LOCUS FM210543 444 bp DNA linear VRL 24-NOV-2009 DEFINITION Human Adenovirus 26 fibershaft. ACCESSION FM210543 VERSION FM210543.1 KEYWORDS . SOURCE Human adenovirus 26 ORGANISM Human adenovirus 26 Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D. REFERENCE 1 (bases 1 to 444) AUTHORS Darr S. JOURNAL Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of Virology, Hannover Medical School, Carl-Neuberg-Strasse 1, Hannover, 30625, GERMANY. REFERENCE 2 AUTHORS Darr S., Madisch I., Hofmayer S., Rehren F., Heim A. TITLE Phylogeny and primary structure analysis of fiber shafts of all human adenovirus types for rational design of adenoviral gene-therapy vectors JOURNAL J. Gen. Virol. 90(Pt 12), 2849-2854(2009). PUBMED 19656960 FEATURES Location/Qualifiers source 1..444 /organism="Human adenovirus 26" /lab_host="A549 Human lung carcinoma cell line" /mol_type="genomic DNA" /db_xref="taxon:46928" CDS <1..>444 /codon_start=1 /gene="fibershaft" /product="fiber protein" /db_xref="GOA:C8Z266" /db_xref="InterPro:IPR000931" /db_xref="InterPro:IPR000939" /db_xref="InterPro:IPR009013" /db_xref="UniProtKB/TrEMBL:C8Z266" /protein_id="CAR66119.1" /translation="GVLSLKLADPITISNGDVSLKVGGGLTVEQDSGNLSVNPKAPLQ VGTDKKLELALAPPFNVKDNKLDLLVGDGLKVIDKSISELPGLLNYLVVLTGKGIGNE ELKNDDGSNKGVGLCVRIGEGGGLTFDDKGYLVAWNKKHDIRTLWT" BASE COUNT 152 a 64 c 111 g 117 t ORIGIN 1 ggtgtgctgt cactcaaatt ggctgaccca atcactatca gtaatggcga tgtctcactc 61 aaggtgggag ggggactcac tgtggaacaa gatagtggaa acctaagtgt gaaccctaag 121 gctccattgc aagttggaac agacaaaaaa ctggaattgg ctttagcacc tccatttaat 181 gttaaagata acaagctaga tctgctagta ggagatggat taaaggtaat agataaatca 241 atatctgaat tgccaggatt gttaaactat cttgtagttt tgactggcaa aggaattgga 301 aatgaagaat taaaaaatga cgatggtagc aataaaggag tcggtttatg tgtgagaatt 361 ggagaaggag gtggtttaac ttttgatgat aaaggttatt tagtagcatg gaacaagaaa 421 catgacatcc gcacactttg gaca //