LOCUS FM210553 444 bp DNA linear VRL 24-NOV-2009 DEFINITION Human Adenovirus 44 fibershaft. ACCESSION FM210553 VERSION FM210553.1 KEYWORDS . SOURCE Human adenovirus 44 ORGANISM Human adenovirus 44 Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D. REFERENCE 1 (bases 1 to 444) AUTHORS Darr S. JOURNAL Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of Virology, Hannover Medical School, Carl-Neuberg-Strasse 1, Hannover, 30625, GERMANY. REFERENCE 2 AUTHORS Darr S., Madisch I., Hofmayer S., Rehren F., Heim A. TITLE Phylogeny and primary structure analysis of fiber shafts of all human adenovirus types for rational design of adenoviral gene-therapy vectors JOURNAL J. Gen. Virol. 90(Pt 12), 2849-2854(2009). PUBMED 19656960 FEATURES Location/Qualifiers source 1..444 /organism="Human adenovirus 44" /lab_host="A549 Human lung carcinoma cell line" /mol_type="genomic DNA" /db_xref="taxon:46939" CDS <1..>444 /codon_start=1 /gene="fibershaft" /product="fiber protein" /db_xref="GOA:C8Z276" /db_xref="InterPro:IPR000931" /db_xref="InterPro:IPR000939" /db_xref="InterPro:IPR009013" /db_xref="UniProtKB/TrEMBL:C8Z276" /protein_id="CAR66129.1" /translation="GVLSLKLADPITITNGNVSLKVGGGLTVQEGTGDLKVNAKSPLQ VGTNKQLEIALANPFEEKDGKLALKIGHGLTVVDENHTHLQSLIGTLVILTGKGIGNE ELKNDDGSNKGVGLCVRIGEGGGLTFDDKGYLVAWNNKHDIRTLWT" BASE COUNT 146 a 73 c 111 g 114 t ORIGIN 1 ggggtcctgt cactcaaact ggctgaccca atcaccatca ccaatgggaa tgtctcactc 61 aaggtgggag gggggctcac tgtgcaagaa ggaactgggg acctaaaggt gaacgctaag 121 tcccccttgc aagttggaac taataaacag ttggagattg cacttgctaa tccatttgag 181 gaaaaggatg gcaaacttgc tttaaaaatt ggacatggat taaccgttgt ggatgaaaat 241 catactcact tacaatcact aataggtaca cttgttattt taactggcaa gggaattggt 301 aatgaagaat taaaaaatga cgatggtagc aataaaggag tcggtttatg tgtgagaatt 361 ggagaaggag gtggtttaac ttttgatgat aaaggttatt tagtagcatg gaacaataaa 421 catgacatcc gcacactttg gaca //