggc
   126781 caaaaacagt tcacgacagg cctgcagcag cggcgtatgt gcgtcggtgg cgacgtcctc
   126841 caccagctcg gtcagcatct cgcctacggc ttgacgttgc gccgctatcg agtcttcggg
   126901 ggtgacaccg cttgtgctct ctttcgacgt cgtacctgac gtggagaccg cggtggcggc
   126961 cggcatcagg agaaacgccg gtcggtaaaa gaggtctact agcagcgtct tgaggttgag
   127021 tcccaggccg caggcccggt tgttggtcat ggcgggcatg aggcagagat aaaagacctt
   127081 ttgtaacgtc cattcgtcgt cggtggcacg gtaatcgtcc acaaacagcg gctcgtcggc
   127141 atccatggcg cccaaacgcg gtacgtccga aacgccgtgg tgtcgcgcct cgatgttggc
   127201 cgggttcaac ggttgccggt cggccactac ctgtacgcct tccatgttac gcggcaggtg
   127261 cgtaacgaag gggggccaca gccggtggtc gtgcagcgcg ttcacgtaag ccgatagcgg
   127321 ttcctcagcc agttgaccgt tgttaagtcc cggcagcgct gagatgcgcg ttaccagacg
   127381 cagcacggcg accagattgc ggtagtgaaa gagcaactgc ggtggtaggg cgccatcagc
   127441 caggtgttcg gcgatcaacg tcaccagcgc gtagctgtgc gcaaaaacca gcagctgacg
   127501 tgtgtgaaac atgttgacga tacaacgtgc tacgaaagtg cggattagca aaaaagcgtc
   127561 gacgttgccg tgtaccagca cgtcgaccag gtagcaaagc tcggggtaat tggggcttgt
   127621 cacggtggtt ttgaaaagtc gcaacgtctc ttcgtagtcg ggtggtggcc gcagtcgcat
   127681 gtgttccatg atctcccagg tgcgcagttc gtggaagggg cccggtgcca gtccatctgg
   127741 caaattaccg atgacgatac gcggtgtaca cagcgccacc gtttcgctgt tttcctggca
   127801 gtgcgtaaag tcgaagaagg ggtgcagctc ggtgtagagc gtgatgttgc ccaccttgta
   127861 gaagtcggtg accacaaagt cctgctttat ttcgttcacc gtgcgcggga cctcgcgtcg
   127921 tacgcggtaa aaatgcggta tgcggcgcgc cgcaccgccc atgggttcct gctgaaaacg
   127981 acactcgagc agtcgttgca tggcgggttc cgagggcggt ccgcgttccg tgaaggtctg
   128041 tagacagggc gcgggctcgt gcagcaccgg gtggcacagc gtcttgagcg cgtccacaaa
   128101 gtctattttt tgtacggcac ggtcccggtt tagcaggtag gccgtggtgg gcaacgcgtt
   128161 gcgaacggtg tcgttaagct taactttgct ttccaccgtg gtgtaaccgc gatcctcggg
   128221 cagatacagc cctacgggga agaaaaacgt caggtccacg ttacgttcta gcggatcttt
   128281 ggtatcggtg tttttgtaga cgcgccgcaa gttttccata atcaccgttt tttcgcccag
   128341 tcggatcacg tccatgctca gcggcgttaa gctgtgcgcc ccggcctgcg aaagcgagtc
   128401 gttgggcaaa tgcggttggc ccgaagtcag atgagccttg tacgagttga aatcggccag
   128461 gatcgagtga taggatatgg cagtgacggc attttcggga ctgagtacaa aattgccgta
   128521 ggtggccggc gccgagaccg tttctttggt gatgtggctt gagagcagcg acatgatgat
   128581 ctgcataacg ttggccgtgc ttaccatcac gccgctgatc ttggcccccg agctcgtggt
   128641 gtacgtggtg gggttgtcta ggatgctatc ggtggccgct tcggccagac gcgtgaggaa
   128701 cttgagcaca tagtcgcgat cgcgcgtgcg attcagcaaa aagagcgtgg ccagcatttt
   128761 ggccttgaag ctctgcaaga tgttgcttcg ctggatgcgg ttcagcgcct gtcgcgccag
   128821 cgtggcgttc tctaccagcg tctgcaccac aaagtacggc ggcgccttgc gtagcagtgt
   128881 ctgtaaaaag ctgtgaatca agccgcgttc catggcgtcg gccgtgtttt tgagcgcgcg
   128941 cagcaccgtg tgcatagctt ccacgttgag gatcttgtcc aggatggtgc cttcgaacgt
   129001 ctcgcgcaga tacgtgaggc aggctgcgct gagctcaaag gggatggtga tgggggattt
   129061 ttcactgtat ttggtgacca taatggtggt ctgacgactg gtaggcaaac cggcgccgct
   129121 ggccacacgc ggcacctgca cgtggaacag catttttccc gtagtcagtt tattgaggtc
   129181 gtggaacttg atggcgtgcg ccgccgcggc caagccgctg gtcaaaaaat aaacccattc
   129241 caggcgattg cagaaggtgc cgaagatggc ttcgaagtga atattgtaac gctcggggtc
   129301 atcgccgtag tagatgcgta aggcctcaaa catctcctcg ccggcgctgg tcttgacgtg
   129361 cgtcagaaag tcagtgggaa tgcctacttt aggcaggagc tcgagcgccg accagttctc
   129421 catcgcggcg gcggcgtgag cgcgaggcgt cggagctcgg ggaaagcagc gcgacccgga
   129481 gaatggccgg cgctgcgccg cgccgcctcg gctgtgacgc tctaatagtc gtcggcggct
   129541 ccgctatgcc gcgccgggtt ttacacgtcc ccgtgcacgt tcgcgcctgc aacctcaccc
   129601 aagagctatc gacgggcgag gacgcccgct tctgtcgtcc gcgacccgtt aacgtcgaac
   129661 gggtgcgcgc tgtttttgcg gctctctacc gtgcctgtcc gatacacgtg aggaccgagc
   129721 ccgagcgtgt caagctggta ctgggtcgtc tgttactggg acccgtggcc gtaccctgtt
   129781 tttgcgacgg tgaagtggag ggccacggtg aacatctggt acctacgacg cagttttgtc
   129841 gcgggccgct gctctacgtg caccgacgtt gttgttgcgg atccgtgacc gccgggcgcg
   129901 cgctgtccta ccacgttctc gaaaaccacg tggccacgca tgtgctacgc ggattgctct
   129961 cgctgacgga atggaatcga gaattgccga gcctcttttg cgactgtcct ggcggcggtg
   130021 gcgcctcggg aaccgaggaa cgctacgcta tggcctgcct gccgcgcgac ctcagcctgc
   130081 acctggacga ctatccttac ctgatggtgg aaatcggacg cgtactcagt gtcagcgagg
   130141 tagacgacta cgtaaccgcc gtctccggct acctgggcga ggccgcggcg ccgcgcatcc
   130201 aggttcacta caagctgctc tttggactca acgtgcgtcc gcaagcgccg tgcgcgttgg
   130261 acgctacacg cgactttttt ctactggagc tgcaaaagct ttggctgggc gttgaatatc
   130321 accacgaagt gacgtcggag tttttcggtc gcgtgctggc tcagctgcat cgcgaccgcg
   130381 cccgcgtcat gatggcgctt cgcttgcccg agcagacggt gtgccacctg agcaccttcg
   130441 ttctcagtcg cttcaagcga caggtactgt acttcaagtt acaggtgagc tacggcaagt
   130501 gccggactgg ccacgctgac agaagtgggg gagggggaaa cggtggaaat cagggacacc
   130561 acaacctact gtgttatcga cgccttagcg tcacgtttgc cgacacggac acggtgtgga
   130621 gaaacctttt ctacgtttat tatgaactag ctcgggatct ggggtcccat gggacgggga
   130681 accgacccgt aaaccgcggt tacggtgttt cttgcgctcc gaggacgtcg cggctatcac
   130741 cgtcagaatc gacggtggtt tcggcgaacg gacacgcgct gtcttccacc gcgctcccga
   130801 cgacgagcgc gggtcacaag ctgtcactgc cgcgcgaccc ggccgccgat cgcgttcgac
   130861 gttacgtgtg catcatctcg cgtctcatgt acgctcggta cggggagaga tggcgtaaac
   130921 accgtcaacg gcggtcggag acgggagaag aggaggagga agagacgctg gaatcggggg
   130981 agactgacgc cacgccgcca tttgacttta cggggcagca gctgcgccgg gcctatcagg
   131041 aacaccgacg tcgtaaacat ctagccgtgc agcgttacgc gccgtgccgt cgtaagctca
   131101 tcggcgggat ggagtttgcc gaggtgacgg gcgtgagtct ggaccgcatc gccgtcaacg
   131161 ctttcaacac caaccgcgtt atcaatatga aggccgcgct ctcgtccatc gccgcgtcgg
   131221 gtctcggcgt gcgcgcgccg cggcttccca agaacatgac ccacagtttt gtgatgtaca
   131281 agcacacctt taaggagccc gcttgcaccg tcagcacctt tgtttccaac gacgccgtct
   131341 acattaactc gctcaacgtc aatattcgcg gttcctaccc cgagtttctg tactcgctgg
   131401 gcgtgtaccg gctgcacgtt aatatcgatc acttttttct gccggccgtg gtgtgcaaca
   131461 gcaactcctc gctggacgtg catgggctgg aggaccaggc ggtgatccgc tcggagcgca
   131521 gcaaggtgta ctggaccacc aactttccgt gcatgatctc gcatactaac aacgtcaacg
   131581 tgggctggtt caaagcggct acggccattg tgccgcgcgt ctcgggcgct gacctggaag
   131641 ccattctgct caaagaactc tcgtgcatca agaacatgcg cgacgtgtgc atcgattacg
   131701 gtctgcaccg cgttttcacg caactagagc tgcgcaattc gtaccagatc cccttcctgg
   131761 ccaagcagtt agtgctgttt ctgcgtgctt gcctgctcaa gctgcacggt cgagagaagc
   131821 ggctgcagtt ggaccgccta gtatttgagg cggcacagcg gggtctcttt gactacagca
   131881 agaacctcac ggcgcacacc aagatcaagc acacttgtgc gctcatcggc agtcgtctag
   131941 ccaacaacgt gcccaagatc ctggcccgga acaaaaaagt caaattggat cacctgggcc
   132001 ggaacgccaa cgtgctgacg gtgtgtcggc acgtggaagc ccacaagatc cctcgcacgc
   132061 gcctcaaagt gttagtcgag gtgctgggcg tgttgcagag tatcagcggt acgccgcaca
   132121 cgcgcgaagt gatccaccag acgttgtttc gattgtgctc ggcggccgca gccacatcgg
   132181 gcctgtgtcc atcccctccc ccattgtgtg tgtcctcatc ttcctccgtc ccttctgtcc
   132241 aaacctccgt cagcgttgac ggcagttctg aacccacgtc gccgcgagcg cggtttgcat
   132301 cacgatgatg gaagccgcgg ccgctgccgc cgcggcgttt cgtccggagg agcgtccgac
   132361 gccgggttgg cacgacgcgg cgttgttaat ggacgacggt acggtgcgcg agcacgcgtt
   132421 tcgcaacgga ccgctgtcgc aactgattcg ccgtgtgtta ccgccgccgc ccgacgccga
   132481 agacgacgtg gtttttgctt ccgagctgtg tttttattgc agcggtcgtt ttaaccgcag
   132541 gtcgtccgtc ttctccatct attggcagaa gcatagcgat ctggtgtacg cgcttacggg
   132601 cattacccat tgcgccaagt tggtggtgga atgcggtcag ttggggagta gtaggctacg
   132661 gtggcgcgac ggtgatgcga gtggtgagga gcgccgggga gacgacgaca gcagggacga
   132721 gctgtacgac atgccgggca tttatatgat tcgcgtcaac gacggcggca gcaccggccc
   132781 cagacacgtt atttggccgg gtaccagcgt gctttgggcg ccggacgttg tgatcactac
   132841 ggtgcagcga cgaatctcgg cggcgcgcgc cctggtgaac acgttccgcc aatatttttt
   132901 tttgctggaa cggcgctcgc acgaggagct ggttctttgt ccgcccgaga tggaggagcg
   132961 tctagcgccg ttgttacaga gtgccacgcg cggtgattcg gacatgtttg atggtgtggt
   133021 ggccagcgct tatcaccgtt tgcgaatgag taatattccg cgttcatccg cccgtctgct
   133081 ggagcactgc gtggggctgg cgggtgctaa gaagctgctc ttgctcgacg tgccgcgtct
   133141 ggagaactat tttctttgtc aagtctgtct ttacgagctg gacgaggacg agatgggcga
   133201 ggagatgctg ggcatgttgg ccggaaagcc cgaggatgcc gccgtctcgg gcgcaagcgg
   133261 cggttttctg ctacatcgca agacgatgaa gctggccgcc tgtctgtgtt tgttgctcaa
   133321 ttcgctgcat ttgcaccagg aggcgctgga ggccttggat cctccgccgc cgcgcgtcga
   133381 ggagaacgac cttgtcaacg tggtgctgcg ccgttattat cgcagtcacg gcggcgtgca
   133441 ggcgcggacg ctggcggcgg cccgggcttt gttagccgac tacgctgaaa cgttttcgcc
   133501 tttggggagt tttacgcgcc tgggttacga tcgtctcgtt tctgccgatg ccggcgtcag
   133561 tcgccggcac ctggtggctc tgctgcgtgc ctagctgacc ctgaaacgga tggcgtgtat
   133621 atcgtcacac aggtaggtgg ccatgatgac ggcgatgata agatcgtccg agatacgatt
   133681 ctggcgcttg gccgagtagc gtgccgtcgt gccttcggcc agcgtgacgc ggtgcaggtt
   133741 ctgaatctgc tccagaagat actcgatggg gtcgtggctc agcttgatgg tgtaggagac
   133801 gagctcttgc gaggctttga tgtagcccga gttgaaacgc gagatgaact gttccacggc
   133861 cagcgccttg tcgcggccca tgaggtagaa gggctgttcg atgtggttct ggtcgggcgt
   133921 gtggtagaag agcacgcgga tgagcgtgct gctttgcacg ctctgtcgga tgaggcaggc
   133981 gatgcgcacg gccgccgcct ggttggtgtt gccctccacg gcgatacgca gttcgtccag
   134041 gtaagggtgc aggctcagca ccgagatgat catgtgcgcc gcgcactcgg cgatggctac
   134101 ctcagaactc tcggagaggt cgcgcaaaaa gaaatgctct aggccgtaaa tgagaaactg
   134161 gtgtcggtag gcgcctacgg ccgccacgcc cgtgcccgag gccttgcggt tggtggtgaa
   134221 ggccgggtcc agatacacgt aaagcgtctt gccgaaataa tcgtaggcgt tggtgttgag
   134281 cgtgctgtaa cgcaaaatat cgaactcttc gcggctctgg tccgtgatga gcacggtgtt
   134341 ctgcgagatt ttattggtac cgccgatgat ctcgtccatg aaagcgcccg gcataaacat
   134401 gttggccgtc ttgcgcacct gcgagttgag gctgatgaag gtgggcttgt gcagtcggta
   134461 gcaaggacac gctgtggcgt cgcccttctc cgtgaagctg tgcaggtgct cttcgcacac
   134521 gtaagagacc acgttgagca tgtcaaaggg cgcattgttg aggcgcgtca agaaacacgt
   134581 ggcgtcactg gtagtgttgg tggacgatat gaagatgatc ttggtggtat tctgggccag
   134641 gaaccccaga atggtgttga aggcctcttt cttgatgaag tgcgcctcgt ccaccagcag
   134701 caaatggaag ttttgtcctc ggatgctctg tgtagagagg agacagaaaa gggactctta
   134761 tgattacgca cgctcggctg gaagcctaca gagtcggggt ggggccggac aggtgagcca
   134821 ggtgagccgc caggtgaggc gggatcgccg tgtgccaacc gggctgcgac ctgaaaaccg
   134881 gaaccaatcc gccgacaccg gcgccgcgtg acgcgcgccc ataaaaacga aagtgtcgtc
   134941 gtcgcgaccc gccacagccg ccatgaactc gttgctgacg gaactcaacc gactgggggt
   135001 cgcgcacgcc actacggagg atgtttttat ctttgtcgac cgcctctttc aacacttttc
   135061 cttccttttc caggccgagg agtcaggccc gcgccgcttg gaactggtcg cgtccgtgtt
   135121 cgagcacctg acggtggagt gcgtcaacga catcctggac gcctgcagcc acccggacgt
   135181 gaacgtcgtg gagacaagca acacctgtcg tccctgtcct tctcctgttc cctccgcccc
   135241 caaaactgtc agcgacgctc agacgtcatg tgcgacgcct cgggcgcctg tgacatgagg
   135301 cacgtccaga acgcgtttac cgaggagatc cagttacact ccctctacgc gtgcacgcgc
   135361 tgctttcgca cgcacctgtg tgatctgggc agcggctgcg cgctcgtctc cacgctcgag
   135421 ggctccgtct gcgtcaagac gggcctggta tacgagactc tctatccggt ggcgcgtagc
   135481 cacctgttgg aacctatcga ggaggtcgca ctggacgacg tcaacatcat cagcgccgtg
   135541 ctcagcggcg tgtacagcta cctcatgacg cacgccggcc gttacgccga cgtgatccaa
   135601 gaggtggtcg agcgcgatcg cctcaaaaag caggtggagg acagtattta cttcaccttt
   135661 aataaggttt tccgttctat gcataacgtc aaccgtattt cggtgcccgt catcagccaa
   135721 ctttttattc agcttatcat cggtatctac tcaaagcaga ccaagtacga cgcgtgtgtc
   135781 atcaaggtta gtcgtaagaa gcgtgaggac gcgcttctga aacagatgcg ttccgaatat
   135841 ggaaacgcac ctgtattcgg atctggcgtt tgaggcgcgg ttcgctgacg atgagcaatt
   135901 gcctctacac ttggtgctcg accaggaggt gctgagtaac gaggaggccg agacgctgcg
   135961 ctacgtctac tatcgtaatg tagacagcgc tggccgatcc gcgggccgcg ctccgggcgg
   136021 agatgaggac gacgcaccgg cctccgacga cgccgaggac gccgtgggcg gcgatcgcgc
   136081 ttttgaccgc gagcggcgga cttggcagcg ggcctgtttt cgtgtactac cgcgcccact
   136141 ggagttgctc gattacctac gtcaaagcgg tctcactgtg acgttagaga aagagcagcg
   136201 cgtgcgcatg ttctatgccg tcttcactac gttgggtctg cgctgccccg ataatcggct
   136261 ctcaggcgcg cagacgctac acctgagact ggtctggccc gacggcagct atcgtgactg
   136321 ggagttttta gcgcgtgacc tgttacgaga agaaatggaa gcgaataagc gcgaccggca
   136381 gcaccagttg gccacgacca cgaatcaccg tcggcggggc ggactgcgta ataacttaga
   136441 caatgggtcg gatcgccgtt tgcccgaagc ggctgtggct tctctggaga cggccgtcag
   136501 tactccattt tttgaaattc cgaacggagc aggaacctcc tccgcgaacg gcggcggcag
   136561 attcagtaac ctggagcagc gggtagcgcg tttgttgcgc ggcgacgagg aattcatcta
   136621 tcacgcgggt ccattggagc cgccttccaa gatacgcggt catgagttgg tgcagctgcg
   136681 cctggatgta aatccagacc tcatgtacgc caccgatccg cacgaccgcg acgaggtcgc
   136741 gcgtacggac gagtggaagg gtgccggtgt ctcgcgtctc cgcgaggtct gggatgtgca
   136801 gcatcgcgtg cgcctccgtg tgctgtggta cgtcaattcc ttttggcgca gtcgcgagct
   136861 gagctacgat gaccacgaag tcgaactata ccgggcgttg gacgcttatc gggcgcgcat
   136921 cgccgtcgag tacgtgctga ttcgcgccgt gcgcgacgag atctacgctg tactacgacg
   136981 ggacagcggc gcgttgccac agcgtttcgc ctgccacgtg ccacggaaca tgtcctggcg
   137041 cgttgtttgg gaactttgcc gtcatgcctt ggcgctctgg atggatcggg cggacgtgcg
   137101 tagctgtatt attaaggcgc taacgcctcg tctgagccgg ggtgccgccg ctgccgctca
   137161 gcgagctcgt cgtcagcgcg agcgctcggc gcccaaaccg caggagctgc ttttcggacc
   137221 gcggaacgag agcggtccgc ccgccgaacg gacttggtac gctgacgtgg tgcgctgcgt
   137281 tcgcgcgcaa gtggatttgg gcgtggaagt gcgcgcggcg cgttgtcctc gcaccgggct
   137341 ttggatcgtc cgtgatcgcc gcggacgcct gcgacgttgg ctctcgcagc ccgaggtgtg
   137401 cgtgttctac gtcacgccag acttggactt ttactgggtg ctgccgggcg gctttgccgt
   137461 ctcttcgcgc gtcactcttc atggcttggc gcagcgggct ttgcgagacc gattccagaa
   137521 ctttgaagca gttcttgcaa gaggaatgca tgtggaagct ggtcggcaag agccggaaac
   137581 accgcgagta tcgggccgtc gcttgccgtt cgacgatctt tagtccggag gacgacggct
   137641 cgtgtatctt gtgccaattg ctgttgctct accgcgacgg cgaatggatc ctctgtcttt
   137701 gctgcaacgg ccgttatcaa ggccactatg gcgtgggcca cgtacatcgg cgtcgtcgac
   137761 gcatctgtca tttacctacc ttgtaccaac tgagcttcgg aggtcctttg ggtccagcca
   137821 gcattgattt cttgccaagc tttagccagg tgaccagcag tatgacgtgc gatggtatta
   137881 cgcccgacgt gatttacgag gtctgcatgt tggtgcccca ggatgaagcc aagcgcatcc
   137941 tggtcaaggg tcacggtgcc atggacctga cctgtcagaa ggcagtgacg ctaggcggcg
   138001 ccggcgcctg gttgctgccg cgtcccgaag gctacacgct tttcttttac attctgtgct
   138061 acgacctgtt tacctcatgc ggcaatcggt gcgatatccc ttccatgacg cggctcatgg
   138121 cggcggccac ggcctgcggg caggcgggtt gcagcttttg cacggatcac gagggacatg
   138181 tagatcccac tggcaattac gtgggttgca cccccgatat gggccgctgt ctttgttacg
   138241 tgccctgtgg gcccatgacg cagtcgctca tccacaacga ggaacccgcg acttttttct
   138301 gtgagagcga tgacgccaag tacctatgcg ccgtaggttc taagaccgcg gcgcaggtca
   138361 cactgggaga cggcctggat tatcacatcg gtgtcaagga ttctgagggc cgatggttgc
   138421 ccgtcaagac cgatgtgtgg gacctggtca aggtagagga acctgtgtca cgtatgatag
   138481 tgtgttcctg tccggtgctt aagaacctag tgcactaacg gggtctgaca gttcacgggg
   138541 agaataaaca agaaacaaca aaaaaaaaag aggacatgga ttcgccacgg tttgtggcaa
   138601 ggcgtatatt atcatcatgg agctactcac gttggtgttg tagcaactgg caaaaagcgc
   138661 cgtgctcttg gcgccgcggt ggtcgatgct gatcacgttg tccttgttct cgaccacgta
   138721 gtcgcgcgcg aaggtgtggc ggcagcggaa ctcgacctct ttgagcacaa actgcgacac
   138781 gtgcttttgg tgcgccacgt agccgatgct gatgccgatc atgtgcttaa gcagaaacga
   138841 gataatgggg atgatgaacc aagtcttgcc gtgacgtcgc ggcaccagga acacggtggc
   138901 tttctgctta aagatgtcga tggaggtctg cgagaggaag tcgatctgga aggcgtggat
   138961 gaggtactgc agcacgcgat tggccagcac ggggatcttg gtcacggcta taaaaaagat
   139021 gacgtgtatc aataaattct tttgaaacgg ttcgagtcgg atggcttttg cgtcgccctc
   139081 gacggcggta ctgaagccgc cgtcgagcca ctttttaaag tcggtcatga agttgttgat
   139141 ctgctgaaac tgcggatcgc ggtagagctc ggttaacgcg tccagcttct ggtaggaggc
   139201 gcgctgctcc tcggagcacg ggcgaaacgt cagttcatcg agcgcactct tgaggcgctc
   139261 gtgaaacagc agctcgcgct ggctttcctc gggcgagttg tagtcgcggt ggcggccgca
   139321 gaaggccatg agcggcagga aggcctcgtt gcacgagtgg gccagcccga gttcggggtg
   139381 catcatctgg tagcgcttgc ggcacagcgc cgccacattg gtgaaggccg tggagatgca
   139441 ggaggtgggg tggctcttgc gcttctgcag ctccgcgtag cgctcctgga tcttggcggc
   139501 cgaatctccg cgcaacatga tggcggcggc ggtagtgcga gcggaggtta ggcggcagcg
   139561 gcgagaggag aggaaaaaga tggcgtccac gaggacgacg gaggatccac ccgaaaacca
   139621 cgttgtcgcg gacgtggctt gtgggacggg cgccgtcact cgttcgtctt cgtcgtccct
   139681 agtggtgtcg tcttcctcgg cgtcaggctc agacgaatct tcctccgcct ctcctctcag
   139741 tttccccgtc tcctctccct caactgccgt caggtctccg gggtccgccg gggtttcgac
   139801 gtccctgtgc tcggtggaac ggatggtcga gctgtcggcg cagtctccgg ccgccgattt
   139861 ctcggtctcc gaggcttggc gcttcgagga ggccgtaaat atggcgctgg tggcctgcga
   139921 ggccgtgtca ccttacgatc gctttcgcct aattgaaacg cccgacgaga atttcttgtt
   139981 ggtcaccaac gtaattccgc gcgagtcggc cgaggtgccg gtgttggata gcagtagcag
   140041 cggtggcgat agcgggccgg aggacaaaaa gaaaaacgtc gggaataaaa ccgcggggga
   140101 aaagaacggc ggtgggtctc gggccaaacg ccgtcgtaga cgacgcgctc cgaaaaacga
   140161 cgccgccacg ccgtcttttc tacgtcgaca cgacgtgctg gagcgtttcg cggccgcggc
   140221 tgagcctttg ccgtcgcttt gtgtgcatga ttatgcgtta cgcaatgctg accgtgttac
   140281 ctacgacggc gaattaatct acggcagtta cctgttgtat cgcaaggctc acgtggagct
