LOCUS       FM210556                 428 bp    DNA     linear   VRL 24-NOV-2009
DEFINITION  Human Adenovirus 48 fibershaft.
ACCESSION   FM210556
VERSION     FM210556.1
KEYWORDS    .
SOURCE      Human adenovirus 48
  ORGANISM  Human adenovirus 48
            Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D.
REFERENCE   1  (bases 1 to 428)
  AUTHORS   Darr S.
  JOURNAL   Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of
            Virology, Hannover Medical School, Carl-Neuberg-Strasse 1,
            Hannover, 30625, GERMANY.
REFERENCE   2
  AUTHORS   Darr S., Madisch I., Hofmayer S., Rehren F., Heim A.
  TITLE     Phylogeny and primary structure analysis of fiber shafts of all
            human adenovirus types for rational design of adenoviral
            gene-therapy vectors
  JOURNAL   J. Gen. Virol. 90(Pt 12), 2849-2854(2009).
   PUBMED   19656960
FEATURES             Location/Qualifiers
     source          1..428
                     /organism="Human adenovirus 48"
                     /lab_host="A549 Human lung carcinoma cell line"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:39641"
     CDS             <1..>428
                     /codon_start=1
                     /gene="fibershaft"
                     /product="fiber protein"
                     /db_xref="GOA:C8Z279"
                     /db_xref="InterPro:IPR000931"
                     /db_xref="InterPro:IPR000939"
                     /db_xref="InterPro:IPR009013"
                     /db_xref="UniProtKB/TrEMBL:C8Z279"
                     /protein_id="CAR66132.1"
                     /translation="GVLSLKLADPITITNGNVSLKVGGGLTLQEGTGDLKVNAKSPLQ
                     VATNKQLEIALAKPFEEKDGKLALKIGHGLAVVDENHTHLQSLIGTLVILTGKGIGTG
                     RAESGGTIDVRLGSGGGLSFDKDGNLVAWNKDVDRRTLWTT"
BASE COUNT          136 a           76 c          113 g          103 t
ORIGIN      
        1 ggggtgctat cactcaaact ggctgaccca atcaccatca ccaatgggaa tgtctcactc
       61 aaggtgggag gggggctcac cttgcaagaa ggaactgggg acctaaaggt gaacgctaag
      121 tcccccttgc aagttgcaac taataaacag ttggagattg cacttgctaa gccatttgag
      181 gaaaaggatg gcaaacttgc tttaaaaatt ggccatggat tagccgttgt ggatgaaaat
      241 catactcact tacaatcact aataggtaca cttgttattt taactggcaa gggaattggt
      301 acaggtagag ctgaaagtgg aggaactata gatgtaagac ttggaagtgg aggaggtttg
      361 tcatttgata aagacggaaa cctagtagcc tggaacaaag atgttgatag gagaactctt
      421 tggacaac
//