LOCUS       FM162591             5064808 bp    DNA     circular BCT 27-FEB-2015
DEFINITION  Photorhabdus asymbiotica ATCC43949 complete genome.
ACCESSION   FM162591
VERSION     FM162591.1
DBLINK      BioProject:PRJEA30577
            BioSample:SAMEA2272210
KEYWORDS    complete genome.
SOURCE      Photorhabdus asymbiotica
  ORGANISM  Photorhabdus asymbiotica
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Morganellaceae; Photorhabdus.
REFERENCE   1  (bases 1 to 5064808)
  AUTHORS   Crossman L.C.
  JOURNAL   Submitted (21-MAY-2008) to the INSDC. Crossman L.C., Pathogen
            Sequencing Unit, The Wellcome Trust Sanger Institute, Hinxton,
            Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM.
REFERENCE   2
  AUTHORS   Wilkinson P., Waterfield N.R., Crossman L., Corton C.,
            Sanchez-Contreras M., Vlisidou I., Barron A., Bignell A., Clark L.,
            Doggett J., Ormond D., Mayho M., Bason N., Smith F., Simmonds M.,
            Arrowsmith C., Churcher C., Harris D., Thompson N.R., Quail M.,
            Parkhill J., Ffrench-Constant R.H.
  TITLE     Comparative genomics of the emerging human pathogen Photorhabdus
            asymbiotica with the insect pathogen Photorhabdus luminescens
  JOURNAL   BMC Genomics 10(1), 302-302(2009).
   PUBMED   19583835
FEATURES             Location/Qualifiers
     source          1..5064808
                     /organism="Photorhabdus asymbiotica"
                     /isolate="ATCC43949"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:291112"
     CDS             133..1452
                     /transl_table=11
                     /gene="dnaA"
                     /locus_tag="PAU_00001"
                     /old_locus_tag="PAT2033"
                     /product="chromosomal replication initiator protein dnaA"
                     /db_xref="EnsemblGenomes-Gn:PAU_00001"
                     /db_xref="EnsemblGenomes-Tr:CAQ82094"
                     /db_xref="GOA:C7BTV9"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010921"
                     /db_xref="InterPro:IPR013159"
                     /db_xref="InterPro:IPR013317"
                     /db_xref="InterPro:IPR018312"
                     /db_xref="InterPro:IPR020591"
                     /db_xref="InterPro:IPR024633"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C7BTV9"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82094.1"
                     /translation="MWIRPLQAELSGNTLALYAPNRFVLDWVREKYINNINGLLNDFC
                     GAEVPLLRFEVGNKPISQNDSPPQRVVAHAPVTPAPQNTSVRPSWDNTAVQPELSYRS
                     NVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNS
                     IMARKANAKVVYMHSERFVQDMVKALQNNAIEDFKRYYRSVDALLIDDIQFFANKERS
                     QEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVA
                     ILMKKADENEIQLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVREA
                     LRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNH
                     SLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS"
     misc_feature    442..1098
                     /note="HMMPfam hit to PF00308, Bacterial dnaA protein,
                     score 4.1e-151"
                     /inference="protein motif:Pfam:PF00308"
     misc_feature    538..1146
                     /note="HMMSmart hit to SM00382, no description, score
                     2.4e-07"
                     /inference="protein motif:Smart:SM00382"
     misc_feature    1171..1380
                     /note="HMMPfam hit to PF08299, Bacterial dnaA protein
                     helix-turn-helix, score 1.9e-48"
                     /inference="protein motif:Pfam:PF08299"
     CDS             1457..2557
                     /transl_table=11
                     /gene="dnaN"
                     /locus_tag="PAU_00002"
                     /old_locus_tag="PAT2034"
                     /product="DNA polymerase III subunit beta"
                     /EC_number="2.7.7.7"
                     /db_xref="EnsemblGenomes-Gn:PAU_00002"
                     /db_xref="EnsemblGenomes-Tr:CAQ82095"
                     /db_xref="GOA:C7BTW0"
                     /db_xref="InterPro:IPR001001"
                     /db_xref="InterPro:IPR022634"
                     /db_xref="InterPro:IPR022635"
                     /db_xref="InterPro:IPR022637"
                     /db_xref="UniProtKB/TrEMBL:C7BTW0"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82095.1"
                     /translation="MKFIIEREQLLKPLQQVSSPLGGRPTLPILGNLLLQVTESSLLL
                     TGTDLEMEMMARVTLSLPHEEGATTVPARKFFDIWRGLPDGAEISVELDGDRLLVRSG
                     RSRFSLSTLPAADFPNLDDWQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLF
                     ETEGEELRTVATDGHRLAVCSMGIGQNLPSHSVIVPRKGVIELMRLLDGGDTPLQLQI
                     GSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEASCDMLKQAFSRAAILSNE
                     KFRGVRLYFSKNQLKITANNPEQEEAEEIVDVSYQGTEMEIGFNVSYVLDVLNTLRCE
                     EVRLLLTDAISSVQIEDCASHNAAYVVMPMRL"
     misc_feature    1457..1816
                     /note="HMMPfam hit to PF00712, DNA polymerase III beta
                     subunit, N-te, score 1.3e-63"
                     /inference="protein motif:Pfam:PF00712"
     misc_feature    1505..2542
                     /note="HMMSmart hit to SM00480, no description, score
                     5e-161"
                     /inference="protein motif:Smart:SM00480"
     misc_feature    1841..2185
                     /note="HMMPfam hit to PF02767, DNA polymerase III beta
                     subunit, cent, score 1.1e-65"
                     /inference="protein motif:Pfam:PF02767"
     misc_feature    2189..2551
                     /note="HMMPfam hit to PF02768, DNA polymerase III beta
                     subunit, C-te, score 2.4e-60"
                     /inference="protein motif:Pfam:PF02768"
     CDS             2579..3670
                     /transl_table=11
                     /gene="recF"
                     /locus_tag="PAU_00003"
                     /old_locus_tag="PAT2035"
                     /product="dna replication and repair protein recf"
                     /db_xref="EnsemblGenomes-Gn:PAU_00003"
                     /db_xref="EnsemblGenomes-Tr:CAQ82096"
                     /db_xref="GOA:C7BTW1"
                     /db_xref="InterPro:IPR001238"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR018078"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C7BTW1"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82096.1"
                     /translation="MTLTRLFIRDFRNIADADLPLATGFNFLVGPNGSGKTSVLEAIY
                     TLGHGRSFRSIQSGRVIRHNCDEFVLHGRLEQRENARESSIGLSKNRNGDSKVRIDGS
                     DGGKIAELAKMLPMQLITPEGFTLLNGGPKYRRAFIDWGCFHNDPRFFSAWVNLKRLL
                     KQRNAALRQVTHYSQIRPWDQELAPLANQINQWRTEYVTNIIQGIADTCKQFLPEFIL
                     RFSFQQGWDKESDYAELLERQFERDRALTYTASGPHKADLRIRVEGTPVEDMLSRGQL
                     KLLMCALRLAQGEYFTRQNGQQCLYLLDDFASELDAGRRQLLAERLKSTQAQVFVSAI
                     SPGQVTDMLDGNSRMFRVENGKIEIQPQD"
     misc_feature    2582..3652
                     /note="HMMPfam hit to PF02463, RecF/RecN/SMC N terminal
                     domain, score 4.1e-55"
                     /inference="protein motif:Pfam:PF02463"
     CDS             3687..6104
                     /transl_table=11
                     /gene="gyrB"
                     /locus_tag="PAU_00004"
                     /old_locus_tag="PAT2036"
                     /product="DNA gyrase subunit B"
                     /EC_number="5.99.1.-"
                     /db_xref="EnsemblGenomes-Gn:PAU_00004"
                     /db_xref="EnsemblGenomes-Tr:CAQ82097"
                     /db_xref="GOA:C7BTW2"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR011557"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="InterPro:IPR013759"
                     /db_xref="InterPro:IPR013760"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018522"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR034160"
                     /db_xref="UniProtKB/TrEMBL:C7BTW2"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82097.1"
                     /translation="MMSNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
                     VDNAIDEALAGHCNEVIVTIHADNSVSVQDDGRGIPTGIHEEEGVSAAEVIMTVLHAG
                     GKFDDNSYKVSGGLHGVGVSVVNALSEKLELVIRRDGKVHEQTYHLGVPQSPLKIVGE
                     TEQTGTRVRFWPSMDTFRNNTEFQHDILAKRLRELSFLNSGVSIRLIDKRTNTEDHFH
                     YEGGIKAFVEFLNKNKTPIHPNVFYFSTEKDGIGVEISMQWNDGFQENIYCFTNNIPQ
                     RDGGTHLVGFRTAMTRTLNSYMDKEGYNKKSKVSATGDDAREGLVAVISVKVPDPKFS
                     SQTKDKLVSSEVKTAVETLMNEKLVEYLLENPNDAKTVVSKIIDAARAREAARKAREM
                     TRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGK
                     ILNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIR
                     TLLLTFFYRQMPEIIERGHVFIAQPPLYKVKKGKQEQYIKDDEAMDEYQLSIALDGAS
                     LYTSDHTPALRGEPLEKLVTEFNGVKKIIKRMERLYPASLLNNLIYHPKLTEEALTDE
                     TKVQEWIETLVTRLNDREQNGSSYSYQLHENRERQMFEPILRVRTHGVDTDYPLDFDF
                     VHGGEYHRITLLGDKLSNLIEENAYIERGERRQPVSDFEQALEWLTKESRRGLSIQRY
                     KGLGEMNPEQLWETTMNPETRRMMRVTVKDAIATDQLFTTLMGDAVEPRRAFIEENAL
                     KAANIDI"
     misc_feature    3780..4214
                     /note="HMMSmart hit to SM00387, no description, score
                     3.2e-30"
                     /inference="protein motif:Smart:SM00387"
     misc_feature    3780..4211
                     /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
                     gyrase B-, and H, score 4.2e-33"
                     /inference="protein motif:Pfam:PF02518"
     misc_feature    3792..6080
                     /note="HMMSmart hit to SM00433, no description, score
                     1.4e-285"
                     /inference="protein motif:Smart:SM00433"
     misc_feature    4350..4862
                     /note="HMMPfam hit to PF00204, DNA gyrase B, score 1e-93"
                     /inference="protein motif:Pfam:PF00204"
     misc_feature    4941..5264
                     /note="HMMPfam hit to PF01751, Toprim domain, score
                     1.1e-05"
                     /inference="protein motif:Pfam:PF01751"
     misc_feature    5868..6068
                     /note="HMMPfam hit to PF00986, DNA gyrase B subunit,
                     carboxyl terminus, score 6.1e-46"
                     /inference="protein motif:Pfam:PF00986"
     CDS             complement(7159..8268)
                     /transl_table=11
                     /gene="asd"
                     /locus_tag="PAU_00005"
                     /old_locus_tag="PAT2037"
                     /product="aspartate-semialdehyde dehydrogenase"
                     /EC_number="1.2.1.11"
                     /db_xref="EnsemblGenomes-Gn:PAU_00005"
                     /db_xref="EnsemblGenomes-Tr:CAQ82098"
                     /db_xref="GOA:C7BTW3"
                     /db_xref="InterPro:IPR000319"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR011534"
                     /db_xref="InterPro:IPR012080"
                     /db_xref="InterPro:IPR012280"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C7BTW3"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82098.1"
                     /translation="MMKNVGLIGWRGMVGSVLMQRMIEERDFDVIRPVFFTTSQHGQP
                     APDFTGQQGILQNAFDIGALGALDIIISCQGGDYTNEIYPKLRATGWQGYWIDAASAL
                     RMNDDSIIILDPVNHAHIQEGLNKGIKTFVGGNCTVSLMLMSLGGLFANDLVEWASVA
                     TYQAASGAGARHMRELLVQMGALHTQVAKELQDPASAILEIERKVTDFTRSGVMPTDQ
                     FGVPLAGSLIPWIDKQLDNGQSREEWKGQVETNKILNTGNNIVTVDGLCVRIGALRCH
                     SQAFTLKLKKDISIPDIEQLLAEHNDWVRVIPNDRELSMRELTPAAVTGTLNTPVGRL
                     RKLNMGPEYLSAFTVGDQLLWGAAEPLRRMLRILA"
     misc_feature    complement(7204..7836)
                     /note="HMMPfam hit to PF02774, Semialdehyde dehydrogenase,
                     dimerisat, score 2.7e-77"
                     /inference="protein motif:Pfam:PF02774"
     misc_feature    complement(7900..8259)
                     /note="HMMPfam hit to PF01118, Semialdehyde dehydrogenase,
                     NAD bindi, score 6.2e-36"
                     /inference="protein motif:Pfam:PF01118"
     CDS             complement(8471..8692)
                     /transl_table=11
                     /gene="ogrK"
                     /locus_tag="PAU_00006"
                     /old_locus_tag="PAT2038"
                     /product="prophage p2 ogr protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00006"
                     /db_xref="EnsemblGenomes-Tr:CAQ82099"
                     /db_xref="InterPro:IPR007684"
                     /db_xref="UniProtKB/TrEMBL:C7BTW4"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82099.1"
                     /translation="MIKCPLCGQAAHARSSFEHSSQTKERYNQCQNINCGATFVSHET
                     FVRFISKPGEVVSVKPHPKEKSKTQLNLA"
     misc_feature    complement(8546..8686)
                     /note="HMMPfam hit to PF04606, Ogr/Delta-like zinc finger,
                     score 9.5e-27"
                     /inference="protein motif:Pfam:PF04606"
     CDS             complement(8768..9841)
                     /transl_table=11
                     /locus_tag="PAU_00007"
                     /old_locus_tag="PAT2039"
                     /product="putative phage regulator"
                     /db_xref="EnsemblGenomes-Gn:PAU_00007"
                     /db_xref="EnsemblGenomes-Tr:CAQ82100"
                     /db_xref="UniProtKB/TrEMBL:C7BTW5"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82100.1"
                     /translation="MMSEFGRVPEKGSAPGFLLEIDNKDISGRIQSRLISLTMTDNRG
                     FEADQLDIELDDADGSLMLPSRGNVISLALGWRDQPLMDKGRFTVDEIEHSGAPDKLT
                     IRARSADFRESLNMRREVSYHQKTIGEIVRTIAARNNLTADLHKDIAKVFINHIDQTN
                     ESDGSFLTRLANQEGAIASVKNGKLIFIRQGQNKTASGQVIPALVITRQSGDSHNFTL
                     SDREAYTGVVANWLDTRKPEKKHTLAVRRGTGKSKSYLIGSTGNVLELSRVYADEASA
                     KRAAKVAWEKIQRGTATFSIQLAQGRADLYPEVPIQVTGFKPEIDETEWTLTKVTHTI
                     NGSSGGFTTALTLELKIDDLDMK"
     misc_feature    complement(8786..9805)
                     /note="HMMPfam hit to PF05954, Phage late control gene D
                     protein (GPD), score 3.8e-163"
                     /inference="protein motif:Pfam:PF05954"
     CDS             complement(9838..10305)
                     /transl_table=11
                     /locus_tag="PAU_00008"
                     /old_locus_tag="PAT2040"
                     /product="putative tail fiber protein of prophage"
                     /db_xref="EnsemblGenomes-Gn:PAU_00008"
                     /db_xref="EnsemblGenomes-Tr:CAQ82101"
                     /db_xref="InterPro:IPR009734"
                     /db_xref="InterPro:IPR016912"
                     /db_xref="UniProtKB/TrEMBL:C7BTW6"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82101.1"
                     /translation="MMAALGLFVFMLKTTPYQNLQYQQSWRHAFNSRIGLRPAWQFLG
                     PDNDTMTLSGSLYPEITTGSRLSLIALQIMADSGKAWSFIDGRGTVYGMFVIEKIEQT
                     KTELMSNGAARKIDFTLSLRRVDSSLGEMFGDLQDQFSMLTDNSASRVRGVLP"
     misc_feature    complement(9925..10290)
                     /note="HMMPfam hit to PF06995, Phage P2 GpU, score
                     4.1e-61"
                     /inference="protein motif:Pfam:PF06995"
     CDS             complement(10308..12923)
                     /transl_table=11
                     /locus_tag="PAU_00009"
                     /old_locus_tag="PAT2041"
                     /product="putative phage tail protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00009"
                     /db_xref="EnsemblGenomes-Tr:CAQ82102"
                     /db_xref="GOA:C7BTW7"
                     /db_xref="InterPro:IPR010090"
                     /db_xref="UniProtKB/TrEMBL:C7BTW7"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82102.1"
                     /translation="MVQKMSNTQSQLKLVIQSVNKLTSVLKSVQRNNRRLADSIRQNR
