LOCUS       FM210552                 423 bp    DNA     linear   VRL 24-NOV-2009
DEFINITION  Human Adenovirus 43 fibershaft.
ACCESSION   FM210552
VERSION     FM210552.1
KEYWORDS    .
SOURCE      Human adenovirus 43
  ORGANISM  Human adenovirus 43
            Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D.
REFERENCE   1  (bases 1 to 423)
  AUTHORS   Darr S.
  JOURNAL   Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of
            Virology, Hannover Medical School, Carl-Neuberg-Strasse 1,
            Hannover, 30625, GERMANY.
REFERENCE   2
  AUTHORS   Darr S., Madisch I., Hofmayer S., Rehren F., Heim A.
  TITLE     Phylogeny and primary structure analysis of fiber shafts of all
            human adenovirus types for rational design of adenoviral
            gene-therapy vectors
  JOURNAL   J. Gen. Virol. 90(Pt 12), 2849-2854(2009).
   PUBMED   19656960
FEATURES             Location/Qualifiers
     source          1..423
                     /organism="Human adenovirus 43"
                     /lab_host="A549 Human lung carcinoma cell line"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:46938"
     CDS             <1..>423
                     /codon_start=1
                     /gene="fibershaft"
                     /product="fiber protein"
                     /db_xref="GOA:C8Z275"
                     /db_xref="InterPro:IPR000931"
                     /db_xref="InterPro:IPR000939"
                     /db_xref="InterPro:IPR009013"
                     /db_xref="UniProtKB/TrEMBL:C8Z275"
                     /protein_id="CAR66128.1"
                     /translation="GVLSLKLADPITITNGDVSLKVGGGLTVEKESGNLTVNPKAPLQ
                     VAKGQLELAYDSPFDVKNNMLTLKAGHGLAVVTKDNTDLQPLMGTLVVLTGKGIGTGT
                     SAHGGTIDVRIGKNGSLAFDKDGDLVAWDKENDRRTLWT"
BASE COUNT          137 a           82 c          108 g           96 t
ORIGIN      
        1 ggggtcctgt cactcaaact ggctgaccca atcaccatca ctaatgggga tgtctcactt
       61 aaggtgggag gaggacttac tgtggaaaaa gagtctggaa acttaactgt gaaccctaag
      121 gcgcccttgc aagttgcaaa aggacaattg gaattagcat atgattctcc atttgatgtt
      181 aaaaacaaca tgcttactct taaagcagga cacggcttag cagtggtaac aaaagacaat
      241 actgatttac aaccactgat gggcacactt gttgtattaa ctggcaaagg catcggcact
      301 ggcacaagtg ctcacggtgg aaccatagat gtgagaatag gaaaaaacgg aagtctggca
      361 tttgacaaag atggagattt ggtggcctgg gataaggaaa atgacaggcg cactctatgg
      421 aca
//