   140341 gtcactctcc agcaacaagg tgcaatacgt ggaagccgtg ctgcgacagg tgtacacgcc
   140401 gggcttgtta gatcatcaca acgtgtgcga cgtggaggcc ctgctgtggc tgctgtactg
   140461 tggaccgcgc agcttttgcg cgcgtgacac ctgtttcggt cgcgaaaaga acggttgtcc
   140521 tttccccgcg ttgttgccca aactctttta cgaacccgtg cgggactata tgacctacat
   140581 gaatctggct gagctgtacg tctttgtttg gtatcgcggc tacgaattcc ctgcgccaac
   140641 gccgcaggcg acgacggcgg gtggtggtgg tggtggtggt agtggtggcg gcggcggggc
   140701 cggcgcttgt gcggtcgaga cgagcgcgtc agcaggccgg gtcgatgacg ccggcgacga
   140761 ggtgcatttg cctttaaagc ccgtctcgct ggaccgtctc agagaggtgt tacaggcggt
   140821 gcgcggccgc ttctcggggc gcgaggtgcc cgcctggccg gcctcgtcgc gcacctgttt
   140881 gttgtgcgcg ctctacagtc agaaccgtct ctgtttagat ctcgcgcgtg acgaggcgcg
   140941 gaccgtgagt tatagcccca tcgttatcca agactgcgcc gcggctgtta ccgacgtcac
   141001 tttgagccac atcttgcccg gccagagcac cgtctcgctt ttccccgtct accacgtcgg
   141061 caagttgctg gacgctctct cgctgaacga cgcgggtctc atcacgttga atctatgacg
   141121 tcggtcaaca aacagctctt aaaggacgtg atgcgcgtcg accttgagcg acagcagcat
   141181 cagtttctgc ggcgtaccta cggaccgcag caccggctca ccacgcagca ggctttgacg
   141241 gtgatgcgtg tggccgctcg ggaacagacc cgatacagtc agcgaacgac gcagtgcgtg
   141301 gccgcacacc tgttggagca acgggcggcc gtgcagcaag agttgcaacg cgcccgacag
   141361 ctgcaatccg gtaacgtgga cgacgcgctg gactctttaa ccgagctgaa ggacacggta
   141421 gacgacgtga gagccacctt ggtggactcg gtttcggcga cgtgcgattt ggacctggag
   141481 gttgacgacg ccgtctaaca ggtatagcaa tccccgtcac gcctctgttc agattttatt
   141541 aaaaaaaaaa acacaccata acgacagtgt cggtgtggta gctagtgcag ccctaggaac
   141601 agggaagact gtcgccacta tgtcctccgc acttcggtct cgggctcgct cggcctcgct
   141661 cggaacgacg actcagggct gggatccgcc gccattgcgt cgtcccagca gggcgcgccg
   141721 gcgccagtgg atgcgcgaag ctgcgcaggc cgccgctcaa gccgcggtac aggccgcgca
   141781 ggccgccgcc gctcaagttg cccaggctca cgtcgatgaa gacgaggtcg tggatctgat
   141841 ggccgacgag gccggcggcg gcgtcaccac tttgaccacc ctgagttccg tcagcacaac
   141901 caccgtgctt ggacacgcga ctttttccgc atgcgttcga agtgacgtga tgcgtgacgg
   141961 agaaaaagag gacgcggctt cggacaagga gaaccagcgt cggcccgtgg tgccgtccac
   142021 gtcgtctcgc ggcagcgccg ccagcggcga cggttaccac ggcttgcgct gccgcgaaac
   142081 ctcggccatg tggtcgttcg agtacgatcg cgacggcgac gtgaccagcg tacgccgcgc
   142141 tctcttcacc ggcggcagcg acccctcgga cagcgtgagc ggcgttcgcg gtggacgcaa
   142201 acgcccgttg cgtccgccgt tggtgtcgct ggcccgcacc ccgctgtgcc gacgtcgtgt
   142261 gggcggcgtg gacgcggtgc tcgaagaaaa cgacgtggag ctgcgcgcgg aaagtcagga
   142321 cagcgccgtg gcatcgggcc cgggccgcgt tctgcagccg ctcagcggta gtgccgggga
   142381 ggaatccgcc acggcggtgg aggccgactc cacgtcacac gacgacgtgc attgcacctg
   142441 ttccaacgac cagatcatca ccacgtccat ccgcggcctt acgtgcgacc cgcgtatgtt
   142501 cttgcgcctt acgcatcccg agctctgcga gctctctatc tcctacctgc tggtctacgt
   142561 gcccaaagag gacgattttt gccacaagat ctgttatgcc gtggacatga gcgacgagag
   142621 ctaccgcctg ggccagggct ccttcggcga ggtctggccg ctcgatcgct atcgcgtggt
   142681 caaggtggcg cgtaagcaca gcgagacggt gctcacggtc tggatgtcgg gcctgatccg
   142741 cacgcgcgcc gctggcgagc aacagcagcc gccgtcgctg gtgggcacgg gcgtgcaccg
   142801 cggtctgctc acggccacgg gctgctgtct gctgcacaac gtcacagtac atcgacgttt
   142861 ccacacagac atgtttcatc acgaccagtg gaagctggcg tgcatcgaca gctaccgacg
   142921 tgccttttgc acgttggccg acgctatcaa atttctcaat caccagtgtc gtgtatgcca
   142981 ctttgatatt acacccatga acgtgctcat cgacgtgaac ccgcacaacc ccagcgagat
   143041 cgtgcgcgcc gcgctgtgcg attacagcct cagcgagccc tatccggatt acaacgagcg
   143101 ctgtgtggcc gtctttcagg agacgggcac ggcgcgccgc atccccaact gctcgcaccg
   143161 tctgcgcgaa tgttaccacc ctgctttccg acccatgccg ctgcagaagc tgctcatctg
   143221 cgacccgcac gcgcgtttcc ccgtagccgg cctacggcgt tattgcatgt cggagttgtc
   143281 ggcgctgggt aacgtgctgg gcttttgcct catgcggctg ttggaccggc gcggtctgga
   143341 cgaggtgcgc atgggtacgg aggcgttgct ctttaagcac gccggcgcgg cctgccgcgc
   143401 gttggagaac ggcaagctca cgcactgctc cgacgcctgt ctgctcattc tggcggcgca
   143461 aatgagctac ggcgcctgtc tcctgggcga gcatggcgcc gcgctggtgt cgcacacgct
   143521 acgctttgtg gaggccaaga tgtcctcgtg tcgcgtacgc gcctttcgcc gcttctacca
   143581 cgaatgctcg cagaccatgc tgcacgaata cgtcagaaag aacgtggagc gtctgttggc
   143641 cacgagcgac gggctgtatt tatataacgc ctttcggcgc accaccagca taatctgcga
   143701 ggaggacctt gacggtgact gccgtcaact gttccccgag taaccgggac gcggaacgtg
   143761 acggttgccg aggggaaagg ggacagagaa ggtacaaacc caccggcggg gaaaatactg
   143821 aggcgccgcc atcatcatgt ggggcgtctc gagtttggac tacgacgacg atgaggagct
   143881 cacccggctg ctggcggttt gggacgatga gcctctcagt ctctttctca tgaacacctt
   143941 tttgctgcac caggagggct tccgtaatct gccctttacg gtgctgcgtc tgtcttacgc
   144001 ctaccgcatc ttcgccaaga tgctgcgggc ccacggtacg ccagtagccg aggactttat
   144061 gacgcgcgtg gccgcgctgg ctcgcgacga gggtctgcgc gacattttgg gtcagcggca
   144121 cgccgccgaa gcctcgcgcg ccgagatcgc cgaggccctg gagcgcgtgg ccgagcggtg
   144181 cgacgaccgg cacggcggct cggacgacta cgtgtggctc agccggttgc tggatttggc
   144241 gcccaactat cggcaggtcg agctcttcca gttgctggaa aaggaatcac gcggacagtc
   144301 gcgcaactcg gtgtggcatc tgttgcgtat ggacacggtc tcggccacca agttctacga
   144361 ggccttcgtc agcggctgtc tgcccggcgc cgcggcggcg gacggttcgg gtggcggcgg
   144421 ctcgcactac acgggctcgc gcgccggcgt ctcgccgggc atccagttcg gtatcaaaca
   144481 cgagggctta gtcaaaacgc tggtggaatg ttacgtgatg cacggacgcg agccggtgcg
   144541 cgacggcctc ggtctgctca tcgaccccac gtcggggctg ctgggcgctt ccatggacct
   144601 gtgcttcggc gtgctcaagc agggcagcgg tcgcaccttg ctggtggaac cgtgcgcgcg
   144661 cgtctacgag atcaagtgcc gctacaaata tttgcgcaaa aaggaggacc cctttgtgca
   144721 gaacgtgctg cggaggcacg acgcggcggc cgtggcctcg ctgttgcagt cacacccggt
   144781 gccgggcgtg gagtttcgcg gtgaacgcga aaccccgtcg gcacgcgagt ttctgctttc
   144841 gcacgatgcg gcgctcttca gggccacgct caagcgcgcg cgcccgctca agccgcccga
   144901 accgctgcgc gagtacctgg ccgatctgct gtatctcaat aaggccgagt gttcggaagt
   144961 gatcgtgttt gacgctaagc acctgaatga cgacaacagc gacggggacg ccacgatcac
   145021 tattaacgcg agtctcggcc tagccgcggg cgacgccgct ggcggcggcg ctgatcacca
   145081 cctgcggggc agcccgggcg attcgccgcc gccgatacct ttcgaggacg aaaacacgcc
   145141 cgagctgctg ggccggctca acgtgtacga ggtagcgcgc ttttcactgc cggcttttgt
   145201 caatccgcgt caccagtatt actttcagat gctcattcag cagtacgtgc tcagccaata
   145261 ctatataaag aagcatccgg acccggagcg gatcgatttc cgcgacctgc ctaccgtcta
   145321 cctggtctcg gctatcttcc gcgagcgcga ggaaagcgaa ctgggctgcg agttgctggc
   145381 cggcggtcgc gttttccact gcgaccacat cccgctcctg ctcatcgtca cgcccgtggt
   145441 ctttgaccct cagtttacgc gccatgccgt ctctaccgtg ttagaccgtt ggagtcgcga
   145501 cctgtcccgc aagacgaacc taccgatatg ggtgccgaac tctgcaaacg aatatgttgt
   145561 gagttcggta ccacgtccgg tgagcccctg aaagatgctc tgggtcgcca ggtgtctcta
   145621 cgctcctacg acaacatccc tccgacttcc tcctcggacg aaggggagga cgatgacgac
   145681 ggggaggatg acgataacga ggagcggcaa cagaagctgc ggctgtgcgg tagtggctgc
   145741 gggggaaacg acagtagtag cggcagccac cgcgaggcca cccacgacgg ccccaagaaa
   145801 aacgcggtgc gctcgacgtt tcgcgaggac aaggctccga aaccgagcaa gcagtcaaaa
   145861 aagaaaaaga aaccctcaaa acatcaccac catcagcaaa gctccattat gcaggagacg
   145921 gacgacttag acgaagagga cacctcaatt tacctgtccc cgcccccggt cccccccgtc
   145981 caggtggtgg ctaagcgact gccgcggccc gacacaccca ggactccgcg ccaaaagaag
   146041 atttcacaac gtccatccac ccccgggaca aaaaagcccg ccgccccctt gcccttttaa
   146101 ctcataaact ttcaggtctc gcgtacgatt cgcgagtcgg gaatgggaca cccgtgggtg
   146161 tttctccgtg tgtatattat tttttttgtg tgtgtttgcg cccccgtgtg tctaatgtgc
   146221 tgtttgaaac acgtaaagta gctggtggaa gaacagataa acctttaata aaaaaaaagt
   146281 atgtgctccc gacccacggt ctgcgtgtct cttttttatg tccatgtctc caagtctggt
   146341 gcgggtggcg gcggggtcaa gcgtcctcga agtcttcatc atcgtcgtcg tcctcttctt
   146401 cgcggaggcg acggctttcc aagctgtcgt ggtgactgag cgcagcgact tcttcgccgg
   146461 aggctgtggc cagcgcctgg tacttgacac tgccgctacc gcgtccgcga aagtagcgga
   146521 cggcgcgaca cgtcgtaaac atggcccata tgaaaaagag catgccgaac gaccagctga
   146581 tgccggtacg gtaatcgtcg ccgatggtaa aggcgccgta ctgcacgatg gggtagatga
   146641 ggccgcagag tccgaagaag gcgcccaggt ggtagccgaa ttgcactttg acgtattgaa
   146701 aaaagacggc ttcgatcagt aaaaagtaga ttatggagat gatagcgtag accacgaaga
   146761 cggccaacac catgtggcct gtacgcacga aaaagttgtt tccgaagccg tagcacaggg
   146821 ccatggctac cacggtggtg ttgaaaccaa gtgccatctc caccaggttg acgatgagcg
   146881 tgcgaaactg caccgtacct ttgagcttgg ggtgaagacg cgagaaaaaa aagagcgagc
   146941 gtttgaagct gcggtactgc gtgaccatgc tcacgttgaa aatggtcagg cagaaaaagt
   147001 gcacggcggc catgaaggcg atcatgctgg gcagccgaaa tgacatggtc agtgtgaata
   147061 gttggaacgt gtccatgctg aggatgaaga ggaaggctgt gaggctgtcg cccatgtacg
   147121 aaatgtcacg tgtcgactgg tttaggctca tgcctttgtc cttgcgcatg ctgatcttga
   147181 tccagcatac caggtagtag atggtcacgg ctaaaaagac gagctgcatg aacacggcgt
   147241 agcacaccag ctgcaccgag tctaagaaaa gcataggcgt gtgcaggtgc attacgttgt
   147301 aggccgacat gttgagcctt tcaaagtcca cgacgtgata gtagacgcag gggtagccca
   147361 ggtgcggaaa attgctcagc accagatgca cgctgacgtt gacaaaagtc agcaccatga
   147421 aaacgataga agcgctccat gtccgtgtat tcaccttatc cacgtgcgag ggggccatgg
   147481 cgatagcggc ggcccgctcg ctcgggaggc gatgggggcg cgccgatgac gacaggctcg
   147541 cgggtcgtta aatactacga tgggagccgc cgcggctcac gacgcggttt gagcacgtcc
   147601 gggcggtcga cgaaaaaaga ccccgcgggc cttcgcgact ctcttctgtc cgaggatgac
   147661 cgctcagccg ccgttgcacc accgccacca cccgtacacc ctgttcggga ccagctgtca
   147721 tctcagctgg tacggccttc tggaggcctc ggtgcctatc gtacaatgtc tgtttttgga
   147781 tctgggtggc ggccgtgccg agccgcggct tcacacgttc gtggtgcgcg gtgaccgtct
   147841 gccgccggct gaggtgcgtg ttgtgcatcg cgccagctac gccgcgctgg cctcggccgt
   147901 gactacggac gccgacgagc gccggcgcgg cctagagcag cgtagcgccg tgttggcgcg
   147961 cgtgttgcta gaaggcagcg cgttaatccg cgtgttggcg cgcaccttca cgccggtgca
   148021 gattcagacg gacgctagcg gcgtggagat tttggaggcc gcaccggcac tgggcgtgga
   148081 aaccgcagcg ctgtcgaacg cgcttagtct tttccacgta gccaagctag tggtcatcgg
   148141 ctcgtatccc gaagtgcacg agccgcgtgt ggtcacgcat gccgcggaac gcgtctccga
   148201 agagtatggc acccacgcgc acaaaaaatt gcgtcgcggt tactacgcct acgatttggc
   148261 catgtcgttt cgcgtcggca ctcacaagta cgtgctggag cgcgacgacg aggccgtcct
   148321 ggcacgcctc tttgaggtgc gcgaggtgtg ttttttgcgc acctgtctgc gtctggtcac
   148381 gcccgtcggt ttcgtggccg tggcagtgac cgacgagcag tgttgtttat tgctgcagtc
   148441 ggcctggact cacctttacg acgtgctttt ccgtggtttc gctgggcagc cgccgctacg
   148501 cgactacctg gggccggacc tctttgagac gggcgccgcc cgttctttct tttttcccgg
   148561 tttcccgccc gtgcccgtct acgcggtcca cggtctgcac acgttaatgc gcgagacggc
   148621 gttggacgcg gcggctgagg tgctctcgtg gtgcggcctg cctgacatcg tgggctcggc
   148681 cggcaagctg gaggtggaac cctgcgcgct ctcgctcggc gtgcccgagg atgagtggca
   148741 ggtcttcggc accgaggccg gcggcggcgc cgtgcgtctc aatgccacgg cttttcgcga
   148801 gcgaccggcc ggcggcgatc gtcgctggct gttgccgccg ctgccgcgtg acgacggcga
   148861 cggtgaaaac aacgtcgtgg aagtcagcag cagcaccggc ggtgcgcacc cgccgagcga
   148921 cgacgctact ttcaccgtgc acgttcgcga cgccacgcta catcgagtgc tcatcgtgga
   148981 tttggtcgag cgcgtgctgg ccaagtgtgt acgcgcgcgc gacttcaatc cctacgtgcg
   149041 ttatagtcat cgactccaca cttatgcggt ttgtgaaaag tttattgaaa atctgcgttt
   149101 tcgctcgcga cgcgccttct ggcagatcca gagtctgctg ggctacatct ccgagcacgt
   149161 tacgtcagcc tgcgcttcgg ccggcctttt gtgggttctg tcgcgtggcc accgcgagtt
   149221 ttatgtctac gacggctatt cgggtcacgg acccgtctcg gccgaagtgt gcgtgcggac
   149281 tgtggtcgac tgttattggc gcaaactttt tggcggcgac gatccgggtc ccacctgtcg
   149341 tgttcaagag agcgcgcccg gcgtgctgtt ggtctggggc gacgagcggt tggtgggtcc
   149401 cttcaacttc ttctacggca acggcggcgc cggtggtagt ccgctccacg gggtggtggg
   149461 tggtttcgcg gcgggacatt gcggtggcgc ttgttgcgcg ggctgcgtcg tcactcaccg
   149521 ccattctagc ggcggcggcg gcggtggtag tggcgtgggc gacgcggacc acgcgagtgg
   149581 cggcggtcta gatgccgctg ccgggagtgg tcataacggc ggtagtgatc gggtttctcc
   149641 ctccacgccg cccgcggcgt taggtggctg ttgctgcgcg gccggtggcg actggctctc
   149701 ggccgtgggt catgtcctgg gccggctgcc ggcgctgtta cgggagcgcg tgagcgtgtc
   149761 cgagctggaa gccgtgtacc gcgagatcct ctttcgcttc gtggctcgcc gcaacgacgt
   149821 ggacttttgg ttactgcgct tccagcccgg tgaaaacgaa gtaaggccgc acgctggggt
   149881 gattgattgc gcgcccttcc acggcgtgtg ggccgagcag ggccagatca tcgtacagtc
   149941 acgcgatacg gcgttggcgg ccgatatcgg ctacggcgtc tatgtggaca aggcctttgc
   150001 catgctcacg gcttgcgtgg aggtctgggc gcgagagtta ttgtcgtcct ccaccgcttc
   150061 caccaccact tgttcttctt cttccgttct ctcctccgcc ttgccgtccg tcacttcgtc
   150121 ctcttcgggc acggcgacgg tgtctcctcc gtcttgttct tcttcgtcgg caacttggct
   150181 cgaggagcgc gacgagtggg tgcgctcgct ggcggttgac gcgcaacacg ctgctaagcg
   150241 ggtggcttcc gagggcctgc ggtttttccg gctcaacgct taacgagtca cgtaggagaa
   150301 ctacgtgggt aagtgacgtg gatactagta aaaaaaagtg cgtcaaagtt ctcagcgtgt
   150361 gacgtggata ctagtaaaag ggacgtcaaa gctcactacg tgttgcgtgt ttttttttct
   150421 atgatatgcg tgtctagttc gcttctcact cttcctctcc ccgttcccag cgcggtggca
   150481 gcttgggggg tgagggcaaa ttggggtagt tggcgttgag cacgtctagc aggcccaggc
   150541 ccacgggcca accgtccacg gtcttacgct cggtcagctt gaggctaaac gagtgtgcct
   150601 cgtcttgacc ggtaaggcgg aaaaagaagc gtgctaccag ctgcaggcag gtatgccgcg
   150661 tctgctggaa gagcacgaag gtagcgggca cgtactgcac aatgtgcggt tctttttcct
   150721 caaagagtag gtagagcgcg ctgcagatca gccgccgggc gctgtggtgc agcagccggc
   150781 cgaagctttc gcgcacgttc accgcgtcca ggtactggag caggtcgtgc aggcacttgc
   150841 gcgttaagtt gcaattttcc acgcatgaaa taacggtaca gagcgcgaag tgcagcaggt
   150901 tgtcggcctt gacgatgccg cagcggtgtt tgagccgcag atccgagagc ctcacctgcg
   150961 tgacggcgtc ttcggtctcg agcaaaaaca cggcggagta gcccagaaag gccgaggtgc
   151021 acagcaactc gctgcggtac tcggccatgg aaaccagcag cccgtgctcc gtatgcagcc
   151081 acagcttgtc gccgcgcacc gtaaagtcga gcacttgcgg ctccatgatc atcacattct
   151141 gtctagtgaa atccgtatgg acctccagca cgccgcggat catcagggcc tccatttcga
   151201 aatcggccga cacgctctgg gccgcgccgc tcctcgtctg ccgtgatcaa gcggcgcggc
   151261 gcggaccttt caagcgttcc tgggccgccg ctcgaggcag ttcccctttc tggcactccg
   151321 cccgccgctt cgcggctcat ttggcgccgg cgcgccttct cgcggctgca aatcagctcc
   151381 acgtatcggc aaaacttgct gtcgtcgtag gcggcggcta cgatctcgcc gaaggagagc
   151441 tgcaggtagg cctcgggtac ggggtccagc gtgcccagcg ccaggatgtg acacagatag
   151501 ggcagggtca cgcgctctac cgtgtaattg gagtatacga tggcctcttc ggccccctga
   151561 tgcgtgacca gacgccgcag gcgaaaggtg cggaaatact cgttttccca cagctgcgtg
   151621 aggaagcgtt ccagcgactc ggtgccgggc acgaactgcg agaagaagct gttggccacc
   151681 aggcggttgt cctccaccgc cagcggacgg aagggcgccg cgtcgcgcgc cttgcgcacg
   151741 gcctccaaca cgggcaggtg gtacagttcg gcgtcgcgcg cgcccaggct catggagtcc
   151801 tcgcggcgcg aggcgtagcg cgtgagcagg tcgcgcagct cgcgcacgcg attctcccag
   151861 gtctggttga gcgtgcgcag gtcctggatc tcgtccacct gcgactggat ctgctcctcc
   151921 aggcacttga tgacctgctt cttaaacagg tcgcggatgt cccgctcggg cgccgccggg
   151981 ccgggtggcg gcggcagcag cccgacgtgg cccgcgggtc ctcccaccac ggcgccgccg
   152041 ggtcccacca cgccgggtcc acccggacca cgcgcgggta gtagacggtt ttggtccacc
   152101 agcgaggggg tcaggtcctg cagaaaggac tcgacgctgt cctcgatgcc gatgcgcgat
   152161 ttgctgtccg agacgttaag caaaaacttc ataatggact ttttggcgtc gctgccccgg
   152221 tcgtgctgct ccatcatctc caccagcttc ttgcagttga gctcgtggcg gctggcggtc
   152281 accactttca caggaaaggt attgagcaac tggcagatct tttggtggcg gcagagcccg
   152341 tcgtagcgca gaatctcctc gtgcaggtgt gccaccggcg tggtgaacag cagcttgtcg
   152401 cgctcataag ccagcggttc ggccgccacg tacaagcgga tgtgcttgcc gcgcagctgc
   152461 gcctccagcc gctccgagcg caccttcttg aagacgcgta cctcgggcgc gttggctacg
   152521 cgcacggcgc ccaggcgctc ggccacctgc agcagcagcg ccaggttagt ctgcagcagg
   152581 tcctgcgcca gcgggtgtgt ctcggtggcc cgctgcacgg ccgcgcgtac aaattgcgcc
   152641 cgctcggccg cctcgttcgg cttggtcttc acgtccagca gcggtaccag tcccaccgtt
   152701 acgcaccaat ccacgtagag accatagtcg tcgttatcgg cgtactgata taaaatgtcg
   152761 cggagcgcgc ccagcacgcc cgtttgcacg ctctggcgca acgaggcgct ccacaccaac
   152821 agatactgct ccaggtcctc ttcgtccagc gcgcggtagg gaaacagcgc cgcgtgcaac
   152881 ttccactcct cggccacgcg ccgcaccgtg atggtgtcaa agagcgtctt gcacactccg
   152941 tagagcagct gcttgcgcag cacgcacggg tcgcgcagca cctggtgcat gctctggccg
   153001 cgacacgtcc ccagaaagcc gtgcagcaac cgcaggaagc tcatcgtctg gcccgtgggg
   153061 aaaatgtcga tgacggcctc gtcatccacg ccgcggccca cgcccaagta cgacgacgcc
   153121 ttgatcctca acctctcgtc ggccgccaag atcgaacgga tcgtcgacaa ggtcaagtcc
   153181 ctctcgcgcg agcgctttgc gcccgaggat ttttcgttcc agtggtttcg ctccatcagt
   153241 cgcgttgaac gaacgacaga taacaacccc tctgccgcaa ctaccgccgc ggcaacggcg
   153301 accgttcact cctccgcctc ctcttctgcc gccgctgccg cttcgtccga ggccggcggc
   153361 acgcgcgtgc cctgcgtcga ccgttggccc ttctttccct tccgcgcgct gctcgtcacc
   153421 ggcacggcgg gcgccggcaa gacttccagc atccaggtgc tggcggccaa tctagattgc
   153481 gtgatcaccg gtaccacggt gatcgccgcg cagaacctca gcgcgatcct caaccgcact
   153541 cgctcggcgc aggtcaagac catctaccgc gtcttcggct tcgtcagcaa gcacgtgccg
   153601 ctggctgaca gcgccgttag ccacgagacg ctggaacgct accgcgtgtg cgagccgcac
   153661 gaggagacca ccatccagcg cctgcagatc aacgatctgc tcgcctactg gccggtcatc
   153721 gccgacatcg tggacaaatg cttaaatatg tgggagcgca aggccgcttc ggcctccgcc
   153781 gcggccgcgg ccgccgcctg cgaggacctc tcggagctgt gcgagagcaa tatcatcgtc
   153841 atcgacgagt gcggccttat gctgcgctac atgctgcagg tggtggtgtt tttttactac
