LOCUS       FM210541                 441 bp    DNA     linear   VRL 24-NOV-2009
DEFINITION  Human Adenovirus 24 fibershaft.
ACCESSION   FM210541
VERSION     FM210541.1
KEYWORDS    .
SOURCE      Human adenovirus 24
  ORGANISM  Human adenovirus 24
            Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D.
REFERENCE   1  (bases 1 to 441)
  AUTHORS   Darr S.
  JOURNAL   Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of
            Virology, Hannover Medical School, Carl-Neuberg-Strasse 1,
            Hannover, 30625, GERMANY.
REFERENCE   2
  AUTHORS   Darr S., Madisch I., Hofmayer S., Rehren F., Heim A.
  TITLE     Phylogeny and primary structure analysis of fiber shafts of all
            human adenovirus types for rational design of adenoviral
            gene-therapy vectors
  JOURNAL   J. Gen. Virol. 90(Pt 12), 2849-2854(2009).
   PUBMED   19656960
FEATURES             Location/Qualifiers
     source          1..441
                     /organism="Human adenovirus 24"
                     /lab_host="A549 Human lung carcinoma cell line"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:46926"
     CDS             <1..>441
                     /codon_start=1
                     /gene="fibershaft"
                     /product="fiber protein"
                     /db_xref="GOA:C8Z264"
                     /db_xref="InterPro:IPR000931"
                     /db_xref="InterPro:IPR000939"
                     /db_xref="InterPro:IPR009013"
                     /db_xref="UniProtKB/TrEMBL:C8Z264"
                     /protein_id="CAR66117.1"
                     /translation="GVLSLKLADPIAITNGDVSLKVGGGLTVEKDSGNLKVNPKAPLQ
                     VTTDKQLEIALAYPFEVSNGKLGIKAGHGLKVIDKIAGLEGLAGTLVVLTGKGIGTEN
                     LENSDGSSRGVGINVRLAKDGGLSFDKKGDLVAWNKHDDRRTLWT"
BASE COUNT          137 a           68 c          119 g          117 t
ORIGIN      
        1 ggggtcctgt cactcaaact ggctgaccca atcgccatca ccaatgggga tgtttcactc
       61 aaggtgggag ggggtcttac tgttgaaaaa gatagtggaa atctaaaggt gaaccctaag
      121 gctcccttgc aagttacaac tgataaacag ttggaaattg cactggctta tccatttgaa
      181 gtcagtaatg gcaagcttgg cataaaagca ggtcatggat tgaaagtcat tgacaaaatt
      241 gctggtttgg aaggtttggc aggtacgctt gtagttttga ctggaaaagg aataggtact
      301 gaaaatcttg aaaacagtga tgggtcaagt agaggagttg gtataaacgt aagacttgct
      361 aaagatggag gtctgtcttt tgataaaaag ggtgatttag ttgcttggaa taaacatgat
      421 gacagacgca ctctatggac a
//