LOCUS FM210552 423 bp DNA linear VRL 24-NOV-2009 DEFINITION Human Adenovirus 43 fibershaft. ACCESSION FM210552 VERSION FM210552.1 KEYWORDS . SOURCE Human adenovirus 43 ORGANISM Human adenovirus 43 Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D. REFERENCE 1 (bases 1 to 423) AUTHORS Darr S. JOURNAL Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of Virology, Hannover Medical School, Carl-Neuberg-Strasse 1, Hannover, 30625, GERMANY. REFERENCE 2 AUTHORS Darr S., Madisch I., Hofmayer S., Rehren F., Heim A. TITLE Phylogeny and primary structure analysis of fiber shafts of all human adenovirus types for rational design of adenoviral gene-therapy vectors JOURNAL J. Gen. Virol. 90(Pt 12), 2849-2854(2009). PUBMED 19656960 FEATURES Location/Qualifiers source 1..423 /organism="Human adenovirus 43" /lab_host="A549 Human lung carcinoma cell line" /mol_type="genomic DNA" /db_xref="taxon:46938" CDS <1..>423 /codon_start=1 /gene="fibershaft" /product="fiber protein" /db_xref="GOA:C8Z275" /db_xref="InterPro:IPR000931" /db_xref="InterPro:IPR000939" /db_xref="InterPro:IPR009013" /db_xref="UniProtKB/TrEMBL:C8Z275" /protein_id="CAR66128.1" /translation="GVLSLKLADPITITNGDVSLKVGGGLTVEKESGNLTVNPKAPLQ VAKGQLELAYDSPFDVKNNMLTLKAGHGLAVVTKDNTDLQPLMGTLVVLTGKGIGTGT SAHGGTIDVRIGKNGSLAFDKDGDLVAWDKENDRRTLWT" BASE COUNT 137 a 82 c 108 g 96 t ORIGIN 1 ggggtcctgt cactcaaact ggctgaccca atcaccatca ctaatgggga tgtctcactt 61 aaggtgggag gaggacttac tgtggaaaaa gagtctggaa acttaactgt gaaccctaag 121 gcgcccttgc aagttgcaaa aggacaattg gaattagcat atgattctcc atttgatgtt 181 aaaaacaaca tgcttactct taaagcagga cacggcttag cagtggtaac aaaagacaat 241 actgatttac aaccactgat gggcacactt gttgtattaa ctggcaaagg catcggcact 301 ggcacaagtg ctcacggtgg aaccatagat gtgagaatag gaaaaaacgg aagtctggca 361 tttgacaaag atggagattt ggtggcctgg gataaggaaa atgacaggcg cactctatgg 421 aca //