   153901 ttttacaacg ccctgggcga cacgcgactt taccgcgaac gccgcgtgcc ctgcatcatc
   153961 tgcgtcggtt cgcccacgca gaccgaggcg ctggagagcc gctacgacca ctacacgcaa
   154021 aacaagagcg tgcgcaaggg cgttgacgtg ctctcggcgc tgattcagaa cgaagtgctc
   154081 atcaactact gcgacatcgc cgacaactgg gtcatgttta ttcacaacaa gcgttgcacc
   154141 gacctggact ttggcgacct gctcaagtac atggagttcg gtatcccgct caaggaggag
   154201 cacgtggcct acgtggaccg cttcgtgcgg ccgcccagct ccatccgcaa tccctcgtac
   154261 gccgccgaga tgacgcggct ttttctctcg cacgtcgagg tgcaggctta cttcaagcgg
   154321 ctgcacgagc agatccgcct gagcgagcgc caccgtctct ttgatttgcc cgtctactgc
   154381 gtggtcaaca accgcgcgta ccaggagctc tgcgagctgg ccgacccgct gggcgactcg
   154441 ccgcagcccg tcgagctctg gttccgccag aacttggcgc gcatcattaa ctactcgcag
   154501 tttgtcgacc acaacctctc cagcgagatc accaaggagg cgctgcgccc cgcggccgac
   154561 gtcgttgcca ccaacaaccc ctccgtccag gctcacggag ggggaggatc tgtaatcggg
   154621 agcaccggcg gcaacgacga gacggcgttt ttccaggacg atgataccac caccgcgccc
   154681 gatagccgtg agacgctgct caccttgcgc attacctaca tcaagggcag ttcggtggga
   154741 gtcaactcta aggtgcgggc ctgtgttatc ggataccagg gcacggtcga acgtttcgtg
   154801 gacatcttgc aaaaggacac gtttatcgaa cgcacgccct gcgagcaggc ggcctacgcc
   154861 tactcgttag tttcgggcct gctcttctcg gccatgtact acttttacgt gtcgccctac
   154921 acgaccgagg agatgttgcg tgagctggcg cgcgttgagc tgcccgacgt gagttcgctc
   154981 tgcgccgctg ccgccgccac ggccgccgct cccgcttgga gcgggggaga gaatctgata
   155041 aataatcacg tcgacgcgga ttcttctcag ggcggccaga gcgtgccggt atctcaacgg
   155101 atggaacatg gccaagagga gacccacgac atcccctgcc tgtccaacca ccatgacgac
   155161 tcggacgcca tcacggacgc cgaactcatg gatcacacca gtctgtacgc ggatcccttt
   155221 tttctcaaat acgtcaagcc acctagcctg gcactgcttt ctttcgagga gacggtgcac
   155281 atgtacacta ccttccgcga catttttctc aagcgctacc agctcatgca gcgtctcacg
   155341 ggcggtcgct tcgccacgtt gccgctcgtt acctacaatc gccgtaacgt ggtgttcaag
   155401 gccaactgtc agatcagctc gcaaaccggc tccttcgtgg gcatgctttc gcatgtgtcg
   155461 ccggcgcaga cgtacacgct cgagggctac accagcgaca acgtgctcag tctgcccagt
   155521 gaccgccacc gcatccaccc cgaggtggtg cagcgcggtc tttcgcggct ggtgctacgc
   155581 gatgcgctcg ggttcctctt tgtgctcgac gttaacgtct cgcgcttcgt cgagtcggcg
   155641 cagggcaaga gtctgcacgt gtgcaccacc gtggactacg gcctcacttc gcgcacggcc
   155701 atgaccatcg ctaagagtca gggcctgtcg ctcgagaagg tggccgtgga ctttggggac
   155761 catcccaaga acctcaagat gagccacatc tacgtggcca tgtcgcgagt cacggacccc
   155821 gagcacctca tgatgaacgt caacccgttg cgacttccct atgagaagaa caccgctatc
   155881 accccctata tctgtcgcgc gctcaaagac aaacgcacca cgcttatttt ttgacacaac
   155941 accgtgtaag gaaaacgtga ctttattgag cagggtaaaa accacgtaca agaaccacgt
   156001 tgtctatccc caaaaaaaac acacaccgtc agggaacaca tcgcctatag atagcggcac
   156061 ttcacataaa accaccgtac ctgcatcacg gtggctcgat acactggaaa ttcaataaaa
   156121 accaccgtgt ctccgtgacg gtacttgccg ggtcagcgtc tttctcttga gatttctgtt
   156181 cgtaaactta tccgtttccc cggtccgcgg tgtctcttcg cgaggctgac agtctacgag
   156241 tggtatctac aagagaaaga aacccgggtg ggagcgacgc cgtcgctggg tatcaacccc
   156301 gcggctgacc gtcgtccggt aaaggaacaa cccgtcgtcg caagccgggt tcgaccaaga
   156361 gaaaaaaccc gggtgcgggg ggagacgggt cgtcctttgg ttgttcgcgg acggcgtaca
   156421 tgccgcgtgg gtcagtcgac ggcgtcgctc cgtgcggtcg gtcatcattc tgcttcacat
   156481 atatgggttg tttgtgtttt tttttataat gaatacgcac tgatcctatc cgtgactgcg
   156541 cgtgtggcag agaggatgcc ttataacatg tattttgaaa aattgccaac agctataatt
   156601 tctctcatgt agcagaatag agaccttttg tcgtcttttt gtttgtcatt acttgttttc
   156661 cagggaatta gagagaggga accgcgcctc cggcggcggt gcccgcggac cccggcccct
   156721 tctcgcgtgc gcggtgtgac tagttgagcg aatgagcagc taggcttggt ggtgctccgc
   156781 gtgcggggga gaagacgatt aacaacaaaa aataagtgga agtggccggt gggtctttgt
   156841 ccgcgtgcgc gcccatccgt cgccgggacc gagcagaaag tgatgtggtg gtacattgat
   156901 tttttccttg acaggaaaga aaaaaaagag ttttgttttc ctatgtgaga ggagaaaggt
   156961 atgtgaggag atgttcgatg atcgtatgtt acagttatgc tgtaaggaag cttttatcgt
   157021 gcgtcctgtt tttcatttga tgtatatgac acaattgaaa cctatcgata ggcgtatatc
   157081 gaggattcat caattcttag aatcgtcgtc tttttggcta attggacttt gcccatgttg
   157141 gttgtcattc gtggcctgag gtcatcgtcg tccacgacga cgtgtctata gcgtgcggtg
   157201 tgatcattgt gtcgagccag agaaagcgcg cctcgcacga cgtttgcgga tcggctcgcg
   157261 ggtgtgtgga attcctaaga acataatcag ctggtcgtct ttctttgatg tgttgttgtc
   157321 gtcgaggtct tgcttcgttt tcttttttct ttttagtcga tggaactttt cttcggtacg
   157381 ggttcttgtt atggaagctt gtgttttcga acatgaattc gaaaaaataa aaaggcctat
   157441 cttcgtttca gaaaaaggac agatatcaat cttcttaact tatatcatgg taaattcaga
   157501 atcctatggt gtcttattat ctctaaagta gtcaacatta tggtctaact tgtatttccc
   157561 tgacgagata tatatgatcc ttataacctg gctactatca tgaacaacaa tatccttact
   157621 tacagtcatc ttcgtgagtt aatgaagtat aatatcggtc atctatcaac ttatctgcta
   157681 tgtaacgtac ccttttaggt attttgcgtt tcttaacgag tgtacccgcc tgtgtgaggc
   157741 gaaactctga gaagtctacc gagtcgagtt acaagtcact aaaacactta cacgagttat
   157801 ctatactaaa atcactatct atgttgtttg cttacctaat tattatccta catgacgaag
   157861 ctacctccca acgtaaggta gggggagagg agacagaaca ataaaaagta actaatgttt
   157921 cttagaactt acccgctaag gacttaccaa actatattca ccaaaaaaca acagctacgt
   157981 gtttcatttg ttttaatcta ccgaagtaaa aaaaaaagat gattagctat ccagaaccta
   158041 cttacttctt aatgttttaa ctaaggatgc ctatgggatt ggaaaaaaaa tcacagcaac
   158101 ttgctactaa tcagttgaca gcgaagagac tcataacaaa gatttctggg taatacggtt
   158161 ataataatgc ttatggacta aaggatactt ggaaaaaaag aacgggctat gactatagag
   158221 attcatcgag atatcaaact tcaaataggc ggctatcatt catggttgtg gtgactatcg
   158281 tggagaaaaa atgtgatcgt tagttagcta ggtgagactt acagctatcc atccgtctag
   158341 tttttcgttg taatgatgat agtacgtcta tggtggtgat cgattttggt tagcaatttg
   158401 ttcgtttaaa ggcttaatgt acttatgcta catgatgtat tattctttga ttcatcgttc
   158461 ctcctaaggg ggtgtatgta tgtatgtatt agtcgtatag tgttcctaac atcatgacta
   158521 ttcagactat ggcttcatct atcgtgtcta aagttcactt attctactat tactatatat
   158581 atgcactact atgtaactag gatatggtcc tataaggtgt cttctatcac ggtggcttgt
   158641 ttatcgcttg gcggttacga gcaagagttc atcacggacc agccgtgagg cagggcacac
   158701 gcgggtcggc ggcgatgatg tcccccgcga agggaacaac aaaaacaaga caagaggccg
   158761 ccggccgcgg ccacggacgc gtagcggtta cacaatgttt ggttgagcgt tttgtttcat
   158821 cgtcgtggtg gtggttttgt tgttctctgt atatatcgtg tggtggcttt atcgtcatca
   158881 ttattatcat cattcttgtt tccatcatca cgatgagttt tctccgtttt cctctcctcc
   158941 agtggtagtc gtgtatcatc atcaatcatc gtagtgacgt cgttgctgct gctgctcttg
   159001 ccttcatggc ggtatttctc ttcctccccc ctaaccccat attaactcgt gagtgtgatg
   159061 gttagagtgg ctgcttgttt tttttttctt ttctctttgg aacaacaaaa gaggataaag
   159121 atggtcggtg gatgtattat tattatcatc attatgatac ggtcgcggtc ttcttctccg
   159181 atgacgaaac ctgcgcacat cgaagaaaag acgagcgcgc gaaccgatag ccgtccgtct
   159241 gggacgaagg agaagatgat ggggagagga ggagagcccc agaagccaga gcgagaaggg
   159301 agacgacaga catacgtcgt caccgtcctc tggaggaggc acggcggcgc tgtttgttgt
   159361 ttggatgctt gattatatcc tgttctatgg ggtagattat tatcaatagg cttggttttc
   159421 gaaggtcagc ctgtgtattg tcgtgtcttt tttttcgttc tcatgatcgc ggagaccaca
   159481 cagacgtgcg cgtctcccaa tggctaggcg ttctttttag gtagtaattt tttgatcttt
   159541 tttttttctt aacaagtctg gcttgatttc ttttatctat gatcgattct tctttttctc
   159601 gggggttgca tcttccgtga aagtaaagtg acactactct aaatggtaac catattatct
   159661 gttgattagg agaaaaaata attttttcgc acgaaatcga tcctaagtga ggtgatttac
   159721 ttgctatcac acgaaatgat tatcttttgc tgctaacgta ctgaattttt taacagaatt
   159781 gcttctccgt aactatttcc gcagattcag acagattgtc aaaaaaaaat acggcacaga
   159841 aatagtgggt ctgtggcttt tggttcgtgt acattcgcgt ttgcgtgtcg agatttctac
   159901 ggtatgttta ttcttcctgc gatgatgtag ggtccttggt gtaagtagga tttcgagtat
   159961 ctctcttaga gcgaacaaaa taatcaaaaa acaacagcta ggaaatcgag ggttactcta
   160021 cgatagagtg tctctacaaa gtgaagaatg ttacgttgtg gtggaataat aagactcgcg
   160081 tgatcgatga gtgatcgaga gcggctcgaa ccttctttaa gagctttgtt tagtgcaact
   160141 ttaaattaca aggagtagaa agctgaaatg aatctatgaa ggtgctattc tttgaatatc
   160201 ttactttgta cgcttcacat tcgttatttg gatagagagt tgtctagaga aaatctgtga
   160261 ttctctatga gtgttatttt tattatcctt ttggggacta cgatttttct tcttgttcta
   160321 cataccacta ctactcgtaa tcacatacat ggacgaaaaa aaaattcgtc aggcagtaga
   160381 taccagattc tccgacgtta cagcgtcttt ttttcttttg agagagtatc tgctgagatt
   160441 gtccgtggtg tatctagtcg ctatttttgt tgttactagt agttttgcac acagtttatt
   160501 cagtatagtt tttcttcttg ccatgatcaa ttgagcccac cacctttttt ttttagagag
   160561 gaggaatttc gtcttgatct ccagccggag acaacggcgg cggtggtggt ggtggcggga
   160621 gagacttcaa ggcaatgaaa aaaaaatttc gttttgccat caagtggtga cgataacccg
   160681 tcagattgat aattggttcc tacagaaact attctaaccg cggaagaaag aaattgaaaa
   160741 aaaaaatgac aaaaacatca taacataaag gaccacctac ctgggacgcg cagttgggcg
   160801 gcggattggg gcggcatgct gcggcgatgc tgtcggtgat ggtctcttcc tctctggtcc
   160861 tgatcgtctt ttttctaggc gcttccgagg aggcgaagcc ggcaacgacg acgacgacga
   160921 taaagaatac aaagccgcag tgtcgtccag aggattacgc gaccagattg caagatctcc
   160981 gcgtcacctt tcatcgagta aaacctacgt tggtaggtca cgtaggtacg gtttattgcg
   161041 acggtcttta ttttccgcgt gtcgggtgac gtagttttcc tcttgtagca acgtgaggac
   161101 gactactccg tgtggctcga cggtacggtg gtcaaaggct gttggggatg cagcgtcatg
   161161 gactggttgt tgaggcggta tctggagatc gtgttccccg caggcgacca cgtctatccc
   161221 ggacttaaga cggaattgca tagtatgcgc tcgacgctag aatccatcta caaagacatg
   161281 cggcaatgcg taagtgtctc tgtggcggcg ctgtccgcgc agaggtaaca acgtgttcat
   161341 agcacgctgt tttacttttg tcgggctccc agcctctgtt aggttgcgga gataagtccg
   161401 tgattagtcg gctgtctcag gaggcggaaa ggaaatcgga taacggcacg cggaaaggtc
   161461 tcagcgagtt ggacgcgttg tttagccgtc tcgaagagta tctgcactcg agaaagtagc
   161521 gttgcgattt gcagtccgct ccggtgtcgt tcacccagtt actttaataa acgtactgtt
   161581 taaccacgtt gcgtcgtgac gttgtttgtg ggtgttgcta ggcgggctgg aaagatgatg
   161641 tataaataga gtctgcgacg gggttcggcg ctctgccgac tgcggcggca ctcgctccac
   161701 ggcctccgac gagcgttgcg ctcgcgcttt gcgccgccgc gtcatggatc tccctactac
   161761 cgtcgtgcga aaatattgga cttttgcgaa tcctaaccgc atcctgcatc agagcgtcaa
   161821 tcagactttc gacgtgcgcc agttcgtctt tgataccgcg cgtctggtca actgcgtgga
   161881 cggcgatggc aaggtgttgc acctcaacaa gggctggctc tgcgctacca ttatgcagca
   161941 cggcgaggct tcggccggtg ctaagacgca gcagggcttc atgtccattg acattacggg
   162001 cgacggggag ctgcaggagc acctgtttgt acgcggcggt atcgtcttca acaaatccgt
   162061 ctcttcggtg gtgggctcca gcggacccaa tgagagcgcg ctgctcacca tgatttccga
   162121 gaacggtaat ttgcaagtga cttacgtgcg ccattacctg aaaaaccacg gcgaatcctc
   162181 cggtggaggc ggtggttgcg gcgccgcgtc taccgcctcc gccgtttgcg tgtcctcgtt
   162241 gggcggcagc ggcgggactc gcgacggtcc ttctgcggag gaacagcaac ggcgaaggca
   162301 ggaacagcgt cacgaagaac ggcgcaaaaa gtcgtcctcg tcggccggtg gtggtggagg
   162361 cggcggcgct ggtggtggcg gtggcggcgg cgggagcggc ggtcagcact cctcggactc
   162421 cgccaacgga ctgctgcggg atccccggtt gatgaaccgg cagaaggagc ggcggccgcc
   162481 tccctcctcc gagaacgacg gtgagtcccg gccctcctcg cgtcacggtg ctttccgagt
   162541 ggactcgtga gcccccccgt agcgcacgag cgagcaggcg agcggtgttg gtgcgctggt
   162601 ggttgtgtgg atgataacca tgtgcttttt cgtgcgctat gtgtcgtccc gtctgtaggc
   162661 tctcctcccc tccgggaggc gaagagacaa aagaccaccg cacagcacga aggccatggc
   162721 ggcggcggca agaacgagac ggagcagcag tccggtggtg ctggcggtgg tggtggcggc
   162781 ggcagcggcc gcatgtcgct gccgctggac acgtctgaag cggtggcctt tctcaattac
   162841 tcgtcctcat cctccgcggt ctcttcttcc tccaacaacc accaccacca tcatcaccac
   162901 cataacgccg tgacggacgt ggccgccggc accgacggtg cgttacttct acccattgag
   162961 cgcggagcgg tggtttcgtc gccgtcgtcg ccgtcgtcac ttctttcgct ccctcgaccc
   163021 agcagcgccc acagcgcggg cgagacggtg caggagtccg aggcggcggc gacggcggcg
   163081 gctgcggggt taatgatgat gaggaggatg aggagggctc cggctgaggc ggcggaggca
   163141 ccaccgcagt cggaggagga gaatgattcc accactccag tctctaactg ccgtgttcct
   163201 ccgaattcgc aggaatccgc ggcgcctcag cctcctcgca gtccgcgttt tgatgacatt
   163261 atacagtcat tgaccaaaat gctcaatgat tgtaaggaga aaagattgtg cgatctcccc
   163321 ctggtttcca gcagactctt gccagagacg tcgggcggga ctgtcgtcgt caaccacagc
   163381 agcgtcgcga ggaccgccgc agctgtctcc acagccggcg ttggcccccc agcagccgca
   163441 tgtccgccac tcgtcaccac cggtgttgta ccctcaggtt ccgtcgccgg tgtcgcgccc
   163501 gttgccgccg cagtcgaaac accagctgct cctccccggc ccgtgtgtga aatcaagccc
   163561 tacgtggtaa accccgttgt cgccaccgcc gcggctgcca gtaactcttc ctcgtcttct
   163621 tcggctccac tgccgccgcc gccgccacca ccgccgggcg gacgtcgggg tcgggcccgg
   163681 aacaataccc gaggaggcgg cggtggtggc ggtggtagaa acagccggcg gcaggccgca
   163741 tcgtcgtcgt cctcctcctc tcggagatcg cgacggagaa acaaccgcca cgaggacgag
   163801 gaggacaacg accctctgct ccggttgtcg caagtcgccg gcagcggccg ccggcgaggg
   163861 ccctcgttcc tcgaggacgg actcgaaatt atcgatccca gcgaggaagc tgcgatcgcc
   163921 gccgcctcga tcgcggcgtt tttcgacgat taaaaaaccg agccgagacc ggaaaaatta
   163981 tgaaacagga cgcgcttgga catttgggtt tccacccctt ttggtgtgtg tctatatata
   164041 ttggtcactg atttttttta caataaagag atagacatca cagttcacca ccttgtctcc
   164101 ccggtgtgtc tattatcatc aatcacccac agagtcgcca gtccatggtc tcttggtaat
   164161 gcgtgtccag atacgcgttg gccagtataa aatggtcgtt gcccacgaag gcgcgggtgg
   164221 tgttgcgcgg cgacgggtgg caggatttga gtaccaagtg ccgccgtcgg tcgatcaggt
   164281 actcgcaggt gtgcgcgtcg gcgccccaca gcatgaacac cagatgctcc cggcgctctg
   164341 acagcctccg gatcacatgg ttactcagcg tctgccagcc taagtgacgg tgagatccag
   164401 gctgtccgtg caccacggtg aacacggtgt tgagcagcag cacgccgcgt cgcgcccaag
   164461 cgtccaggca acccgaggcc ggacgctgaa acccgtccac cgtacgcgcc agttcgcgaa
   164521 acacgttgtt gagggagggc ggcggcggtc ggcccgccag cgtgccgaag gccaggccac
   164581 tggcgctgcc gtcgcagtac gggtcctggc ccacgatcac cacgcgcacc tgctcgggcg
   164641 gacacagata gctccagcgg tgtacgtgct cgggtgccgg gtacaccatc tcgagttgcc
   164701 gcgcgccctc caccgccgcc accgtgtcgc gcagcagcac cgtgtcgtgg tcgggcaagc
   164761 tgaggaagcg gatccagtcg gcgctcagac aaaacacgcg agcctgctcg tcgggggtta
   164821 acagagagcc tttattatca gcaatgttag cgagcatcca ctgcttgagg gccatagcgc
   164881 gagtgagccg gcaggttgac gcgcgtctgc ttcagctcgg gcggcagtcc ggcgtagtat
   164941 ttatctaggt ggcgtagcag cggcgggtcc agctggtgac gcaggcagaa ttccttcact
   165001 gcgttgtaca ggccgtaaaa gagcgtgatg ccctcgggcg cggcagcggt gctcacgggc
   165061 agacgcacgg cgcggttggt acgcgtggct tcgttgcgta tggccaccac cacgttaaag
   165121 agagacggtg gcaccagctc gaagcctaac acgtgttccg tgaagatgct gcgctcgtat
   165181 gacagtcgcg tgaggtcgta gccgcggcac aggtcgtcca cgcacgtgta cacggccggc
   165241 gagccatcgc cgcactcgct gtagccgcgc atcaccgtca tccagcgcgg cgctgtgtcc
   165301 gagctcaaca gcgtcagcag ggcccgcaat tgatccggat tgttgtacag cagagccaga
   165361 gtgtccagga aagcctcgtc caacagcacg gagttggcgg cttccggcgt aacgggacgg
   165421 taacggataa gttgcgatag cgggccatcg cgtccggtaa cattcaccaa cgggcgcagc
   165481 caactttcat acttgtcacc ctgaaacacc tcacccaaca ggcatcggcg cgttagttcg
   165541 gggcactccg cggggacttt ctcggcggcg gtaggagcga cgctgacggc ggctgaggaa
   165601 acaatgggca gcagaaggca acaccacagc agtatcaccg gtccaggtga gaaagagaag
   165661 ccgcaatccg ggcggcggca catcaagtct gcggcacgat gagagtgtga cggtaaggag
   165721 ccagttggcg ccgaaagttg gcactcaggt cttcgatccc taaaacgtta tatattgcat
   165781 ccagcaggtg agccaggcta aacggattca cgtaccaggt ttggttaccc gcgacgatga
   165841 cggccagacc gtgggcgcta cagttggaga ggttcctggg tacgaaggta actgagtcga
   165901 tgtcgcgcca cggggggaat gagacagacg actggcgcac gctgtaatca caactgtgat
   165961 tgacgtattg tagcgtgtaa tttaggttgc actcagcctc gaagtagagg gggaaccaca
   166021 gttcgtcgta ctcttcgtcg tcgtcctctt ccgactccga ctcttcttca cccaccgtaa
   166081 tgtccacgct gctctgagat tcctcttcgt acaggatgat tgacaggtta tggctacaca
   166141 ggtcctgggc gggaggacgc gtgggagcgc gggtggtggt aatgttttcc aggtcaaaag
   166201 ttggagtgta gtcggatgtt acatctccgt tgttggaggt ggtagaagtc gcggccggtg
   166261 tcacggtggt aagtatggat acagaagggg agggggaagt agcgttcgta ccgatggttg
   166321 tggtattatt attccctgtg tttcttattc cagaaaccgt tgacgttgag atgggaatcg
   166381 acgtggcgct ggatgtcaga ttgctgaccg aggaaaccgt ggtgggagtg gtgacggtgt
   166441 tactcgtggt tgaagtgacg ttaggggagg tagtagtggt accggtggtg gcgacggtag
   166501 tgtttgtcgt ggcggcggca gcggtggtac tggtaacggt ggtcgtgttg gtttccaccg
   166561 cttcacgcag taagcaaaag catagggcca ggaaaagcaa ccagccccgc catcgccgcc
   166621 gccgcttcat gaggtgggca ggcgaaagct ggtgaattcg ttgtacagcg gcaagtgggg
   166681 cgccgcgatc gaagggtacg tcaacaagct gacgttgata ttaaatacgt ctggctgctt
   166741 ttctacgatg gaagcgcaca gggtcacggc gtcaaacagg tctttcttgg tggcgcccga
   166801 gacccacatc tggtacacac ccgtctcgtg gtacgaagtg gagcgcggca ccaccggacg
   166861 gatgcagtcc agaacgcggt tgggatcctg gtgaaagaat ttgaacgtgg ctacggcctg
   166921 tggcgtgtgc ggcatcgtct gcgtgatgag ctgctggccc gctaacacgg tgacgttgtg
   166981 caacttgagc agggcactct tgagggcctg gaaagcgttg ccgcacgagg cgctgatctg
   167041 cagctgcacg gccgtggagt cgtgcagccg catgagacgt gacacctctt cgaagacgta
   167101 cttatacttg ctggcaaaga gtggcgcgta ccgacagtcg gccggcaaaa tgtaggtggc
   167161 gttaccgccg ttggtggcca cggcgggcgc agcggccgcg gaggccggcg taaatagcgt
   167221 cagcggccgg tggtggctgg taaggtcgat catgggcggc gtggtgaccg tggcggtggc
   167281 gggcatgacg gggtttgcgg cgacgggcac tccggccaca gcggcggcag cggcggccac
   167341 ggcggcgctg gccgagccca cacccgccgg cagtcctccg ctacccatga cgccgccggg
