LOCUS FM210541 441 bp DNA linear VRL 24-NOV-2009 DEFINITION Human Adenovirus 24 fibershaft. ACCESSION FM210541 VERSION FM210541.1 KEYWORDS . SOURCE Human adenovirus 24 ORGANISM Human adenovirus 24 Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D. REFERENCE 1 (bases 1 to 441) AUTHORS Darr S. JOURNAL Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of Virology, Hannover Medical School, Carl-Neuberg-Strasse 1, Hannover, 30625, GERMANY. REFERENCE 2 AUTHORS Darr S., Madisch I., Hofmayer S., Rehren F., Heim A. TITLE Phylogeny and primary structure analysis of fiber shafts of all human adenovirus types for rational design of adenoviral gene-therapy vectors JOURNAL J. Gen. Virol. 90(Pt 12), 2849-2854(2009). PUBMED 19656960 FEATURES Location/Qualifiers source 1..441 /organism="Human adenovirus 24" /lab_host="A549 Human lung carcinoma cell line" /mol_type="genomic DNA" /db_xref="taxon:46926" CDS <1..>441 /codon_start=1 /gene="fibershaft" /product="fiber protein" /db_xref="GOA:C8Z264" /db_xref="InterPro:IPR000931" /db_xref="InterPro:IPR000939" /db_xref="InterPro:IPR009013" /db_xref="UniProtKB/TrEMBL:C8Z264" /protein_id="CAR66117.1" /translation="GVLSLKLADPIAITNGDVSLKVGGGLTVEKDSGNLKVNPKAPLQ VTTDKQLEIALAYPFEVSNGKLGIKAGHGLKVIDKIAGLEGLAGTLVVLTGKGIGTEN LENSDGSSRGVGINVRLAKDGGLSFDKKGDLVAWNKHDDRRTLWT" BASE COUNT 137 a 68 c 119 g 117 t ORIGIN 1 ggggtcctgt cactcaaact ggctgaccca atcgccatca ccaatgggga tgtttcactc 61 aaggtgggag ggggtcttac tgttgaaaaa gatagtggaa atctaaaggt gaaccctaag 121 gctcccttgc aagttacaac tgataaacag ttggaaattg cactggctta tccatttgaa 181 gtcagtaatg gcaagcttgg cataaaagca ggtcatggat tgaaagtcat tgacaaaatt 241 gctggtttgg aaggtttggc aggtacgctt gtagttttga ctggaaaagg aataggtact 301 gaaaatcttg aaaacagtga tgggtcaagt agaggagttg gtataaacgt aagacttgct 361 aaagatggag gtctgtcttt tgataaaaag ggtgatttag ttgcttggaa taaacatgat 421 gacagacgca ctctatggac a //