LOCUS       FM210543                 444 bp    DNA     linear   VRL 24-NOV-2009
DEFINITION  Human Adenovirus 26 fibershaft.
ACCESSION   FM210543
VERSION     FM210543.1
KEYWORDS    .
SOURCE      Human adenovirus 26
  ORGANISM  Human adenovirus 26
            Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D.
REFERENCE   1  (bases 1 to 444)
  AUTHORS   Darr S.
  JOURNAL   Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of
            Virology, Hannover Medical School, Carl-Neuberg-Strasse 1,
            Hannover, 30625, GERMANY.
REFERENCE   2
  AUTHORS   Darr S., Madisch I., Hofmayer S., Rehren F., Heim A.
  TITLE     Phylogeny and primary structure analysis of fiber shafts of all
            human adenovirus types for rational design of adenoviral
            gene-therapy vectors
  JOURNAL   J. Gen. Virol. 90(Pt 12), 2849-2854(2009).
   PUBMED   19656960
FEATURES             Location/Qualifiers
     source          1..444
                     /organism="Human adenovirus 26"
                     /lab_host="A549 Human lung carcinoma cell line"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:46928"
     CDS             <1..>444
                     /codon_start=1
                     /gene="fibershaft"
                     /product="fiber protein"
                     /db_xref="GOA:C8Z266"
                     /db_xref="InterPro:IPR000931"
                     /db_xref="InterPro:IPR000939"
                     /db_xref="InterPro:IPR009013"
                     /db_xref="UniProtKB/TrEMBL:C8Z266"
                     /protein_id="CAR66119.1"
                     /translation="GVLSLKLADPITISNGDVSLKVGGGLTVEQDSGNLSVNPKAPLQ
                     VGTDKKLELALAPPFNVKDNKLDLLVGDGLKVIDKSISELPGLLNYLVVLTGKGIGNE
                     ELKNDDGSNKGVGLCVRIGEGGGLTFDDKGYLVAWNKKHDIRTLWT"
BASE COUNT          152 a           64 c          111 g          117 t
ORIGIN      
        1 ggtgtgctgt cactcaaatt ggctgaccca atcactatca gtaatggcga tgtctcactc
       61 aaggtgggag ggggactcac tgtggaacaa gatagtggaa acctaagtgt gaaccctaag
      121 gctccattgc aagttggaac agacaaaaaa ctggaattgg ctttagcacc tccatttaat
      181 gttaaagata acaagctaga tctgctagta ggagatggat taaaggtaat agataaatca
      241 atatctgaat tgccaggatt gttaaactat cttgtagttt tgactggcaa aggaattgga
      301 aatgaagaat taaaaaatga cgatggtagc aataaaggag tcggtttatg tgtgagaatt
      361 ggagaaggag gtggtttaac ttttgatgat aaaggttatt tagtagcatg gaacaagaaa
      421 catgacatcc gcacactttg gaca
//