   167401 cagagcgtcg cccagacaga cttccacagt ggcgggcgcg ctctcggcgg tcagtacggt
   167461 ttgccgatcg acctcgcgac gaaagctggt gaggaactca ctatgatcca tggccgcagg
   167521 gcccgagatc ccgggattct gcgggtgctg accgagtgcg ggccgagtta tatggaagac
   167581 gattagcttg gagcggagtt ttgcgtccct agctgacctg cggatcagcg acgtgccata
   167641 gggatagact gtgagcggcg gccgcaacgg cgggatcggc cgccgttcgt cgtcacgggg
   167701 cggcgcgagg gaggaggagg tggtggtggg tacgatcttg acgtggttaa cgtcctgccc
   167761 gtccggggga atacgcaaaa aaccccgccg cggcgctacc acgatggtgc gatgggtctt
   167821 tctcttgttg gccggggcca gggacttgca gatgcgtgtg gagccgtaga cgatctggac
   167881 gtggtcctgg gagaacatga ccatcgccgc caacgctcag cggggggacg ggttgggaac
   167941 acagaggctg aggggaaacc ccgtagaagt tagcgaaata aagacaacac agcagccgct
   168001 cctctcgttt cgggccctac cactgcttga agtagggcac cgggtgtttc ttttcctcaa
   168061 cgggctcctc cagtctctta taggaccagt cccgccggcg cgccagcatg taggtcacgt
   168121 acaaaagaat aattaccatg aacaccagga aagccagcac gccgtaggcc agcagccggt
   168181 cctcgaacag cgggtcgctc ttgataaaca cgtaggtggt ggtaaaactt cggcccgcga
   168241 tctgaacgtg gagacgcacg acagtatacg tgccgttgag gtagaagaca aactcgcgta
   168301 accgttgtcc gttatacgtc acgttactaa tattccacgg cggaatgagc tggtcgccct
   168361 gatgcagatg cacggtgctg ttggggtgat agaggctgct accgttgagc aagcagtgtt
   168421 cgtgttcctg aagcagcacg cggacccgca tcgtggtggc gttcaggcga gtcccgtaca
   168481 cggcgtagat gggataggtg aaaaggtccc aagtggcgtt gtgatggcgg ccccagctga
   168541 agaaagagca cgtgtactca gtggtctcct gcggcctgag tcccgagata agcagctctt
   168601 gagcagtagc gttgtaggag agatgtagtt ttcctgcgga taaaattaat gtttattttg
   168661 atatcaggtt gacgatggag gaaaaggggt tgaacagaaa ggtaggtgct acttaccttc
   168721 gttatcgggg ggaaaagcgc taagataccc cacctgagtg aagggacctt tgcagtcggt
   168781 ccgtgcataa caagtaactg ataaaatgtc tggatttttg gtgttattca acaggataac
   168841 tttgcaggtg gcgtttagag acacttggtc gtagctgtag ctggcttcgc aattcacagt
   168901 atacaggtgc ccctctttct gcgtcgtggc tatcacggag gtggaggcgg acgaggtaga
   168961 ggtttgtacc gtggtggtga cagcagaagt gacgttgtta gaggtactta ttgacgtagt
   169021 ggatgtggcg gtggtattac taggggaagt aacggcgctt gtggtgctac tttccactcc
   169081 cgggtgcgtg tcgcccaaaa gcgcaaccac gagtacgatc gccagtacgg gacacatgtt
   169141 gctgtgtgac gagacggcgt gtggacgagc tatatgtggc agggggccgc gtcaccgctt
   169201 gtgacgctta aacgtccagc tccagataaa agaagcgtta ataatgaaga ccacaaaaac
   169261 cacttgcgtc agtatgacaa tcataaaggc tcggtgattg ctgcgcctaa agtacgcggg
   169321 attctccacc agttcattct gttgaacaaa gtggatggat gtactggtgt taccggtcgt
   169381 gtcgttaacc atggattgca ctaggaaagt cccggcgccg aaaattccgt tagagcccca
   169441 gcaagtaacg ctgccgttca cgtaggttcc cggatcaccc gttagcatat atgtcagttg
   169501 gtgggtatag tttttcctga tattattcat gtcattacta tagttgactt tgctagtgag
   169561 aaatcgtgtg ttatgtggaa tactgatcat cattcccgag gccaaaaagg gcgaattgcg
   169621 agctgtagtg ttacaaaaaa tagtcaggtt agtgtcatta tgctcataca tataagccat
   169681 gctcacttgg ggctcatacc acccaattgc agccgccacc gtcaccacgt cccatctccc
   169741 caaacttacc accgccacca ctaatagcgt cacccccgca cggtacatag ttaccctctc
   169801 gacgtcgccg gctgtcaatg acgtgcctgc gtcagtagct atgatttata gcttttggac
   169861 ccaaccgcaa cggatctgtc gtaatctacc ttccacaggg ccgccgcgac gatgctgaac
   169921 gacaggatca gacagacggc gtataggagt cctaggtcgg cgtcgacgcg gcaggtgcgg
   169981 atgtctcgca gggtgggtag atggacgatg cacaactctt tctccccccg cccgtacatc
   170041 ccatctcgta tcagcagccg tagcgtggca ttgatggtca gcggggtaac caaagaaatc
   170101 acatagggat gtgtacagga agtgcagtga cgggtatccg tgagatgtaa gtcatcaccc
   170161 tcctcaccgt catcatgaaa gaccaagact cgggtgagac gacccgatga atactggatc
   170221 tcccaccaca gtctttggtc caacaccgag agggcgcaag agattctaag tctccctggg
   170281 ttgggtgagc agatgtaagc cccgtatgtg cctctcgcca tcagggctat acacatgagg
   170341 gggagaagga caagtatccg ggaccacccg cacccccaca tcacgagacc agagacggag
   170401 atgtataaaa aaaagctact tttattaaac agcattctca ccacacgtta atactgtcac
   170461 ggggaatcac tatgtacaag agtccatgtc tctctttcca gtttttcact tactgagact
   170521 tgttcctcag gtcctggatg gctgcctcga tggccaggct cagggtgtcc aggtcttcgg
   170581 gaggggtctc ggtgggctgc tcaaactgcc ccacggcgta ggccttcgcg gccgtctcgt
   170641 agataggcag catgaaccca ccctggttgg tggagaagat gcgcaccatg acctgtttgg
   170701 ggaacttttg catcaggggc aggcacaggt tgagagcgcc caacaggtcc acgggggtgg
   170761 cagcgtggat gatcatgttg cggtaatcgg aggaacgggg gcataattgg tgggtgtgca
   170821 attctttgag gctccacgcg gccttgacgc cttcgttaca agcatcggcc gtgcgctgcg
   170881 ccacttcggg tgggtgtgtc acaggcatgg tgtgctccat gaggaaggga gtggagaggg
   170941 ccaggttgca catggtgccc aggcgacacc gcaccgcatc cacctcactc ttcacctcat
   171001 gattgcgggt gtagatgatc tggatgccct tgttgttcac ctgcatggtt ttgcaagctt
   171061 tgatggcctc atctaacacc tggtgcatac tgggaatcgt gaagggcagg ttcttgtact
   171121 caagagagcg attggtgttg cggaacatgc ggctcacctc gtcaatcttg acgcgacccc
   171181 gccgagtctg cacgttgggt gtgcagaagg gggtgttctt atctttcatg atattgcgca
   171241 ccttctcgtt gtccaactcg gagatgcgtt tgctcttctt cttgcgaggt ccggtgctcg
   171301 ccccgccgct gctctgatgg ccgcagctca gcagagagga ggaggccgcg ccaccaaaac
   171361 cgccgcgccc atggtggctc gaggtcacgg atgctcctcc gccactgctg catttcatct
   171421 cctcggactc actctccgag tccgaagccg aactgcagga ggaggaagac gaagaggaac
   171481 tatcttcatc gggccggccc aaaggatcgg gaagaggagg gtggttcatc tgggagagcg
   171541 ggtgcgtggg agaggtcact cgcggcgtgc cgctgccggt ggaaggggaa gacgcggtag
   171601 caccgcgggt ctcgacttct tcaccctgtt cttcctcgct atcagagatc acgatacagc
   171661 cggcggtatc gataatcttg ttgcggtact ggatggtaaa gtcgggctcg ggcttgatgt
   171721 cttcctgttt gatgaggggc agcatgatag gcgcgggagg cacgggcggt ttaataatca
   171781 ccttgaaagg acgcgtggtt ttgcgcggtt tcttacgcgg gctgagctcg ggagtagcgg
   171841 atgccccggg gagaggagtg ttagtaaccg cgacgctggt gggggtcggc ttgttaagag
   171901 gggcgctgct aacgctgcaa gagtgggttg tcagcgtggg gccggtgcta ctggaatcga
   171961 taccggcatg attgacagcc tgggcgagga tgtcacctga tggtgataag aagacacggg
   172021 agacttagta cggtttcaca ggcgtgacac gtttattgag taggattaca gagtataaca
   172081 tagagtataa tatagagtat acaatagtga cgtgggatcc ataacagtaa ctgatatata
   172141 tatatacaat agtttactgg tcagccttgc ttctggtcac catagggtgg gtgctcttgc
   172201 ctccagaggt ggtgggttcc tcagcaccat cctcctcttc ctctgaggca acttcctcta
   172261 tctcagacac tggctcagac ttgacagaca cagtgtcctc ctgctcctcc tgagcaccct
   172321 cctcctgttc ctcatcactc tgctcacttt cttcctgatc actgttctca gccacaatca
   172381 ctgaggacag agggatagtc gcgggtacag gggactctgg gggtgacacc agagaatcag
   172441 aggagctagc accagcggtg gccaaagtgt aggctgcaat agcatcttcc tcatctgact
   172501 cctcagcgat ggcccgtagg tcatccacac taggagagca gactctcaga ggatcggccc
   172561 ccagaatgta ctgggcaaag accttcatgc agatctcctc aatgcggcgc ttcatgacat
   172621 tgataacctc aggcttggtt atcagaggcc gcttggccag catcacacta gtctcctcta
   172681 agatatagca gcacagcacc cgacaaaact cacttaagag agagatggac ccgtacatgg
   172741 tcatcataca agcgtcactg gtgaccttgt actcattaca catggtttcc acacatgtag
   172801 tgaggatatc cataaatatg tgatcaatgt gcgtgagcac cttgtctctc tcctcatcca
   172861 aaatcttaaa gattttctgg gcataagcca taatctcatc aggggagcac tgaggcaagt
   172921 tctgcaatgc cgccatggcc tgactgcagc cattggtggt cttagggaag gctgagttct
   172981 tggtaaagaa ctctatattc ctgtagcaca tataaatcat ctttctgtta agttcatcct
   173041 tcttagcacg ggccttagcc ttcagtgcac cccctaactt gttagcggcg cccttggtca
   173101 catcatgcag ctccttaata caagccatcc acatctcccg cttatcctcg ggtacaatgt
   173161 agttctcata catgctctgc atagttagcc caatacactt catctcctcg aaaggctcat
   173221 gaaccttatc taagatatct aaggcattct gcaaacatcc ccccatcata ttaaaggcgc
   173281 cagtgaattt ctcttccgtc tgggtatatt ttttcagcat gtgctccttg attctatgcc
   173341 gcaccatgtc cactcgaacc ttaatctgtt tgactgtaga ggaggataac aacacatata
   173401 agtatccgtc ctcctgactc atttatcgct acctcgatgc cccgctcaca tgcaagagtt
   173461 aatcttcact ctatctgaca tacacaagta aatccacgtc ccatgcaggt tagtatatat
   173521 cacatacatg tcaacagact taccgagttc tgccaggaca tctttttcgg ggttctcgtt
   173581 gcaatcctcg gtcacttgtt caaaggtttt gagagattct tcggccaatt ctgggaacag
   173641 cgggtctccc aggctcagct gactgttaac ctccttcctt aacatagttt gcaggaacgt
   173701 cgtggccttg gtcacgggtg tctcgggcct aaacacatta gaaagagtca taagcacatg
   173761 gatcacatac aggaaatatg tatataacat taaagatata actttttatt aaaaaaaggg
   173821 gaacacaagt cccgacacgt accgtggcac cttggaggaa gggccctcgt caggattatc
   173881 agggtccatc tttctcttgg cagaggactc catcgtgtca aggacggtga ctgcagaaag
   173941 gatccatgga aaggaacagt ctgttagtct gtcagctatt atgtctggtg gcgcgcgcgg
   174001 cagcaacgag tactgctcag actacactgc cctccaccgt taacagcacc gcaacaggag
   174061 ttacctctga ctctcaacag aacacaactc agctgcctgc ttcttctgct gctgccttaa
   174121 gtcttccatc tgcgtcagcg gtgcaagccc attccccgag ctcattttca gacacatacc
   174181 ctaccgccac ggccttgtgc ggcacactgg tggtggtggg catcgtgctg tgcctaagtc
   174241 tggcctccac tgttaggagc aaggagctgc cgagcgacca tgagccgctg gaggcatggg
   174301 agcagggctc ggatgtggaa gctccgccgc taccggagaa gagcccatgt ccggaacacg
   174361 tacccgagat tcgcgtggag atcccacgtt atgtttaata aaaactgcgg gcactgggga
   174421 cggtgttata tatgtgaatt tgtaaataat aaatgggacc ccttcctgta aaaatacaga
   174481 gtccgtgtca gtctctgaat gacagtattg gcatatagcc aacaaagaga gttgtggcaa
   174541 agagccatgt tatggattag taatggaaag tatcgtcacc aataggggag tggtcaataa
   174601 tggtcaataa cccacaccta taggctaagc tataccatca cctatagcat aaggaagcgg
   174661 gggtgtatag gccccaagcc aaaaacagta tagcatgcat aagagccaaa ggggtgtgcc
   174721 tatagagtct ataggcggta cttacgtcac tcttggcacg gggaatccgc gttccaatgc
   174781 accgttcccg gccgcggagg ctggatcggt cccggtgtct tctatggagg tcaaaacagc
   174841 gtggatggcg tctccaggcg atctgacggt tcactaaacg aactctgctt atatagacct
   174901 cccatagtac acgcctaccg cccatttgcg tcaatggggc ggagttatta cgacattttg
   174961 gaaagtcccg ttgaatttgg tgccaaaaca aactcccatt gacgtcaatg gggtggagac
   175021 ttggaaatcc ccgtgagtca aaccgctatc cacgcccatt gatgtactgc caaaaccgca
   175081 tcaccatggt aatagcgatg actaatacgt agatgtactg ccaagtagga aagtcccgta
   175141 aggtcatgta ctgggcataa tgccaggcgg gccatttacc gtcattgacg tcaatagggg
   175201 gcgtacttgg catatgatac atttgatgta ctgccaagtg ggcagtttac cgtaaatact
   175261 ccacccattg acgtcaatgg aaagtcccta ttggcgttac tatgggaact cacgtcatta
   175321 ttgacgtcaa taggcggggg tcgttgggcg gtcagccagg cgggccattt accgtaagtt
   175381 atgtaacgcg gaactccata tatgggctat gaactaatga ccccgtaatt gattactatt
   175441 aataactagt caataatcaa tgtcaacatg gcggtcatat tggacatgag ccaatataaa
   175501 tgtacacatt atgatataga tgcaacgtat gcaatggcca ttagccaata ttgatttacg
   175561 ctatataacc aatgactaat atggctaatg gccaatattg attcaatgta tatatcgata
   175621 tgcattggcc atgtgccaac tcgatgtcgc ctctatcggc gatatggcct catatcgtct
   175681 gtcacctata tcgaaactgc gatatttgcg acacacagaa tcgcccaagt cgccaaagtc
   175741 gtctatcgcc atcccccgta aacgatataa gcgctatcgc cagatatcgc gtatgcccaa
   175801 aaatcacttt tggaaaaatg gcgatatcag ttacacagaa actcacatcg gcgacatttt
   175861 caatatgcca tattttcaaa tatcgatttt tccaatatcg ccatatctat cggcgataaa
   175921 caccactatc gcgcgacatg aatttaatcg gcgacagaaa tctcaaaacg cgtatttcgg
   175981 acaaacacac attttattat tcactgcagc atatagccca ttttagcgcg gcacacatcc
   176041 agccgtttgt gtttcttaac gctctccagg tactgatcca ggcccacgat ccgggttatc
   176101 ttgtcgtatt ccagattgat ccatcgatag ggaacgctgc cagcggcgcc cagcaagtac
   176161 tgcgccttgt cgtttacttt gccacagcgt attcgcccgt cagcttcgag gtataaccta
   176221 caacacggag gggaaggggg gtacaaaacg tgaaattaga cttttttttt aatgttttgt
   176281 ccctctctgt tttactctcc cataggctgt aaggccctcg aggaagagac ttacggattg
   176341 tagttgcagc tcgtcagttt gttgtgtacg acctggcgtg tcaatgaatg ggtcatggtg
   176401 gtgacgatcc cgcgaatctc agccgttttc tcgggactgt agcagacttc gccgttcgga
   176461 caccgcagcc tgtggattca tgaaaatcta ctctggcatt cccgaggatc gtcgatggaa
   176521 catggctatc agaaacgtcg agagacagat ccagacgcac cacagaacgc agacaatcat
   176581 gaaaatacgt aggcgacggt gaagcgattg cacattttga aatcgtaaca gcggtccggc
   176641 gggtggttga cgtttatgaa ttcgcaacat tcttctgcgc gtacccgcgg cacgcggctg
   176701 tgatccaata gcagccacaa cgccgtcaag aacggcgtca ggtttttggg actcatgacg
   176761 cgcggttttc aaaattccct gcgcgcgcga cgggctcaaa cgatgagatt gggatgggtg
   176821 cagaaggtgt aagtctggtt attggcctcg gtgaacgtca atcgcacctg aaaagacacg
   176881 ctgtagtccc ggaagacgtg agcccagctc tccagcttca tcacacacat ctgataacgt
   176941 gtgccatcgt tgacgacgaa gcgtagcagc ttggtctgct tgggcaccat gtgcgctcca
   177001 aaaatcttgg cgtcttccac gctgatctgc acgtttccgt cgctcggttt cgaagccgtt
   177061 cggggcatcc gttggaggat ggtctggttg cgaccgctca ggtaccagat cacctttttc
   177121 acccaggtgg agcttctctc caccaaggtc tggccttccc ggttgtacag cagatacagg
   177181 gtctcgttgc gacactcggg acccgttaat acccgctgga accccgagaa ttgcaagggg
   177241 gaccgtggga gcgagggata gataaaagga cagtaaaacg tcgccgcgtc atgcggtttg
   177301 gaatacgtca gtttagacca tagcggggac ggattctggt tcgccgttag cgtcgaccac
   177361 ggagacgcca gacagggcgt tgtccaaacc gcgcacagaa gcaggcagtg aaagtggtga
   177421 cgaagcagaa gccgcagcat attatttccc gtgacgcagg ctagttggca aagagtcgca
   177481 cgctgaactc gaggctccgg gcgtgcggcg ccagcgaacc ggcggcgttg aacgtggtcc
   177541 ttttgttggt gccgccgcga cggttctgac gtctaaagtc gctgatgagc aacgacacct
   177601 cggtcacgtt gattctgcaa gcacaggttc cgaacgtcat ttcacacccc atgcggttac
   177661 ctacccgtta ctcgttcgcc cttaccttcc cgttgtcata cacctttagc gcgtaccctc
   177721 acctcttgag cacgtcaaag ttgtccaagc cgtggctcgc atcgtagtgg tagttcaacg
   177781 tgaggtccac gagctgttcc acatacttgt aacgggtttg gtcgggcaac gcgcgagagc
   177841 acgcgtccca gtaatgcggt actcggtaat aatcgttttt ttctgcggtc tcccgctggc
   177901 actgacccag caccacggcg cacagacaaa cagacagcca cacccgacac agccgcatgt
   177961 tgcagactga gaaagaaagc tttattatga gatatcatac acatagtata ggcgaggtga
   178021 tggggcgggg aaagggttgg aaccgaaaga caaaaaaaaa gcctagtcgt actcgggatc
   178081 tctgagcgag acgggttgca tggcaacttt cattagtttg ggaatctgcc agctggtgct
   178141 gttcgaaggt tcttccattt ccgaggcggt cagttcatcg tacaccgaga cgtagtacct
   178201 gatggggtcc tcctcattgt ccgaaaggtg agattcgatg gtcaaaggcg agcctctccc
   178261 ataattggga ttcacgaacg acgtgtccaa gttgccatcc tttctgaaat agatgacgtt
   178321 ctcaggatca tgtttcatgc gctcgcgggc cgcggacgcc tcctcctcct cctcgtccca
   178381 gtcccgagtt tccaaccgct gataagggct cgaggaacaa aatccggcgg ggatctgaga
   178441 acctcgtcgg gaaccgctgc caaacgggct gctaccgcca ctgtcgtccg tgtcgtccaa
   178501 caggttgacg gcctcttcgt cggcgaaacg aaagcggccc gggtgcttgc aacacgagga
   178561 gtaaactacc gcgatcagta ccgctatgaa gctgaaaatg gaggtgcctg tcacgatgta
   178621 gaagaggata gccagcactt tcatgatctc gtcgttgtgc gcgttgtgaa cggaagactc
   178681 gtgggcggtg gtcatgttgg tttcggttgt aggttcgcta ctcgtggcgc tctcgacggt
   178741 atttctgctg atggtgctag tagggacgtt tgtgctgctg gtcatattcg tagcgtcgct
   178801 gaagtccatg tgaagcagca acccgaacgc gaccagggcc aggaatgtta cgcgaaggag
   178861 accccgcgga gccggcattc ttgagacgtg gcgacgtgaa tttcttgtta tgtccgcgaa
   178921 cgacgtgtga cgagtacgtg gtttccgcaa gcctctaccg acgccgcgac accaggtagg
   178981 ttatcaaaac gcgagcccat atcgccgcca tcattgtaat cagcaatgtg ttgaggtact
   179041 gcacgatgaa tctgtctagt gacaccagcc aaccctctgc ttttgcgggc aagcgcgctt
   179101 tcggtgacag ggtgtatcgt acgtagccgc gggtcaggcg cgcgttgtag cggtacacgc
   179161 agaaatctat ccacaggcca acgcccggct gtagcttagg atggtggata atagcgcggt
   179221 gacgtacgcc gcggggcttt agaatctcca cctgtaaggc catctcctcc aggtagtggg
   179281 tctgactgcg acgcagcgtc cagttcatgt aaaagtcggt ctcgccgtgt ccggccacga
   179341 agaggctgct tactaaatcg ggcgccagag ctaggtcagg cgtatcaaat tccactgcca
   179401 ggcgacctga ttctaacggt tccacgatcc gggagagcgt ctctagatat agagcaaagc
   179461 gtaccacgtc tacctgcggt gtaaaaaact gctgtgggcg ttcaccgtcg ttgaccacgt
   179521 aggccacgta gaggccaaca ttttccacca cgggttctag ctgcaggcgg cacgtaaagc
   179581 ttagaaacga cggctgtacg gtttggttcc cgtgaagctg aagcgttact tccttgccgg
   179641 ggctcaccgt gctgtaacgc cgcaccgagt cggttatctg ttccagatcg gtagaccaga
   179701 aaggcgtgca atgcatactg tcccagtcgc gacacgcagc ccagcctagc tcggtaaagg
   179761 gtcgacgcac acccgaaaaa gtgtgcttga agaccagggg gtcgcctcgg tagctcagta
   179821 gccgaacatg cacatagtcg cggctagcgt tgacagacgg cccgtggaag accagcagga
   179881 cgagcgtgaa cagcaagcgc aacatgctgc gcgggttaga aaatgcggcg tgccggccac
   179941 cgcccgactc ataaacgcta ccagcatgac gtctcagatc acacaagtga cgaggagcgt
   180001 accgcaaatc actagggaaa aggccagcag agcccgatag tcttgctctt cgcgaacgat
   180061 ctcgtccggt tcctcgcagt cttcgtggtc cacagaagat gaggagcagg attcttcgtt
   180121 aatctctgcc aggatactag tgctatacca caccagagcg ctcagcgtgc ccagggctac
   180181 cgcacggtaa aatagggaca tgatcaccag cgcaatctga agtggtggta gttcagtttc
   180241 ttggcgtatt tccagagaaa ggctttgtag gccgtaggga ctggccaggc accgaactca
   180301 atattggtag acactacgtc gtaaatgcgt tgttcctcgt ctaagattaa ccgaaaaaat
   180361 agccgattga tgtgacgacg cacggcttgc gcgttaggat tgagacactt ggtgcccttg
   180421 tcctttaaaa tagccagcac ttcctgacga ttgcagcttt cgctcgctgc gattggctta
   180481 agcaattcag ttccgactgg cagagtattc aacagaattt ggttgttaca acgacagcgt
   180541 ttgtcgtaat cttccaattc taaaagatga acggctaggg gacatacggc aaataacatg
   180601 tatgcagtca attgcatata tcgtaccgat aaaatgttag tgtgcggatt cagaatcgga
   180661 tgatgcaacc gtcttagcat catatcgaaa aagtatacat attaccgatt cattatagtt
   180721 aaggaattat ttccaacgcg gacgtttgtt agtgacagcg ttttcttcta catgcggtcc
   180781 attactatcc tttactttta ccaatacttt gtgccatgag ttgtcttttt taccatccag
   180841 ccatttcgac aaatgatgat cgggagctaa acatacaggt ttacctcgag gaggcaatag
   180901 ataatgttga ggtttgtcac actcaggagg attgggaggg tcacgaccaa cccaaaataa