                     GEFKRLNQTWDVIKPYSAPEYAQGTAHTSSKNFLMPDYDLNVQLSKIQAQTNIEKNSP
                     KYTTLLNQSYERSKRAGVSASQVVQETAQTSRKKEESRSENRYSKIKDFRDRISQHGA
                     SAKSAGVNILTTSKNFLMPGYDLNAQMSKIQAQTNIEKNSPEYAMLLNQSRELSKSTG
                     VSANQIAQGQSLYASKGYSSDQIKNMMPGTVSMSQANGADFAATIDIGTNVLEGFKLQ
                     SEEMSRVSDVLTATFTGSKTTLAALGDTMKFVAPTASSLGIDIETVAAATRKLSDANI
                     KGSEAGEVLSSMLGRLAEPPKAAAAALAQLSIKIRDAKGNLRQLPDILVELDDKTRSM
                     SSKQRTSYFTAIGGENAAPALDVLVNQAGQGELQSFIDKLRNVQGESQKVASTMTNSL
                     TGDIQKLNAAWSDLGVQMFSGVEGPAREVTQKVTNVVNKVSEWMKANPRLAATLATIT
                     MVVGGVLTVFGAFAQAIASILLPLAVAKYSLTLFGSTGVRALGLVGNALKMLGSTMMI
                     VGRLMMANPILAIVGLIAMAAVYIWQNWETLGPKFSQLWENIKISLSEKWESIKQSAL
                     QIWDNIKNNISNAWELVKQNTLDIWENIKISISDKWNEIITDVMNLPSKFKEVGTAII
                     NSLLEGINEKWEVLKKKLTSLSDYIPDWMRPGEDTSKGTNNNMTHNVSSVLPKHDKGG
                     IIPAGGFGIVGEYGPEIVTGPVNVISRRQTAKLAAAAAFSLSVMAPSAAARTAPLHIQ
                     SLPVQAYPQIQEKVEKRHQIQYRNESPVYHINIYGAPGQSAQDIAAVVRRELDDRERK
                     QQARLRSSFSDRGEF"
     misc_feature    complement(10947..10979)
                     /note="HMMPfam hit to PF05017, no description, score 40"
                     /inference="protein motif:Pfam:PF05017"
     misc_feature    complement(10980..11012)
                     /note="HMMPfam hit to PF05017, no description, score
                     2.1e+02"
                     /inference="protein motif:Pfam:PF05017"
     misc_feature    complement(11013..11045)
                     /note="HMMPfam hit to PF05017, no description, score 1.4"
                     /inference="protein motif:Pfam:PF05017"
     misc_feature    complement(11046..11078)
                     /note="HMMPfam hit to PF05017, no description, score 44"
                     /inference="protein motif:Pfam:PF05017"
     misc_feature    complement(11079..11111)
                     /note="HMMPfam hit to PF05017, no description, score
                     1e+02"
                     /inference="protein motif:Pfam:PF05017"
     misc_feature    complement(order(11148..11216,11253..11315,11358..11426))
                     /note="3 probable transmembrane helices predicted for
                     PAT2041 by TMHMM2.0 at aa 500-522, 537-557 and 570-592"
     CDS             complement(13038..13355)
                     /transl_table=11
                     /locus_tag="PAU_00010"
                     /old_locus_tag="PAT2042"
                     /product="putative phage tail protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00010"
                     /db_xref="EnsemblGenomes-Tr:CAQ82103"
                     /db_xref="InterPro:IPR019289"
                     /db_xref="UniProtKB/TrEMBL:C7BTW8"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82103.1"
                     /translation="MTETLITQNDEQRTIVLEEPLARGGSNITEVVIRKPNSGALRGA
                     RLQALLEMDVDSMMLVLPRVTTPALTKSDLLAMTPGDLINLSVEVVNFLLPKSAKSGF
                     QTD"
     misc_feature    complement(13062..13319)
                     /note="HMMPfam hit to PF06158, Phage tail protein E, score
                     2e-37"
                     /inference="protein motif:Pfam:PF06158"
     CDS             complement(13382..13897)
                     /transl_table=11
                     /locus_tag="PAU_00011"
                     /old_locus_tag="PAT2043"
                     /product="putative tail fiber component of prophage"
                     /db_xref="EnsemblGenomes-Gn:PAU_00011"
                     /db_xref="EnsemblGenomes-Tr:CAQ82104"
                     /db_xref="InterPro:IPR006498"
                     /db_xref="UniProtKB/TrEMBL:C7BTW9"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82104.1"
                     /translation="MALPRKLKYLNLFNDGNNYQGIVEELTLPKLSRKLETYRGGGMN
                     GSATVDLGLDEGALDVEFTLGGMEAQHYRQWGLTKTDGVMLRFSGSCQRDDTSDVIAV
                     EIVMRGRFHEFDHGTYKQGDNTQTKISAKNTYFKLTWDGQTLIEVDTVNMVEIVNGED
                     RLADHRRAMGL"
     misc_feature    complement(13385..13894)
                     /note="HMMPfam hit to PF04985, Phage tail tube protein
                     FII, score 7.2e-98"
                     /inference="protein motif:Pfam:PF04985"
     CDS             complement(13908..15080)
                     /transl_table=11
                     /locus_tag="PAU_00012"
                     /old_locus_tag="PAT2044"
                     /product="probable major tail sheath protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00012"
                     /db_xref="EnsemblGenomes-Tr:CAQ82105"
                     /db_xref="UniProtKB/TrEMBL:C7BTX0"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82105.1"
                     /translation="MAQDYHHGVRVQEINEGTRTITTISTAIVGMVCTGPEADEKAFP
                     LNTPVLITDVSMAIGKAGKTGTLPQALKAIADQAKPVTVVVRVAQGETEDQTTTNIIG
                     TTTNEGKKTGIQALLAAQGQLGVKPRILGVPGLDTKAVAVELATIAQKLRAMAYISAY
                     GCKNKEEVAKYRENFGQRELMLIWPDFLSWDTVSNSEATAYATARALGLRSKIDEETG
                     WHKTLSNIGVNGVTGISADVFWDLQDPATDAGYLNEKGITTLIRKNGFRFWGSRTCAS
                     DPLFQFESYTRTAQVLADTMAEAHMWAIDKPLTPSLVRDIIEGVNAKFRELRSGGYII
                     NGKCWYDESANDKDTLKAGKLTLDYDYTPVPPLENMMLRQRITDKYLMDFAKSING"
     misc_feature    complement(13932..15074)
                     /note="HMMPfam hit to PF04984, Phage tail sheath protein,
                     score 2.7e-175"
                     /inference="protein motif:Pfam:PF04984"
     CDS             15482..16042
                     /transl_table=11
                     /locus_tag="PAU_00013"
                     /old_locus_tag="PAT2045"
                     /product="similar to dna inversion product and tail fiber
                     protein from lambdoi prophage"
                     /db_xref="EnsemblGenomes-Gn:PAU_00013"
                     /db_xref="EnsemblGenomes-Tr:CAQ82106"
                     /db_xref="UniProtKB/TrEMBL:C7BTX1"
                     /inference="similar to DNA sequence:INSD:BX571866"
                     /inference="similar to DNA sequence:INSD:AF320576"
                     /protein_id="CAQ82106.1"
                     /translation="MKNLGLVETIINTLYPVGMVVWFAQNKNPNVLFPGTTWKYIDEN
                     KTVRLASANGADILSTGGNDLITLTVAQMPAHNHVLSGMTDIFDYGTRTTNTTGEHKH
                     DSGWGEQDGGRYGYYDGSKNNQGSGKTDFDNYKFNTSTDGAHAHTVSIGPHSHTISGN
                     TGSTGASAAIPITNSYVKLMGWYRNT"
     CDS             complement(16140..16745)
                     /transl_table=11
                     /gene="tfaE"
                     /locus_tag="PAU_00014"
                     /old_locus_tag="PAT2046"
                     /product="lambdoid prophage e14 tail fiber assembly
                     protein-like protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00014"
                     /db_xref="EnsemblGenomes-Tr:CAQ82107"
                     /db_xref="InterPro:IPR003458"
                     /db_xref="UniProtKB/TrEMBL:C7BTX2"
                     /inference="similar to DNA sequence:INSD:BX571870"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82107.1"
                     /translation="MMNKAVLVLDENNIAISTGSIIVFNYDAITLEYLNSTDEHLSVG
                     IGLPANSCTDAPPNAQEGYVACRSSDLTGWQVVPDYRGKIAYNTQTGEQKEIIKPGEL
                     PGELTFKQPVTDFDKWDGEKWVTDIEAQKVSQIEQAEQQRVTLRQRADEAMTLLQYAI
                     EAEMASDAEKALLLTWKKYVVLLSRVDTSLDSDIEWPQIPE"
     misc_feature    complement(16143..16562)
                     /note="HMMPfam hit to PF02413, Caudovirales tail fibre
                     assembly protein, score 9.7e-43"
                     /inference="protein motif:Pfam:PF02413"
     CDS             complement(16742..17245)
                     /transl_table=11
                     /gene="stfE"
                     /locus_tag="PAU_00015"
                     /old_locus_tag="PAT2047"
                     /product="side tail fiber protein homolog from lambdoid
                     prophage e14 (fragment)"
                     /db_xref="EnsemblGenomes-Gn:PAU_00015"
                     /db_xref="EnsemblGenomes-Tr:CAQ82108"
                     /db_xref="InterPro:IPR011083"
                     /db_xref="UniProtKB/TrEMBL:C7BTX3"
                     /inference="similar to DNA sequence:INSD:BX571870"
                     /inference="similar to DNA sequence:INSD:X01805"
                     /protein_id="CAQ82108.1"
                     /translation="MSISVLEEIPVGIPLPWPTNIPPNGWVKCNGAIFDKSLYPKLAE
                     VYPSGRLPDLRGEFIRGWDDGRGVDIGRYLLSDQLADVAPHNHRLSRMWSNSSAATAD
                     GLGTPNYILNSVTKEANYGIDSRRLGIATGMGNGGFGYMDNAIFASTGTETRPRNVAF
                     NYIVRIA"
     misc_feature    complement(17069..17212)
                     /note="HMMPfam hit to PF07484, Phage Tail Collar Domain,
                     score 2.8e-21"
                     /inference="protein motif:Pfam:PF07484"
     CDS             complement(17245..18372)
                     /transl_table=11
                     /locus_tag="PAU_00016"
                     /old_locus_tag="PAT2048"
                     /product="probable variable tail fibre protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00016"
                     /db_xref="EnsemblGenomes-Tr:CAQ82109"
                     /db_xref="InterPro:IPR005068"
                     /db_xref="InterPro:IPR011083"
                     /db_xref="InterPro:IPR022225"
                     /db_xref="UniProtKB/TrEMBL:C7BTX4"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82109.1"
                     /translation="MKYFAILTKLGAAKLANAAALGTKVDITHMAVGDGGGKLPDPDV
                     NQTQLVNEKRRAAINTLSVDPVNTNQIIAEQIIPEGEGGWWMREIGLFDSEGNLIAVA
                     NCPETYKPQLQEGSGRTQTIRMILIVSNTDSVTLKIDPSIVLATREYVDSSILKHEKS
                     RNHPDATLTEKGFTKLNSATNSNDETTAATPKAVKAAYDNANSKLAKNQNGADIPDKN
                     AFVKNLGLLEKLIPVGVPIPWPTDTPPEGWVQCNGAAFDKSKFPELAKAYPGGNLPDL
                     RGEFIRGWDAGRGVDPSRTLLVWQEGSYLLQEIAGQPADNVVNFSLNERIKLQWDTPQ
                     HKEIPLRARSVGSATTWTTSAGYIGVSRPRNVAFNYIVRAA"
     misc_feature    complement(17530..17673)
                     /note="HMMPfam hit to PF07484, Phage Tail Collar Domain,
                     score 4.9e-23"
                     /inference="protein motif:Pfam:PF07484"
     misc_feature    complement(17743..17874)
                     /note="HMMPfam hit to PF03406, Phage tail fibre repeat,
                     score 1.3e-15"
                     /inference="protein motif:Pfam:PF03406"
     sig_peptide     complement(18319..18372)
                     /locus_tag="PAU_00016"
                     /note="Signal peptide predicted for PAT2048 by SignalP 2.0
                     HMM (Signal peptide probability 0.636) with cleavage site
                     probability 0.458 between residues 18 and 19"
     CDS             complement(18369..18983)
                     /transl_table=11
                     /locus_tag="PAU_00017"
                     /old_locus_tag="PAT2049"
                     /product="putative phage tail protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00017"
                     /db_xref="EnsemblGenomes-Tr:CAQ82110"
                     /db_xref="InterPro:IPR006521"
                     /db_xref="UniProtKB/TrEMBL:C7BTX5"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82110.1"
                     /translation="MNDRLLPTGSTVLELAAAKACSQLQNIPIPLRKLWNPDTCPEEL
                     LPYLAWAWSVDRWDEKWSVSTKRGVIKNSLFLHRHKGTIGAVRRVVEPLGYLIQIKEW
                     WQNNETPGTFRLAIGVQENGITEETFLELERLIFDAKPVSRHLVGLSINLDIKGEFYC
                     AATSYSGDDLTVYQYLPDVITTSDNAPLGAAIHLIDTDTLRVSP"
     CDS             complement(18976..19980)
                     /transl_table=11
                     /locus_tag="PAU_00018"
                     /old_locus_tag="PAT2050"
                     /product="phage baseplate assembly protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00018"
                     /db_xref="EnsemblGenomes-Tr:CAQ82111"
                     /db_xref="InterPro:IPR006949"
                     /db_xref="InterPro:IPR014507"
                     /db_xref="UniProtKB/TrEMBL:C7BTX6"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82111.1"
                     /translation="MPNIDLSQLPPPNVVEPLDYDILLAERKARLISLYPEEQRDAIT
                     RTLELESEPLVKLLEENVYRELILRQRVNEAARAVMLAYATNNDLDQLGANYNVTRAV
                     MEPDSTFRKRIQNAFEGLSVAGPIRAYEYHASKVNEGIRVNKDDEKGKGEYQIVDDVS
                     VISPSPANVTVTILSQKWIWEKDKDDKVDEKHNGVPSQDLLDKVVVALNDEDVRPVAD
                     RVKVQPAQIVEYQIDAVLHLDPTPESEPIRKLAQQNMDNYIKDQHKLGRDIRLSAIYA
                     ALHVAGVQQVELRAPTKDIILCEDQAPYCSSAKLELVKTQASDCSKPNPNLIMGGYDE
                     "
     misc_feature    complement(19150..19824)
                     /note="HMMPfam hit to PF04865, Baseplate J-like protein,
                     score 9e-81"
                     /inference="protein motif:Pfam:PF04865"
     CDS             complement(19985..20362)
                     /transl_table=11
                     /locus_tag="PAU_00019"
                     /old_locus_tag="PAT2051"
                     /product="phage baseplate assembly protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00019"
                     /db_xref="EnsemblGenomes-Tr:CAQ82112"
                     /db_xref="InterPro:IPR007048"
                     /db_xref="UniProtKB/TrEMBL:C7BTX7"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82112.1"
                     /translation="MMYLGMNRQTGRSLTDLEHVRQSVSDILLTPIGSRVERRTYGSL
                     LPELIDWPQNAALRLQVMAACYTAISRWEPRINLTAITIDTPKDGDTQKDGDTQKNGK
                     MTIDISGHYQLSPGGFSLSIPVR"
     misc_feature    complement(19991..20314)
                     /note="HMMPfam hit to PF04965, GPW / gp25 family, score
                     6.3e-37"
                     /inference="protein motif:Pfam:PF04965"
     CDS             complement(20362..21135)
                     /transl_table=11
                     /locus_tag="PAU_00020"
                     /old_locus_tag="PAT2052"
                     /product="putative phage baseplate assembly protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00020"
                     /db_xref="EnsemblGenomes-Tr:CAQ82113"
                     /db_xref="InterPro:IPR006531"
                     /db_xref="InterPro:IPR012334"
                     /db_xref="InterPro:IPR013046"
                     /db_xref="UniProtKB/TrEMBL:C7BTX8"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82113.1"
                     /translation="MDTQLTELLRLLRNLIRTGVVTEVDHARGMCRIATGNLETDWRP
                     WLTMRAGHSRTWWAPSVNEQVLLLSVGGELTTSFVLPAIYSDQFPAPSVSSEAVHIAF
                     PDGAVMVYEPKFGALVVKGIRTASVQAINSISLEATNIALKAHDKISISANNKIELAS
                     HNEISMSADNKIGLSSHNEIAMGADNKIGLEAKKDFALKAYEVKCEATKEMSLKASKI
                     KLDGDVENTGGKLSSNGVTLHSHQHSGVMAGGATTGGPV"
     misc_feature    complement(20779..21081)
                     /note="HMMPfam hit to PF04717, Phage-related baseplate
                     assembly protein, score 2.1e-49"
                     /inference="protein motif:Pfam:PF04717"
     CDS             complement(21426..21563)
                     /transl_table=11
                     /locus_tag="PAU_00021"
                     /old_locus_tag="PAT2053"
                     /product="Hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00021"
                     /db_xref="EnsemblGenomes-Tr:CAQ82114"
                     /db_xref="UniProtKB/TrEMBL:C7BTX9"
                     /inference="similar to DNA sequence:INSD:CAAJ01000543"
                     /protein_id="CAQ82114.1"
                     /translation="MQDILEKLKIEFVFGSKYVCLELDKQMVEVTHCNCIVLQHSNEN
                     H"
     CDS             complement(21717..21953)
                     /transl_table=11
                     /locus_tag="PAU_00022"
                     /old_locus_tag="PAT2054"
                     /product="probable phage tail protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00022"
                     /db_xref="EnsemblGenomes-Tr:CAQ82115"
