LOCUS       FM210550                 444 bp    DNA     linear   VRL 24-NOV-2009
DEFINITION  Human Adenovirus 39 fibershaft.
ACCESSION   FM210550
VERSION     FM210550.1
KEYWORDS    .
SOURCE      Human adenovirus 39
  ORGANISM  Human adenovirus 39
            Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D.
REFERENCE   1  (bases 1 to 444)
  AUTHORS   Darr S.
  JOURNAL   Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of
            Virology, Hannover Medical School, Carl-Neuberg-Strasse 1,
            Hannover, 30625, GERMANY.
REFERENCE   2
  AUTHORS   Darr S., Madisch I., Hofmayer S., Rehren F., Heim A.
  TITLE     Phylogeny and primary structure analysis of fiber shafts of all
            human adenovirus types for rational design of adenoviral
            gene-therapy vectors
  JOURNAL   J. Gen. Virol. 90(Pt 12), 2849-2854(2009).
   PUBMED   19656960
FEATURES             Location/Qualifiers
     source          1..444
                     /organism="Human adenovirus 39"
                     /lab_host="A549 Human lung carcinoma cell line"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:46935"
     CDS             <1..>444
                     /codon_start=1
                     /gene="fibershaft"
                     /product="fiber protein"
                     /db_xref="GOA:C8Z273"
                     /db_xref="InterPro:IPR000931"
                     /db_xref="InterPro:IPR000939"
                     /db_xref="InterPro:IPR009013"
                     /db_xref="UniProtKB/TrEMBL:C8Z273"
                     /protein_id="CAR66126.1"
                     /translation="GVLSLKLADPIAINNGNVSLKVGGGLTVEQDSGKLIVNPKVPLQ
                     VANDKLELSYADPFETSANKLSLKVGHGLKVLDQKNSGGLQDLIGKLVVLTGKGIGVE
                     DLKNDDGSSRGVGINVRLGTDGGLSFDRKGELVAWNRKDDRRTLWT"
BASE COUNT          143 a           62 c          120 g          119 t
ORIGIN      
        1 ggtgtcctgt cactcaaact ggctgaccca atagccatca acaatggaaa tgtctcactc
       61 aaggtgggag gggggctcac tgtggaacaa gatagtggaa agctaattgt gaatcctaag
      121 gttcccttgc aagttgcaaa tgacaaatta gagctttctt atgcagatcc atttgaaact
      181 agtgctaata aacttagttt aaaagtaggg catggactaa aagtgttgga tcagaaaaat
      241 tctggaggat tgcaagattt aattggcaaa cttgtggttt taactggaaa aggaataggt
      301 gttgaagatt tgaaaaacga tgatggtagt agcagaggag ttggtataaa tgtgaggttg
      361 ggtaccgatg gaggtctgtc ctttgatagg aaaggtgaat tagtcgcttg gaacagaaaa
      421 gatgatagac gtaccctttg gaca
//