   180961 gccacctata ggatgatgta aagctttgtg ggtacacgga caacgcaatt ctctactgtg
   181021 aaccccatgg taatacataa atgccatcaa aagactaatc agcgaaccaa aaattaatcg
   181081 cattctaatt ttattaacta cgtcactatc agtaattcgt aatatccggt attcccggaa
   181141 aatcattcaa aactgcgtcc atgacacatc aattcccgat aagtaccccc tttaaaatcg
   181201 gatcccccca cataccaatc aattatacaa cacacaggtt taaaaatcga tcacacgtca
   181261 attaggtttc aaaatcgata ccatttatta tcaggaatct agactaattc tacaatgaca
   181321 gctctgaatt tctctctcgt ctttcttgtc aggttctcat catcaatcat cacttccacc
   181381 catcggggag tcatcgtcgc tccaaactcc tttggggtcg ctagttggaa aagtctctga
   181441 cacgatccag gcaccccgca cccagtccga ctgatctagc ttgcggagca tttcaacagg
   181501 catgagctgc agggccacgg ctgtcacggc actgtatcga tgtaacacta gggactttct
   181561 ttgcgatgta gccatcaaca cggcgtatgc cccgtagttc gcgtgatacg acgcatgatg
   181621 ggttaaacgt tcccatccgg cagtgccgtc tcgggtccgt gcacacaaca gctgcacggc
   181681 gttatgatgc ttaaaattaa ccataacgct ggggctactg atgaaggagt agtaatgagc
   181741 caggacgccg tacatcgaag gcaacaagaa agagtgacag cacgatagca ccgggctctt
   181801 atgtaggcga cagcttattt ttcctgacgt cggcaaaaag tacctaaatt ccccacagat
   181861 actcagacac ggttccgtaa agtgcttctt tttttagtgc aggaattgga aaaaataata
   181921 aaaaatatga acagctcatc tgtaattatc tgtgtgactt catcgtaccg tgatgtaaaa
   181981 acaacaacag gaagcttaca gggtgcggta gaaaattttg ccgattgagc aacactgttg
   182041 gcatctctca ctccgatagg cggctataag atagagaatt aaaagtatga tacccacaag
   182101 aaagataaag agagacaacc aggctagagt atgacgaccg ctttttcttt gtttgacagt
   182161 tatatgtgcg gtatgatttt gctgtcgttg cttgtgatgt tggacgcctg gagtggagaa
   182221 gtacgtatgg ttcttaggtg cgcatacggt attattggtg gaagtgcagt tacgaatcat
   182281 gacctgagtg acgttacatt gagtgcaatc ggtacagttg taaagtcccg atacatacgt
   182341 gccgttgggg caaggggtac acgttacact ggtataatcc gtgcatactt tagtaactct
   182401 ttgtcccgaa ccacacggag ggcagcactc attgcccagt tgcacttcat tatgctgaca
   182461 cactttagtc actccaagct gcaataatat cacagcaaag cagatgagca tcaccagagg
   182521 cttcatgcct cctaccggaa gaataaaaat aactcatggg gccgaacggt atcatcctct
   182581 ccgcggtttg taatacgaga tcgtaaacgt aaataaatga cataacttca ctaacccgca
   182641 tactgcaaaa tccacctata acgctgaaag tttttccagg acagaacagg atagtcagcc
   182701 atcttcacag gtaaccagtt tctagccaca gtatagcgag cctaagagac cgcacacggt
   182761 ccctgctgga aacacagtac cacatcgatt tgtcgtgccg tataatcgtc gagttttccg
   182821 aacttttata cacgccaatg gcgttagggc tgtgtgtgta ctgtgattgg aggtttcgtg
   182881 agttatgtga cagccgtgat tacacctatc gccaaggctg acagcggtta cccagatgga
   182941 gcacaatcac atagctgatg gacgttggtt gacccgttga ttcccatgga tattttaacg
   183001 gtgacagtac agctctcgtt aaacattaga ttaatagacg ctagtggatg acagcatatt
   183061 attcgcccaa atgtgattgt ggctatactt tcttgttttt tgctcatatg ctgtaaggtg
   183121 ctcgaggatc gtggggagta tatgtgttga atccgaatcg tctttactga ccgcgccata
   183181 cctcgtatac gaacttaact ggcgtaaagt gtttcccgat atataaaccg gcgcctattg
   183241 aggctgtagc gcccataggt atggcatata tccacggtga tgttgtgtta ttcgtttttt
   183301 gtgataaaac gtagcttatg tttaacgtgt gtttcgtcac gttatgtgtg tcgttaaaag
   183361 acggcgtctg tacagtatgg ctttgagttg tatcttgaat tgttattgta tttggaggta
   183421 ttgtgtgcag agtggttgtt gcgtgttgag atgttgttac gttttgaggc acagttgtga
   183481 tgtatacgga ctccaaggtg tagttacgga gtctttctat gcaggtagtg ttgagatatc
   183541 tttgaatatt ggttatgttc gattctgtga ggttaaagtg tgtactattt atgacggtgt
   183601 aatttagacg gtcttgccat cccgaggatg ttagtgttag gtaattcgtg ttgttcatgt
   183661 ttacttgata tgtataggta ggtgtactgt ttgtgaggtc gcaagtgtga ttctcttgca
   183721 gagattttat ccatcttgtg tgaaaatatt gagatacgcg atgaatgttt tcgctatcta
   183781 tattataaag cgtttcagtg tcacctaggg gttgtttgat gtaactttta ttttggaccc
   183841 agggtgtgaa ccatgattcc aatacttgta tagtaaggtg tcctattaat gaagacgaac
   183901 tgattcctac cgtaatgtta taccgcacac ccagggtgcc gtttacaaac acggaaatgt
   183961 ttccgttaca aaccacgttg gcagatgaat tagactccag gtggtaacga taggataatg
   184021 accgttcgct cccaacggat gacacaaagt atccgaataa ccaacacgcc cattcaatcc
   184081 gcatatttta atcacactat tcacacttca cacactgcat tttttaacat cttatttttt
   184141 tattttatgc gtgttctcac ctcttcatct ttctaacacc ggggtaacta tcgtaagtcg
   184201 gtaggcgtcg atagccctca ccgcctcgtc gtccccttcc cggcgtgggg caccagcgtc
   184261 cacagcactg caggtaacac aggtagcata ggaaacatac ggtgaaaata ctccaaaatc
   184321 ccaaaaacgc agcgattccc cgagtggccc agggagacat tccggtgtct atgtcggccg
   184381 gtggtgctgg cgtcaccggt aaaaatttcg gcgggtgtgg ctgcgaacgg tagcagtcgc
   184441 cggggagccg gtaacgctgt atcactgtcc aacagcggtc gggttcctcg tccggacatg
   184501 cgggtttcca gcaatcctcg gcgtcggcgc ggccgatata gaagtagttg cgttgaaagc
   184561 cgtggtacgt tccgcagtcg tgattccgta aacgccaggg cgtcggcgac cagatctggt
   184621 ctcccagcga gtagcgacct aacgccggtg tgcaacaagg ttcgtcgggc cggctgagcg
   184681 tctccagctg cgtgagaatt acaaagcgtt gcatgatgag gccgtggctg tagttgcgca
   184741 gcacgcattc gtacatgccg gctgtgtcca tcgatacgtt aaaagtcagc gagaatattt
   184801 ggccgagatg caattgcgag aaattccaag tggcgtacgg caggcggtac tggagtccgt
   184861 tcatcagccg atggcctttg acggcgtcca ggatgagctc gtcgctaccg tcgtgggaac
   184921 gacagaaacg tgcgcgaatg gagaccatgg gccaggagtg tgtcatgacc gtgcagggga
   184981 tagtaacttg ctctccctcg gcgaccaaca ccggcgccgg cgacgtggtc tcataattct
   185041 cggcccacat cttttcggca atgtcagcgg tggcgaaggg gaacgaagag gaagaatatt
   185101 cgaggagtcg cgggcagctc aacagcaccc agaacagcca cggcagagtt cggagcgact
   185161 cccggcggca catgatgatt cttttcttcc cttttttgca gagacgctgc ccgcctgctc
   185221 ctgctccgtg tgtcggccgc tcaaacgtcg ggccggcgtg gtggtgacca ccgtgcgacg
   185281 cagcttctcg cccgggatgc ccgcaactga gcgtccggtt tttttacagg tcttttttgc
   185341 tgcctcgccc tcgccgtcgc ggccgacgtg gtggaccagc accgcgcagg aactctcgcg
   185401 tcgccggcgg tacgcgacct gtctcattgc tacctcggat gtttaagaag gaacgttcat
   185461 ctacgtcaca gggtctgatg aagctgccaa gagtcgtggc tgtggcgtag cgcgttctgt
   185521 acagcacgtt tcaccgcttt ctgcatggcc gctaccacat cgggcgggag cggctccggc
   185581 ggaagctcga tgagcaattg ctgcgaatct cggcgctcgg tgtccgccgt ttcgtcggac
   185641 gtggcgtaaa aaaccgaggt ggtcgcccag tcgtccacgc tgtcgacggc ttctgtcagt
   185701 gccgggttgt caaaaccgcc gtcggacgcg ggtgataaaa gaacgtacga tgacacgctg
   185761 ttagtacgac tctcgtcgtc gctctgggaa cgacgtgatg gacgacggta gatgacctcg
   185821 tcttgccacg cgtcgaagcg gtcgcagcag cgctggatcc aagcgcagcg gagcagctta
   185881 cggaacacgt cgttgttcca aaagtagagc ataaagagaa agaaaagtag cgtaacgatg
   185941 aagccgaaaa cgacgagggt cggcagggca ctaccgccgc tgccgttttt tgcgtcgtgc
   186001 gggtgcacgg tggtagtggc gttagtctga gcgggggtca tgacaagtct gaagagatga
   186061 gagcgcgggt gctcatcagg aacagttgag gtctctccct accgaagcct tagcctctac
   186121 ggtgttttat gatgaacgtg tatacggacg tcattgtgaa agtgacgtct caggccttcc
   186181 gaaaccgcgt taggttcaac gtgggtttcg gtttagcctg cgtcaccgag gcggaggtgg
   186241 aaatgagccg tcctgtgggg gagtgtacga ccctgtagtg cccatgggca acgttgcgtc
   186301 ggaagaagtg aatgcggcat tggtgtacgc gtgggttgtt ttgctctctg actcggagga
   186361 gttgccgcag cagctgcaga ttttacgtac taaccaaaag cagcaaaagc agcaggtaaa
   186421 taagagaagg agtccagata atgtccagcc gctagcggca agcagcgcga gctgtggaaa
   186481 tgtccaatta ctgccgccaa aagcttgaac gcatgctact gatggcgtgg ttggtgctac
   186541 agtactgtta ctgctattgg tggaagtact ggaattagaa ctggtgcctg tagtggtttc
   186601 actcgctgtc gcggtaagcg caagtaaagc tagtatccac agcatgttcg ttactatata
   186661 attgatatac gaactcgttt gtcgtaacaa tcagcgttat acacgctgta tcggcatcgt
   186721 tttaccggaa agtttatcgt aatgtaaccc gcgtcgtgta cattcgtact gacagggaac
   186781 ctccggtgat gtgtacatta tactctttca ttctggggtt tcccaatgac gtaaaaattt
   186841 ccactacaca ataaaattac tgactcatgt gaaaagtgtg ctttttatta acagagcaga
   186901 gggtttacag tagatatatg tttgccaggg ccaccgtttt ctaacaccga tcaccgccac
   186961 cattaccacc cgttgaactc cacacccggg agccgcctga tcgccaggga ctcctcaccg
   187021 tccatcgttc gaacaagctc ccgccaccga tgctgccacc atcaccgaga gaaagaaccg
   187081 cttgctgcag atacgcttgg gctcgcctcc gtgcggacgc cgtttcgtgc agacgctgag
   187141 tagatcgagc agagaatgtc aaaacgacat tatcgcgatc cgctcccctc tttttctttt
   187201 cctcattcac gtgtattctt gatgataatg taccatggct acggtggtga actgcgtcgc
   187261 ggatcccgtc acgggtttca acagatcgac gtcggtcagc ggcgccgtca ccgccatgtc
   187321 cggcggaggc acgctgtttc tctggctagc gacgtggacc gacgacgagg acgatgaacc
   187381 cgcgcggcgg tctgttatcc gcgacgacgc gtagctgcac tgggaagaca cttcctccca
   187441 acggaccaaa atctcgtcgg gccgttcgga gaaacggtat cgtctgtccg actcccgccg
   187501 tacggcgccg aggcccagag acgacaggtc cgcgaaccga cgctcgtact ccccgtacag
   187561 ctcgcaacag cggatcagcc agcggtagct cagaaacatg cgcaccagtt tgaaggtgtc
   187621 gtgccagtgg taagccagat agcagaggat ggccacgatc agcacgagca tcacgccgat
   187681 gatgggtaac ccgacattca gcggcagatc gtccatggtg accgtcctct gtccggatct
   187741 acgtcccagt ctctctcttt tgtacagcac tcgcacggga acggccccct caaccctctt
   187801 acgtagcggg agatacggcg ttctcccgcg ggccacttac ttgcacggtc gcttgaacgg
   187861 cggcttggac cgccacatgc accgcatcca tccattccgg cagcagcgcg ttcggcgacg
   187921 tcgtacgagt cgcggatgat gttaccccgc cagcacctcc gccggcaacc gcgtcgtcgt
   187981 tgctatcgtc gccggtttcg ggcgatgaca gcgccggcgg cgcgggtctc gtctcgtcca
   188041 ccatttccac cgtgtcgaag cgacagccgc tgccgtagta catggctccg ttcaacggcc
   188101 ggcgagccgg gtcgccgagt tccgggtcgg gcacatccat ggttcgccgt ctccttctct
   188161 gccgctcgtg gtgccgacgg cacttctcgg gataatgaca gccgcaaaat agatcgtgga
   188221 gcatgtctcg ccaactgtcc tggtggtaat atcttaagta cgcgatgagc gcgccgatgg
   188281 ccataatcat aagcgtaagc aaaacggcac agacaacgtg aaacaccgcg gtcatccaag
   188341 tcgggcggcg tcggggacgc ggtgggtcgg tttctcttac gccggcgtca ctcagccacc
   188401 acacccgtag ccgacattcc cagaaccggt gaatgcgact cagggccttt cgacgccgcc
   188461 atttatttcc aacgtctaag tcccacgtca tttctggcat ctccacgccc ttgactgaca
   188521 tactctctct ctcttagctg cggtgaaaaa gagggaaggc gtgtgctgct atacaactgt
   188581 acaacggacg cgctcgctct ttcggtctca ggtcatctgc atcgactcgg cgtccttcat
   188641 gacgctctgc accgcctgtt ccaagagttc ctcgatgtcc gaccatcgag gaggcggggc
   188701 tagctcggaa accgacacga taggcagcgt ggtcggctcc gtcggcgtgc ggggtcgggg
   188761 acagggacac gagagtccca ccttcgagag attctccaga ccgacggtgc gcggtagtct
   188821 cggattccgc ggcggctttt gtggcgtcgg cgttttcggg aagggcctgg gtgtcaccgg
   188881 cggtgtccag ccgaccggct tgggtttcgt gggcggcggc gttttcttgg tgggcggcgt
   188941 gctcaggttc ttacgcggcg cgggtatcgg cgtcgggggt ctgtgcgacg acagccgcgt
   189001 ggtgggggcc cggaccggcg gcgtaggcgg ccgcttcttg cgcccgggcg gcggaggtgg
   189061 cttccaggat ggcggcggct gatgcagcac cgtgtcgacg ctggtcgagg acgacaaaga
   189121 gctcgacgag gagcaatgcg acggagatcg gccggtgctg gtcggcgttc ccggcgtgga
   189181 tacgtcgggg atctcgaacc gcgccggagg aaactcgggt ttatctatcg gcagaccatc
   189241 ctctcctatg tagagcgacg tacaccgcgg cacctgcggc gtcggcgggt gggtggccac
   189301 ccgcatgagc cccagttcca gatccagcgg ctcgacgacg tcttctttcg gatttcgata
   189361 gcagcacgcg caggcaccac gcttatcaga agcagcaccc gggagccggc ctcgcgacga
   189421 agtctcgtcg gatcgcttgc ggcctcggcg ctgggtaaat aaggaaatgg ccaggaccag
   189481 ggaagccagt ccggtaccgc cgaggagccc gacgccgagc catatccaca ccatgatctt
   189541 ctctcctgct tggaatctca aactccgtgt cgggaagggc cggtgtacgg acatttatgc
   189601 cttggatttc tggaaacgtc attttttggc aaggaatgtg tttattgtcc aaacattgag
   189661 gaaggagatg tgcgccaagt cggaaaattc cttatcgcac cgggggcggg ttacgttccg
   189721 gtctgatgct gctgctgttg ttgttgtaga gccgcggcca cggccgcctg cacggcagct
   189781 tgtaccgcct cggccacgcc gggtggcatc tgcggcatgg cggggggagg cgcgtcgggc
   189841 ggaccgccgg gcattgtcgt cggctgcgac ggtggttgtg aactcaccgt cggttcgcac
   189901 ggaggtttgt ccttcggtct acccttcggt ttatctttcg ccctaccttt cttcggtttg
   189961 ggttccgatg tcggtgctgg cggctgcggt gggataacgg gctggtggga ctcctccgac
   190021 ggcgggggga cggacaccgt cggcgccgaa accgggggac tctcgactat ttcgcagatc
   190081 accctgtctg gatcgtcgcc gtgtccggga cgccgccgat gaccgtattg gaccatatcg
   190141 taaatcatcg tctccttgta acacgctgaa cagcagcggc tgcaggggcc cgagatgcat
   190201 ttacagctgc acttacagct gcagctgcag tagcgcaccc atcggcaggt gaagacgtcg
   190261 attacggagt ccttgaagaa ttcccggtaa cggatgagat acgcgcagag gaaaatcatg
   190321 aaaacagaac agccaactac ggctgcgatg ccgggtcccg aaaacgtatt cggtgatact
   190381 accaaacacc aaattcccag ggccgcgcat gttatccagg ccacaataat cgtgggaacg
   190441 ccccattggc attgccacga aggatcgtgc acatcgcaac ccatcgctac tgcgttctcc
   190501 cacaaacgcc atcgcactat ttatccctac agcggctgcc gagtcacgtc cgccggcgcc
   190561 catcggccgc ggcgatctcc tagtaacact cgtccgacac ttccaccatc tccagctcgg
   190621 ccggcggttc ggcatctttc accagcggcg tcgtctcatc tttgccgcag caacggacgc
   190681 ataccttctc caggcagaac gctaccagct gccgccgaac gtaccacagg tacacgtgca
   190741 gacctgcgaa caggactacg gaggtcatga ctaccacgac gcacacggga atccagggat
   190801 cgagattgtt gctggaaccc atggctatcg ccaccgacgt gcccgcgtct gtctcaccgc
   190861 cgctcgcccg atgtcgcgcg gcctgttata cgctagcccg tcaccgcctc ggggcacggt
   190921 gccctcctac ccacgtaact tcctccgtga cttaaagtcg cgtatggtag atctcctgct
   190981 ccgtggacga accgtccggc aggatagcgg ttaaggattc ggtgctaagg ccgtgtcgcc
   191041 aacgtcgaat gctacgttgc aacagcttcg acggacggcc atcccctctc tcatcgcaat
   191101 aataaaacac cagcagcgcg cacgacgcga tcacggtgac acccatgact agacccacgc
   191161 agatagccag ccccgctagc gtatccagcg ccatcccgtt cgctcccgtc gtcgtctcct
   191221 gaacaaagca acaactccgc agtccccgtt ttcaaccgtt tttgtttcct tctccgcgac
   191281 tagatgttaa cgcccgcggt ctttccggcc gtgctctacc tcctggcgct tgtcgtctgg
   191341 gttgagatgt tctgcctcgt tgccgtagcc gtcgtcgagc gcgagatcgc ctgggcgctg
   191401 ctgctgcgga tgctggtcgt tggcctgatg gtggaagtcg gcgccgccgc cgcttggacc
   191461 ttcgtgcgtt gtcttgccta tcagcgctcc ttccccgtgc ttacagcctt cccctgaaac
   191521 ccacgttaac cgaccgtccc gaaaacgccg gtgttaacac aggaaaaaag aaaccacgca
   191581 ggaaccgcgc aggaaccacg cggaacatgg aacactatct ggaaatcctg ttcaacgtca
   191641 tcgtcttcac tttgctgctc ggcgtcatgg tcagcatcgt cgcctggtac ttcacgtgaa
   191701 ccatcgtcgt cccggtttaa aaaccatcat cgacggccgt tataaagcca cccggacacg
   191761 cgccgcggca cttgcctacg gcgctgctcc agggaaactc ctcttcctcc tgctcttcct
   191821 cctccgccgc agggatcgtt tccctcgact agggacccgc cgaagcaact gccggaacaa
   191881 cctggaggag tcgcggcatg acggcgccca agtgtgtcac caccagtact tatctggtca
   191941 agaccaagga acagccctgg tggcccgaca acgccatcag gagatggtgg atcagcgttg
   192001 ccatcgtcat cttcatcgga gtctgtctgg tagccctgat gtactttacg cagcagcagg
   192061 cacgcaacgg gagcggcagc ggctagacga gtcccgggcg gctacagctc cgagcgccgc
   192121 agccggcccg cctgccgatc gcgacgtcgt ggaccatcga acagagactc acgcgtacga
   192181 gaccccgagg tacgccacgc ggtgcctaac gcggtatacc acacccgtac ggtctgcagt
   192241 gcggcgtaca acgtgtggaa aatgcgttgc gtcgcagagt ccgccacgtt cctgtcttgt
   192301 cgctccccaa tcgtctcccg tacacccccc gcgacaccca gagggcgggt gagccaagta
   192361 ttcttaaggc cgttctttgt tccatagccc ataaattgtt gattccggag ctcgttggcg
   192421 cggaaatagt cggataaggg gagcaacaac cgtcggcgaa agccgtctcg ctcattcagt
   192481 ccgggtttcg cgtccagtcg gacgtgtgac cgttgggcaa cggaacggcg tttcactgcc
   192541 aaaatcgtat cgggtagtgt acgagacgtc ggcggtgcag aatgcgactc gcggcgtagc
   192601 tcgccgtcgc tatgtggctc gtcgccgtgt ggcgcggcct ggccggctgt ctgcgtccag
   192661 atctgttggc cttttggttc ctctggctgc tgctgcgtgt gtgctttggt agacgcggtg
   192721 gcagtttgcg gtctgcggta agtgaggatg tcgccgagca ggcgcacttg cggcgcgtgg
   192781 gcggcacgcg tgtcattgta ggttcgttgc cagatggcaa gtgctgtcaa cagcaggcgt
   192841 tgtgggcggt cggtgtattt ttgtgggttg cggtgagagt cggcactcgg tgttttgtga
   192901 gtcatgtcaa ctatctgtgt tgctttgagc agcgtccaga acagcgacgc gactttgggg
   192961 atggcctcgt gctcacctcc gcggagagcg ccgccggacc tgctcgtcag cagcgagcta
   193021 cgcagacgga atatctggag gagagttacg tgtgtcacag gagagcgcgg gtctccggcg
   193081 gtaacgacgg cggtgtcgtt gacacgtgtg cggcctgtta tgctctgcgg aaaagtgccg
   193141 gtctcggaga ccgtggacga aaaagagaac gcagcagcta ccgctggcgg cggcggcgtt
   193201 aatgcagccg ttgatgttcg acgttgtgag cactcggaaa cagcggtgag gcagaaggtc
   193261 gattctccag ggaacgacag tcgatgcgtg gtagccgcag caggtgaggt tggggcggac
   193321 aacgtgttgc ggattgtggc gagaacgtcg tcctcccctt cttcaccgcc ccacccaccc
   193381 tcggttggtg tttctttttt cttgtgtcct gcagatagtt ccacggacag cgacggcaag
   193441 tccataatca gcggtgtgca agtggtggaa cacgacgaag agatcatcgc gccgcagagt
   193501 ttgtggtgca cggcgttcaa ggaagccctc tgggatgtgg ctctgttgga agtgccgcgt
   193561 tgggcgtggc agggctggaa gaggtggcgc aacagcgagg ccgggcgtcg atggagtgct
   193621 gtgtctgcgt cggcttccag cttgtctgac ttggcgggcg aggccgttgg agaattggtg
   193681 ggatcggtcg tcgcgtacgt gattgttgaa cgtctgtggt tggcagccag aggttgggtg
   193741 tgcgaaacag gtgtggaagc cgaggaggcc atgtcgcggc ggcgacagcg catgctgtgg
   193801 cgtatgttct ctcgtggagg cgacggcgaa tgcagcagac ggtgttcgat ggagatggcg
   193861 tgcggggaag aaagcgccgt gttgtgagca gacgacgtag gatgcgggac gacggagcac
   193921 atgggccatg tgtggtggca gatggcggtg tccacttgtg cttgtcgcgg cagcgcatag
   193981 acgaagcaac atgtcgctgt gaagagatag agtgtgagca tagctgtatg cagcgttgcg
   194041 tgtagaagcg gggggattaa gacgttaata aagagtagcg gcggttctga tagggcgacc
   194101 gctaaggcga gctgcgtgtg cgtgccgtgt gtgttccccg ccgcgaaagg cccccgtccc
   194161 cggcgccacc cccgtccccg tccccgccgc aagagtcccc cgtccccacc actgtgtccg
   194221 ccgcgaaagg cccccgtccc cgccgcaaac gcccccggcc ccgcaacgcc ccgtccctgc
   194281 cgcaggaggc ccccgtcccc agcgccaaag ctccccgtcc ccactactgt ccccgccgca
   194341 aaagcccgca agtccccgcc gcaaaaggcc cccgtggccg tccacgcaca cccccccgtc
   194401 cccgcacacc ccccgtcccc ggcgcaaccc ccgtccccgt ccccagcgta actcccgtta
   194461 ccggcgccgg cgcccagcac gcccgaaaac accgccgtcg ccgccccgaa aagcgaagcg
