LOCUS FM210556 428 bp DNA linear VRL 24-NOV-2009 DEFINITION Human Adenovirus 48 fibershaft. ACCESSION FM210556 VERSION FM210556.1 KEYWORDS . SOURCE Human adenovirus 48 ORGANISM Human adenovirus 48 Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D. REFERENCE 1 (bases 1 to 428) AUTHORS Darr S. JOURNAL Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of Virology, Hannover Medical School, Carl-Neuberg-Strasse 1, Hannover, 30625, GERMANY. REFERENCE 2 AUTHORS Darr S., Madisch I., Hofmayer S., Rehren F., Heim A. TITLE Phylogeny and primary structure analysis of fiber shafts of all human adenovirus types for rational design of adenoviral gene-therapy vectors JOURNAL J. Gen. Virol. 90(Pt 12), 2849-2854(2009). PUBMED 19656960 FEATURES Location/Qualifiers source 1..428 /organism="Human adenovirus 48" /lab_host="A549 Human lung carcinoma cell line" /mol_type="genomic DNA" /db_xref="taxon:39641" CDS <1..>428 /codon_start=1 /gene="fibershaft" /product="fiber protein" /db_xref="GOA:C8Z279" /db_xref="InterPro:IPR000931" /db_xref="InterPro:IPR000939" /db_xref="InterPro:IPR009013" /db_xref="UniProtKB/TrEMBL:C8Z279" /protein_id="CAR66132.1" /translation="GVLSLKLADPITITNGNVSLKVGGGLTLQEGTGDLKVNAKSPLQ VATNKQLEIALAKPFEEKDGKLALKIGHGLAVVDENHTHLQSLIGTLVILTGKGIGTG RAESGGTIDVRLGSGGGLSFDKDGNLVAWNKDVDRRTLWTT" BASE COUNT 136 a 76 c 113 g 103 t ORIGIN 1 ggggtgctat cactcaaact ggctgaccca atcaccatca ccaatgggaa tgtctcactc 61 aaggtgggag gggggctcac cttgcaagaa ggaactgggg acctaaaggt gaacgctaag 121 tcccccttgc aagttgcaac taataaacag ttggagattg cacttgctaa gccatttgag 181 gaaaaggatg gcaaacttgc tttaaaaatt ggccatggat tagccgttgt ggatgaaaat 241 catactcact tacaatcact aataggtaca cttgttattt taactggcaa gggaattggt 301 acaggtagag ctgaaagtgg aggaactata gatgtaagac ttggaagtgg aggaggtttg 361 tcatttgata aagacggaaa cctagtagcc tggaacaaag atgttgatag gagaactctt 421 tggacaac //