LOCUS FM210562 444 bp DNA linear VRL 24-NOV-2009 DEFINITION Human Adenovirus 22 fibershaft. ACCESSION FM210562 VERSION FM210562.1 KEYWORDS . SOURCE Human adenovirus 22 ORGANISM Human adenovirus 22 Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D. REFERENCE 1 (bases 1 to 444) AUTHORS Darr S. JOURNAL Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of Virology, Hannover Medical School, Carl-Neuberg-Strasse 1, Hannover, 30625, GERMANY. REFERENCE 2 AUTHORS Darr S., Madisch I., Hofmayer S., Rehren F., Heim A. TITLE Phylogeny and primary structure analysis of fiber shafts of all human adenovirus types for rational design of adenoviral gene-therapy vectors JOURNAL J. Gen. Virol. 90(Pt 12), 2849-2854(2009). PUBMED 19656960 FEATURES Location/Qualifiers source 1..444 /organism="Human adenovirus 22" /lab_host="A549 Human lung carcinoma cell line" /mol_type="genomic DNA" /db_xref="taxon:46924" CDS <1..>444 /codon_start=1 /gene="fibershaft" /product="fiber protein" /db_xref="GOA:C8Z285" /db_xref="InterPro:IPR000931" /db_xref="InterPro:IPR000939" /db_xref="InterPro:IPR009013" /db_xref="UniProtKB/TrEMBL:C8Z285" /protein_id="CAR66138.1" /translation="GVLSLKLADPIAITNGDVSLKVGGGLTVEQDSGNLSVNPKAPLQ VGTDKKLELALAPPFDVRDNKLAILVGDGLKVIDRSISDLPGLLNYLVVLTGKGIGNE ELKNDDGSNKGVGLCVRIGEGGGLTFDDKGYLVAWNNKHDIRTLWT" BASE COUNT 148 a 67 c 112 g 117 t ORIGIN 1 ggggtcctgt cactcaaact ggctgaccca atcgccatca ctaatgggga tgtctcactc 61 aaggtgggag ggggactaac tgtggaacaa gatagtggaa acctaagtgt aaaccctaag 121 gctccattgc aagttggaac agacaaaaaa ctggaattgg ctttagcacc tccatttgat 181 gtcagagata acaagctagc tattctagta ggagatggat taaaggtaat agatagatca 241 atatctgatt tgccaggttt gttaaactat cttgtagttt tgactggcaa aggaattgga 301 aatgaagaat taaaaaatga cgatggtagc aataaaggag tcggtttatg tgtgagaatt 361 ggagaaggag gtggtttaac ttttgatgat aaaggttatt tagtagcatg gaacaataaa 421 catgacatcc gcacactttg gaca //