                     /db_xref="InterPro:IPR008861"
                     /db_xref="UniProtKB/TrEMBL:C7BTY0"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82115.1"
                     /translation="MKIISHQNDTVDALCWRHYGRTQGMTELVLEANPGLVELIFKKF
                     PELSEYSVILPYGTEVEMPEVIPTTTKPILQLWD"
     misc_feature    complement(21741..21953)
                     /note="HMMPfam hit to PF05489, Phage Tail Protein X, score
                     8e-25"
                     /inference="protein motif:Pfam:PF05489"
     CDS             complement(22234..22416)
                     /transl_table=11
                     /gene="rlsC"
                     /locus_tag="PAU_00023"
                     /old_locus_tag="PAT2055"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00023"
                     /db_xref="EnsemblGenomes-Tr:CAQ82116"
                     /db_xref="UniProtKB/TrEMBL:C7BTY1"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AJ831831"
                     /protein_id="CAQ82116.1"
                     /translation="MSVDFLMESVIAQRINFIARMATSCECNHVEDKELALTWIAELS
                     TPLAKQLINRHETFEE"
     CDS             22796..23410
                     /transl_table=11
                     /locus_tag="PAU_00024"
                     /old_locus_tag="PAT2056"
                     /product="similar to phage repressor protein ci"
                     /db_xref="EnsemblGenomes-Gn:PAU_00024"
                     /db_xref="EnsemblGenomes-Tr:CAQ82117"
                     /db_xref="GOA:C7BTY2"
                     /db_xref="InterPro:IPR010744"
                     /db_xref="InterPro:IPR032499"
                     /db_xref="UniProtKB/TrEMBL:C7BTY2"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:M55249"
                     /protein_id="CAQ82117.1"
                     /translation="MKKNVTEIKMGADSGGKQAIERLVSAYGFKSRQALSDHLGVSKS
                     TMANRYLRDSFPADWVIQCNLETNASLLWLSTGQGEMFPDGEKKRESLENIITPTIQR
                     VKLVGGKLNADNPVTLDNQLIAKEIKKPLIIDNNDTWYLLDTAEPDVQDGLWLIDIEG
                     MHSIKKITKIPVGKIRVYDNDVTFDCAIDEINFIGRVYLMISRY"
     misc_feature    22847..23041
                     /note="HMMPfam hit to PF07022, Bacteriophage CI repressor
                     helix-turn-h, score 1.4e-39"
                     /inference="protein motif:Pfam:PF07022"
     CDS             complement(23492..24067)
                     /transl_table=11
                     /gene="hin"
                     /gene_synonym="pin"
                     /locus_tag="PAU_00025"
                     /old_locus_tag="PAT2057"
                     /product="putative dna-invertase"
                     /db_xref="EnsemblGenomes-Gn:PAU_00025"
                     /db_xref="EnsemblGenomes-Tr:CAQ82118"
                     /db_xref="GOA:C7BTY3"
                     /db_xref="InterPro:IPR006118"
                     /db_xref="InterPro:IPR006119"
                     /db_xref="InterPro:IPR006120"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:C7BTY3"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82118.1"
                     /translation="MAKIGYIRVSTNDQNSDLQRNALISINCERIFEDKISGKTANRP
                     GLKQALKQLKKGDTLVVWKLDRLGRSVKNMVTLISDLSERGIHFQSLTDSIDTSTSMG
                     RFFFHVMSALAEMERELIVERTNAGLIAARAQGRIGGRPVSFSFTEQQQAARLLAKGH
                     SRKQLSLIYNTSLSTIYKYFPVNKTDYRSAN"
     misc_feature    complement(23519..23653)
                     /note="HMMPfam hit to PF02796, Helix-turn-helix domain of
                     resolvase, score 3.5e-09"
                     /inference="protein motif:Pfam:PF02796"
     misc_feature    complement(23657..24061)
                     /note="HMMPfam hit to PF00239, Resolvase, N terminal
                     domain, score 2e-74"
                     /inference="protein motif:Pfam:PF00239"
     CDS             24165..25136
                     /transl_table=11
                     /locus_tag="PAU_00026"
                     /old_locus_tag="PAT2058"
                     /product="similar to bacteriophage tail fiber protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00026"
                     /db_xref="EnsemblGenomes-Tr:CAQ82119"
                     /db_xref="UniProtKB/TrEMBL:C7BTY4"
                     /inference="similar to DNA sequence:INSD:BX571868"
                     /inference="similar to DNA sequence:INSD:AB017338"
                     /protein_id="CAQ82119.1"
                     /translation="MAKNAVPNSRKVNGKVLVGDINITSQDIFDGQAIAIPEKVNLND
                     YRTPGVYVQYANASAETGTNYPEPLAGSLIVLKAAGIIQRYFVYNSSRIYTRSLNDIG
                     VWTSWAREYNTLNKPTAGDIEVYTQTESDSRYITGSRKINGKSLSGDVDITSQDIFNG
                     QAIYLGDKANLDNYKTPGIYYQDYNIHAQNGANYPEQLAGSLIVLKAAGIIQRYFVYN
                     SSRIYTRSQYHDLAWTPWTMEYNTSNPPFVGNLGAYTKEECNSFYITNIRLGAEVQVG
                     AGGVLEYHGPNVLTGFYNRDRDYSAETLYWSPIQFLKNGQWITIVRG"
     CDS             25142..25678
                     /transl_table=11
                     /locus_tag="PAU_00027"
                     /old_locus_tag="PAT2059"
                     /product="hypothetical phage protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00027"
                     /db_xref="EnsemblGenomes-Tr:CAQ82120"
                     /db_xref="InterPro:IPR003458"
                     /db_xref="UniProtKB/TrEMBL:C7BTY5"
                     /inference="similar to DNA sequence:INSD:AP008232"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82120.1"
                     /translation="MNLVNLGPFEQYIPDSENAVQFALYLQDKQGNDWYTSQNQFSTE
                     TLKIMYDANGLIRAITTDVSKFAPLGFSVAEINKNEVPKEFNEKTNYKWIFDGQKIFP
                     YVATKEELIRKAEYERVQLLVKANNIIVPLQDAIDLNIATEEEKNTLLKWKKYRIMLN
                     RIDISTTPEIVWPSPPLS"
     misc_feature    25241..25672
                     /note="HMMPfam hit to PF02413, Caudovirales tail fibre
                     assembly protein, score 3.1e-32"
                     /inference="protein motif:Pfam:PF02413"
     CDS             complement(25818..25946)
                     /transl_table=11
                     /locus_tag="PAU_00028"
                     /old_locus_tag="PAT2060"
                     /product="Hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00028"
                     /db_xref="EnsemblGenomes-Tr:CAQ82121"
                     /db_xref="UniProtKB/TrEMBL:C7BTY6"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82121.1"
                     /translation="MLNSYLPKDSDIAIYHSAKLACQEYTSNYLGRIVYSIRVLEQ"
     CDS             complement(26022..26519)
                     /transl_table=11
                     /gene="Sc/SvP"
                     /locus_tag="PAU_00029"
                     /old_locus_tag="PAT2061"
                     /product="similar to dna inversion product and tail fiber
                     protein from lambdoi prophage"
                     /db_xref="EnsemblGenomes-Gn:PAU_00029"
                     /db_xref="EnsemblGenomes-Tr:CAQ82122"
                     /db_xref="InterPro:IPR011083"
                     /db_xref="UniProtKB/TrEMBL:C7BTY7"
                     /inference="similar to DNA sequence:INSD:BX571866"
                     /inference="similar to DNA sequence:INSD:X62121"
                     /protein_id="CAQ82122.1"
                     /translation="MKNLGLVEKLIPVGVPLPWPTETPPEGWVQCNGAAFDKSKFPKL
                     AKAYPSGNLPDLRGEFIRGWDDGRGIDQSRALLSQQNSTRLPSVYVHAASADIGILVS
                     PPVNTYSRTYPSEIMASDFEDSTNGSGPYYTTSSSLVPGGSVGLSAFRVRPRNIAFNY
                     IVRAA"
     misc_feature    complement(26337..26480)
                     /note="HMMPfam hit to PF07484, Phage Tail Collar Domain,
                     score 1.9e-21"
                     /inference="protein motif:Pfam:PF07484"
     CDS             complement(26896..27036)
                     /transl_table=11
                     /gene="rpmJ"
                     /gene_synonym="rpmJ2"
                     /locus_tag="PAU_00030"
                     /old_locus_tag="PAT2062"
                     /product="50s ribosomal protein l36 2"
                     /db_xref="EnsemblGenomes-Gn:PAU_00030"
                     /db_xref="EnsemblGenomes-Tr:CAQ82123"
                     /db_xref="GOA:C7BTY8"
                     /db_xref="InterPro:IPR000473"
                     /db_xref="UniProtKB/TrEMBL:C7BTY8"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82123.1"
                     /translation="MQVLSSLKTAKTRHPDCKIVSRRGRLYVICKSNPRFKAVQGKKK
                     KR"
     misc_feature    complement(26914..27036)
                     /note="HMMPfam hit to PF00444, Ribosomal protein L36,
                     score 0.00015"
                     /inference="protein motif:Pfam:PF00444"
     CDS             complement(27054..27308)
                     /transl_table=11
                     /gene="rpmE2"
                     /locus_tag="PAU_00031"
                     /old_locus_tag="PAT2063"
                     /product="50s ribosomal protein l31 type b"
                     /db_xref="EnsemblGenomes-Gn:PAU_00031"
                     /db_xref="EnsemblGenomes-Tr:CAQ82124"
                     /db_xref="GOA:C7BTY9"
                     /db_xref="InterPro:IPR002150"
                     /db_xref="InterPro:IPR027493"
                     /db_xref="InterPro:IPR034704"
                     /db_xref="UniProtKB/TrEMBL:C7BTY9"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82124.1"
                     /translation="MKPNIHPNYRVVVFHDTSVNAYFSIGSTIRTERTITLNGEEYPY
                     VTIDVSSESHPFYTGKQKTLSQEGSTARFQKKFGRFIGNK"
     misc_feature    complement(27069..27308)
                     /note="HMMPfam hit to PF01197, Ribosomal protein L31,
                     score 3.5e-10"
                     /inference="protein motif:Pfam:PF01197"
     CDS             27328..27603
                     /transl_table=11
                     /locus_tag="PAU_00032"
                     /old_locus_tag="PAT2064"
                     /product="hypothetical transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00032"
                     /db_xref="EnsemblGenomes-Tr:CAQ82125"
                     /db_xref="GOA:C7BU07"
                     /db_xref="UniProtKB/TrEMBL:C7BU07"
                     /inference="similar to DNA sequence:INSD:BX571863"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82125.1"
                     /translation="MLYYNIIVIRVYEQENNEKFSQTQKKASVLSMYKGLFQLLTYIP
                     FILQVAALLAAFTHPSHIVIYAPGDSFTCRRAATRNLLGIKRLFHSH"
     misc_feature    27430..27498
                     /note="1 probable transmembrane helix predicted for
                     PAT2064 by TMHMM2.0 at aa 35-57"
     CDS             complement(27586..29415)
                     /transl_table=11
                     /gene="glmS"
                     /locus_tag="PAU_00033"
                     /old_locus_tag="PAT2065"
                     /product="L-glutamine:D-fructose-6-phosphate
                     aminotransferase"
                     /EC_number="2.6.1.16"
                     /db_xref="EnsemblGenomes-Gn:PAU_00033"
                     /db_xref="EnsemblGenomes-Tr:CAQ82126"
                     /db_xref="GOA:C7BU08"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="InterPro:IPR005855"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C7BU08"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82126.1"
                     /translation="MCGIVGAVAQRDIAEILIEGLRRLEYRGYDSAGLAVVDNEKNML
                     RLREVGKVQMLADEVGKQPVLGGTGIAHTRWATHGEPNERNAHPHISDYIAVVHNGII
                     ENYEELRVQLIERGYSFVSDTDTEVIAHLVHWEQKQDGTLLEAVQRVIPQLRGAYGAV
                     IMDSRDPGTVIAARSGSPLVIGLGVGENFLASDQLALLPVTRRFIFLEEGDIAEVTRR
                     TVRIFNSHGEPIEREQIESNIQYDAGDKGIYRHYMQKEIYEQPMAIKSTLENRLGHGQ
                     VDLSELGPNAAELLSKVEHIQIVACGTSYNAGMVSRYWFEALAGIPCDVEIASEFRYR
                     KSAHRSGSLLITLSQSGETADTLAALRLSKDLGYLTSLTVCNVAGSSLVRESDFALMT
                     KAGAEIGVASTKAFTTQLTVLLMLVAYLGRLNGIDAEQEQEIVHALHALPSRIEGMLS
                     KDKIIEALAEDFSDKHHALFLGRGDQYPIAVEGALKLKEISYIHAEAYAAGELKHGPL
                     ALIDADMPVIIVAPNNELLEKLKSNIEEVRARGGLLYVFADQDAGFTDSEGMKIIPLP
                     HVEELIAPIFYTVPLQLLSYHVALIKGTDVDQPRNLAKSVTVE"
     misc_feature    complement(27631..28041)
                     /note="HMMPfam hit to PF01380, SIS domain, score 5.8e-35"
                     /inference="protein motif:Pfam:PF01380"
     misc_feature    complement(28150..28557)
                     /note="HMMPfam hit to PF01380, SIS domain, score 1.6e-39"
                     /inference="protein motif:Pfam:PF01380"
     misc_feature    complement(28834..29412)
                     /note="HMMPfam hit to PF00310, Glutamine amidotransferases
                     class-II, score 8.1e-51"
                     /inference="protein motif:Pfam:PF00310"
     CDS             complement(29525..30895)
                     /transl_table=11
                     /gene="glmU"
                     /locus_tag="PAU_00034"
                     /old_locus_tag="PAT2066"
                     /product="bifunctional protein GlmU"
                     /EC_number="2.3.1.157"
                     /db_xref="EnsemblGenomes-Gn:PAU_00034"
                     /db_xref="EnsemblGenomes-Tr:CAQ82127"
                     /db_xref="GOA:C7BU14"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005882"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="InterPro:IPR025877"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C7BU14"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82127.1"
                     /translation="MSNSAKSVVILAAGKGTRMYSDLPKVLHLLAGKPMVQHVIDTAM
                     ALGAKNVHLVYGHGGDLMKQTLSEQKLNWVLQEEQLGTGHAMQQAAPHFTDDEDILML
                     YGDVPLIGTDTLERLLAAKPEGGIGLLTAILDNPTGYGRIIRKNGDVTGIIEQKDATE
                     EQCKISEINTGILVANGGDLKRWLSQLDNNNAQGEYYITDVIALAHKEGRKIEAVHPR
                     RLSEMEGVNNRLQLSTLERIYQSEQAEKLLLAGVMLLDPTRFDLRGTLIHGRDVVIDT
                     NVIIEGNVTLGNNVLIGTGCVLKNCIIGDDSILSPYTVIEDSEMGVGCTVGPFARLRP
                     GSKLAEKAHVGNFVEMKKSYLGKGSKAGHLTYLGDADIGSDVNIGAGTITCNYDGANK
                     FKTIIGDNVFVGSNTQLVAPVTIAKGATIGAGTTVTKNVAEDELVVSRTKQTHIQGWK
                     RPVKKK"
     misc_feature    complement(29609..29662)
                     /note="HMMPfam hit to PF00132, Bacterial transferase
                     hexapeptide (th, score 2.4"
                     /inference="protein motif:Pfam:PF00132"
     misc_feature    complement(29663..29716)
                     /note="HMMPfam hit to PF00132, Bacterial transferase
                     hexapeptide (th, score 2.3"
                     /inference="protein motif:Pfam:PF00132"
     misc_feature    complement(29738..29791)
                     /note="HMMPfam hit to PF00132, Bacterial transferase
                     hexapeptide (th, score 1.1e+02"
                     /inference="protein motif:Pfam:PF00132"
     misc_feature    complement(29876..29929)
                     /note="HMMPfam hit to PF00132, Bacterial transferase
                     hexapeptide (th, score 21"
                     /inference="protein motif:Pfam:PF00132"
     misc_feature    complement(29945..29998)
                     /note="HMMPfam hit to PF00132, Bacterial transferase
                     hexapeptide (th, score 0.039"
                     /inference="protein motif:Pfam:PF00132"
     misc_feature    complement(30032..30085)
                     /note="HMMPfam hit to PF00132, Bacterial transferase
                     hexapeptide (th, score 0.14"
                     /inference="protein motif:Pfam:PF00132"
     misc_feature    complement(30197..30877)
                     /note="HMMPfam hit to PF00483, Nucleotidyl transferase,
                     score 6.4e-08"
                     /inference="protein motif:Pfam:PF00483"
     CDS             complement(31026..31448)
                     /transl_table=11
                     /gene="atpC"
                     /locus_tag="PAU_00035"
                     /old_locus_tag="PAT2067"
                     /product="ATP synthase epsilon chain"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:PAU_00035"