   194521 ccgcgcaaaa gctgcgtaga aacgccgcac aaacaccgta gaaacacccg ccgccaaccc
   194581 ccgagcgccc gcaacacccc gtccccggcg ccggtccgcg gaaaaaaaaa aaaaaaacac
   194641 cgcgggacgc cacgcaccgg cagtgcgcac aaagcgccgg acacagcacg ccgcaaacgc
   194701 gatgaggacg ccgccgtgct tacttatgtc ccgcaacgct gcctcaaccc tgtcccgtgc
   194761 cggactggcg gaacgaaaag tgctgtggag ccacacgcaa cgacggcccg caacaccccc
   194821 tgagccctgt cccgcaccgg cggcgatcgg ggtgtgtcgg gggcgcggct gggtgggtgt
   194881 gtgccgggtg tggcgggtgt gtcagggtgt gccgcgggtg tgtcgcgggc gtgtgccggg
   194941 tgtgtcaggg tgtgtcgcgg gcgtgtgccg ggtgtgtcgg gggtgtgctg gcggggtgtg
   195001 tcaggggtgc ggtcgcacgt tttccccggg gacttcctct tttctgcgtc ttgtctcttc
   195061 gtgtgtcccc agggacccgc gctgccgtcc cctggggact tcttcctctt ttccccgggg
   195121 aattaaacag acacagacgc gcgtctgctt ttcgccgtgc gcgccgcacg tcgcttttat
   195181 tcgccgtccg cgaccgccgt ccccaccgca ccacacgcaa ctattcgccg tcgccgtcca
   195241 cacacgcaac tccaaatttc accccccccc cgctaaaaac acccccccgc ccctcgggga
   195301 cccagcacac ggcccggaat ggatgtgggg cgtccactta ggtggttgcg cgctcgggag
   195361 gcgcgtatgc gctccggtgc tgcgggcctg tcgcgcgtgt tccttcgggt ggctgggctg
   195421 ccgggtggtt tttcacagcc ctttagactg cgcggcgcca aggcggcgct agcacgcgcc
   195481 gttcacgtcg ctggctataa aagccagatg cgtgtcgccc gtggcacacg ggccacggag
   195541 ccgtccgcgt gtgtaaacgg cgtggtcgcg gacgcgggtt gtgttgctat atagtggaca
   195601 tcggctcgac gtcggaggtg tccggcggcc atggcccagc gcaacggcat gtcgccgcgc
   195661 cccccgcccc tcggtcgcgg acgcggtgcc ggcgggcctt cgggggttgg ttcctgttcc
   195721 tcttctgtac cgtcaacggc ggggactagt acgagtactg cgggtacggc aactccgggc
   195781 cacggcgtcc accgggtaga accccgcggg ccgccgggcg cccctccggg tagcggcaac
   195841 aacagcaact tttggcacgg cccggagcgc ctgttgctgt ctcagattcc cgtggagcgg
   195901 caggcgctga cggagctgga ataccaggcc atgggcgccg tgtggcgcgc ggcgtttctg
   195961 gccaacagca cggcccgcgc catgcgcaag tggtcgcagc gcgacgcggg cacgctgctg
   196021 ccgctcggac ggccgtacgg attctacgcg cgggtgacgc cgcgcagcca gatgaacggc
   196081 gtgggcgcga cggacctgcg tcagctgtcg ccgcgggacg cgtggatcgt gctggtggcg
   196141 accgtggtgc acgaagtaga ccccgcggcc gacccgacgg tgggcgacaa ggccggccat
   196201 cccgagggtc tgtgcgcgca ggacggactg tacctggcgc tgggcgccgg gttccgcgtg
   196261 ttcgtgtacg acctggcgaa caacacgctg atcctggcgg cgcgcgacgc ggacgagtgg
   196321 tttcggcacg gcgcgggcga ggtggtgcgg ctgtaccgct gcaaccggct gggcgtgggc
   196381 accccgcgcg cgacgctgct gcctcagccg gcgcttcgac agacgttgct gcgcgccgag
   196441 gaggcgacgg cgctcggacg agagctgcgc cggcggtggg ccggcacgac ggtggcactg
   196501 cagacgccgg gcaggcgact gcagccgatg gtgctgctgg gcgcgtggca ggagctggcg
   196561 cagtacgagc cgttcgcgtc ggcgccgcac cccgcgtcgc tgctgacggc cgtgcgtcgg
   196621 cacctgaacc agcgtctgtg ctgcggctgg ctggcgctgg gcgcggtgct gcccgcgcgg
   196681 tggctgggct gcgcggcggg gccggcgacg gggacggcgg cggggacgac gtcgccgacg
   196741 gcggggacga cggcgatggc gacggggacg acgttgctgg cgggggcgag cggcacggag
   196801 acggaggccg ccggcgggga cgcgccgtgc gcgatggcgg gagccgtggg gtccgctgta
   196861 cctgtgcctc cgcagccgta cggcacctcc gccggcgggc acgcggtgtg cgtgccaaac
   196921 gcggaggcgc acacggtggt cggggcggac gcggcggcgg cgccgacggt gatggtgggt
   196981 ccggcggcgt cggacaccgt gccgcgcgcc atgctggtgg tggtgctgga cgagctgggc
   197041 gccgtgttcg ggtactgccc gctggacgga cacgtgtacc cgctggcggc ggagctgtcg
   197101 cactttctgc gcgcgggcgt gctgggcgcg ctggcgctgg ggcgcgagtc ggcgcccgcc
   197161 gccgaggccg cgcggcggct gctgcccgag ctggaccgcg agcagtggga gcggccgcgc
   197221 tgggacgcgc tgcacctgca cccgcgcgcc gcgctgtggg cgcgcgagcc gcacgggcag
   197281 tgggagttca tgtttcgcga acaacgcggt gaccccataa gtgatcccgt cgcgtttcgt
   197341 gtttcggacg ctcgaaccct cggcctcgac ttaaccaccg ttatgacaga gcgtcaaagt
   197401 caattgcccg aaaagtatat cggcttctat cagattagga aacctccttg gctcatggaa
   197461 caacctccac ccccatctcg ccacaccaaa ccggacgctg caactatgcc cccaccgctc
   197521 agtgctcagg caagcgtcag ccacgcgctc cgatacgatg acgagtcgtg gcgcccgctc
   197581 agtacagttc acgaccacaa agcctggttg gatctcgacg aatcacactg ggtcctcgga
   197641 gacagccggc ccgacgatat aaagcaacgc agactgctga aggccactca acgacgaggc
   197701 gccgaaatcg acagacccat gcctgtcgtg cccgaagaat gttacgacca acggttcact
   197761 accgaaggcc accaggtcat cccgttgtgc gcgtccgaac ccgaggatga cgacgaagat
   197821 cccacctacg acgaattgcc gtcgcgccca ccccagaaac ataagccgcc agacaaacct
   197881 ccgcgcttat gcaaaacggg ccccggccca cctccgctgc cgccaaagca acggcacggt
   197941 tccaccgacg gaaaagtttc tgcgccccga cagtcggagc atcataaaag acagacccga
   198001 ccgccaaggc cgccaccgcc caaattcggg gatagaaccg cggcccatct ctcgcaaaat
   198061 atgcgagaca tgtacctcga tatgtgtaca tcttcgggcc acaggccacg gccgccagca
   198121 cctccgcggc cgaaaaaatg tcaaacacac gcccctcacc acgttcatca ttgaaagtct
   198181 ctccactcca catgttgtca ggacgtgctg tcgttctccg cttgctgcga agcccgttct
   198241 tccgagtcgt gtcgctgcgt ccagcgtcgc gcccaagatg ggaatttggg tctcttcacg
   198301 cgtagcctcc tccaccacgg ctgctgatcg ccgtcgctaa ggaccgacac ggaggatgac
   198361 gaggagcttc tccccgactc cgcggtccgc gaccggctgc gtagcgcgtg gccctgccag
   198421 tctccgcagt tacaccacac gtcgtgagcg gcgtgcacct gctgccgcca ctgggcctcg
   198481 gcgtgctcag gccacccgcc ggagcccggt ctgagctccg acgcaggatg cgcgtattca
   198541 acgtgcgcct tccagtccat acagcaacac cataggtcgt gcgagtcgtc ggctacccgc
   198601 cgccaggcca gttcccgcat gggaaggctg gacacgccga ccgagaggtc accgagcccg
   198661 gacgccatct cttcttcctc tccgtcgctg tcatcaagca gccaggtcac ctcctccgct
   198721 ccgcggtccg ccggtctcga cggaccgcgc cgccgtcggc aacacggaaa acagcacgcc
   198781 agcccgagcc gctaaggccg catgcccctg ccgcccaact gaacatgcat accccgctca
   198841 actgcgtttt gccacccctg ccagtgctct cgctcgagca ccaccccgca tctcccaacc
   198901 tttttccaat aaacgaaacc gacatgacat acgtaatggg tgctcgtggc tacatttatt
   198961 gaaacaaacc gcgatcccgg gcgtctcagc acacgaaaaa ccgcatccac atcatagaca
   199021 agttacagtc cacagtcaca tacacgataa acaataccaa cagggtaatg tttatggagt
   199081 aaaacactat tgtccaggcc acatgcgtgt atgacttccg caccatcccg tactgcatgt
   199141 tccacatgta cgcgctagac gtgtaatcca ctcgcagttc ggggacgcaa cgcagccaga
   199201 tcacatcccc ttgcagtacc agacgcaggg ctagcgtctc gaagatcggc atcacatcta
   199261 agttccgcac attccacttt aacgactccc cgggaacgaa ctccacgtcg tcggcgtgta
   199321 cgtacaggtt ctctcccacg ccgccataat cggccttcgg atcgaagacg aaccgactca
   199381 tgttgcccac gatgctcccc cgagcaaaca acttgccgtt gtcaatgtag caccggttgt
   199441 cctcgatttg aaaccaggga tgcttggccg tggacttcca gggccggagc gcgtcttccc
   199501 cggctttagt gattccatcg ggcaggcgga tcaagggacc catggaggtc caaagaccca
   199561 cccaggcttt ccagagattg ttcatggtga aacagcgtgt ggactgtacg ctctttccca
   199621 atttatatcc cagagtagtg acgtgagccc agccacctcc cagattcctg acgttttggt
   199681 tgtctttcct gccaattcct cccgtaaact tatgattatc ctagcccatt cccgataaaa
   199741 atacacggag acagtagata cagttacgaa taaaccggtt tatttattca agtgtctcag
   199801 gagattcttg aacgagcgtg gataccacgc cgtcgtcagt tcatggtggc attgagcagc
   199861 catagcacca gagtcccggc gcccggtatc agacacgctg acctaccggg cgccttcgag
   199921 tccgtacccc gcggcctggg tgttagagtc cgtaccttgc agcccaggta ggtttcaggt
   199981 actagctggt tcgtacctgt taaataaatc gcagacgggc gctcacccct acggtcagga
   200041 gcacaagaac aaccagagag aacagatata cgagcagggt tctgaacagc agaccccaat
   200101 tgtcgtctct catgcttcgc tgaaggtacc agttgatggt ctgagagcta tagtccatcc
   200161 tcacctgagg aacacacgcg gcatatttct tggggtctcc ccacttcgta gacaacgtga
   200221 tgtccaccat atccacggtg tgcgtcaccg ggtgcccacc gatgttccac tcgaaatagg
   200281 ctccgcgctc atcatggtgg tactgctcac cggacacctg cagtctgtcc atgtaagatt
   200341 gagagacgat acccacgttc acaaagtgtt tctcggtgaa gttgcccgac atcctcccct
   200401 tgaagtacag catgcccata tggaaccagc attggttctc ctccacccga aagtgggccg
   200461 atctgatctc cgataccacc acatccaggg gccggggcac cgagtccgcg agtctcagga
   200521 acaagacggc caggatcgcg agcaccaaca ccggcttcat ggctccgaag gtccgctgct
   200581 cggctccgct caccgctccg gtctggctgc agcagtgctt cgctgagaag tagcgtgtgg
   200641 actgaacggt gtttttgaat atatagcgtt tcttggtgac gttgtttccc ctacgtagta
   200701 ggcaactacg tgccaaaaga ggcgttacgg tactttccgt actgggattt ccaaaccggg
   200761 actttccaca cggcggtttc aacaccggga cttttcacac ggtgatttcg ccaccgggac
   200821 tttccgcacg gcggtttcgc caccgctgac gttctcatcg ccgcccacgt caacggtggc
   200881 gacaccgtac tttcccatgc ggtttataaa cgtcaagagt cacgtcagtc gcccaccccc
   200941 attacacgac gatatcccga tagggcatga gggggcccgg atgtcgcgac atgtcgacga
   201001 caggtgcgga ctagtggtcg tgtcgcgaca tggacgtgca gggggatgtc tgtcgcgata
   201061 gagttgatgt gacagcccgc tacacctctc tgtcgcgaca tgcgtacaca gcgggccggc
   201121 ttgtcggcga ttgtcgcgac atatcgttat cagttagcga ccggagttgt ctatcgcgac
   201181 atatcgtcga ctatcgcgac agaaaaaaat taccgttcgt agagaatgcc gtgttgaagg
   201241 aacgcgcttt tattgagacg attaaacaac atcaggagcc gcaacgtcga attccacgtc
   201301 cacttgattc gtatgttatg ctgcacagca atgctagaat aacaaccagc agggtaatcc
   201361 cgcaacatag atacaaagtc acagcgaaga atccgtgtcg ttctatcaag cgaaacgcgt
   201421 tccaaacggc cccgtcacag acgcagttat tcataagcgt caacaaccgg tggctaggat
   201481 gaatatccaa atcacagggc agtagccgac tgactcgttg acaggtcagc ctaccctcaa
   201541 ggttcctatc gttcggacgg gatttgtgcg ttttaggcct ctttttcgcc gccagcaagc
   201601 attggtgcgc aaagtcctca cccagctgtt tccagctatc atctgcatct gtgcagtccc
   201661 ctgtatcgtt gtaacaaatg ggtctgtgcg actttgttct cggaacacaa gcttgttgtc
   201721 gcggagacag agagagaaga gttttcgggt cacgcgaaga ccgctcaccg ggggtcggca
   201781 acgcacacat caacaaaaaa ccgagacgga tcaagaggtc catagtgaag gagtgatatc
   201841 gacgtgctta cgaaacggcg attatatacg ttgtatgatg taacgtgtga cgtgagtctg
   201901 atccaacact gaacgctttc gtcgtgtttt tcatgcagct tttacagacc atgacaagcc
   201961 tgacgagagc gttcatcggg gcatgaagta cgcattacac aaactctata tatttgttac
   202021 gatagaatac ggaacggagg aggctttcgc cacacctatc ctgaaagcgt tgcactcttt
   202081 atgataggtg tgacgatgtc tttaccattc ccacggctgc tttgcgtgat gatgacattc
   202141 atcatgtatt tccattcaca catacctttt gtgcatacgg tttatatatg accatccacg
   202201 cttataacga acctaacagt ttattagccc ttgacaggat aggtcaaaag attatatgta
   202261 ggttttccgg taaaccgaat tgtgatattt ctctgcagga aatagaacag cctggtacct
   202321 atgaaacgga caatgcagta ctgtagcagc atgaccaagt aggtccacat gaacacgtac
   202381 aaaattatgg taagccatcg tttttcgtac cacagcctgt agctgtcgta catgaatgag
   202441 gacggcctag ggatccaggg tagttgcaat tgggggcggc attcgtactc tctggaagac
   202501 agtttcacgg gtttcagtga gatgagcact ttagcgatgt ccgcgtggac ggtacgtttc
   202561 accgtgacgg tgagaacttg accgtcgttt tgtacttcat gaggcacgtt atacaagcca
   202621 ctggtatcat gaaggatgac ctctgatgcg atgtgaggat taaattgtcc ctcaaaccgc
   202681 caaacgctgg tcatgttacc accgtcaatt acgcagctga cggtgtgaga gaccacgatg
   202741 ttggacttag gtttgggggc taattgcctt ttcacaaatt ccctttggta ttgcaggtcc
   202801 tgctgccact gcttttccgt gcggaaagtc gccatgtctt ccacacgttt agcgacgata
   202861 cacgccacca gggtggatac cagaagcagc tggatccgca tggtattacc gtatgtcaat
   202921 tagaaagttg agcggacacg gctatcgttc ctggcggata taagtatata aacgcaagtt
   202981 agcttttccc gtccgttttg tacacccgtt ccccacacaa atgacgaata cggccttttt
   203041 tttataaaaa taaaccacgt gtattgtata aaaacattta catagaaaag agacacacgg
   203101 atcaacataa ggacttttca cacttttggg gtacacaggc gtgccaccgc agatagtaag
   203161 cgctggatac acggtacaca gtcctggcca gcacgtatcc caacagcagc accatcgcca
   203221 tctgtatggc gatcacgacc ccgagctcta agtgtctgta ttcatagtgt agtcgtcgca
   203281 ggttatccat tgaattcccg taactgaaat aacgtatatg gtaccgaggc tggcaccaca
   203341 tgggtttgca tttggtgcac ggcaccaaat gcagagtgag atggtccaag tccgtgggca
   203401 cccactgacg caaacggaat acggcttcgg tggtctccac gaggcactcc ggggcgtgca
   203461 gacggcccca ctttcgtccg tgacggcccg accagccgac ccgagccact atccctttct
   203521 cgggatagaa cgtaccctgt acacgccaca cagcgtccaa cacgccgtcc ttgacgacgc
   203581 agctggcctg atagctggac acgttgttaa gcggcggaaa gcgaaactga cgtgccggcg
   203641 gagccacata gttcggttca ccgtgttgtc gcggttcgtc ctccctatag taatagtagt
   203701 cgtcgtcctc ataggggttg ccggcgtgag ccagcgttac ccaacagcag cccaggccga
   203761 cgaggaggcg cagccaccgc ctcatggcgg cttcgccagt caatcgtctt tagcctcttc
   203821 ttcccgtgag gtccttccgg tggcgcggtg ccgacctcgg acccagggac gtatccacct
   203881 caggtacaca cagcaggcta cctggacacc gaagctgaac aaggctacgt gtttcacaaa
   203941 ctgcaccagt accacataga ggaatgtcag gtagcgtctc tccgcaaaca gccgttccaa
   204001 gtctgagggc gttgcccgca gcggcaacca gggcagcctg gacgccggcc ggcaatggag
   204061 cacgctccgg ttacaggcac tgcaggggta aacggttaac atcacgtaag agagtcgtgc
   204121 gtccacctgt gggagctcag tttcgtaacg tagagccccg tcattttcca gctggggtgc
   204181 gccgaccttg aaatgggtcg cgctccgctc gttaccccag gtgccgtagg ctctcggggc
   204241 cgtatcggag aagttgccgc gcacaagcca ggcggccacg agtaccccgt gctggacgta
   204301 acattcggac acggaactgg agacacggta gccggacacg tccccgaacc cgcgagggta
   204361 ctggggcaga cggacggact tgctatctga caacggacag ataccagacg acgaggacgc
   204421 agacgactcg tcgctggacc acgacaaccg gagcgactcc ttggagcggc tcgagagtac
   204481 acttactgcg atcagacacc agtgccagaa gaaggaacag gtggacggag accacaggat
   204541 catagccgcc ggcaccgcgg ccggccgcag gaagccgccc ggcgcgtcgt ctgtgtgcgg
   204601 gagccgaaac accgtgcctc tttatatcgt cctgacgtga cgcgagtatt acgtgtcagg
   204661 gaaaaccccc gtcatgacga acgtgatttg taagtgacgc ggggtgctga cggggttcgg
   204721 cccaagaggt gatggagcgc ctcacgtcag tatgatgtcc gatccgcgtc agccccgacg
   204781 tggttgtggt caccaaaacc cacgtttata tggacgttga gagcagcgcc tgaccacatg
   204841 attcatcata ccatttctcg gaatcgggcc catgccggga aagcacattc cttttcagta
   204901 aacaatgaca tcataacaaa tcattttatt cgcgaggtgg ataataaccg catatcagga
   204961 ggagggatcg ggtgatgacg caggccccgc aaaacagtcc gaaataaatt tttagtatcg
   205021 ccccgtagtc gcctagatac cagaggtacg tcaagttcat caaaacgccc atgggcgtcc
   205081 cggaatcgta taccgggcac acgaagcgtt cataacaatc ccgggaggcg agtgttaggg
   205141 tagcagaata gtttcggggt cggtttcctt ccggcgacga cagctccgta ggcagcagaa
   205201 tgtagagcgc ctcggtagcc gtcgcggtgc cttccacgag gatgggctgc cggtgccttt
   205261 cgtgattttc cccgtcgtgt agccaagccg aggcccgcaa agtcttaggc gaggggaatt
   205321 gtccatagag tttcaccgca cctttcagta catgattctg aataacacag ccgcacgtaa
   205381 agtaggtcgg ttctctcgtc tcctctgtgg ctgccgccac cactcccagc caccacaaca
   205441 ggcaggtcgc gagagggttc cggaggcttc cccggcgtag catggtttcg ggttaaagca
   205501 aaaagtctgg tgagtcgttt ccgagcgact cgagatgcac tccgcttcag tctatatatc
   205561 accactggtc cgaaaacatc cagggaaaat gtcggtgcag ccaacctttc acatacagcc
   205621 cccaaaacac ttgaatcact gccaccatca tcagcgtata ctgcgccgac ttaatcgtga
   205681 gcgcgtagta cgccattaga cggcgatctt cgaacaatag tcgttcgatg tcctctaacg
   205741 agctccacag gggaacccaa ggcacgaggc accggggttc gcactctaca taataagttt
   205801 ggcattgatg acagggggaa aagtagaaca acacgagttt tgtgcgttgg ggaacacgat
   205861 agtcccggag ccagtagcgt tttgcgacga ggctttcgga gatgtcctcc accggcgtcg
   205921 gcactcgatc cgcgtagccc tccagcgtct ggtagtacac ccggggtgtc ggcgtgggca
   205981 cggacaggtt cccgcgcagg gtccacagag cctccagtcg accgcccgat cggagcacgc
   206041 agcgcgcctc ggaatactct actcggtact ccgaaacatc gggcagaggc ggtaacggct
   206101 ccgtctccac caagggcgga ggttcatcga aaagagtcat ggataattca ggcatactac
   206161 ccgcgaccgg ggcccagagg gctagaataa gcattacaag attcattctg tcttacaagg
   206221 gaaggctgtt cccctgtcta gactcaaaag ctgtaaggct atcttatagc atgtagtctt
   206281 gcacgtcacg gggaacaggg tggtgatcta gtgacgtcgg gagaacacgg tgttttaggg
   206341 tgcgggggac aaaggacagt acgacagatt aggtgataga aacgtttttt tttatttatg
   206401 aaaaagccag tgtgccgtgc ggcctagggc cccggcgtag tttggatacc agatgggggc
   206461 cgtcaggggt actaccacga gcagaaacat aatgacttgg tccatatata gcagcatagc
   206521 ggtgcgcagc aggtcgccgt ccgtgtagca atttgacggt gagcgataaa gcaccgttaa
   206581 tgtgtcgcgg atgagcacga tcttgaggcc gtagatgaag ctcacagtca gtgctaaaat
   206641 gatgcgttgg tatggttccc aggactgcac ggcgatgaag agccagagta tgggaagcat
   206701 gaagcttagc aaacagagga tggctaatcg tcgttgcatg ttccaggcca tgagccaggc
   206761 taggcccgta caccagacgc agagcatgga tgacaggaca taggcctgga ttaccacggt
   206821 gcgatcgaaa cacagcccga tggtggacac ggatatcgta gtgagggtgg tatataccat
   206881 gaccagcatc agggtcccgg gtcggcgctg acgttccagc cagtacgcgt ggcaacgcag
   206941 agcacagggt agcagtgtgc tccagaaggg cagtgtatcg cgcaggtagg gggtcgtcac
   207001 gcgccacggt atgagcatga aaaggatggt agtggctatg gtggcgctgg tctggaacac
   207061 gacggtgccg tagagacgta ccatccagag aaagtgttga acgctccgca gggtgtcttc
   207121 atctttggtg attacggtga ctcgacggat cggcggtggt gacggcggcg acacgggtgg
   207181 gggtttctct ttcttatggc cgagtggctc gccttggtga aactggatct gtaccatgac
   207241 gggtgctcga cgaacagtcg tcggggcttc aggtacccgg caagttttat agagaaaggg
   207301 ggacgatggg tggtggctac gagccaccgc caccttcgca atacgaggat ctgaaggcgg
   207361 caaagacggt cgtccagggc aggcgccaga ggttgggact gagcacgatc agcgtgattt
   207421 taaacatggt caccagtcct acgtagatta gcagcgagcc gcgtaacgtc tgagcagccg
   207481 gcagttcgtc gcggatgtaa cgcgtgccgt agaaagtcac ggtcatcata aggaagacga
   207541 tggcgccgta gccgtagagt agaatacgct gatgatggaa cacggtctgg tcgccgataa
   207601 cccagagcgt gatgaaaaaa acgctggtga gcacccgtga gcatatgagc tcccaacgct
   207661 tagcgcgaaa gctgtcccca accatgacag cgccggtgca agctatccac agcgtgagga
   207721 ccagtgtgta gtcgatgagg atggcgggca ggtcggagca ccaggtgtag aaaaccgtgg
   207781 taacggagag gaggcctacg tagcccatgg tcaataccac gtcgtcgggg tgcctttcgc
   207841 cctgtatcaa gaccaaacac cagagaaggg agggggcaaa aaccagcagc agaggggaag
   207901 attcatgttg acatatgttg tgggaatcgg ggatacccag ccaaatcatt ccgcagaaag
   207961 ccgtactgat ggcgatgtga aagaccacta gggcgtagac ccggacgagg acagcaaaac
   208021 ggcgcagcca cataaggccg tggtgcagct gcaggaggga agcccattgc ggcgaatgta
