LOCUS       FM210546                 444 bp    DNA     linear   VRL 24-NOV-2009
DEFINITION  Human Adenovirus 32 fibershaft.
ACCESSION   FM210546
VERSION     FM210546.1
KEYWORDS    .
SOURCE      Human adenovirus 32
  ORGANISM  Human adenovirus 32
            Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D.
REFERENCE   1  (bases 1 to 444)
  AUTHORS   Darr S.
  JOURNAL   Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of
            Virology, Hannover Medical School, Carl-Neuberg-Strasse 1,
            Hannover, 30625, GERMANY.
REFERENCE   2
  AUTHORS   Darr S., Madisch I., Hofmayer S., Rehren F., Heim A.
  TITLE     Phylogeny and primary structure analysis of fiber shafts of all
            human adenovirus types for rational design of adenoviral
            gene-therapy vectors
  JOURNAL   J. Gen. Virol. 90(Pt 12), 2849-2854(2009).
   PUBMED   19656960
FEATURES             Location/Qualifiers
     source          1..444
                     /organism="Human adenovirus 32"
                     /lab_host="A549 Human lung carcinoma cell line"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:46933"
     CDS             <1..>444
                     /codon_start=1
                     /gene="fibershaft"
                     /product="fiber protein"
                     /db_xref="GOA:C8Z269"
                     /db_xref="InterPro:IPR000931"
                     /db_xref="InterPro:IPR000939"
                     /db_xref="InterPro:IPR009013"
                     /db_xref="UniProtKB/TrEMBL:C8Z269"
                     /protein_id="CAR66122.1"
                     /translation="GVLSLKLADPITIANGNVSLKVGGGLTLEQDSGKLIVNPKAPLQ
                     VANDKLELSYADPFETSANKLSLKVGHGLKVLDEKNAGGLKDLIGTLVVLTGKGIGVE
                     ELKNADNTNRGVGINVRLGKDGGLSFDKKGDLVAWNKHVDRRTLWT"
BASE COUNT          148 a           66 c          114 g          116 t
ORIGIN      
        1 ggtgtcctgt cactcaaact ggctgaccca atcaccatcg ccaatgggaa tgtttcactc
       61 aaggtgggag ggggactcac tctggaacaa gatagtggaa agctaattgt gaatcctaag
      121 gctcccttgc aagttgcaaa tgacaaatta gagctttctt acgcagatcc atttgaaact
      181 agtgctaata aacttagttt aaaagtaggg catggactaa aagtgttgga tgagaaaaat
      241 gctggaggat tgaaagattt aattggcaca cttgtagttt taactggaaa aggaataggc
      301 gttgaagagt taaaaaacgc tgataatact aataggggag ttggaattaa tgtaagactg
      361 ggtaaagatg gaggtttgtc ctttgataaa aaaggcgact tagtagcttg gaataagcat
      421 gtggacagac gcactttatg gaca
//