                     /db_xref="EnsemblGenomes-Tr:CAQ82128"
                     /db_xref="GOA:C7BU15"
                     /db_xref="InterPro:IPR001469"
                     /db_xref="InterPro:IPR020546"
                     /db_xref="InterPro:IPR020547"
                     /db_xref="UniProtKB/TrEMBL:C7BU15"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82128.1"
                     /translation="MAAMTYHLNVVSAESRMFDGLVQKIQVTGSEGELGIYPGHAPLL
                     TAIKPGMVRIVKQFGEEEVIYLSGGILEVQPSGVIVLADTAIRGKDLDEAKALESKRK
                     AEEHIRNSHGDVDYAQASAELSKAIAKLRVIELTKKAM"
     misc_feature    complement(31041..31184)
                     /note="HMMPfam hit to PF00401, ATP synthase, Delta/Epsilon
                     chain, long, score 1.1e-12"
                     /inference="protein motif:Pfam:PF00401"
     misc_feature    complement(31188..31436)
                     /note="HMMPfam hit to PF02823, ATP synthase, Delta/Epsilon
                     chain, beta, score 4.3e-32"
                     /inference="protein motif:Pfam:PF02823"
     CDS             complement(31470..32852)
                     /transl_table=11
                     /gene="atpD"
                     /locus_tag="PAU_00036"
                     /old_locus_tag="PAT2068"
                     /product="membrane-bound ATP synthase F1 sector
                     beta-subunit"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:PAU_00036"
                     /db_xref="EnsemblGenomes-Tr:CAQ82129"
                     /db_xref="GOA:C7BU16"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005722"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C7BU16"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82129.1"
                     /translation="MATGKIIQVIGAVVDVEFPQDAVPKVYDALEVQNGEAKLVLEVQ
                     QQLGGGVVRCIAMGTSDGLSRGLSVTDLSHPIEVPVGKATLGRIMNVLGEPIDMKGDI
                     GEEERWPIHRPAPSYEELSNSQELLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNM
                     MELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRL
                     RVALTGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEM
                     GVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPA
                     VDPLDSTSRQLDPLVVGQEHYNVARGVQSILQRYQELKDIIAILGMDELSEDDKLVVA
                     RARKIQRFLSQPFFVAEVFTGSPGKFVSLKDTIRGFKGILEGDYDHLPEQAFYMVGTI
                     EEAVEKAKKL"
     misc_feature    complement(31473..31790)
                     /note="HMMPfam hit to PF00306, ATP synthase alpha/beta
                     chain, C termin, score 4e-49"
                     /inference="protein motif:Pfam:PF00306"
     misc_feature    complement(31638..32429)
                     /note="HMMSmart hit to SM00382, no description, score
                     0.0003"
                     /inference="protein motif:Smart:SM00382"
     misc_feature    complement(31827..32468)
                     /note="HMMPfam hit to PF00006, ATP synthase alpha/beta
                     family, nucleot, score 1.9e-91"
                     /inference="protein motif:Pfam:PF00006"
     misc_feature    complement(32634..32837)
                     /note="HMMPfam hit to PF02874, ATP synthase alpha/beta
                     family, beta-ba, score 6.1e-25"
                     /inference="protein motif:Pfam:PF02874"
     CDS             complement(32887..33750)
                     /transl_table=11
                     /gene="atpG"
                     /locus_tag="PAU_00037"
                     /old_locus_tag="PAT2069"
                     /product="ATP synthase gamma chain"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:PAU_00037"
                     /db_xref="EnsemblGenomes-Tr:CAQ82130"
                     /db_xref="GOA:C7BU17"
                     /db_xref="InterPro:IPR000131"
                     /db_xref="InterPro:IPR023632"
                     /db_xref="UniProtKB/TrEMBL:C7BU17"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82130.1"
                     /translation="MAGAKEIRTKIASVQNTQKITKAMEMVAASKMRKTQDRMAASRP
                     YAETIRSVIGHLALGNLEYKHPYLEEREIKRVGYLVVSTDRGLCGGLNTNLFKKLMLD
                     MKGWSDKGVQCDLALIGSKAASFFASVGGNIVAQVTGMGDNPSLSELIGPVNIMLRAY
                     DEGRLDKLYVVTNKFINTMSQEPTITQLLPLPAGDDETLKKKSWDYLYEPDPKALLDI
                     LLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQE
                     LTEIVSGASAV"
     misc_feature    complement(32890..33747)
                     /note="HMMPfam hit to PF00231, ATP synthase, score
                     6.7e-166"
                     /inference="protein motif:Pfam:PF00231"
     CDS             complement(33809..35350)
                     /transl_table=11
                     /gene="atpA"
                     /locus_tag="PAU_00038"
                     /old_locus_tag="PAT2070"
                     /product="ATP synthase subunit alpha"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:PAU_00038"
                     /db_xref="EnsemblGenomes-Tr:CAQ82131"
                     /db_xref="GOA:C7BU18"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005294"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR033732"
                     /db_xref="UniProtKB/TrEMBL:C7BU18"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:J01594"
                     /protein_id="CAQ82131.1"
                     /translation="MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVNDGIIRIHGL
                     AEVMQGEMIALPGNRYAIALNLERDSVGAVVMGPYADLAEGMKVKCTGRILEVPVGRG
                     LLGRVVNTLGEPIDGKGPVEHDGFSAVEMIAPGVIDRQSVDQPVQTGYKSVDAMIPIG
                     RGQRELVIGDRQTGKTALAIDAIINQRDSGIKCVYVAVGQKASTIANVVRKLEEHGAL
                     ANTIVVVATASESAALQYLAPYSGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLL
                     LRRPPGREAFPGDVFYLHSRLLERAARVNAEYVEKFTNGEVKGKTGSLTALPIIETQA
                     GDVSAFVPTNVISITDGQIFLESSLFNAGIRPAVNPGISVSRVGGAAQTKIVKKLSGG
                     IRTALAQYRELAAFSQFASDLDDATRKQLDHGQKVTELLKQKQYAPMSVAQQSLSLFS
                     AERGYLEDVEIAKIIDFESALLAYASREHADLLKEIDQSGGYNEEIEAKLKALLDSFK
                     ATQSW"
     misc_feature    complement(33878..34192)
                     /note="HMMPfam hit to PF00306, ATP synthase alpha/beta
                     chain, C termin, score 1.4e-27"
                     /inference="protein motif:Pfam:PF00306"
     misc_feature    complement(34226..34909)
                     /note="HMMPfam hit to PF00006, ATP synthase alpha/beta
                     family, nucleot, score 6e-117"
                     /inference="protein motif:Pfam:PF00006"
     misc_feature    complement(35075..35281)
                     /note="HMMPfam hit to PF02874, ATP synthase alpha/beta
                     family, beta-ba, score 1.1e-16"
                     /inference="protein motif:Pfam:PF02874"
     CDS             complement(35365..35898)
                     /transl_table=11
                     /gene="atpH"
                     /locus_tag="PAU_00039"
                     /old_locus_tag="PAT2071"
                     /product="membrane-bound ATP synthase F1 sector
                     delta-subunit"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:PAU_00039"
                     /db_xref="EnsemblGenomes-Tr:CAQ82132"
                     /db_xref="GOA:C7BU09"
                     /db_xref="InterPro:IPR000711"
                     /db_xref="InterPro:IPR020781"
                     /db_xref="InterPro:IPR026015"
                     /db_xref="UniProtKB/TrEMBL:C7BU09"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82132.1"
                     /translation="MSEFATVARPYAKAAFDFAVEKQSLEQWQNMLAFTAEVTRNEQV
                     GELLSGSLASETLANTFIAICGEQVDEHAQNFIRIMAENGRLLALPEVLQQFIQLRAS
                     LESTVDVEVISATELSEQQLAKISTAMEKRLSRKVKLNCKIDKSVIAGVVVRAGDLVI
                     DGSIRGRLDRLTDVLQS"
     misc_feature    complement(35374..35880)
                     /note="HMMPfam hit to PF00213, ATP synthase delta (OSCP)
                     subunit, score 3.5e-70"
                     /inference="protein motif:Pfam:PF00213"
     CDS             complement(35911..36381)
                     /transl_table=11
                     /gene="atpF"
                     /locus_tag="PAU_00040"
                     /old_locus_tag="PAT2072"
                     /product="ATP synthase B chain"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:PAU_00040"
                     /db_xref="EnsemblGenomes-Tr:CAQ82133"
                     /db_xref="GOA:C7BU10"
                     /db_xref="InterPro:IPR002146"
                     /db_xref="InterPro:IPR005864"
                     /db_xref="InterPro:IPR028987"
                     /db_xref="UniProtKB/TrEMBL:C7BU10"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82133.1"
                     /translation="MNLNATILGQAIAFVLFVMFCMKFVWPPIMAAIEKRQKEIADGL
                     SSAERAKKDLDLAQANATDQMKRAKAEAQVIIEQANKQKAQILDDAKAEAELERNRIV
                     AQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL"
     misc_feature    complement(35971..36366)
                     /note="HMMPfam hit to PF00430, ATP synthase B/B' CF(0),
                     score 4.1e-40"
                     /inference="protein motif:Pfam:PF00430"
     sig_peptide     complement(36289..36381)
                     /gene="atpF"
                     /locus_tag="PAU_00040"
                     /note="Signal peptide predicted for PAT2072 by SignalP 2.0
                     HMM (Signal peptide probability 0.878) with cleavage site
                     probability 0.869 between residues 31 and 32"
     misc_feature    complement(36295..36363)
                     /note="1 probable transmembrane helix predicted for
                     PAT2072 by TMHMM2.0 at aa 7-29"
     CDS             complement(36438..36677)
                     /transl_table=11
                     /gene="atpE"
                     /locus_tag="PAU_00041"
                     /old_locus_tag="PAT2073"
                     /product="ATP synthase C chain"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:PAU_00041"
                     /db_xref="EnsemblGenomes-Tr:CAQ82134"
                     /db_xref="GOA:C7BU11"
                     /db_xref="InterPro:IPR000454"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR005953"
                     /db_xref="InterPro:IPR020537"
                     /db_xref="UniProtKB/TrEMBL:C7BU11"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /inference="similar to AA sequence:UniProt:Q0TAX2"
                     /protein_id="CAQ82134.1"
                     /translation="MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPD
                     LIPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFAVA"
     misc_feature    complement(36447..36656)
                     /note="HMMPfam hit to PF00137, ATP synthase subunit C,
                     score 1.2e-24"
                     /inference="protein motif:Pfam:PF00137"
     misc_feature    complement(order(36453..36521,36582..36650))
                     /note="2 probable transmembrane helices predicted for
                     PAT2073 by TMHMM2.0 at aa 10-32 and 53-75"
     sig_peptide     complement(36609..36677)
                     /gene="atpE"
                     /locus_tag="PAU_00041"
                     /note="Signal peptide predicted for PAT2073 by SignalP 2.0
                     HMM (Signal peptide probability 0.749) with cleavage site
                     probability 0.528 between residues 23 and 24"
     CDS             complement(36726..37550)
                     /transl_table=11
                     /gene="atpB"
                     /locus_tag="PAU_00042"
                     /old_locus_tag="PAT2074"
                     /product="membrane-bound ATP synthase F0 sector subunit A"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:PAU_00042"
                     /db_xref="EnsemblGenomes-Tr:CAQ82135"
                     /db_xref="GOA:C7BU12"
                     /db_xref="InterPro:IPR000568"
                     /db_xref="InterPro:IPR023011"
                     /db_xref="UniProtKB/TrEMBL:C7BU12"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82135.1"
                     /translation="MSASGEVSTARDYIGHHLNNLQLDLRTFELVDPNSGGSATFWTL
                     NIDSLFFSVVLGILFLYVFRKVAVNATSGVPGKLQTAIELIMGFVDNSVRDMYHGKSK
                     VIAPLALTVFVWVLLMNIMDLLPIDFLPYIGEHVFGLPALRVVPTADVSITLSMAIGV
                     FVLILYYSIKMKGISGFTKELTLQPFNHPLFIPINLILEGVSLLSKPVSLGLRLFGNM
                     YAGELIFILIAGLLPWWSQWMLSLPWAIFHILIITLQAFIFMVLTIVYLSMASEEH"
     misc_feature    complement(36744..37427)
                     /note="HMMPfam hit to PF00119, ATP synthase A chain, score
                     6.6e-92"
                     /inference="protein motif:Pfam:PF00119"
     misc_feature    complement(order(36747..36815,36843..36911,37050..37118,
                     37176..37244,37362..37430))
                     /note="5 probable transmembrane helices predicted for
                     PAT2074 by TMHMM2.0 at aa 41-63, 103-125, 145-167, 214-236
                     and 246-268"
     CDS             complement(37581..37958)
                     /transl_table=11
                     /gene="atpI"
                     /locus_tag="PAU_00043"
                     /old_locus_tag="PAT2075"
                     /product="atp synthase protein i"
                     /db_xref="EnsemblGenomes-Gn:PAU_00043"
                     /db_xref="EnsemblGenomes-Tr:CAQ82136"
                     /db_xref="GOA:C7BU13"
                     /db_xref="InterPro:IPR005598"
                     /db_xref="UniProtKB/TrEMBL:C7BU13"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to AA sequence:UniProt:Q0W9Q9"
                     /protein_id="CAQ82136.1"
                     /translation="MSVSLYSGKIALKLLFLQLMTFVILSVAFCTKSIEWGASAFAGG
                     LACWLPNAIFMLFAGFQKAKGEDVSVRVAWSFAIGEGVKVIITIAVLIVALGVFKAAF
                     VPLGLAYLVVLIVQIIASAVING"
     misc_feature    complement(37584..37946)
                     /note="HMMPfam hit to PF03899, ATP synthase I chain, score
                     3.5e-20"
                     /inference="protein motif:Pfam:PF03899"
     misc_feature    complement(order(37587..37655,37674..37742,37785..37853,
                     37872..37931))
                     /note="4 probable transmembrane helices predicted for
                     PAT2075 by TMHMM2.0 at aa 10-29, 36-58, 73-95 and 102-124"
     sig_peptide     complement(37833..37958)
                     /gene="atpI"
                     /locus_tag="PAU_00043"
                     /note="Signal peptide predicted for PAT2075 by SignalP 2.0
                     HMM (Signal peptide probability 0.844) with cleavage site
                     probability 0.811 between residues 42 and 43"
     CDS             complement(38568..39209)
                     /transl_table=11
                     /gene="gidB"
                     /locus_tag="PAU_00044"
                     /old_locus_tag="PAT2076"
                     /product="methyltransferase GidB"
                     /EC_number="2.1.-.-"
                     /db_xref="EnsemblGenomes-Gn:PAU_00044"
                     /db_xref="EnsemblGenomes-Tr:CAQ82137"
                     /db_xref="GOA:C7BU63"
                     /db_xref="InterPro:IPR003682"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C7BU63"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82137.1"
                     /translation="MPERIFIVLNKLELLLTKARIKLSQQQKQQLIAYVDMLNKWNKT
                     YNLTSVRDPEQMLVRHIMDSIIVSPYLQGYRFIDVGTGPGLPGIPLAIVRPDSHFTLL
                     DSLGKRVRFLRQVQHELSLANIEPVQSRVEEYLSGPPFDGVISRAFASLQDMVSWCNH
                     LSKPIHGRFYALKGVLPEEELTMLPSGISVDSVIQLDVPELEGQRHLVILKSN"
     misc_feature    complement(38586..39131)
                     /note="HMMPfam hit to PF02527, Glucose inhibited division
                     protein, score 1.9e-83"
                     /inference="protein motif:Pfam:PF02527"
     CDS             complement(39202..41091)
                     /transl_table=11
