LOCUS FM210546 444 bp DNA linear VRL 24-NOV-2009 DEFINITION Human Adenovirus 32 fibershaft. ACCESSION FM210546 VERSION FM210546.1 KEYWORDS . SOURCE Human adenovirus 32 ORGANISM Human adenovirus 32 Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D. REFERENCE 1 (bases 1 to 444) AUTHORS Darr S. JOURNAL Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of Virology, Hannover Medical School, Carl-Neuberg-Strasse 1, Hannover, 30625, GERMANY. REFERENCE 2 AUTHORS Darr S., Madisch I., Hofmayer S., Rehren F., Heim A. TITLE Phylogeny and primary structure analysis of fiber shafts of all human adenovirus types for rational design of adenoviral gene-therapy vectors JOURNAL J. Gen. Virol. 90(Pt 12), 2849-2854(2009). PUBMED 19656960 FEATURES Location/Qualifiers source 1..444 /organism="Human adenovirus 32" /lab_host="A549 Human lung carcinoma cell line" /mol_type="genomic DNA" /db_xref="taxon:46933" CDS <1..>444 /codon_start=1 /gene="fibershaft" /product="fiber protein" /db_xref="GOA:C8Z269" /db_xref="InterPro:IPR000931" /db_xref="InterPro:IPR000939" /db_xref="InterPro:IPR009013" /db_xref="UniProtKB/TrEMBL:C8Z269" /protein_id="CAR66122.1" /translation="GVLSLKLADPITIANGNVSLKVGGGLTLEQDSGKLIVNPKAPLQ VANDKLELSYADPFETSANKLSLKVGHGLKVLDEKNAGGLKDLIGTLVVLTGKGIGVE ELKNADNTNRGVGINVRLGKDGGLSFDKKGDLVAWNKHVDRRTLWT" BASE COUNT 148 a 66 c 114 g 116 t ORIGIN 1 ggtgtcctgt cactcaaact ggctgaccca atcaccatcg ccaatgggaa tgtttcactc 61 aaggtgggag ggggactcac tctggaacaa gatagtggaa agctaattgt gaatcctaag 121 gctcccttgc aagttgcaaa tgacaaatta gagctttctt acgcagatcc atttgaaact 181 agtgctaata aacttagttt aaaagtaggg catggactaa aagtgttgga tgagaaaaat 241 gctggaggat tgaaagattt aattggcaca cttgtagttt taactggaaa aggaataggc 301 gttgaagagt taaaaaacgc tgataatact aataggggag ttggaattaa tgtaagactg 361 ggtaaagatg gaggtttgtc ctttgataaa aaaggcgact tagtagcttg gaataagcat 421 gtggacagac gcactttatg gaca //