   208081 gcgacggcag cggcgggtcc atgaggcggg tgatgcgccc gagtgaacgg gtgagcgtct
   208141 cggtggagtc ttcttataaa ccagcgggtc tcaagcaacc ctgctctgga acgtcgcggt
   208201 ggtgctgttg aggatgacgc tgagcgtgcc gttgtcaacc cggtaatgat gataggtgcc
   208261 cagcttggcc aggtagctga acatttggtc ccagcgtgcc gaccacacca cgggcgtgag
   208321 catcaggagt gtggtgtgat agatgagtgt ctcggtggcg taaagtacca gcgagctgcg
   208381 gatgatgtgg ctcacgggca ttttggtggc gatgtagcgc acgtcttgga aaaggacagc
   208441 caggatgcag cccacgaaca cggtgtagag acacagcaga gtcttatgca accaggtgta
   208501 agtagaagcc aggacgctga ccatcaccgt caaaagtgtg gaggtgaaaa gcgcgtcacg
   208561 ccacacagag ctgagacggt gttcccaagc cacgccgttg caggccacga acaacgtcca
   208621 cgttaggatg aggctggaaa cgccgatggg cgctgtggcg cacagattga gcccggcggt
   208681 ggtgaacgag agaagcgcca catacagcgc aaacaccagg ccgttgctgg ggtgtctgtg
   208741 gtcggtgagc tccagcgcgc ccagaaccaa caccggtgtg cagctaagca atagcggcga
   208801 gggatcgtcg cggcactcgt agcccagtga ggggtaaccc agccaaacca gcgcgctaat
   208861 gagtacgctg aaagcggttt ccagcgtcag caatccgtag acacgcatga cgatcgcggt
   208921 ccgacgtagc caacacaccg catcttcgga agctgtggac gctgtttccg aataccggga
   208981 ggagatcgtg cttccctctt ccaaggatcg gaaagtagcg tccgtcgttt ccgcggacgc
   209041 ggcttccctg gtacgctccg tttccgacga cgcggtttcc cgctgcgtgg aaactgtctc
   209101 catgtcggga ccgcagcgcc cggcggcgta tccgcaaggt ctcgaagcta cagcttgtca
   209161 gaggaaaagt aggtttgcaa aaaggtgcgc agggtcatga ttctcagcac catcagcaga
   209221 gtgaaaacca ggctgagaaa caccttgacg gccgccaaaa gcgcgcgttc cagcggcgtc
   209281 tcgtagcgta cagccagggc cgcttcgtgg aaatgcgaga cggctagaca ggtaatgagc
   209341 acgctgaagg acaagacgat cttaaagcac caggaccaac cacgcctcaa gatgaccacc
   209401 acgattgccg tgaaggtcaa cgtgatcaaa gcatggacga ccacgatctg acgacggacg
   209461 gtacgttcgg gagccaacaa cgctacgccg gtgcagctga gaaaggccag taaggtgaac
   209521 aacgcggccg agatgaccaa cgtaccgtcc aggcagagac atatcacgat caacggcggc
   209581 acgtgaagca gcgtgtaaaa gagcagaacg ccgatattgc tgggatgcga tgtttcgtaa
   209641 cagtgaatga agatcaccga cgtgacgggt atgacaaaga cgaggctggg cgaggactcc
   209701 gtgagacaca gacgggaatg gtgaaaccac gtcgcgggcg ccgcgtagca gaaggcgctc
   209761 aacaacgcgg tcaagccggc cagctgccaa cccacggcgc cataggtgtg cagcgccacg
   209821 cggcaacagt cgacccaagc cagactgcgg gtcgccagcc gggtctcttg gatcccgggg
   209881 ggcacgtaga tgaccgtgcc atcggtgggt acttgaaacc ctttttctct tctcatggtg
   209941 cgctgcgttc tctggaaacg gctgctctgt ccgaaaacca gttccgaacg aaaatctagg
   210001 gcgagagggt ggacaacggc gtcgacgacg aagcatggga caggtcgttc ggcgttaacg
   210061 tcatcgcgtc ggacgacggt agttctaaga gacgtagatc gctcagcagg tcctgacagt
   210121 tgcggattcg caagatcaga aaaaaaaggg aaatgaacgt aataaagagc tgtagcgacg
   210181 tatgcgccac atcgcgtggc ataagaacgt gacggacgaa aaggacctgc tgcgaaaagt
   210241 ggccggcgaa gataaggccc accgtgctgt agaagcccaa aagcagccgc aggggccaag
   210301 tccagggccg cgtgaagacg atgagaacgt tagccagaaa gaccacgacc cagacgccgt
   210361 tgatgagggt aaattgatcg gacagggtgc agttgtcgcg acagatgaag actacttccg
   210421 cgcagagcaa ggtgatgacc aacgtgagca caaacgacgt caacacctcg cggggctcct
   210481 ggcagacaca cgtgatacct agcgccggga tgtgcgccag gaggccggcg agtaatagca
   210541 ccagctgtcg gaacggacga cggcagcgcg ggtgccggtt tcgctgagcg agaaccggtc
   210601 gctcatagcg gaaatacacg aagagcgcgg aggccacagg caccaggagg agcacctcgg
   210661 gcgcccagac aacgtgacaa ggaaagcccg gacgcgactt aagagtcgct gtagggaaga
   210721 ccagagagaa gctacccaag acggccaccg ccgcggagat ttggaagagg agcaagccgg
   210781 cgattcggac gacaacctcg aagcgatgca cccagcccag cacggccacc acggccgctt
   210841 catcatagtc gtcgttgttg ccgctgtcga acagccgccg aaacacgatc tgtcgctggg
   210901 tcgcggtggg aaagcgcaga cccatgacag ccggaggcta tatgaccgcg cgtctaaggc
   210961 gcgagatccc tggggggact tttagatgtt tgggcggccc gcggttctga caggcttgat
   211021 tggtggagac ggccggcgcg gcgggtgggg gaaacgacga gtttttccgt tacgccatgg
   211081 ttcgcgtgag gtttctctgt acctcccgca aaaggtcaca gcccgaaatg gaggccgcgt
   211141 tggtggcccc ggtggcgcgt gacgataacc aggtcatcca agcgatgagt ttgtctaatg
   211201 agtcctcggt ggtgaagagg ataagaatga gcaggtacaa gtacaccagg ttctcataga
   211261 gacacaaggt gagcaggtcg gcctcggacc acgcgatctc aaacaggcgc gtggtgtcaa
   211321 agaccgtgac gaccagcatg aagctgagcg ccatggcgta atagcccaaa aaaagtttgt
   211381 gccccaacgg tacgggctgc aggtaaagtg cgatcaagaa cgcgataacg ccgatcacaa
   211441 acagcgtgac gatgacctgc catcgacggt gattatggcc ggctagaccc gtgacgcagc
   211501 tgcagaggct aaaaagcacg caagccaaga ggcccgagaa ggtcaccagc gtagaggagg
   211561 agcaggcgct ggccacgatc accgaaagcg tcgtgagcac gctataaatg gtgagcaggc
   211621 ccgggctcgg cggcgacgtg aacgatcctt catcgcgttt gccgtgcagc agggccaaac
   211681 agatggtggg caccatcaaa ctcaagggtg gcataaagcc ggtgcaacag agaaagacgg
   211741 tgcctttaag atgcggaaaa gccagcacca ggcccagaca gagcaagaag gtgcaggtgc
   211801 cctgcacggc cacggtgctg tagacccgca tacaaagtaa aaagcgacgt acgtcgttcg
   211861 tcgagacgga ggaaatcata atgactccgc gcgagggtcg cgggggtggg ggcgcccagg
   211921 ccgtctcggt ggcctctgag ttcggagaca tgacggcggt ggctatcaaa aggcgcgtat
   211981 gagaaaccgt ttatagagtg taatagaatc accgtcattc ccacacggcg ttcccccata
   212041 aagtcacgtc acactcgagt aagcgtgaaa aagctttatt gttgaataaa aaacacgagt
   212101 acaacaccga gttgcggtgt cctgtctgtc tactgggtgg gggaggttca tcgtctgtct
   212161 ctagagggaa ggtggggaac gtctaagcga gcgggagcgt gtcatctccc ccatcttttt
   212221 acaacaagct gaggagactc acgccgtcga tgcgtccgcc gtgtttctcg gcgtactgct
   212281 gcacccagac gtggccgcta aagatggcga cgctcatgtt taggagactc atgacgatgg
   212341 tgtacaacac gacgctgaca cagacgctgt ttttagacag cgttccacgc tggtagatga
   212401 gatccagggt ttcgtaaata agcacggccg aagcggcggt caccaccagg acgtagagtc
   212461 cgctgtagat cttgctgacc cacagcacgg gcgaaaagta aagcaatagg taaaagacga
   212521 tgacggacca gccgtagcca atcccgatga ctttccagcg cgtgggattg ttgccggcca
   212581 ggtaagtgag accactgcag agaacgaaaa agaccatcac cagggcaaac gacagaccga
   212641 tgacgcgcct ttctccgcaa aagcccgtgc acacggtgat gccggtgttg atcagcaggc
   212701 acgccaccgt gagatgagca aaattggtgg tgtgtgggcg aaactcggcg aaaccgcgta
   212761 gcatggccag cgtggacacg ggcacgatgg aggacagggc tggcactatg ccgttggcgc
   212821 actgtccttg cacatcgggg aaggcgagcc aagccagcag gcagaccgtg agggtacaag
   212881 ccagctgcca cacgagcccg tgatagacct ccatgagcag cttgaagcgt ttcaaccact
   212941 ggaagagctg ctgttcggcc accagcgcgt ggctgcgatg gagcggcacg atggtgaccg
   213001 tcggcgactc atggtgttcg gaaaccgagg cggtgtcgcc catgctgccg cttacgaccg
   213061 ctgtcggtct aaggtaggcg tcgatgaaac agtccgtctt atcagcaccc ggttaccacg
   213121 gatttgattg acgtcacgag tgtggtcaaa ccgtggcggc accctgtatc cgacccgtcg
   213181 tcatgggctc cacaaccaga gcctcagaag atggtacatg ccgatgaata aagccacatt
   213241 ttcgacatag aggcgtagcg aggactgaaa actctccggg aaagaactct gacaggtgat
   213301 cagggacaga tcgtgaatta gcatcagcgt caccgtcaac agcgtcgtcg cgtgtaaacc
   213361 gagaaagaac ggggtcgcgg cctgcagcag ccaaaatccc agcgccgtag cgcagagcag
   213421 agacaggacc gacggtagcc acagccgccg gagagacgcg ccaggatcgc aacccaaaag
   213481 cgaggccccc aggcagccga gatctaccgc cagggcgaga agagccgcgc cgagaaaggc
   213541 ctgcagcgac ggctgacaca tcagcaaggt cagaaaggct agcgcgtgcg gcaggcagta
   213601 agccaacagg agtaggagtt tgcggggaca acggtcgatc gacggaccgc gtagcagcag
   213661 gaacaggcag ccgacgggta cgacgagact gagatgagaa agcggcggtg ggtcgtcgtc
   213721 ccgtccccgt tcgcatagct cggccaccgg tggcggcatg agccaccagc tgagcacgct
   213781 gagggcgacg gtagcgataa gctggaaggc gacgaggacg gaggcgcgca gccataccgc
   213841 cagcctctct aggtagggga ctacctcctc gacggtccat tctagcggga cgacatgaag
   213901 catggcgaca agcgcggctg ctctgaaaac gggcacggtt ttataggcat taggacgtcc
   213961 ccgtcgtact ggcggctgtc aaagtcccgt tgtccaaaga cgcgccgtcc gaaagactaa
   214021 tccaacgggg acccgagagc atgagcaaca acgtgagaaa gatggccatg ctgtccaggt
   214081 agagacagac ggcatgacgg atgcactggt taggtgggca gaaaaagatg accatgagac
   214141 tgtcgtaggc cagaataccc aaaaagaaac tgatggagaa ggcgcacaac gtcactacta
   214201 tcttctgcag ccagtcggcg tcgcttagca gagcgagcgt gaggaacgaa agcagcatca
   214261 ccacgtagac gcagctgatg catttccagc gacgtcggtc acggccacct agaaacgcca
   214321 gtcccgtaaa ggagataaac aacgccaggg tcatcacgta ggaacctact agtacgcggc
   214381 tttcagagca catttggaag atggccgccg tcaggctgtt ggccaacaga tagataaaaa
   214441 gcaccgtggc gttactagga tgctcgttgc ccaacgtgta cgtgatgaac atgcagacga
   214501 tgggcacgag cacggtgaga aagaagctgt agttctcgac gcaaaagttg cggttttgtg
   214561 gaaaccccaa ccaaaaaacg cttcccaaac cgaagctgaa agccagctga aagatgaaga
   214621 tggcgtacac gcgcagccat acggtgaact ttttgaacca ctcgagagcc tccatgcggg
   214681 agagcaacag cgcgttagcc tcctgcgcct gcatggtggc gacggtctcg gcacaaagcc
   214741 gctgcggcgc acctaccctt ctcttataca caagcgagcg agtggggcac ggtgacgtgg
   214801 tcacgccgcg gacacgtcga ttaggagacg aactggggcg acgccgctgc tgtggcagcg
   214861 accgtcgtag cgaccgtcgt ctgagcagtg tgggcgctgc cgggctcgga gggcatgaag
   214921 tagagcacgg agacaaagag gtacatgagg tccatgtaca agcagagcgc gcccgggata
   214981 taactctcat actcgatgtc gtgcaggatg tcctgtgtat cgcacaccac cgaggtcacg
   215041 atgacggcca aaccggctat catcaccagg atctcactta ccgcctcggg aaaaagagaa
   215101 aatacggcga acagtaagag aatcagcgtg gatgcgcccg tcaataggga acgctgtaat
   215161 tccacgtcgc gggcaaacag atacgtagcg agcgtaagga aacaaaatag cgttactgtg
   215221 gccaccatgg cataaatgac tgaatgatga ctaaagtgga agcctgacgc cgtgacagcc
   215281 acgctggtaa gcaacgtgta cgtcagtaag atccatacgt ttttgggaaa gttgggctcg
   215341 gcccaacgca acagacctag gcacacgatg gagatcatta agcaagacag cgtcagacgc
   215401 acgctggaaa agagctgctc cagccggtgc ggcaacacca gccagcaaaa ggcgcagacg
   215461 ctcataagga tgaggcattg cacccagata aggatgtaga tgcgcagcag gaagaccgac
   215521 cgggctatct ggacctgacc gcggagcgac atggcggcaa cgccggcggt tatcgccgag
   215581 atccgtctaa atacacgaag cgaactagaa aacgcacaca cgttatttgc aaaaagaaag
   215641 cagctgccgg cttattattt tattaaaaat ttatctgtgc agaatcataa gtttatgatg
   215701 aataaaaacg gggaaaggga atctgctttt agggacccgg gtctggtccg tcatctccca
   215761 tctggtcggg ttcggggatg gggacctgtt tcagcgtgtg tccgcgggcg tgcatggctt
   215821 ttgctcgccg accgcgctgt aaccaggcct ctttctctgt ggtcggcgag tcttccgacg
   215881 ggtagggagt ctgggagtcc atcgcttcag gcccaccgct cgttccctcg accgtcgtgt
   215941 cgtcctcgtt ttcgctatta cacggggttt ctggagtatc gcctatacgg ttagcgattc
   216001 tccgggggcg gccgctctcg tcctcgtcgc tgctatcgcc gcccggtaat tcgacgccgc
   216061 attcgttgta cggagcgcgg cacatgggcg gcggaaagaa cttgggcatg cgaaagcagc
   216121 gttgtccatc cacggtctgc gtggtttcat cgttatcctc ccataatccc ccctgtagcg
   216181 ccggcagcgt ttccacgctg tgagagggaa aggcccagtt ttggttgtct tgcagcgcgc
   216241 ccgtgggcag taggtccgtg cggccccagg cgctgctgtt gttgggtacc ttgtcagtgc
   216301 cgcgagtagg tcgcagaaac caatccagag cgctctctag ctgcgagcgt gtgatggtgc
   216361 ccagtgcgcc gtgccagcgc agcacgtctc ttttcagcgt gtggtgacag acgggcagct
   216421 cctccaaccg acactcgccg cgcaatccgc ggtcgaagcg gcagagacca cgcagtttaa
   216481 gcagaccgca cttgagaaac atgtgaaaat tatcggcaat gcgatacagg tctgagtcct
   216541 cgatcttgtg taggtagacc acgccaaact tgtcgagcag taccaggccg ctgggcacaa
   216601 aaggcccgta ggccaggtaa tagcccacga ggccgacgac gtaccactcg cagcacaagc
   216661 gttgacgaat aaagttcaga agatcgcgaa agtccgcggc cggcatgtgg tcaaaaggcc
   216721 ggcaggcgcg caggccctcg atggagccca gcatgagcaa cggctccacc tcggtgcgac
   216781 ccggcgtgcg gatgaccagg ttgagaccgc tcatttcgcg ggccgtcttg gccacggccg
   216841 cagcgtcagt ggggtcggtg cagaggaatt tttgcacatg gtagcgcggt tcggtggtgg
   216901 cgaacggtgt ttgtgggtgc cgatacacat attcgcacca gagtagaccg ttcttggaaa
   216961 aagctttgat atcactggcc acctcgtaga gcccgtcggt ctcccagtcg tagacgtaga
   217021 cggtgccgta atgacttagc atgagcacgc agggcagttc ctgcgcctgc ttggtgtttc
   217081 gtgttagatc gctgtcgggt ggacgtacgg ctagtacacc gacggcttcc agggtgtcat
   217141 cgcagcagag atagtcggcg gccagagaac gtgcgtaaat ctgcgggata gcggcctgtt
   217201 cgcgcatcac taggaaccag ttggcggggt tgcgcagtgc tacggtggtt ccctggtggc
   217261 gctgcacgta ggttctcagc gccggaggat cgtactggcg cagatagagg ccttgcagca
   217321 tcgataacgt cttttgaaag acggtgtttc taaattggaa aacgccgtag tcgcagcgga
   217381 tagcatcttc gcagcgctcg tcgcgctgtc ggagataggt gccccaggct tcggcggcgg
   217441 ctttggtgag tagggacatg ccggcaaagc cgtctcgaca gcgagtcgga taaagcgcgc
   217501 tgcgcgaaag cttaatatag gagcagcgtc agacgaatcg cggctggtgg cccggggggt
   217561 gggacgcgcc gcctacacaa agtgctcccg aaaatcgaaa ctcttgaccc actccggaga
   217621 caaatccgta ttcagattga tgcgtcgcgc ttccacttcg gcttccgaaa cctcggcctc
   217681 cgtccggtag gcgttaacga tacgctgacc caggtgccaa cgttctttct ctgccaaacg
   217741 ccgttgctca aaccattcgt ctacgtcctt gaggtcaaag acagtgtcct cctcaaggtc
   217801 aaagcctagg tcttcccact cgtcgtcatc gctctcgtgg ccggcagcca tacgcgcggc
   217861 aaccgcgtct tcccctcctc ttctttcaac gttgggtacc acgttgtttt cttcgggttc
   217921 cataggttct gcgccactgt cgtcatcatc ctctccctgc tcctcatcgt ccgtcaaggc
   217981 gtcgtggatt acctccaggt tctgattgtc gggtacgacg tggttatctt cgtcgtcgtc
   218041 gcgcggcatg ggcggcggcc gacggcggac gaccggcatg gcgcggccgt cgtttctttc
   218101 gtcttcctct tctccgtctc ccagggaacg cggtcgacgg cgttccgcga agtcgccgcg
   218161 gaccacgcgc gcctgccaga tggtaaatgc gtcccaaccg tcccagttat ttagcatttc
   218221 ggcgcggaaa cggtcgcctc gacagagcca gcgaaactgc cgcgcgtagt cgcggtctac
   218281 gccgctgtcg aacatggtaa agtgaagacg cgccgcctcg cccatgtgta cgcagcctcc
   218341 gttgcgttcc agcctggccg cgcgccgcag accgtgttcg tagcggcgac gcacgtacac
   218401 cttcatgagg ccggcgcgaa agagttcctc taggctgtcg gccagacggt agatttcacc
   218461 ggctagacgc tgcaggggcg gcgagcggtc caggtgcgac ttgacgatta ccacgtaaaa
   218521 acgacagaaa cggtcgaaga tgatgaggaa tgacgtgtca aagaaaccac cggcgcggta
   218581 ggagcccacg gcgcccagca ggtaccagcg gcaacgcagt tgcagcgtga cgtacatttc
   218641 gcactcggcc aagcgggcgg ctggcgctac ctcgaagggc cagcagtccg tcaagcagcc
   218701 gaaactggtc aggagtttca acgttttggc atggcgtcca ggtgtatgaa agttcacgtc
   218761 gcgtccgtgg tgttcgccaa cgcaggcggc caacgcgtcg gcgtcatgac cgtgacgcag
   218821 cagcatcgct accacgtcgt gcggtacccg cgtagcaaac ggcgtctgtg gctgacggta
   218881 tacggcttcg gtgtacatca taccgtaacg cgccagttcg tccagatgac gcgcgcacag
   218941 cagcagaatc tcttgcgagg gttcgtagat gtagaggcgc gtaccgccac ccatgcagag
   219001 caccagctcc gtctcttcat agtgatcttc caccatgatc acgcatttgc ctagcacgat
   219061 aaggcgttcg gggcaacaaa tcacgtcgtc cagcagttgg tcgcgcagct ccggcatggt
   219121 gctgccaggc cgcacctgca ggaaccagtt gtgcggaatg ccgagcgaca acacctggtc
   219181 gacgtggtta cggacccagt cgcgaagcac gtcggcgctg tactggcact caaagatgcc
   219241 ctgaaagtcg cccatgaccc gcagaaaagt ttcgtagcgc gtgtggcaat agaggaattc
   219301 atcgtttcgc gtaaacgtgg gagctccgtc ttcccagcgt gtacgccaca tgtcaaaaga
   219361 ggccgccagc tagacacccc agaaaagaag cagagaaaga gagttctttg tgcgacacgt
   219421 tttattccgc gtcctccgct cgacgctcaa atctggatgt actcgcgcac acccgtcagg
   219481 ctctttaagg gaaaagggtc cgagtacgtc actaaccgcg actgatgcac cagggcggta
   219541 atcacccgct ctgcgccctc gcgcgtcgac gaacgcgtcg tcaccaggca gtgcagccgc
   219601 gggcccgtat cgtcctgatg accagcggcc tcgcgctcgg ctgcttccac accgacaatg
   219661 tcgggatcca acacgtagct ctgcgagttg gtgtcgtagc ggtgtagcac caacgtgttg
   219721 gggtccagac gctcccacgc gccctcgtgc gggtcaaaac gctccgttaa acagagccag
   219781 tcatactgct gctgcagaat acgccgctcg cgctcacgtc gctcatcggg caacgcggcg
   219841 tcttcgttga agagaatgtc ccgcttgtgg tctacggcac gctcgtggtg gtgcgggcac
   219901 agatgacggt gttccatacg cgtctgacgt tgacgctcgc gctcaaaacg ccggtgtcga
   219961 aagaccattt tcagcaaccc catgcggaaa aactccgtga tggtgttggc aacgcgtcgc
   220021 acgtagtggt tggggtcgtc catctggatg gcgtacacgg caccgaacca gtccagcagt
   220081 accagcactt cggccacaaa gctgcgtccc ggtcgcggac gtcccgtcac gcctagcaca
   220141 taccacggcg tggccagatt agcacggaca gcccaccacc aacgacggct ctccacctcg
   220201 gtgagcgcac aaaagggcca aatgcggtgt aactgctgca ccgttttcat cagccgcata
   220261 atcaccgtgc cgtaacccgg tgtatgcaac ttcacgtcgc aacccaggat tcgttcggcc
   220321 gtggcgtacg agccctcagg cgtggtgtca ttgagaaaca aaacatgcat ggtacgcgcg
   220381 cccttagggt atcgtcgcgg aacaggtacc gtcattctcc gcaaagtggt gtgaatcacg
   220441 tcgcgatacg caatctccga acgtgacaca ccgtaacgtg ccagttcgtc caggttgtgc
   220501 gataccaaca ccatgtactt ttcacgggtg tcgtaggcgt agacgcgaga aaagcgaccc
   220561 ataaaaacca cgtacggggt agccaccatg ccatcatggt gatcgcgacg tggctcgggc
   220621 aacaaaataa cagcgtatcc caacggcgtc agcggctcgc ggcaacagat gagctttgac
   220681 gccgcctgtt tggcggcggt aatgatcccg tcctccgtac gtaacatcac atgccagccc
   220741 ttggggggac ccaaggacag acagcgtccc tcgttacgat gaacgtaacg cgtgatttcc
   220801 attggctcca ggcaaaagaa cagttcctta aaatcccgca acacttgtcg atataacgcc
   220861 atgggatcct cggccgccac aggcagcgcg gggagctccg gcggcacaac tgcagcgccg
   220921 tcagggccag aacccgcagc cggatccatc attgcgcgac actctcagcc ggacaaccgg
   220981 cgtcactgac agaagccgaa ccaaatacag agaaagcaac gctacaccgt caccccgctc
   221041 ccaagcgccg cggaaagtgc tccgattttt caccgtcgtt cgcgacgttg atttgcctcg
   221101 gtctgagaac cgacctagcg ttcggaccgg tgcgcagaaa cagccggcgg tccgagccac
   221161 tgagcggttc acagccccgg ccgccgatag ttaccggaga gacgttcgag ctgcaggtac
   221221 atcggcgctc cccgcttcgc caccccgcgc ccgccccagt ttatactctc cgacgtcccg
   221281 tccaacgcgc ctgtggaggg ccaatcggac cgcgggagct ctccaagtgg atgacaggca
   221341 cagccgggtg gccgaccgtg aagagccctc atccacctga acagaccgct aaccgaagga
   221401 ccccgagtcg cgtccgttgg tcccgacgtc cgtcgccatc tggctccctg ctgttggcta
   221461 cctctcggat ttcaaaaaag agcacgtgcc gatgacggtg cacaggaaag agccaaagtg
   221521 tcacagcgtc tttttttatt tgtattcctt tcctgttttg tactcgtaaa ctgttgacgt
   221581 tgtttttaca tccaaaaggg caagtaagaa acaggatgag gcatggtagg tttgggcgcg