                     /gene="gidA"
                     /locus_tag="PAU_00045"
                     /old_locus_tag="PAT2077"
                     /product="trna uridine 5-carboxymethylaminomethyl
                     modification enzyme gid (glucose-inhibited division
                     protein a)"
                     /db_xref="EnsemblGenomes-Gn:PAU_00045"
                     /db_xref="EnsemblGenomes-Tr:CAQ82138"
                     /db_xref="GOA:C7BU64"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR002218"
                     /db_xref="InterPro:IPR004416"
                     /db_xref="InterPro:IPR020595"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="InterPro:IPR026904"
                     /db_xref="UniProtKB/TrEMBL:C7BU64"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82138.1"
                     /translation="MFYPEQFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQ
                     MSCNPAIGGIGKGHLVKEIDALGGLMAKATDQAGIQFRTLNASKGPAVRATRAQADRV
                     LYRQAIRTALENQPNLMIFQQPVEDLIVENDMVIGAVTRMGLKFRAKAVVLTVGTFLD
                     GKIHIGLENYSGGRAGDPPAISLSQRLRELPLRVNRLKTGTPPRIDARTIDFSQLTQQ
                     LGDTPTPVFSFLGNAGQHPQQMPCYITHTNEKTHDVIRNNLDRSPMYAGIIEGIGPRY
                     CPSIEDKVMRFADRNAHQIFLEPEGLTSNEIYPNGISTSLPFDVQMQIVHSMKGMENA
                     RIVRPGYAIEYDFFDPRDLKQTLESKFIHGLFFAGQINGTTGYEEAAAQGLLAGLNAA
                     RYATEEEGWFPRRDQAYIGVLVDDLCTLGTKEPYRMFTSRAEYRLMLREDNADLRLTE
                     KGRKLGLVDDSRWEHYCRKVEMIEQERQRLRNIWIHPHSNNLIDINDILKTPLSKEAN
                     GEDLLRRPEMNYELLTSLPLFSPGLKEPQTADQVEIQVKYEGYIARQQEEIEKQLRNE
                     NTSLPIDLDYCQISGLSNEVVAKLNDHKPSSIGQASRISGITPAAISILLVWLKKQGL
                     LRRSA"
     misc_feature    complement(39895..41070)
                     /note="HMMPfam hit to PF01134, Glucose inhibited division
                     protein A, score 6.7e-273"
                     /inference="protein motif:Pfam:PF01134"
     misc_feature    complement(39898..41070)
                     /note="HMMPfam hit to PF01266, FAD dependent
                     oxidoreductase, score 0.0011"
                     /inference="protein motif:Pfam:PF01266"
     CDS             complement(41470..41931)
                     /transl_table=11
                     /gene="mioC"
                     /locus_tag="PAU_00046"
                     /old_locus_tag="PAT2078"
                     /product="protein mioc, involved in modulation of
                     initiation at oric, initiation of chromosome replication"
                     /db_xref="EnsemblGenomes-Gn:PAU_00046"
                     /db_xref="EnsemblGenomes-Tr:CAQ82139"
                     /db_xref="GOA:C7BU65"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:C7BU65"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82139.1"
                     /translation="MKFVGITMATITLISGSTMGSAEYVAEHMAEILEDVGFSTEILH
                     GPSLNELPQEGIWLVVTSTHGAGELPENIQPLAEEIAEQKPDLSKVTFGAVGLGSSEY
                     DTFCGAIRSLDQLLIENGAKRLGDRLEIDIQQHEIPEDPAEEWVKIWATSL"
     misc_feature    complement(41497..41895)
                     /note="HMMPfam hit to PF00258, Flavodoxin, score 1.7e-35"
                     /inference="protein motif:Pfam:PF00258"
     sig_peptide     complement(41872..41931)
                     /gene="mioC"
                     /locus_tag="PAU_00046"
                     /note="Signal peptide predicted for PAT2078 by SignalP 2.0
                     HMM (Signal peptide probability 0.982) with cleavage site
                     probability 0.775 between residues 20 and 21"
     CDS             complement(42002..42463)
                     /transl_table=11
                     /gene="asnC"
                     /locus_tag="PAU_00047"
                     /old_locus_tag="PAT2079"
                     /product="regulatory protein asnc"
                     /db_xref="EnsemblGenomes-Gn:PAU_00047"
                     /db_xref="EnsemblGenomes-Tr:CAQ82140"
                     /db_xref="GOA:C7BU66"
                     /db_xref="InterPro:IPR000485"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR019885"
                     /db_xref="InterPro:IPR019887"
                     /db_xref="InterPro:IPR019888"
                     /db_xref="UniProtKB/TrEMBL:C7BU66"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82140.1"
                     /translation="MSEIYQIDNLDRDILHALMDNARTPYAELAKKFAVSPGTIHVRV
                     EKMKQAGIITGTRVDISPKQLGYDVCCFIGIILKSAKDYPSALKKLGNLNEVVEVYYT
                     TGHYSIFIKVMCRSIESLQDVLINKIQTIDEIQSTETLISLQNPIMRTIKP"
     misc_feature    complement(42029..42253)
                     /note="HMMPfam hit to PF01037, AsnC family, score 3.2e-19"
                     /inference="protein motif:Pfam:PF01037"
     misc_feature    complement(42122..42445)
                     /note="HMMSmart hit to SM00344, no description, score
                     3.3e-44"
                     /inference="protein motif:Smart:SM00344"
     CDS             42552..43622
                     /transl_table=11
                     /gene="asnA"
                     /locus_tag="PAU_00048"
                     /old_locus_tag="PAT2080"
                     /product="asparagine synthetase A"
                     /EC_number="6.3.1.1"
                     /db_xref="EnsemblGenomes-Gn:PAU_00048"
                     /db_xref="EnsemblGenomes-Tr:CAQ82141"
                     /db_xref="GOA:C7BU67"
                     /db_xref="InterPro:IPR004618"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:C7BU67"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82141.1"
                     /translation="MNLFPILLLNVFNRTSGSFKEFENNIMKKSFIEKQQQISFVKSF
                     FSRLLESKLGLIEVQGPMLSCLGDGIQDNLSGHEKAVQVKVKTLPDSTFEVVHSLAKW
                     KRKTLGRFDFQPEQGLYTHMKALRPDEDRLTPIHSVYVDQWDWEKVMGDGQRSLAYLK
                     QTVGKIYEAIKETEKAVSKEFGLAPFLPDQIHFVHSEALLSRYPELDAKGRERAIAKE
                     LGAVFLIGIGAKLSDGQSHDVRAPDYDDWTTPNSDGFAGLNGDIIVWNPVLEDAFEIS
                     SMGIRVDAATLERQLSLTGDEDRLQYDWHQALLKGDMPQSIGGGIGQSRLVMLLLQMK
                     HIGQVQCSIWSPEVRETVEDML"
     misc_feature    42636..43367
                     /note="HMMPfam hit to PF03590, Aspartate-ammonia ligase,
                     score 7.2e-167"
                     /inference="protein motif:Pfam:PF03590"
     CDS             complement(43628..45085)
                     /transl_table=11
                     /gene="viaA"
                     /gene_synonym="yieM"
                     /locus_tag="PAU_00049"
                     /old_locus_tag="PAT2081"
                     /product="protein viaa (vwa-domain protein interacting
                     with aaa atpase)"
                     /db_xref="EnsemblGenomes-Gn:PAU_00049"
                     /db_xref="EnsemblGenomes-Tr:CAQ82142"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR008912"
                     /db_xref="InterPro:IPR023481"
                     /db_xref="UniProtKB/TrEMBL:C7BU72"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82142.1"
                     /translation="MISLTTLDLLLSVNEGELIEELVLTLLASPQLAIFFEKYPRLKR
                     ALLKDIPGWKQDLQQRIKEALIPATLAEEFQLYQQLLPASTDNFYLKLPEILETLSRI
                     ESPFYTEAQKLATNAIDHSNTLQTLFIQRWRLNLILQTTNFHKELLEQEKEQLLAELQ
                     QRLTLSGNLDPILNENDRAAGRLWDMSKSQINHSRNDTQLLIHYSEFLRQQPELEKLA
                     QLLGRSQSARSKLQENHLLEPFTTIERTPDTIPEQVNGIGQSDDILRLLPTELAILGI
                     EDLEYEFYRRLIEKRLFTYQLQGDSWKQKTTLRSVTHYSQEEKPRGPFIVCVDTSGSM
                     GGFNEKCAKAFCLALLRIALADDRNCHIMLFATEVVHYELSSSDGLEQAIRFLSQTFT
                     GGTDLTFCLTSTIEKMKEQHWQDADAVVISDFIAQRLPGSLIHQIKNLQQHQQHRFHA
                     VSMSQYGKPGIMRIFDYIWRFDTGLKSRLLRKWRH"
     misc_feature    complement(43631..44125)
                     /note="HMMSmart hit to SM00327, no description, score
                     5.2e-05"
                     /inference="protein motif:Smart:SM00327"
     CDS             complement(45090..46601)
                     /transl_table=11
                     /gene="ravA"
                     /locus_tag="PAU_00050"
                     /old_locus_tag="PAT2082"
                     /product="ATPase RavA"
                     /EC_number="3.6.3.-"
                     /db_xref="EnsemblGenomes-Gn:PAU_00050"
                     /db_xref="EnsemblGenomes-Tr:CAQ82143"
                     /db_xref="GOA:C7BU73"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR022547"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C7BU73"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82143.1"
                     /translation="MVWIMQIAEKIACLSNYLESGLYERQQAIRLCLLAALCGESVFL
                     LGPPGIAKSLIARRLKFAFHDARAFEYLMTRFSTPEEIFGPLSIQALKDEGRYQRLTT
                     GYLPETEIVFLDEIWKAGPAILNTLLTAINEKKFRNGDIEEKIPMRLLVTASNELPEA
                     DSSLEALYDRMLIRIWLDKIQEKQNFRALLTNHKNEIDNPVPANIQITSEEFHQWQNE
                     INKIALPDNCFDIIYQLRQQLDVTEHSPYVSDRRWKKAIHLLQASAFFNGRKEISFLD
                     LILLKDCLWHDLHSFKLLPQHLNTLITEQAYQQRVLSQQIDSLYHQWIQVRQDKNNQQ
                     AFQLGKKIHLFRHKTQYSLPDHINEEKLTLFLHTPLYVHDIQVNFIEIEKKILNIWIN
                     KGGKLPARLNSIGFPQNITAEINSAHQIEIFDISRRSSTLYLPDSQYQQNEKSSKWLE
                     RFDKINQDIHHQRQLFNQHKPCLFIESHWLNTIEQSFIQLTDKLNQLKTKMGN"
     misc_feature    complement(46041..46490)
                     /note="HMMSmart hit to SM00382, no description, score
                     3.6e-05"
                     /inference="protein motif:Smart:SM00382"
     misc_feature    complement(46065..46481)
                     /note="HMMPfam hit to PF07728, ATPase family associated
                     with various cellul, score 1.4e-42"
                     /inference="protein motif:Pfam:PF07728"
     operon          46871..52786
                     /operon="rbs"
     CDS             46871..47275
                     /transl_table=11
                     /operon="rbs"
                     /gene="rbsD"
                     /locus_tag="PAU_00051"
                     /old_locus_tag="PAT2083"
                     /product="high affinity ribose transport protein rbsd"
                     /db_xref="EnsemblGenomes-Gn:PAU_00051"
                     /db_xref="EnsemblGenomes-Tr:CAQ82144"
                     /db_xref="GOA:C7BU74"
                     /db_xref="InterPro:IPR007721"
                     /db_xref="InterPro:IPR023064"
                     /db_xref="InterPro:IPR023750"
                     /db_xref="UniProtKB/TrEMBL:C7BU74"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82144.1"
                     /translation="MLNSEISAVISRLGHTDQITIGDAGLPIPSSAQRIDLALTQGIP
                     CFISVLKVVTHEMQVEAAFLAKEIISYNPLIHQLILAQIKELEKQQGNSITIEYISHN
                     TLKEKTEHSRAMIRTGENSPYANIILCAGVTF"
     misc_feature    46871..47272
                     /note="HMMPfam hit to PF05025, RbsD / FucU transport
                     protein family, score 2.8e-63"
                     /inference="protein motif:Pfam:PF05025"
     CDS             47283..48788
                     /transl_table=11
                     /operon="rbs"
                     /gene="rbsA"
                     /locus_tag="PAU_00052"
                     /old_locus_tag="PAT2084"
                     /product="ribose transport atp-binding protein rbsa"
                     /db_xref="EnsemblGenomes-Gn:PAU_00052"
                     /db_xref="EnsemblGenomes-Tr:CAQ82145"
                     /db_xref="GOA:C7BU75"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR015861"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C7BU75"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82145.1"
                     /translation="MQPVLELKGIGKSFPGVKALSDAALRVYPGKVMALVGENGAGKS
                     TMMKVLTGIYTRDTGMIRYLGKEVTFSSPKSSQEAGIGIIHQELNLVSQLTIAENIFL
                     GREFVNKFGTIDWKKMYQEADRLLRKLNLSYSSHRRVTELSIGEQQMVEIAKVLSFES
                     KVIIMDEPTDALTDTETESLFRVIRELKFQGCGIVYISHRLKDIFEICDDVTILRDGQ
                     FIDEKQVKELKEDNLIEMMVGRKLEDQYPRLNLPRGKKRLEVEEISGPGVRNVSFSLY
                     SGEILGISGLMGAGRTELMRIIYGALPKTQGQITLDGNPVITRNPQDALAYGIVYISE
                     DRKRDGLVLGMSVKENMSLTALRYFSNKSGSLNHKEERQAVSNFIKLFNIKTPSMEQT
                     INLLSGGNQQKVAIARGLMTRPKVLILDEPTRGIDVGAKKEIYQLINQFKKGGLSIIL
                     VSSEMPEVIGMSDRILVMHEGHISAEFFAEQATQKALMAAAVGKHYDVVQE"
     misc_feature    47367..47960
                     /note="HMMSmart hit to SM00382, no description, score
                     9.9e-08"
                     /inference="protein motif:Smart:SM00382"
     misc_feature    47370..47933
                     /note="HMMPfam hit to PF00005, ABC transporter, score
                     5.6e-48"
                     /inference="protein motif:Pfam:PF00005"
     misc_feature    48111..48698
                     /note="HMMSmart hit to SM00382, no description, score
                     1.2e-10"
                     /inference="protein motif:Smart:SM00382"
     misc_feature    48114..48695
                     /note="HMMPfam hit to PF00005, ABC transporter, score
                     1.8e-34"
                     /inference="protein motif:Pfam:PF00005"
     CDS             48795..49766
                     /transl_table=11
                     /operon="rbs"
                     /gene="rbsC"
                     /locus_tag="PAU_00053"
                     /old_locus_tag="PAT2085"
                     /product="ribose transport system permease protein"
                     /EC_number="3.6.3.17"
                     /db_xref="EnsemblGenomes-Gn:PAU_00053"
                     /db_xref="EnsemblGenomes-Tr:CAQ82146"
                     /db_xref="GOA:C7BU76"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="UniProtKB/TrEMBL:C7BU76"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82146.1"
                     /translation="MNSNASLTPKRWFTKEWLLAQKSLIALLVLIIVVSSLSPNFFTL
                     DNLFNILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALTGAVAASLVGMDVNALVAI
                     VSGLALGAAIGAGTGIIIAKGKIQAFIATLVMMLLLRGITRVYTDGSPINTGFSDNAD
                     LFSWFGIGRPLGIPTPVWLMLIVFVIAWYILHYTRLGRYIYALGGNESATRLSGISVD
                     KIKIIVYSLCGLLTALAGIIEVARLSSAQPMAGNGYELDAIAAVVLGGTRLSGGKGLI
                     VGTLIGALILGFLNNGLNLLGISSNYQMIVKAIVILLAVLIDNKSGK"
     sig_peptide     48795..48923
                     /gene="rbsC"
                     /locus_tag="PAU_00053"
                     /note="Signal peptide predicted for PAT2085 by SignalP 2.0
                     HMM (Signal peptide probability 0.950) with cleavage site
                     probability 0.733 between residues 43 and 44"
     misc_feature    order(48867..48926,48960..49028,49086..49154,49173..49232,
                     49305..49373,49458..49526,49620..49688)
                     /note="7 probable transmembrane helices predicted for
                     PAT2085 by TMHMM2.0 at aa 25-44, 56-78, 98-120, 127-146,
                     171-193, 222-244 and 276-298"
     misc_feature    48930..49739
                     /note="HMMPfam hit to PF02653, Branched-chain amino acid
                     transport syst, score 6.1e-76"
                     /inference="protein motif:Pfam:PF02653"
     CDS             49791..50681
                     /transl_table=11
                     /operon="rbs"
                     /gene="rbsB"
                     /locus_tag="PAU_00054"
                     /old_locus_tag="PAT2086"
                     /product="d-ribose-binding periplasmic protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00054"
                     /db_xref="EnsemblGenomes-Tr:CAQ82147"
                     /db_xref="InterPro:IPR025997"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="UniProtKB/TrEMBL:C7BU77"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82147.1"
                     /translation="MKMKKLAAILSAVALSATMSANTLAKDAIALVISTLNNPFFVTM
                     KDSAQKEANKLGYNLIVLDSQDNPAKELANVQDLTVRGIKLMLINPTDSDAVGNAIIM
                     ANNAEIPVITLDRMANKGRVVSHIASDNRRGSKIAGDFIAEILGNGAQVIQLEGIIGT
                     SAARERGEGFNKVAQEHKFNVLINQTADFDRTKGLNVMQNLLTAHPNVQAVFAQNDEM
