LOCUS       FM210562                 444 bp    DNA     linear   VRL 24-NOV-2009
DEFINITION  Human Adenovirus 22 fibershaft.
ACCESSION   FM210562
VERSION     FM210562.1
KEYWORDS    .
SOURCE      Human adenovirus 22
  ORGANISM  Human adenovirus 22
            Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D.
REFERENCE   1  (bases 1 to 444)
  AUTHORS   Darr S.
  JOURNAL   Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of
            Virology, Hannover Medical School, Carl-Neuberg-Strasse 1,
            Hannover, 30625, GERMANY.
REFERENCE   2
  AUTHORS   Darr S., Madisch I., Hofmayer S., Rehren F., Heim A.
  TITLE     Phylogeny and primary structure analysis of fiber shafts of all
            human adenovirus types for rational design of adenoviral
            gene-therapy vectors
  JOURNAL   J. Gen. Virol. 90(Pt 12), 2849-2854(2009).
   PUBMED   19656960
FEATURES             Location/Qualifiers
     source          1..444
                     /organism="Human adenovirus 22"
                     /lab_host="A549 Human lung carcinoma cell line"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:46924"
     CDS             <1..>444
                     /codon_start=1
                     /gene="fibershaft"
                     /product="fiber protein"
                     /db_xref="GOA:C8Z285"
                     /db_xref="InterPro:IPR000931"
                     /db_xref="InterPro:IPR000939"
                     /db_xref="InterPro:IPR009013"
                     /db_xref="UniProtKB/TrEMBL:C8Z285"
                     /protein_id="CAR66138.1"
                     /translation="GVLSLKLADPIAITNGDVSLKVGGGLTVEQDSGNLSVNPKAPLQ
                     VGTDKKLELALAPPFDVRDNKLAILVGDGLKVIDRSISDLPGLLNYLVVLTGKGIGNE
                     ELKNDDGSNKGVGLCVRIGEGGGLTFDDKGYLVAWNNKHDIRTLWT"
BASE COUNT          148 a           67 c          112 g          117 t
ORIGIN      
        1 ggggtcctgt cactcaaact ggctgaccca atcgccatca ctaatgggga tgtctcactc
       61 aaggtgggag ggggactaac tgtggaacaa gatagtggaa acctaagtgt aaaccctaag
      121 gctccattgc aagttggaac agacaaaaaa ctggaattgg ctttagcacc tccatttgat
      181 gtcagagata acaagctagc tattctagta ggagatggat taaaggtaat agatagatca
      241 atatctgatt tgccaggttt gttaaactat cttgtagttt tgactggcaa aggaattgga
      301 aatgaagaat taaaaaatga cgatggtagc aataaaggag tcggtttatg tgtgagaatt
      361 ggagaaggag gtggtttaac ttttgatgat aaaggttatt tagtagcatg gaacaataaa
      421 catgacatcc gcacactttg gaca
//