   221641 gggcggccct ccagcacggc ggcccgggcc gcccggcggg tgagcacccg gcgttgcgcc
   221701 gtatctatct tgtgtttctt ctgtgtcttt ttcctatctt gttccgcgac ggcctctttc
   221761 atcacgttca gcatgcgttc ctcgacgccc tccagggatc ctggggagga gggagtccta
   221821 gtgaggcttc caatgttgtt ttgtggattt tcggtttcct cttcttggtc gtcatcgtcg
   221881 gacgtgttgt cttcctcttg atcctcttct tcgtccgaat agtagacgca tagtccctgg
   221941 ttcatcaggc tgggattcat caggttctga cggggaatcc gctgttgtag acgtttaacc
   222001 gcccgttcca ggcgagagct catgccgcac cagacgctgt aacgccgcac gggcccgtag
   222061 cgggctgttt gttcgcgtac atgatcgttg agctcttgcc aatattgttt ggcacactcc
   222121 agatcggagg tttgtggata gtcgggtcgg atccgcggat cccaactgac atcggcggtg
   222181 ccagagactt cgtccagact gttacgcata gagcaccagt cgggtcggac gataaacctg
   222241 tccttgcgga ttaaccattt ataacgtagt tcgtgatggc gtgtagaggc ccgtacacgc
   222301 tccacggtcc caaagcggtc ccagaaggga aagttttcgt gagggcagcg acccggcact
   222361 tccagacgtt cggcgtcgtc cacggcgtag tgaaaacgcc ggccggcctg gtaaattttg
   222421 agcagaccca cggttaacaa catatccacg ctgtcagcca accgccagat ctcgcgtcga
   222481 gacacgtcaa aatagaaaaa ttcacaggct cggtcgacca ggatcacgaa atcggcgtga
   222541 aagacgccgg agggtagcga ctcgcccacc acacccatta tcatggtttc acagcataag
   222601 cggtccacaa agaacttcaa caggtcgttg aattgctccg tctccataca gatgaagggc
   222661 cagacgcctt tgaggttctc ggcctggccg cagagcagca acggacgcgt catctcgcct
   222721 ggagtgcgca gaggcacgca ttcgccgcga taacgacagg tcacacgctg cagttcgctg
   222781 atgctgttgt cgtgcaggcg aaggtcgcag ataatatgat ccggttgcgt ggttagcagt
   222841 ggcgtgcgca tctgctcgcc gtagatggcc tcgcagtgca acagtccgtg tcgcgcaaaa
   222901 tcatccagac tgtgcgccag gtagtaaagc accccgcaat cgcggtctaa acaccacacg
   222961 gtttcgtaac gtcctagcag gagcaccaga cgggcctggc taggtggctc aatttcctct
   223021 acatatacga aaaagtcgtc atcgtccgag tcctcgtcct cagaagagga ccgcggcccg
   223081 tgtactctgg gcaacacggt ggtagagaac tgcaggacgc ccagagactc gagcgactct
   223141 tcgcagcaga tgagctgacc ccagggcgtt tcgggcccgt cggtgacagc cgcgctgcca
   223201 aagatgtcct caaactctac aaaatctaga cgccatccgg gtggcgctga aacgggaagg
   223261 ctaatgttca tatcagcata gctacgaact aagtggcgga tgtcctgccg caagtcttgg
   223321 cagagaatga gctttcgtaa acccttgagg gtcctccgaa caacggcccc agacgcgtag
   223381 cgataggact ggcgcatggt gccgcggcgt ggagcggcac ttggcagcct attttatgga
   223441 gtttcttcag tgacgtggct tgttcacgtc gttcgtgggc tgcggttggc agctccggtc
   223501 tgtaaaccac ccgaaaagac tgacatcgac gtcaaagact cacgtaattt ggaacatgtg
   223561 cgaccgcaaa atgcgtcaga atagcacgtg gctttaggac ataaaaagta ccgtgaggtc
   223621 tagacgtggt ttttgtgatt gacacttaca ccaggtaagc caagggacgg tgaaactgta
   223681 tgtgaggaac ctgggtgctt agacaactaa cgtgtaatgc tttttacagg accgttcaac
   223741 aggtgatact acctgcaagg taatgactac atctactaca actaccacta atatcatgct
   223801 acaggtgagc aacgtaacga atcacacctt gaatagcacc gaaatttatc agttgttcga
   223861 gtacactcgg ttcggggtat ggttgatgtg catcgtgggc acgtttctga acgtgctggt
   223921 gattaccacc atcctgtact accgtcgtaa gaaaaaatct ccgagcgata cctacatctg
   223981 caacctggct gtagccgatc tgttgattgt cgtcggcctg ccgttttttc tagaatatgc
   224041 caagcatcac cccaaactca gccgagaggt ggtttgttcg ggactcaacg cttgtttcta
   224101 catctgtctt tttgccggcg tttgttttct catcaacctg tcgatggatc gctactgcgt
   224161 cattgtctgg ggtgtagaat tgaaccgcgt tcgaaataac aagcgggcta cctgttgggt
   224221 ggtgattttt tggatactgg ccgcgctcat ggggatgcca cactacctga tgtacagtca
   224281 taccaataac gagtgtgttg gtgaatttgc taacgagact tcaggttggt tccccgtctt
   224341 tttgaacacc aaagtcaaca tttgcggcta cctggcgccc atcgtgctga tggcgtacac
   224401 gtacaaccgt atggtgcggt ttatcattaa ctacgtgggt aaatggcaca tgcagacgct
   224461 ccacgttctt ttagttgtgg ttgtatcttt tgccagcttt tggtttccct tcaacctggc
   224521 actattttta gaatccatcc gtcttttagc gggaacgcaa aacgagactc tccaaaccgt
   224581 tattactttc tgtctatacg tcggtcagtt tttagcctac gttcgtgctt gtctgaatcc
   224641 ggggatctac atcctagtag gcactcaaat gaggaaggac atgtggacaa ccctaagggt
   224701 attcgcctgt tgctgcgtga agcaggagat accttaccag gacattgata ttgagctaca
   224761 aaaggacata caaagaaggg ccaaacacac caaacgtacc cattatgaca gaaaaaatgc
   224821 acctatggag tccggggagg aggaatttct gttgtaattc gatcctctct cacgcgtccg
   224881 ccgcacatct atttttgcta attgcacgtt tcttcgtggt cacgtcggct cgaagaggtt
   224941 ggtgtgaaaa cgtcatctcg ccgacgtggt gaaccgctca tatagaccaa accggacgct
   225001 gcctcactct cgttgcgtgg accagacggc gtccatgcac cgagggcaga actggtgcta
   225061 ccatgacgcc gacgacgacg accgcggaac tcacgacgga gtttgactac gatgaagccg
   225121 cgactccttg tgtttttacc gacgtgctta atcagtcaaa gccggttacg ttgtttctgt
   225181 acggcgttgt ctttctgttc ggttccatcg gcaacttctt ggtgatcttc accatcacct
   225241 ggcgacgtcg gattcaatgc tccggcgatg tttactttat caacctcgcg gccgccgatt
   225301 tgcttttcgt ttgtacacta cctctgtgga tgcaatacct cctagatcac aactccttag
   225361 ccagcgtgcc gtgtacgtta ctcactgcct gtttctacgt ggctatgttt gccagtttgt
   225421 gttttatcac ggagattgca ctcgatcgct actacgctat tgtttacatg agatatcggc
   225481 ctgtaaaaca ggcctgcctt ttcagtattt tttggtggat ctttgccgtg atcatcgcca
   225541 ttccacactt tatggtggtg accaaaaaag acaatcaatg tatgaccgac tacgactact
   225601 tagaggtcag ttacccgatc atcctcaacg tagaactcat gctcggtgct ttcgtgatcc
   225661 cgctcagtgt catcagctac tgctactacc gcatttccag aatcgttgcg gtgtctcagt
   225721 cgcgccacaa aggtcgcatt gtacgggtac ttatagcggt cgtgcttgtc tttatcatct
   225781 tttggctgcc gtaccaccta acgctgtttg tggacacgtt aaaactcctc aaatggatct
   225841 ccagcagctg cgagttcgaa agatcgctca aacgtgcgct catcttgacc gagtcgctcg
   225901 ccttttgtca ctgttgtctc aatccgctgc tgtacgtctt cgtgggcacc aagtttcggc
   225961 aagaactgca ctgtctgctg gccgagtttc gccagcgact cttttcccgc gatgtatcct
   226021 ggtaccacag catgagcttt tcgcgtcgga gctcgccgag ccgaagagag acatcttccg
   226081 acacgctgtc cgacgaggtg tgtcgcgtct cacaaattat accgtaataa aaaagcgcta
   226141 cctcggcctt ttcgtacaaa ccccgtgtcc gcccctcttt tccccgtgcc cgatatacac
   226201 gatattaaac ccacgaccat ttccgtgcga ttagcgaacc ggaaaagttt atggggaaaa
   226261 agacgtagga aaggatcatg tagaaaaaca tgcggtgttt ccgatggtgg ctctacagtg
   226321 ggtggtggtg gctcacgttt ggatgtgctc ggaccgtgac ggtgggtttc gtcgcgccca
   226381 cggtccgggc acaatcaacc gtggtccgct ctgagccggc tccgccgtcg gaaacccgac
   226441 gagacaacaa tgacacgtct tacttcagca gcacctcttt ccattcttcc gtgtcccctg
   226501 ccacctcagt ggaccgtcaa tttcgacgga ccacgtacga ccgttgggac ggtcgacgtt
   226561 ggctgcgcac ccgctacggg aacgccagcg cctgcgtgac gggcacccga tggagcacca
   226621 actttttttt ctctcagtgt gagcactacc ctagtttcgt gaaactcaac ggggtgcagc
   226681 gctggacacc tgttcggaga cctatgggcg aggttgccta ctacgggggt tgttgtatgg
   226741 tgggcggggg taatcgtgcg tacgtgatac tcgtgagcgg ttacgggacc gccagctacg
   226801 gcaacgcttt acgcgtggat tttgggcgcg gcaactgcac ggcgccgaaa cgcacctacc
   226861 ctcggcgctt ggaactgcac gatggccgca cagaccctag ccgttgcgat ccctaccaag
   226921 tatatttcta cggtctgcag tgtcctgagc aactggttat caccgcccac ggcggcgtgg
   226981 gtatgcgccg ctgtcctacc ggctctcgtc ccaccccgtc ccggccccac cggcatgact
   227041 tggagaacga gctacatggt ctgtgtgtgg atcttctggt gtgcgtcctt ttattagctc
   227101 tgctgctgtt ggagctcgtt cccatggaag ccgtgcgtca cccgctgctt ttctggcgac
   227161 gcgtggcgtt atcgccgtcc acttccaagg tggatcgcgc cgtcaagctg tgtcttcggc
   227221 gcatgctggg tctgccgccg ccaccgtcag tcgcaccacc tggggaaaag aaggagctac
   227281 cggctcaggc ggccttgtcg ccgccactga ccacctggtc actaccgccg tttccgtcca
   227341 cgcggatacc tgacagtccg ccgccaccgt accagcttcg tcacgccacg tcactagtga
   227401 cggtacccac gctgctgtta tatacgtcat ccgacatcgg tgacacagct tcagaaacaa
   227461 cgtgtgtggc gcacgctact tatggggaac ccccggagcc cgctcgatcg acggctacgg
   227521 ttcaggaatg tgccgttctt accgccccaa attgcggcat cgtcaacaac gacgccgcgg
   227581 tctctgaagg ccaagaccat ggagatgcgg ttcaccatag cctggatgtg gtttcccagt
   227641 gtgctgctga tactggggtt gttgacgcct ccgagtaacg gctgcactgt cgatgtcgga
   227701 cgaaacatgt ccattcgaga acagtgccgc cttcgaaacg gtgcgacgtt ttccaaggga
   227761 gacatcgaag gtaacttcag tgggcccgtc gtcgtggagt tggactacga agacgtcgat
   227821 attactggcg agcggcagcg acttcggttc catctcagcg gactcgggta tcctacaaag
   227881 gaaaatacaa gaaaagacaa tgaaagcgac gtcagcggtg gaattcgctg ggctctatat
   227941 atacaaaccg gtgacgccaa gtacggtatt cgtaaccagc atttgagtat acggttaatg
   228001 tatcctgggg aaaaaaatac gcaacagctg ttgggctctg atttcagttg cgaacgtcac
   228061 cggaaaccgt ccacgccgtt gggaaagaac gccgaagtgc ctcccgcgac ccgcacgtct
   228121 tctacataca gcgtcctcag cgcttttgta gtgtggatcg gatccggcct caatatcatc
   228181 tggtggaccg gcatcgtgct tctagcggcg gacgctctcg ggcttggcga gcgttggcta
   228241 aggttggcgc tgtctcaccg ggacaaacat cacgcatcgc ggaccgcgac gctccagtgt
   228301 caacgcgaca tgttacttcg gcaacgtcga cgggctcggc ggctgcacgc cgtttctgaa
   228361 ggcaaactgc aggaagagaa gaaacgacag tctgctttgg tctggaacgt tgaggcgcga
   228421 ccctttccgt ccacacatca gctgattgtg ctgccccctc ctgtagcgtc agctcctcct
   228481 gcggttccct cgcagccccc cgagtattcg tctgtgtttc cgcctgtata aaaataaaga
   228541 gacgagaggc tgatcgcggc cttcagcgtc tcatttgtct ttactctcca gtgcggtcgg
   228601 tgtctcgtcg gtgagacgag gccgccgccc gacaagttcg atctcatgtc gctcttggaa
   228661 cgcgaagaga gttggcgtcg cgtagtcgac tactcgcaca acctgtggtg tacgtgcggt
   228721 aactggcaaa gccacgttga gattcaggac gaggagccca actgcgagca gccggagccc
   228781 gcacactggc tggaatacgt ggcggtccag tggcaggccc gggttcgcga ttctcacgat
   228841 cgctggtgtc tctgcaacgc ctggcgtgat cacgccttgc gcggccgttg gggtacggcg
   228901 tattcctcgg gttcctcggc gtcttcctcc ggttttgtcg cggagagcaa gtttacctgg
   228961 tggaaacgac tgcgccacag tacccggcgc tggttgtttc gccgccggcg agctcgatac
   229021 actccgtcta actgtgggga aagtagcact agcagcggcc agagtagcgg tgacgagagt
   229081 aattgcagtc tacgcaccca cggcgtgtac acacggggtg aacaacacta atcgataagt
   229141 cgcgtgtagg cgactggcta catcaaccgg atatctgtgg ggatttaaaa agacgacccg
   229201 ttgtcatccg gcttagagca aaccgtcctt ttatcatctt ccatcgccat ggctatgtac
   229261 acatccgaat ccgaacgcga ctggcgtcgt gtaatccacg actcgcacgg cttgtggtgc
   229321 gactgcggcg actggcgaga gcacctctat tgtgtgtacg acagccattt tcagcgacga
   229381 cccacgacac gagccgaacg gagggccgcc aattggcggc gacagatgcg ggggttacac
   229441 cgtctgtggt gtttctgtca ggactggaag tgtcacgcgt tatacgccga gtgggacggt
   229501 aaagaatccg acgacgagtc gtcggcgtct tcctcaggtg aagcgccaga gcaacaggtc
   229561 cccgcttgga agaccgtgcg agccttctcg cgggcctacc atcaccgcat caaccggggt
   229621 ttgcggggca cgcccccacc acgcaacttg ccgggatacg agcacgcctc cgagggctgg
   229681 cggttttgca atcgacggga acggcgagag gacgatcttc gcacgcgggc tgagccggat
   229741 cgcgtggtgt tccagttagg gggagtaccg cctcgccgtc accgggaaac ttacgtgtaa
   229801 gaacacggcg tgataataaa caacatagcg taaatccccg tgtgatgtgt gtgattgacg
   229861 ttcaggaaac atgtccccat catcagcgtc acaactgacg tgggttggtt actgacgtgc
   229921 aggatgttac gcgagtcaga gaatcgcata agaacggggt ggtgagcggg ttcccacagg
   229981 agtctctggc gcaaaagcac catgagcctc aggttccccg agagggcggg ttacgagaaa
   230041 ctgggacacc gcccgcatgc caaacgcgtg cgggtgcatg acccgttggg attgacgcgg
   230101 tttatcatga ggcaactcat gatgtacccg ctggtgttgc cgtttacttt tccgttttac
   230161 gtgccgcggt cctagcacgt cagtggtgac gctgataatt gcaacatggc ccatgacgaa
   230221 cccgcttggg acgaacgtca ataccacgtc aaaccaccgt gacttggctg aacgttgaaa
   230281 cataaagcca aagcgccgtc ggcacttggc ttcagagcag cgcctcgggg cgatgcgacg
   230341 gcgatgaact tagagcaact catcaacgtc cttggtctgc tcgtctggat tgccgctcgt
   230401 gctgtcagcc gcgttggtcc gcatggctcc ggactcgttt atcgtgagct tcatgatttc
   230461 tacgggtatc tgcagctgga ccttctggga ccagtggtgg cggggaatcg ctcagtccgg
   230521 acctggagag agcaggcgga ccgagccaga gggaccttcg ctcggcgttc aggccttaat
   230581 actagccaca tcttacctgt cggcagcatg tatcggggct ccgacacctt atccgccggc
   230641 ttgtatcgtc ccgaagaaga ggtgttcctc ctcttgaacc gctgccatgg gccactgtca
   230701 acgccgaaaa acgcttgtct ggctgaggtc ggtgtcgcta atgccacttt tttgtctcgc
   230761 ttcaatgtcg gtgattttca cggagcgtca tgggaaaacg gtaccgctcc cgatggagag
   230821 cccggggtat gctgaaattc ttcttaaaat tacgtaaacg acgtcgtcca gtcgttgtgc
   230881 cgcgattcgt acggttcatc gtctacgtcg ttttgttcac cgtcgctgtg caacgtgtga
   230941 aacaagagcg taatgcgcac cttcggcggt atgaagaacg gttacggaaa gaccgcgcac
   231001 ggcgtcggca atcttttccg tgacttgggg cgatgggtcc gagctgcggt atgggtcacg
   231061 gcagcgtgtg tcttgctaac gaagatgccg atgtgtgact aaaaacgtcc cagccccaga
   231121 gcgatatgtt tcaataaaaa aaatatgtag tatcatatca tgcgtgtcct ggtttttcat
   231181 ttttggatat atgtatcgca taaagggtgg cgaggtgtga ggatgaaaca tatgcagata
   231241 cgcagttttg ttatccgaac gaaacccgtg taatgcgtac aacggtactt cagtatgaaa
   231301 gtcccgtggg gggggggggg ggcaaatagt cgcgtttgcc gttgggcgta cgctgcgttt
   231361 gtatttctgg ctataatatg tgcggtcatg tgtcgatgtt cctattggga agggtgtgac
   231421 tgtagggtgt ataaagtacg gtgggacgca gagggacatt gatagaaaca ggttgagcgc
   231481 tgtacgagtt tcacacgctg attcggcgcc aagaataaaa cagtggttat tcgtaaaagt
   231541 atgggggggg ggggatgttg tcgacggttg ttagatgcat tgcgtatctg tattagtagt
   231601 tttgcaagcc gtggtgcgtg ttattgtgac gtagcaatta tcgtattgtg catgtgtcgt
   231661 tcatcacaga gtttagtata ctaatatgaa gcgtcgcgag tattaaagca attggtgtct
   231721 ctgtgctagt ctaacaacac ctgtgtaatg cgtacaacca gaaaaaagac gcgaaagcaa
   231781 cgtgtatggg gggggggggg ggataatatt gctaatcatg cgtcttgcag tacagatagc
   231841 cgctgtatct tacgcgtatt gtcgcaatag ttccacatcg gtgtaattgg atgtctgtta
   231901 cttatcactg gcgtcgttat aacattgtaa aacataagtt ttcgaaacat aacgacagct
   231961 gcaaaagaaa accagtttat tgagcattgt aatggtagtg tgtggctata ttagaaaacg
   232021 tgacgcgtcg catgtcgcgg cacaatctgg cagcggggtc ggggtagggt acggtgggag
   232081 gcatgtacac agatggaaca aaagcagaag taacgtgaga cggagcatat agtccagtat
   232141 ccagcggttc ctgagtagca ccacccatca actgaatgcc ctcatgagta aaagtctgcg
   232201 ggcggcagcc cttggggacc gttggcatgg gacgatcaat ctccaaacca cagcgtaaca
   232261 ccgttttctt ccaacgtcgt tgatacacgt cgtttttacg gttactcccc agaacccaga
   232321 aagtctcgtc caagtcgtac caggaatctt ctccggggag acgcgacggt ttccaatcct
   232381 cgtcgtctcg tctcaaagca cgtcccaaac tggcttgagg agtcaacggt ggttctgtgg
   232441 gtcgggtgta gcgcgagtgt tttcccttca tgagcgatcc gtcctccttg cctttaggct
   232501 ttttggtctt tttgtgtatc atctggccgc cggcctccat aaccaccgtg gccaagtcca
   232561 gtcccagagc ttgagcgtcg gcgcggcgtc gggcgtcttg caggtagtct tccacatttg
   232621 cacagatggc cgggtgtttg gtggctaggg tgaggacctc agcctcgccg cgacccggac
   232681 gtagcaaaaa agctaactgc ccgtgcggct cgcgcgccca cagcgcggcg cgcgggtgca
   232741 ggtgcagcgc gtcccagcgc ggccgctccc actgctcgcg gtccagctcg ggcagcagcc
   232801 gccgcgcggc ctcggcggcg ggcgccgact cgcgccccag cgccagcgcg cccagcacgc
   232861 ccgcgcgcag aaagtgcgac agctccgccg ccagcgggta cacgtgtccg tccagcgggc
   232921 agtacccgaa cacggcgccc agctcgtcca gcaccaccac cagcatggcg cgcggcacgg
   232981 tgtccgacgc cgccggaccc accatcaccg tcggcgccgc cgccgcgtcc gccccgacca
   233041 ccgtgtgcgc ctccgcgttt ggcacgcaca ccgcgtgccc gccggcggag gtgccgtacg
   233101 gctgcggagg cacaggtaca gcggacccca cggctcccgc catcgcgcac ggcgcgtccc
   233161 cgccggcggc ctccgtctcc gtgccgctcg cccccgccag caacgtcgtc cccgtcgcca
   233221 tcgccgtcgt ccccgccgtc ggcgacgtcg tccccgccgc cgtccccgtc gccggccccg
   233281 ccgcgcagcc cagccaccgc gcgggcagca ccgcgcccag cgccagccag ccgcagcaca
   233341 gacgctggtt caggtgccga cgcacggccg tcagcagcga cgcggggtgc ggcgccgacg
   233401 cgaacggctc gtactgcgcc agctcctgcc acgcgcccag cagcaccatc ggctgcagtc
   233461 gcctgcccgg cgtctgcagt gccaccgtcg tgccggccca ccgccggcgc agctctcgtc
   233521 cgagcgccgt cgcctcctcg gcgcgcagca acgtctgtcg aagcgccggc tgaggcagca
   233581 gcgtcgcgcg cggggtgccc acgcccagcc ggttgcagcg gtacagccgc accacctcgc
   233641 ccgcgccgtg ccgaaaccac tcgtccgcgt cgcgcgccgc caggatcagc gtgttgttcg
   233701 ccaggtcgta cacgaacacg cggaacccgg cgcccagcgc caggtacagt ccgtcctgcg
   233761 cgcacagacc ctcgggatgg ccggccttgt cgcccaccgt cgggtcggcc gcggggtcta
   233821 cttcgtgcac cacggtcgcc accagcacga tccacgcgtc ccgcggcgac agctgacgca
   233881 ggtccgtcgc gcccacgccg ttcatctggc tgcgcggcgt cacccgcgcg tagaatccgt
   233941 acggccgtcc gagcggcagc agcgtgcccg cgtcgcgctg cgaccacttg cgcatggcgc
   234001 gggccgtgct gttggccaga aacgccgcgc gccacacggc gcccatggcc tggtattcca
   234061 gctccgtcag cgcctgccgc tccacgggaa tctgagacag caacaggcgc tccgggccgt
   234121 gccaaaagtt gctgttgttg ccgctacccg gaggggcgcc cggcggcccg cggggttcta
   234181 cccggtggac gccgtggccc ggagttgccg tacccgcagt actcgtacta gtccccgccg
   234241 ttgacggtac agaagaggaa caggaaccaa cccccgaagg cccgccggca ccgcgtccgc
   234301 gaccgagggg cggggggcgc ggcgacatgc cgttgcgctg ggccatggcc gccggacacc
   234361 tccgacgtcg agccgatgtc cactatatag caacacaacc cgcgtccgcg accacgccgt
   234421 ttacacacgc ggacggctcc gtggcccgtg tgccacgggc gacacgcatc tggcttttat
   234481 agccagcgac gtgaacggcg cgtgctagcg ccgccttggc gccgcgcagt ctaaagggct
   234541 gtgaaaaacc acccggcagc ccagccaccc gaaggaacac gcgcgacagg cccgcagcac
   234601 cggagcgcat acgcgcctcc cgagcgcgca accacctaag tggacgcccc acatccattc
   234661 cgggccgtgt gctgggtccc cgaggggcgg gggggtgttt ttagcggggg gggggtgaaa
   234721 tttggagttg cgtgtgtgga cggcgacggc gaatagttgc gtgtggtgcg gtggggacgg
   234781 cggtcgcgga cggcgaataa aagcgacgtg cggcgcgcac ggcgaaaagc agacgcgcgt
   234841 ctgtgtctgt ttaattcccc ggggaaaaga ggaagaagtc cccaggggac ggcagcgcgg
   234901 gtccctgggg acacacgaag agacaagacg cagaaaagag gaagtccccg gggaaaacgt
   234961 gcgaccgcac ccctgacaca ccccgccagc acacccccga cacacccggc acacgcccgc
   235021 gacacaccct gacacacccg gcacacgccc gcgacacacc cgcggcacac cctgacacac
   235081 ccgccacacc cggcacacac ccacccagcc gcgcccccga cacaccccga tcgccgccgg
   235141 tgcgggacag ggct
//