                     ALGALRALQAAGKSDVLVVGFDGTEDGIKAVQSGKLGATIAQRPDQIGIIGVQTADKV
                     LKGEKVDAVIPVELELIIKK"
     sig_peptide     49791..49865
                     /gene="rbsB"
                     /locus_tag="PAU_00054"
                     /note="Signal peptide predicted for PAT2086 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.991 between residues 25 and 26"
     misc_feature    49866..50678
                     /note="HMMPfam hit to PF00532, Periplasmic binding
                     proteins and sugar b, score 1.9e-09"
                     /inference="protein motif:Pfam:PF00532"
     CDS             50853..51782
                     /transl_table=11
                     /operon="rbs"
                     /gene="rbsK"
                     /locus_tag="PAU_00055"
                     /old_locus_tag="PAT2087"
                     /product="ribokinase"
                     /EC_number="2.7.1.15"
                     /db_xref="EnsemblGenomes-Gn:PAU_00055"
                     /db_xref="EnsemblGenomes-Tr:CAQ82148"
                     /db_xref="GOA:C7BU68"
                     /db_xref="InterPro:IPR002139"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR011877"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C7BU68"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82148.1"
                     /translation="MGTAKLAVVGSINADHILNLESFPRPGETVIGKQYQIAFGGKGA
                     NQAVAAGRSGADITFIACVGQDDIGSRICQQLAMDNVNTSSIEAIEGETTGVALILVN
                     QQGENVICINAGANAALTPEYFHRYQNIIKEADALLIQLESPLETVQLAAETAKQNNT
                     KVILNPAPAQKLSDQLLSLVDIITPNETEVEYLTGITIKDNSDAEKAAKVLHGKGIET
                     VIITLGSCGIWLSEKGQKGKIVPGFKVKAVDTIAAGDTFNGALATALLEGKVMLSAVR
                     FAHSAAAIAVTRQGAQPSIPWRNEIDTFLTEQD"
     misc_feature    50859..51746
                     /note="HMMPfam hit to PF00294, pfkB family carbohydrate
                     kinase, score 8.6e-89"
                     /inference="protein motif:Pfam:PF00294"
     misc_feature    51234..51722
                     /note="HMMPfam hit to PF08543, Phosphomethylpyrimidine
                     kinase, score 9.5e-05"
                     /inference="protein motif:Pfam:PF08543"
     CDS             51785..52786
                     /transl_table=11
                     /operon="rbs"
                     /gene="rbsR"
                     /locus_tag="PAU_00056"
                     /old_locus_tag="PAT2088"
                     /product="regulator for rbs operon"
                     /note="regulator for rbs operon"
                     /db_xref="EnsemblGenomes-Gn:PAU_00056"
                     /db_xref="EnsemblGenomes-Tr:CAQ82149"
                     /db_xref="GOA:C7BU69"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="UniProtKB/TrEMBL:C7BU69"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82149.1"
                     /translation="MATIKDVARFAGVSTSTVSHVINNNRYVSDGVKKKVNDAINQLN
                     YAPSALARSLKVKQTKTIGMLVTTSNNPFYAEIVRGVERSCYERGYSLILCNTEGDIK
                     RMDHSMETLLQKRVDGLLIMCAENQCTSCDVLRRYPPLPMVMMDWSPFDIVGDIIQDN
                     SLLGGEMATNHLISCGFKKIACIAGPQDKTPARHRLEGYRKAMAKVGYAIPDGYEIYS
                     DFEFAGGFESMQKLLQHPEPPEAVFAGNDAMAVGAYQALYQAGLSVPNDISIIGYDDI
                     DLAPYMIPPLTTIHQPKDELGKLAIDTLLYRMGNPESDPKLLVLTPTLIERNSVFRS"
     misc_feature    51785..51997
                     /note="HMMSmart hit to SM00354, no description, score
                     2.1e-33"
                     /inference="protein motif:Smart:SM00354"
     misc_feature    51788..51865
                     /note="HMMPfam hit to PF00356, Bacterial regulatory
                     proteins, lacI fami, score 1.2e-12"
                     /inference="protein motif:Pfam:PF00356"
     misc_feature    51959..52768
                     /note="HMMPfam hit to PF00532, Periplasmic binding
                     proteins and sugar b, score 2.3e-17"
                     /inference="protein motif:Pfam:PF00532"
     CDS             complement(52783..54174)
                     /transl_table=11
                     /gene="yieO"
                     /locus_tag="PAU_00057"
                     /old_locus_tag="PAT2089"
                     /product="putative transport protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00057"
                     /db_xref="EnsemblGenomes-Tr:CAQ82150"
                     /db_xref="GOA:C7BU70"
                     /db_xref="InterPro:IPR004638"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C7BU70"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82150.1"
                     /translation="MVKTARNMAGLPWIAAIAFFMQALDATILNTALPAIAESLEHSP
                     LAMQSAVVSYTLTVALLIPVSGWLADRFGTRRIFIFAVSLFSLGSLACALSGNLAFLV
                     VSRVIQGIGGAMMMPVARLALLRAYPRSELLPVLNFVTMPGLVGPILGPMLGGLLVTY
                     ATWHWIFIINIPIGLLGIIYAKKHMPNFTMPKRSFDFSGFILFGLSLIMVSISLDLLG
                     ESSLPSYIPFTIMIVGFTMLFGYLMHARKHPQPLISLNLFRTRTFSIGIIGNIVTRLG
                     TGCIPFLMPLMLQIGFGYPAVIAGMMMAPTAIGSIIAKSFVTNVLTRFGYRKILVSIT
                     VIIGLIISQFSLQSPEIPVVLLVIPLFLLGMAVSIQFTSMNTITLADLTNNNASSGNS
                     LLAVTQQLSISFGVAVSAAILRFYDSMPHGTTVDHFHNTFITVGIMTLLSSSTFLLLH
                     KEDGDNLIKEKNT"
     misc_feature    complement(order(52825..52884,52927..52995,53056..53124,
                     53137..53205,53239..53307,53320..53388,53449..53508,
                     53536..53595,53632..53691,53701..53769,53803..53871,
                     53881..53949,53968..54027,54070..54138))
                     /note="14 probable transmembrane helices predicted for
                     PAT2089 by TMHMM2.0 at aa 13-35, 50-69, 76-98, 102-124,
                     136-158, 162-181, 194-213, 223-242, 263-285, 290-312,
                     324-346, 351-373, 394-416 and 431-450"
     misc_feature    complement(52933..54132)
                     /note="HMMPfam hit to PF07690, Major Facilitator
                     Superfamily, score 1.8e-49"
                     /inference="protein motif:Pfam:PF07690"
     sig_peptide     complement(54064..54174)
                     /gene="yieO"
                     /locus_tag="PAU_00057"
                     /note="Signal peptide predicted for PAT2089 by SignalP 2.0
                     HMM (Signal peptide probability 0.982) with cleavage site
                     probability 0.814 between residues 37 and 38"
     CDS             complement(54345..54569)
                     /transl_table=11
                     /locus_tag="PAU_00058"
                     /old_locus_tag="PAT2090"
                     /product="Hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00058"
                     /db_xref="EnsemblGenomes-Tr:CAQ82151"
                     /db_xref="UniProtKB/TrEMBL:C7BU71"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82151.1"
                     /translation="MPAESSPYWLFSAWPDNVYQRCVGQWWRIIGRSSALASVYLQKT
                     FVRVFFQQILYFWWFFYTKTNVIDSNSSQI"
     rRNA            54772..56260
                     /gene="16S rRNA"
                     /product="16S ribosomal RNA"
     tRNA            56391..56463
                     /product="transfer RNA-Glu"
                     /anticodon=(pos:56425..56427,aa:Glu)
                     /note="tRNA Glu anticodon TTC, Cove score58.81"
     rRNA            57296..59677
                     /gene="23S rRNA"
                     /product="23S ribosomal RNA"
     rRNA            59813..59928
                     /inference="similar to RNA sequence:Rfam:RF00001"
     CDS             complement(60039..61622)
                     /transl_table=11
                     /gene="yhbX"
                     /locus_tag="PAU_00059"
                     /old_locus_tag="PAT2096"
                     /product="outer-membrane protein yhbx"
                     /db_xref="EnsemblGenomes-Gn:PAU_00059"
                     /db_xref="EnsemblGenomes-Tr:CAQ82152"
                     /db_xref="GOA:C7BTZ0"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="UniProtKB/TrEMBL:C7BTZ0"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82152.1"
                     /translation="MQNKLSILIISLLTLLPIIFIGDIAHEYKLRIVLLNFFLAGTSA
                     FLYRFNYLKPLVFITSLLWSLNISTSFFFSNEYQINFSSTIANTFINTNSNEAVGMLS
                     YNKHYVLFFIFMLLTYFLSIRWLSKNTNYRLLKFSVWALFFTCLLVPIDYYISEKKLS
                     DNIILTEYFLMVTPFNNSSAIVRAIYENQQIRKIASVNVKFNYIQEDKNIDTYILLIG
                     ESARRDHMSLYGYDKATTPTLDAMQKNMLIFNQAISPASVTILSVPISLSNITLYQLR
                     DKAHYADNIISLAKDAGFNTTWISNQGRSGKSNSLITVIANMAESQKWNKYIGYDEEL
                     LPYLDDALKQKGKKFIIMHIYGSHEPSCNRFPENKLISFSSNKDDNCYDSSIAYTDLL
                     IDKIIDKLKGNKASILYFSDHGLQRLDKDGDIRYHHGVSNPRKDSYNIPLLIWYDDSI
                     NSQYRHTGVINTPFSTTDNYYLISDWLGIHHKSPEHCRSPLSNCFKSLKELMVIDGNK
                     NLMEYSKLPDEKDIKTSGK"
     misc_feature    complement(60159..60995)
                     /note="HMMPfam hit to PF00884, Sulfatase, score 3.9e-49"
                     /inference="protein motif:Pfam:PF00884"
     misc_feature    complement(order(61158..61226,61245..61304,61404..61463,
                     61482..61535,61545..61604))
                     /note="5 probable transmembrane helices predicted for
                     PAT2096 by TMHMM2.0 at aa 7-26, 30-47, 54-73, 107-126 and
                     133-155"
     sig_peptide     complement(61548..61622)
                     /gene="yhbX"
                     /locus_tag="PAU_00059"
                     /note="Signal peptide predicted for PAT2096 by SignalP 2.0
                     HMM (Signal peptide probability 0.703) with cleavage site
                     probability 0.543 between residues 25 and 26"
     CDS             complement(61771..63420)
                     /transl_table=11
                     /gene="actP"
                     /gene_synonym="yjcG"
                     /locus_tag="PAU_00060"
                     /old_locus_tag="PAT2097"
                     /product="cation/acetate symporter actp (acetate
                     transporter actp) (acetat permease)"
                     /db_xref="EnsemblGenomes-Gn:PAU_00060"
                     /db_xref="EnsemblGenomes-Tr:CAQ82153"
                     /db_xref="GOA:C7BTZ1"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="InterPro:IPR014083"
                     /db_xref="InterPro:IPR018212"
                     /db_xref="UniProtKB/TrEMBL:C7BTZ1"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82153.1"
                     /translation="MKKSLLTVILLFSNLTWADAISGSVERQPVNIQAIIMFVLFVGF
                     TLYITYWASKRTRSRTDYYTAGGRITGFQNGMAIAGDFMSAASFLGISALVYISGYDG
                     LIYSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLQQRPIRTLSAIGSLVVVALY
                     LIAQMVGAGKLIELLFGLDYHIAVVLVGILMVLYVLFGGMLATTWVQIIKAILLLAGA
                     TFMAFMVMKAVNFNFNTLFKEAVAVHSKGEAIMSPGGLVSDPISALSLGLALMFGTAG
                     LPHIIMRFFTVNDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVSPNPLFKEATGA
                     LIGGTNMAAVHLASAVGGNLFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANVIK
                     HGKANERDELKVSKITVVILGLVAIGLGILFENQNIAFMVGLAFSIAASCNFPIILLS
                     MYWRKLTTRGALVGGWLGLITAVVLMILGPTIWVSILGHEKPIYPYEYPALFSMIVAF
                     IGSWLFSITDNSLQGIQERGKFRAQFIRSQTGFGIAQGKAH"
     misc_feature    complement(order(61873..61941,61969..62037,62071..62139,
                     62152..62211,62272..62340,62464..62532,62566..62634,
                     62722..62790,62809..62877,62920..62988,63049..63117,
                     63130..63198,63259..63327,63355..63408))
                     /note="14 probable transmembrane helices predicted for
                     PAT2097 by TMHMM2.0 at aa 5-22, 32-54, 75-97, 102-124,
                     145-167, 182-204, 211-233, 263-285, 297-319, 361-383,
                     404-423, 428-450, 462-484 and 494-516"
     misc_feature    complement(62017..63237)
                     /note="HMMPfam hit to PF00474, Sodium:solute symporter
                     family, score 3.2e-173"
                     /inference="protein motif:Pfam:PF00474"
     sig_peptide     complement(63367..63420)
                     /gene="actP"
                     /locus_tag="PAU_00060"
                     /note="Signal peptide predicted for PAT2097 by SignalP 2.0
                     HMM (Signal peptide probability 0.999) with cleavage site
                     probability 0.990 between residues 18 and 19"
     CDS             complement(63417..63728)
                     /transl_table=11
                     /gene="yjcH"
                     /locus_tag="PAU_00061"
                     /old_locus_tag="PAT2098"
                     /product="similar to putative membrane protein yjch of
                     escherichia coli"
                     /db_xref="EnsemblGenomes-Gn:PAU_00061"
                     /db_xref="EnsemblGenomes-Tr:CAQ82154"
                     /db_xref="GOA:C7BTZ2"
                     /db_xref="InterPro:IPR007436"
                     /db_xref="UniProtKB/TrEMBL:C7BTZ2"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82154.1"
                     /translation="MNDVIYQGIENNPRFKELVKKRGRFAWLLSIITLVLYVSFIFTI
                     AFTPEWLGTPLYAGSHITRGIPVGIGLIVISFILTGLYVIRANSEFDSLTSQILIEVK
                     K"
     misc_feature    complement(63420..63728)
                     /note="HMMPfam hit to PF04341, Protein of unknown
                     function, DUF485, score 5e-46"
                     /inference="protein motif:Pfam:PF04341"
     misc_feature    complement(order(63477..63545,63588..63656))
                     /note="2 probable transmembrane helices predicted for
                     PAT2098 by TMHMM2.0 at aa 25-47 and 62-84"
     CDS             complement(63794..65749)
                     /transl_table=11
                     /gene="acs"
                     /locus_tag="PAU_00062"
                     /old_locus_tag="PAT2099"
                     /product="acetyl-coenzyme A synthetase"
                     /EC_number="6.2.1.1"
                     /db_xref="EnsemblGenomes-Gn:PAU_00062"
                     /db_xref="EnsemblGenomes-Tr:CAQ82155"
                     /db_xref="GOA:C7BTZ3"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR011904"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="InterPro:IPR032387"
                     /db_xref="UniProtKB/TrEMBL:C7BTZ3"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82155.1"
                     /translation="MTQIMKYPIPAIIAEHTLMNKQQYQQNYQLSLQDPEKFWGDKGK
                     IVDWIKPYTKVKNTSFDPGHINIRWFEDGTLNLSANCLDRHLKERGDQTAIIWEGDDP
                     TESKTVTYRELHHDVCQFANVLKNLGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHS
                     VIFAGFSPDAVSGRIIDSNTKLVITADEGLRAGRTIPLKKNVDDALSNTAVVSVSNVI
                     VFKRTGNINNWHSGRDLWWHELTAGVSADCPVEEMNAEDPLFILYTSGSTGKPKGVLH
                     TTGGYLVYASLTFKYVFDYHPGEIYWCTADVGWVTGHSYLLYGPLSCGAITLMFEGVP
                     NYPAANRLSQVIDKHQVNILYTAPTAIRALMAEGDKAIEGTKRTSLRIMGSVGEPINP
                     EAWEWYYQKIGNKQCPIVDTWWQTETGGFMITPLPGATELKAGSATLPFFGVQPALVD
                     NLGELLEGACEGNLVITDSWPGQARSLFGDHDRFEQTYFSAFKGMYFSGDGARRDEDG
                     YYWITGRVDDVLNISGHRLGTAEIESALVSHPKIAEAAVVGVPHNIKGQAIYAYVTLI
                     HGEEPSPQLYTEVRNWVRKEIGPIATPDILHWTDSLPKTRSGKIMRRILRKIASGDIS
                     NLGDTSTLADPGVVEKLLEEKQTMNIS"
     misc_feature    complement(64109..65425)
                     /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
                     3.8e-135"
                     /inference="protein motif:Pfam:PF00501"
     CDS             66060..66749
                     /transl_table=11
                     /gene="sodA"
                     /locus_tag="PAU_00063"
                     /old_locus_tag="PAT2100"
                     /product="superoxide dismutase [mn] (mnsod)"
                     /EC_number="1.15.1.1"
                     /note="Superoxide dismutases (SODs) () catalyse the
                     conversion of superoxide radicals to molecular oxygen.
