LOCUS FM210540 444 bp DNA linear VRL 24-NOV-2009 DEFINITION Human Adenovirus 23 fibershaft. ACCESSION FM210540 VERSION FM210540.1 KEYWORDS . SOURCE Human adenovirus 23 ORGANISM Human adenovirus 23 Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D. REFERENCE 1 (bases 1 to 444) AUTHORS Darr S. JOURNAL Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of Virology, Hannover Medical School, Carl-Neuberg-Strasse 1, Hannover, 30625, GERMANY. REFERENCE 2 AUTHORS Darr S., Madisch I., Hofmayer S., Rehren F., Heim A. TITLE Phylogeny and primary structure analysis of fiber shafts of all human adenovirus types for rational design of adenoviral gene-therapy vectors JOURNAL J. Gen. Virol. 90(Pt 12), 2849-2854(2009). PUBMED 19656960 FEATURES Location/Qualifiers source 1..444 /organism="Human adenovirus 23" /lab_host="A549 Human lung carcinoma cell line" /mol_type="genomic DNA" /db_xref="taxon:46925" CDS <1..>444 /codon_start=1 /gene="fibershaft" /product="fiber protein" /db_xref="GOA:C8Z263" /db_xref="InterPro:IPR000931" /db_xref="InterPro:IPR000939" /db_xref="InterPro:IPR009013" /db_xref="UniProtKB/TrEMBL:C8Z263" /protein_id="CAR66116.1" /translation="GVLSLKLADPIAIVNGNVSLKVGGGITVEQDSGQLIANPKAPLQ VANDKLELSYAYPFETSANKLSLKVGQGLKVLDEKDSGGLQNLLGKLVVLTGKGIGVE ELKNPDNTNRGVGINVRLGKDGGLSFNKNGELVAWNKHNDTRTLWT" BASE COUNT 150 a 65 c 109 g 120 t ORIGIN 1 ggtgtccttt cgctaaaact ggctgatcca atcgccattg tcaatgggaa tgtttcactc 61 aaggtgggag ggggaatcac tgtggaacaa gatagtggac agctaattgc gaatcctaag 121 gctcccttgc aagttgcaaa tgacaaatta gagctttctt atgcatatcc atttgaaact 181 agtgctaata aacttagttt aaaagtaggg caaggactaa aagtgttgga tgaaaaagat 241 tctggaggat tgcaaaattt acttggcaaa cttgtagttt taactggaaa aggaataggt 301 gttgaagagt taaaaaaccc tgataatact aataggggag ttggaattaa tgtaagactg 361 ggcaaagatg gaggtttgtc ctttaataaa aatggtgagt tagtagcgtg gaacaaacac 421 aatgacacac gcactctttg gaca //