LOCUS FM210550 444 bp DNA linear VRL 24-NOV-2009 DEFINITION Human Adenovirus 39 fibershaft. ACCESSION FM210550 VERSION FM210550.1 KEYWORDS . SOURCE Human adenovirus 39 ORGANISM Human adenovirus 39 Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D. REFERENCE 1 (bases 1 to 444) AUTHORS Darr S. JOURNAL Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of Virology, Hannover Medical School, Carl-Neuberg-Strasse 1, Hannover, 30625, GERMANY. REFERENCE 2 AUTHORS Darr S., Madisch I., Hofmayer S., Rehren F., Heim A. TITLE Phylogeny and primary structure analysis of fiber shafts of all human adenovirus types for rational design of adenoviral gene-therapy vectors JOURNAL J. Gen. Virol. 90(Pt 12), 2849-2854(2009). PUBMED 19656960 FEATURES Location/Qualifiers source 1..444 /organism="Human adenovirus 39" /lab_host="A549 Human lung carcinoma cell line" /mol_type="genomic DNA" /db_xref="taxon:46935" CDS <1..>444 /codon_start=1 /gene="fibershaft" /product="fiber protein" /db_xref="GOA:C8Z273" /db_xref="InterPro:IPR000931" /db_xref="InterPro:IPR000939" /db_xref="InterPro:IPR009013" /db_xref="UniProtKB/TrEMBL:C8Z273" /protein_id="CAR66126.1" /translation="GVLSLKLADPIAINNGNVSLKVGGGLTVEQDSGKLIVNPKVPLQ VANDKLELSYADPFETSANKLSLKVGHGLKVLDQKNSGGLQDLIGKLVVLTGKGIGVE DLKNDDGSSRGVGINVRLGTDGGLSFDRKGELVAWNRKDDRRTLWT" BASE COUNT 143 a 62 c 120 g 119 t ORIGIN 1 ggtgtcctgt cactcaaact ggctgaccca atagccatca acaatggaaa tgtctcactc 61 aaggtgggag gggggctcac tgtggaacaa gatagtggaa agctaattgt gaatcctaag 121 gttcccttgc aagttgcaaa tgacaaatta gagctttctt atgcagatcc atttgaaact 181 agtgctaata aacttagttt aaaagtaggg catggactaa aagtgttgga tcagaaaaat 241 tctggaggat tgcaagattt aattggcaaa cttgtggttt taactggaaa aggaataggt 301 gttgaagatt tgaaaaacga tgatggtagt agcagaggag ttggtataaa tgtgaggttg 361 ggtaccgatg gaggtctgtc ctttgatagg aaaggtgaat tagtcgcttg gaacagaaaa 421 gatgatagac gtaccctttg gaca //