                     Their function is to destroy the radicals that are
                     normally produced within cells and are toxic to biological
                     systems"
                     /db_xref="EnsemblGenomes-Gn:PAU_00063"
                     /db_xref="EnsemblGenomes-Tr:CAQ82156"
                     /db_xref="GOA:C7BTZ4"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="InterPro:IPR019833"
                     /db_xref="UniProtKB/TrEMBL:C7BTZ4"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82156.1"
                     /translation="MIMLFTEMWTWNHSYMTGVHDMSYSLPSLPYSYDALEPHFDKQT
                     MEIHHTKHHQTYINNTNSALEACPELAKLDIDDLIQQLDKIPADKRTFVRNNAGGHSN
                     HSLFWKGLKLKTTLKGPLKEAIERDFGSVDVFKEKFEQAAATRFGSGWAWLVLKDDGK
                     LAIVSTANQDSPLMGEAISGASGYPIIGLDVWEHAYYLQYQNRRPDYIKAFWHVVNWD
                     EAAERYQAKVK"
     misc_feature    66126..66392
                     /note="HMMPfam hit to PF00081, Iron/manganese superoxide
                     dismutases, alpha-, score 2.7e-48"
                     /inference="protein motif:Pfam:PF00081"
     misc_feature    66408..66731
                     /note="HMMPfam hit to PF02777, Iron/manganese superoxide
                     dismutases, C-term, score 6.1e-63"
                     /inference="protein motif:Pfam:PF02777"
     CDS             66867..67538
                     /transl_table=11
                     /gene="yiiM"
                     /locus_tag="PAU_00064"
                     /old_locus_tag="PAT2101"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00064"
                     /db_xref="EnsemblGenomes-Tr:CAQ82157"
                     /db_xref="GOA:C7BTZ5"
                     /db_xref="InterPro:IPR005163"
                     /db_xref="InterPro:IPR005302"
                     /db_xref="InterPro:IPR011037"
                     /db_xref="UniProtKB/TrEMBL:C7BTZ5"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82157.1"
                     /translation="MHYPQVYTGKIEISEKLSASAINKRMVDGRLHLTALGLEGDEQA
                     ETRFHGGPDRALCHYPREHYDFWIRQFPEQEDFFIAPAFGENISTTGLTEENVCIGDI
                     FSWGETMIQVTQPRSPCYKLNSHSGISNFSAIMQESGRCGWLYRVIASGNISPDEPLV
                     LVSRNSDVLVKEAIAIAFNMPFDEEQYRRLMSAAALSASWSLTMQKRVMLGKIEDFNR
                     RLFGK"
     misc_feature    66972..67349
                     /note="HMMPfam hit to PF03473, MOSC domain, score 1.3e-44"
                     /inference="protein motif:Pfam:PF03473"
     misc_feature    67365..67505
                     /note="HMMPfam hit to PF03475, 3-alpha domain, score
                     5.6e-09"
                     /inference="protein motif:Pfam:PF03475"
     CDS             complement(68401..68709)
                     /transl_table=11
                     /gene="orf2"
                     /locus_tag="PAU_00065"
                     /old_locus_tag="PAT2102"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00065"
                     /db_xref="EnsemblGenomes-Tr:CAQ82158"
                     /db_xref="UniProtKB/TrEMBL:C7BTZ6"
                     /inference="similar to DNA sequence:INSD:AE009442"
                     /inference="similar to DNA sequence:INSD:AF346500"
                     /protein_id="CAQ82158.1"
                     /translation="MMTVVSGGPLTWFFVLPDGVTVRLTIDHVGLDDSAVRLSYPGLG
                     IHEGFLDAEQGLIIAYAHGPETFVMRYDEPSVSHSELLGTNPWIDFSSNTPKLFKKVK
                     "
     CDS             complement(68851..69888)
                     /transl_table=11
                     /gene="trpS"
                     /locus_tag="PAU_00066"
                     /old_locus_tag="PAT2103"
                     /product="tryptophanyl-tRNA synthetase (tryptophan--tRNA
                     ligase (trprs)"
                     /EC_number="6.1.1.2"
                     /db_xref="EnsemblGenomes-Gn:PAU_00066"
                     /db_xref="EnsemblGenomes-Tr:CAQ82159"
                     /db_xref="GOA:C7BTZ7"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR024109"
                     /db_xref="UniProtKB/TrEMBL:C7BTZ7"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82159.1"
                     /translation="MNKPTVSEKPNSQKPIVFSGAQPSGELTIGNYMGALRQWVKMQD
                     DYDCIYCIVDQHAITVRQDPTALKKRTLDTLALYLACGIDPKKSTIFVQSHVPQHAQL
                     SWVLNCYTYFGELSRMTQFKDKSARHAENINAGLFDYPVLMAADILVYQTNQVPVGID
                     QKQHLELSRDIAQRFNAIYGDIFTVPEPFIPTGGARVMALQDPEKKMSKSDDNRNNII
                     ALLEDPKSAAKKIKRAVTDSEEPPRVRYDLEQKPGVSNLLDILVGVTGKTIPELEAEF
                     EGQMYGHLKSAVADAVSGMLTELQERFHHFRNDEALLNKIMAEGAAKAKARAQITLDK
                     VYEAVGFIAHP"
     misc_feature    complement(68998..69849)
                     /note="HMMPfam hit to PF00579, tRNA synthetases class I (W
                     and Y), score 8.2e-119"
                     /inference="protein motif:Pfam:PF00579"
     CDS             complement(69893..70597)
                     /transl_table=11
                     /gene="gph"
                     /locus_tag="PAU_00067"
                     /old_locus_tag="PAT2104"
                     /product="phosphoglycolate phosphatase"
                     /EC_number="3.1.3.18"
                     /db_xref="EnsemblGenomes-Gn:PAU_00067"
                     /db_xref="EnsemblGenomes-Tr:CAQ82160"
                     /db_xref="GOA:C7BTZ8"
                     /db_xref="InterPro:IPR006346"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C7BTZ8"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82160.1"
                     /translation="MANKVLKGIRAVAFDLDGTLVDSAGGLADALDQALLAKGFPTAG
                     KERVAAWVGNGADIMVERALTWAKVDLTVQLHTETRKLFDQFYETTVTTGSQLFPEVK
                     TTLKELAKHNLPMGIITNKPTPFIAPLLASLGISEYFSLVLGGDDVKEKKPHPAPIYL
                     TMGTFGLRKEELLFVGDSRNDILAAQAAGCPCVGLTYGYNYGESIALSNPDCILTNFS
                     DLLPTIGLPSLKLQEA"
     misc_feature    complement(70004..70573)
                     /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
                     hydrolase, score 8.3e-37"
                     /inference="protein motif:Pfam:PF00702"
     CDS             complement(70587..71279)
                     /transl_table=11
                     /gene="rpe"
                     /locus_tag="PAU_00068"
                     /old_locus_tag="PAT2105"
                     /product="ribulose-phosphate 3-epimerase"
                     /EC_number="5.1.3.1"
                     /db_xref="EnsemblGenomes-Gn:PAU_00068"
                     /db_xref="EnsemblGenomes-Tr:CAQ82161"
                     /db_xref="GOA:C7BTZ9"
                     /db_xref="InterPro:IPR000056"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR026019"
                     /db_xref="UniProtKB/TrEMBL:C7BTZ9"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:U18997"
                     /protein_id="CAQ82161.1"
                     /translation="MEKIMKDFLIAPSILSADFARLGADTAEVLAAGADVVHFDVMDN
                     HYVPNLTFGPMVCQALRNYGITAPIDVHLMVKPVDRIIPDFAKAGATYITFHPEASEH
                     IDRSLQLIKEYGCKAGLVFNPATPLSYLDYVLDKLDVILLMSVNPGFGGQSFIPRTLD
                     KLRQVRKIIDKSGYDIRLEVDGGIKTSNIAQAAEAGADMFVAGSAIFSQSDYKTVIDN
                     MRSELSKVSHGK"
     misc_feature    complement(70650..71255)
                     /note="HMMPfam hit to PF00834, Ribulose-phosphate 3
                     epimerase family, score 8.5e-140"
                     /inference="protein motif:Pfam:PF00834"
     CDS             complement(71330..72142)
                     /transl_table=11
                     /gene="dam"
                     /locus_tag="PAU_00069"
                     /old_locus_tag="PAT2106"
                     /product="DNA adenine methylase
                     (deoxyadenosyl-methyltransferase (dna adenine
                     methyltransferase)"
                     /EC_number="2.1.1.72"
                     /db_xref="EnsemblGenomes-Gn:PAU_00069"
                     /db_xref="EnsemblGenomes-Tr:CAQ82162"
                     /db_xref="GOA:C7BU00"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR012263"
                     /db_xref="InterPro:IPR012327"
                     /db_xref="InterPro:IPR023095"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C7BU00"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82162.1"
                     /translation="MKKKRAFLKWAGGKYPLVDDIKRHLPAGSCLIEPFVGAGSVFLN
                     TDYDSYILADINSDLINLYNTVKFRANEFIAHTRPLFTQEYNSAEHFYQLREQFNQST
                     DPFHRSVLFLYLNRHCYNGLCRYNSHGKFNVPFGRYKKPYFPEEELYWFAEKAQNATF
                     ICEHYQYTLDKAHKGSVIYCDPPYAPLSATANFTAYHTNSFNITDQENLAHIAFKLSS
                     ERAIPVLISNHDTPMTRKWYYQASLHIVKARRTISRNILARSKVDELLALYR"
     misc_feature    complement(71387..72115)
                     /note="HMMPfam hit to PF02086, D12 class N6
                     adenine-specific DNA met, score 3.2e-97"
                     /inference="protein motif:Pfam:PF02086"
     CDS             complement(72227..73180)
                     /transl_table=11
                     /gene="damX"
                     /locus_tag="PAU_00070"
                     /old_locus_tag="PAT2107"
                     /product="putative membrane protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00070"
                     /db_xref="EnsemblGenomes-Tr:CAQ82163"
                     /db_xref="GOA:C7BU01"
                     /db_xref="InterPro:IPR007730"
                     /db_xref="UniProtKB/TrEMBL:C7BU01"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE009952"
                     /protein_id="CAQ82163.1"
                     /translation="MAVLALFGGHMDEFKSENAQRADNEFRPDTSDRRPSRSRQQLNK
                     PKFAISRQQMMIGVGILVLLLLIIAISSALKAPTEHEKQQSPNVAERNIDLSSSSAKK
                     DDNGQSVTSENTTTDAMNRPQEIHVPPVSGTPMHPQPPQVNSGENQQIELSGNIPDVL
                     TQQQSNINHAVQNLNKTQQPQTITPPPPVQQKSENIRPLKPEESTKSKPSTNHTTNSK
                     NNVANTGNNLLKTPPNHYTLQLSSASRSDTLTSFAKKHNLTHYKVYETKRNGKTWFVL
                     IHGNYRSVSEAKRAVSSLPDEIQAKKPWVRTMQQVQQDLRK"
     misc_feature    complement(72260..72487)
                     /note="HMMPfam hit to PF05036, Sporulation related domain,
                     score 2.4e-09"
                     /inference="protein motif:Pfam:PF05036"
     misc_feature    complement(72959..73027)
                     /note="1 probable transmembrane helix predicted for
                     PAT2107 by TMHMM2.0 at aa 52-74"
     CDS             complement(73302..74402)
                     /transl_table=11
                     /gene="aroB"
                     /locus_tag="PAU_00071"
                     /old_locus_tag="PAT2108"
                     /product="3-dehydroquinate synthase"
                     /EC_number="4.2.3.4"
                     /db_xref="EnsemblGenomes-Gn:PAU_00071"
                     /db_xref="EnsemblGenomes-Tr:CAQ82164"
                     /db_xref="GOA:C7BU02"
                     /db_xref="InterPro:IPR016037"
                     /db_xref="InterPro:IPR030960"
                     /db_xref="InterPro:IPR030963"
                     /db_xref="UniProtKB/TrEMBL:C7BU02"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82164.1"
                     /translation="MEKIIVTLGERSYPITIAKGLFDDPSAFAPLKAGQQVMLVTNQT
                     LAPLYLAKVKATLQQAGVRVDEIILPDGEQYKSLSILDDVFSALLENNHGRDTTLIAL
                     GGGVIGDLTGFAAACYQRGVRFIQIPTTLLAQVDSSVGGKTAVNHPLGKNMIGAFYQP
                     VSVMVDLNCLQTLPARELSSGLAEVIKYGIILDSEFFSWLEDNMDKLLALDNKAMAYC
                     IRRCCELKAEVVAADEKELSGLRALLNLGHTFGHAIETEMGYGVWLHGEAVAAGIVMA
                     TRTAQLAGDFSEQDTQRIIRLLKRANLPVHGPQNMSPETYLPHMMRDKKVIAGKLHLI
                     LPIAIGKASLRADIGYDCVLEAVRQCLPSESV"
     misc_feature    complement(73422..74354)
                     /note="HMMPfam hit to PF01761, 3-dehydroquinate synthase,
                     score 6.9e-184"
                     /inference="protein motif:Pfam:PF01761"
     CDS             complement(74449..74970)
                     /transl_table=11
                     /gene="aroK"
                     /locus_tag="PAU_00072"
                     /old_locus_tag="PAT2109"
                     /product="shikimate kinase I"
                     /EC_number="2.7.1.71"
                     /db_xref="EnsemblGenomes-Gn:PAU_00072"
                     /db_xref="EnsemblGenomes-Tr:CAQ82165"
                     /db_xref="GOA:C7BU03"
                     /db_xref="InterPro:IPR000623"
                     /db_xref="InterPro:IPR023000"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR031322"
                     /db_xref="UniProtKB/TrEMBL:C7BU03"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82165.1"
                     /translation="MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIERRTG
                     ADVGWVFDVEGEEGFREREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVY
                     LETTIEKQLARTQRDKKRPLLQVDAPAREVLENLADERNPLYEEIADVTIRTDEQSAK
                     VVANQIIELLEKN"
     misc_feature    complement(74458..74934)
                     /note="HMMPfam hit to PF01202, Shikimate kinase, score
                     1.9e-80"
                     /inference="protein motif:Pfam:PF01202"
     CDS             complement(75340..76374)
                     /transl_table=11
                     /gene="hofQ"
                     /locus_tag="PAU_00073"
                     /old_locus_tag="PAT2110"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00073"
                     /db_xref="EnsemblGenomes-Tr:CAQ82166"
                     /db_xref="GOA:C7BU04"
                     /db_xref="InterPro:IPR001775"
                     /db_xref="InterPro:IPR004845"
                     /db_xref="InterPro:IPR004846"
                     /db_xref="InterPro:IPR005644"
                     /db_xref="UniProtKB/TrEMBL:C7BU04"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82166.1"
                     /translation="MTKKFILFIIFLPVICVAEIRNPFTPPIIEPEEQPTELIDQSVY
                     DTEIQHIATTLQYADAERIALNLRQNTPALMTKEGKADFDPETNSLILKDTPIAIAQI
                     KSWLKEIDTPQQQVQITAHIVTSSREALHELGIYWGIPIGEQLNTSTGINRLNINQAA
                     NDNMHRFALNIARIHTSLLELELSALEQENLLDIIASPRLTASHQQLASIKQGSDIPY
                     VSQEKEKSTVQFKEAVLGMEVTPHILRKDKIRLSLKISQNMPGISISQGGGENLTIDK
                     QEIMTQVTVKNGETLILGGIFQQKKGEKTQKIPYLSDIPLLGSLFDQKGHKHSRRELI
                     IFITPQLMDI"
     misc_feature    complement(75346..76026)
                     /note="HMMPfam hit to PF00263, Bacterial type II and III
                     secretion system, score 1.6e-62"
                     /inference="protein motif:Pfam:PF00263"
     misc_feature    complement(76030..76227)
                     /note="HMMPfam hit to PF03958, Bacterial type II/III
                     secretion system sho, score 1.4e-07"
                     /inference="protein motif:Pfam:PF03958"
     sig_peptide     complement(76321..76374)
                     /gene="hofQ"
                     /locus_tag="PAU_00073"
                     /note="Signal peptide predicted for PAT2110 by SignalP 2.0
                     HMM (Signal peptide probability 0.867) with cleavage site
                     probability 0.783 between residues 18 and 19"
     CDS             complement(76367..76912)
                     /transl_table=11
                     /locus_tag="PAU_00074"
                     /old_locus_tag="PAT2111"
                     /product="similar to putative membrane protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00074"
                     /db_xref="EnsemblGenomes-Tr:CAQ82167"
                     /db_xref="GOA:C7BU05"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="UniProtKB/TrEMBL:C7BU05"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to AA sequence:UniProt:Q0WKF4;"
                     /protein_id="CAQ82167.1"
                     /translation="MIKSDYLWWFAKPAWLLFVWQQASIIPFLLLFYLFFWQESTEQE
                     INLTQEIVAQEINTKSTNDRLNQLPLLENIQQHIHQIENELSKPSQNTVKISAVKQLQ
                     QPLINSGGQILEWQRKKEGEKTLWQIMIYLNYEQMLDFLSALQTLHPPLLIKQFSVSP
                     SGEFLNVKMTLSETSYEELYD"
     misc_feature    complement(76802..76870)
                     /note="1 probable transmembrane helix predicted for
                     PAT2111 by TMHMM2.0 at aa 15-37"
     CDS             complement(76899..77453)
                     /transl_table=11
                     /gene="yrfC"
                     /locus_tag="PAU_00075"
                     /old_locus_tag="PAT2112"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00075"
                     /db_xref="EnsemblGenomes-Tr:CAQ82168"
                     /db_xref="GOA:C7BU06"
                     /db_xref="InterPro:IPR007813"
                     /db_xref="InterPro:IPR016778"
                     /db_xref="UniProtKB/TrEMBL:C7BU06"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82168.1"
                     /translation="MMYQVNFLPWRQTRLKQRYRWWIILLLLQLILWLIVLIWISFKQ
                     QETINRYQRQLQQLNRQQLHLQQQITQTEEAFNLYNKLTYKLKQQQTRLRQNQQHLKL
                     FNQLPDLLPEGSWLTAFDDHAGQLKLVANSLDYSSMTSLLDNLENNEQLSEIQLKKMT
                     TTEQQIRQSIIDANWQTEIPDDKK"
     misc_feature    complement(76956..77441)
                     /note="HMMPfam hit to PF05137, Fimbrial assembly protein
                     (PilN), score 1.3e-06"
                     /inference="protein motif:Pfam:PF05137"
     sig_peptide     complement(77325..77453)
                     /gene="yrfC"
                     /locus_tag="PAU_00075"
                     /note="Signal peptide predicted for PAT2112 by SignalP 2.0
                     HMM (Signal peptide probability 0.617) with cleavage site
                     probability 0.541 between residues 43 and 44"
     misc_feature    complement(77334..77393)
                     /note="1 probable transmembrane helix predicted for
                     PAT2112 by TMHMM2.0 at aa 21-40"
     CDS             complement(77450..78280)
                     /transl_table=11
                     /gene="yrfD"
                     /locus_tag="PAU_00076"
                     /old_locus_tag="PAT2113"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00076"
                     /db_xref="EnsemblGenomes-Tr:CAQ82169"
                     /db_xref="InterPro:IPR005883"
                     /db_xref="UniProtKB/TrEMBL:C7BU34"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82169.1"
                     /translation="MYSPKWYVGLDIQNGIVRAVAAIKRRDGWQLRHCWQYLLPDVVM
                     PEGRLQRPEILRDILNQWRQKLPKKISFRLALPVQQTLQRNLILPSDISLKEPEQGWF
                     INASAEKQFPFNTRELTLDYRIIEQNAYISAARQKDLDLWLQCLAQAGIFPDAIDIAP
                     CALRYMAQYSGVPINSWLLHRQQSGWLWVSPANAPFAYDLVSANTAVSPQQIISQLPA
                     LSIIEEKIYYSSFQHEALPEGTCSWDMLAAFRHYHPPLPIQLMEYVIAGGLALRPDDK
                     "
     CDS             78400..80928
                     /transl_table=11
                     /gene="mrcA"
                     /locus_tag="PAU_00077"
                     /old_locus_tag="PAT2114"
                     /product="penicillin-binding protein 1a (pbp-1a) (pbp1a)
                     (penicillin-bindin protein a)"
                     /note="penicillin-binding protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00077"
                     /db_xref="EnsemblGenomes-Tr:CAQ82170"
                     /db_xref="GOA:C7BU35"
                     /db_xref="InterPro:IPR001264"
                     /db_xref="InterPro:IPR001460"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="InterPro:IPR023346"
                     /db_xref="InterPro:IPR031376"
                     /db_xref="UniProtKB/TrEMBL:C7BU35"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82170.1"
                     /translation="MKFVKYFLIFVVCCIFLGTVSIFGMYKYIEPQLPDVATLKDVRL
                     QTPMQVFSADGELIAQYGEKRRMPLTLSEIPPIMVKAFIATEDSRFYEHHGVDPVGII
                     RAASVAVSSGRASQGASTITQQLARNFFLSPEKTLTRKIKEVFLAIRIEQLLNKDEIL
                     ELYLNKIYLGYRAYGVGAAAQVYFGKSVNELTLSEIAMIAGLPKAPSTFNPLYSYGRA
                     INRRNVVLSRMLDQGYITQQQYNQARNEKLVANYHAPQIAFSAPYLSEMVRQEMIERY
                     GENAYTDGYKVYTTITRKLQLAAVEAARNNTIDYDVRHGYRGAQEVLWKVGESGWSQE
                     QILKKLKTLPNYDPLMPAVVTRVSTDRATVMLADGSNVELPMAGVRWARKFRSDNAQG
                     AVPRSVNEVVQAGEQVWVRKVKDIWWLAQIPEVNVALVSIDPNDGAVKALVGGFDFNL
                     SKFNRVTQSLRQIGSNIKPFLYAAAMDKGLTLASLLNDLPISRWDAGAGTDWRPKNSP
                     PTYAGPIRLRQGLGQSKNVVMVRAMRAMGVDYAADYLQRFGFPGKNIVRTESLALGAP
                     SFTPMQVVRGYSVMSNGGYLVDPYFITKIENEDGDILFEARPKVACSQCDIPVIYGDT
                     ARSIELSENSIENVAQSHVSQQEILPLPELEKVPVMDGNENEQKYAPHVISTPLAFLI
                     HDALNSNIFGEPGWTGTGWRASRDLKRRDIGGKTGTTNSSKDAWFSGYGPDIVTTVWI
                     GFDDHRRSLGRTAAGGGEAGAKSAQPIWDDFMKVALEGVAEKEIAPPPGIVSVVIDRR
                     TGKLAGGGGDTRSEYFIDGTQPTESAIQEVGTTLIEDGESQELF"
     sig_peptide     78400..78471
                     /gene="mrcA"
                     /locus_tag="PAU_00077"
                     /note="Signal peptide predicted for PAT2114 by SignalP 2.0
                     HMM (Signal peptide probability 0.605) with cleavage site
                     probability 0.531 between residues 24 and 25"
     misc_feature    78418..78486
                     /note="1 probable transmembrane helix predicted for
                     PAT2114 by TMHMM2.0 at aa 7-29"
     misc_feature    78541..79044
                     /note="HMMPfam hit to PF00912, Transglycosylase, score
                     6.9e-92"
                     /inference="protein motif:Pfam:PF00912"
     misc_feature    79678..80718
                     /note="HMMPfam hit to PF00905, Penicillin binding protein
                     transpeptid, score 3.5e-22"
                     /inference="protein motif:Pfam:PF00905"
     CDS             complement(80979..81578)
                     /transl_table=11
                     /gene="nudE"
                     /locus_tag="PAU_00078"
                     /old_locus_tag="PAT2115"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00078"
                     /db_xref="EnsemblGenomes-Tr:CAQ82171"
                     /db_xref="GOA:C7BU19"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:C7BU19"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82171.1"
                     /translation="MMHRYSTQSILIPSGAIMNDPKNPKILNIENIAHSRLFHIQSVD
                     LEFSNGVKRVYERMRPANREAVLIIPILGDELLLIREYAVGIEQYELSFPKGAIDPGE
                     SILEAANRELKEEVGFGARKIEQLAKLTMAPSYFSNKMNIVIAENLYPESLKGDEPEP
                     LLQIRWPIADMMSLLDHADFNEARNVSALFLAQKYLQHR"
     misc_feature    complement(81000..81395)
                     /note="HMMPfam hit to PF00293, NUDIX domain, score
                     1.2e-14"
                     /inference="protein motif:Pfam:PF00293"
     CDS             81952..82884
                     /transl_table=11
                     /gene="yrfF"
                     /locus_tag="PAU_00079"
                     /old_locus_tag="PAT2116"
                     /product="putative membrane protein igaa homolog"
                     /db_xref="EnsemblGenomes-Gn:PAU_00079"
                     /db_xref="EnsemblGenomes-Tr:CAQ82172"
                     /db_xref="GOA:C7BU20"
                     /db_xref="InterPro:IPR010771"
                     /db_xref="UniProtKB/TrEMBL:C7BU20"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82172.1"
                     /translation="MHDNVRYLPSVAEPTCRKLNADEYQAIECYLNRVLPPVTDRVNK
                     TTWPALVGENDTIYTICNAITRFAVATDEPHSWRYYIDMAEVHLPFFFEPFIKQRNII
                     DVVHTATIPLVISINGHFLKDFQRDFPSALVVSDASHQQASIQKNGDTSVKFQGIRKE
                     TPEEYRLNHSSGIWEGGFLCLGFLIWFLALLSPALLLPWLMLIAGSLIAVSFWSLFCP
                     LSVRRRQDIHCFTGMPRRWGLFGEFEQGQMSNISLGGIDLIYPTHWQPYIIHNLDQQT
                     NIDIYTMVRSSDKGIIFLCMMKRRIIPITVMGKI"
     misc_feature    order(82450..82518,82546..82614)
                     /note="2 probable transmembrane helices predicted for
                     PAT2116 by TMHMM2.0 at aa 167-189 and 199-221"
     CDS             82884..83981
                     /transl_table=11
                     /gene="yrfF"
                     /locus_tag="PAU_00080"
                     /old_locus_tag="PAT2117"
                     /product="hypothetical membrane protein yrff"
                     /db_xref="EnsemblGenomes-Gn:PAU_00080"
                     /db_xref="EnsemblGenomes-Tr:CAQ82173"
                     /db_xref="GOA:C7BU21"
                     /db_xref="InterPro:IPR010771"
                     /db_xref="UniProtKB/TrEMBL:C7BU21"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82173.1"
                     /translation="MMIGSSLLIMLLLYLYQPISVPMKLSFVWLHGSNTKVVTDANAI
                     DRMELRVGDVLKAKGIGMCYMPPDNMNGKGDVRFSPFDCSGIYWNSTNPLPMPESEII
                     ENAAKLIATVNKQLRLQENNDAVNPDLTPKMSKSGMILLDNFSDIILKTKNLCGKEAD
                     CFRLKNALVNLGSANDWEALLKDAKSGKFDDINVLLRPAGAEALGKLVDATTSSFIYR
                     EIDKAAILLNSPSPGGVLLISDEGKQLVEYMMPLSISYDHSALEQWHDLQRLSDMLLQ
                     TPFETTGIITELSEDANGTHRIVLHSMLDSMTLARCIGTTLLLLVLFATLIINLVLVV
                     KKNRQNKQRFSKIKQYYDNCFNMTFSPTCWR"
     misc_feature    82884..83978
                     /note="HMMPfam hit to PF07095, Intracellular growth
                     attenuator protein IgaA, score 5.5e-52"
                     /inference="protein motif:Pfam:PF07095"
     misc_feature    83817..83885
                     /note="1 probable transmembrane helix predicted for
                     PAT2117 by TMHMM2.0 at aa 312-334"
     CDS             84038..84454
                     /transl_table=11
                     /gene="hslR"
                     /gene_synonym="hlsR"
                     /locus_tag="PAU_00081"
                     /old_locus_tag="PAT2118"
                     /product="ribosome-associated heat shock protein 15"
                     /db_xref="EnsemblGenomes-Gn:PAU_00081"
                     /db_xref="EnsemblGenomes-Tr:CAQ82174"
                     /db_xref="GOA:C7BU22"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR025708"
                     /db_xref="UniProtKB/TrEMBL:C7BU22"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82174.1"
                     /translation="MKDNSDSNQAVRLDKWLWAARFYKTRAVAREMIDGGKVHYNGQR
                     SKPSKLVELRAEIKLRQGNDERTVEVLALSSHRRSAPEAQQLYRETEASIANREKMAI
                     ARKMNALTMPHPDRRPDKKERRTLIKFKNTKLSEPE"
     misc_feature    84068..84253
                     /note="HMMSmart hit to SM00363, no description, score
                     2e-09"
                     /inference="protein motif:Smart:SM00363"
     misc_feature    84068..84208
                     /note="HMMPfam hit to PF01479, S4 domain, score 3.3e-11"
                     /inference="protein motif:Pfam:PF01479"
     CDS             84481..85353
                     /transl_table=11
                     /gene="hslO"
                     /locus_tag="PAU_00082"
                     /old_locus_tag="PAT2119"
                     /product="33 kda chaperonin (heat shock protein 33
                     homolog) (hsp33)"
                     /db_xref="EnsemblGenomes-Gn:PAU_00082"
                     /db_xref="EnsemblGenomes-Tr:CAQ82175"
                     /db_xref="GOA:C7BU23"
                     /db_xref="InterPro:IPR000397"
                     /db_xref="InterPro:IPR016153"
                     /db_xref="InterPro:IPR016154"
                     /db_xref="InterPro:IPR023212"
                     /db_xref="UniProtKB/TrEMBL:C7BU23"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82175.1"
                     /translation="MSKQDQLHRFLFENYSVRGELVLASETYQHILENHGYPQPVQQL
                     LGELLVATSLLTATLKFDGDITVQIQGDGPVKLAVINGNHQQQMRGVARIDGLIAENS
                     SLKQMVGTGYMVITITPTHGERYQGVVALEGETLADCLDDYFRQSEQLPTRLFIRTGS
                     QDGNIAAAGMLLQVLPTAEQNSEEAFDHLVQLTATIKGEELFSLEVKEILRRLYHEED
                     VTLYEPQGVEFRCTCSRQRCADTLVTLSDEDVNHILQKDGNINMGCEYCGAHYIFDAN
                     DIAEIKSEKKSRLH"
     misc_feature    84490..85305
                     /note="HMMPfam hit to PF01430, Hsp33 protein, score
                     2.5e-123"
                     /inference="protein motif:Pfam:PF01430"
     CDS             85569..87188
                     /transl_table=11
                     /gene="pckA"
                     /locus_tag="PAU_00083"
                     /old_locus_tag="PAT2120"
                     /product="phosphoenolpyruvate carboxykinase"
                     /EC_number="4.1.1.49"
                     /db_xref="EnsemblGenomes-Gn:PAU_00083"
                     /db_xref="EnsemblGenomes-Tr:CAQ82176"
                     /db_xref="GOA:C7BU24"
                     /db_xref="InterPro:IPR001272"
                     /db_xref="InterPro:IPR008210"
                     /db_xref="InterPro:IPR013035"
                     /db_xref="InterPro:IPR015994"
                     /db_xref="UniProtKB/TrEMBL:C7BU24"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82176.1"
                     /translation="MSVKGITPQELADYGIHDIREIVYNPSYELLFSEETKPSLEGYE
                     CGTLTNLGAVAVDTGIFTGRSPKDKYIVRDDVTCDTVWWADQGKGKNDNKPLQQETWT
                     HLKGLVTKQLSGKRLFIVDAFCGANADTRLKVRFITEVAWQAHFVKNMFIRPSDEELA
                     GFKPDFIVMNGAKCTNPQWKEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMM
                     NYLLPLKGIASMHCSANVGEKGDVAIFFGLSGTGKTTLSTDPKRKLIGDDEHGWDDDG
                     VFNFEGGCYAKTINLSKEAEPDIYNAIKRDALLENVTVLADGIVDFNDGSKTENTRVS
                     YPIYHIENIVKPVSKAGHATKVIFLTADAFGVLPPVSRLTPEQTQYHFLSGFTAKLAG
                     TERGVTEPTPTFSACFGAAFLTLHPTQYAEVLVKRMQAAGAKAYLVNTGWNGTGKRIS
                     IKDTRGIIDAILSGDIEEADTIELPIFELAVPTALPGVDTHILDPRNTYADKSQWEEK
                     AKDLANRFVDNFDKYTDTPAGEALVKAGPKL"
     misc_feature    85620..87044
                     /note="HMMPfam hit to PF01293, Phosphoenolpyruvate
                     carboxykinase, score 0"
                     /inference="protein motif:Pfam:PF01293"
     CDS             complement(87237..87602)
                     /transl_table=11
                     /gene="yhhW"
                     /locus_tag="PAU_00084"
                     /old_locus_tag="PAT2121"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00084"
                     /db_xref="EnsemblGenomes-Tr:CAQ82177"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:C7BU25"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82177.1"
                     /translation="MTGIYQIWIIPDKTGLTPRYEQHRFEDVQGRQLILSPDARDGSM
                     KIFQDMTLWRWTLKNNETSEYVTKKDRHIWIQVVRGNVIVNGVKATTSDGLAIQNATN
                     LQLSANDDSEILLFDLPQR"
     CDS             complement(87642..88046)
                     /transl_table=11
                     /gene="yhhW"
                     /locus_tag="PAU_00085"
                     /old_locus_tag="PAT2122"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00085"
                     /db_xref="EnsemblGenomes-Tr:CAQ82178"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:C7BU26"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82178.1"
                     /translation="MIHLRKASDRGHANHGWLDSWHTFSFANYYDANFMRFSALRVIN
                     EDFIKAGQGFDPHPHKDMEILTYVLSGTIEHQDSMGNKEQISAGEFQIMSAGTGIRHS
                     EYNPDSDSQLHLYPMDFKMHRDGKGANPREHR"
     misc_feature    complement(87693..87917)
                     /note="HMMPfam hit to PF07883, Cupin domain, score 0.0021"
                     /inference="protein motif:Pfam:PF07883"
     misc_feature    complement(87702..88040)
                     /note="HMMPfam hit to PF02678, Pirin, score 3.6e-54"
                     /inference="protein motif:Pfam:PF02678"
     misc_RNA        complement(88168..88262)
                     /inference="similar to RNA sequence:Rfam:RF00057"
     CDS             88606..89970
                     /transl_table=11
                     /locus_tag="PAU_00086"
                     /old_locus_tag="PAT2123"
                     /product="similar to two-component sensor kinase"
                     /db_xref="EnsemblGenomes-Gn:PAU_00086"
                     /db_xref="EnsemblGenomes-Tr:CAQ82179"
                     /db_xref="GOA:C7BU27"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="UniProtKB/TrEMBL:C7BU27"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000316"
                     /protein_id="CAQ82179.1"
                     /translation="MKDILSGNHMWHFFAWMVLTALTAWGMINHSLDQNYQQQTVSFN
                     ILYRELSEKLAQHDAIVSLMDANIGLKQLQENFPQIIGLQEIPVHVLIFPMISEAEEG
                     RYWLNSTRNSIRLLIDLNILMKNLSLLSQFRSVQLDWNNRPLIRWGLEEGPYFWHWEK
                     KLTSRFQPFVLKASNDQQWSQLPWGYITCLSFLWAVIICFIFLIQKNRRLRKVSDLRA
                     HFFEFTRLNTIDEVATGIVHELNQPLTAIMSYNQSALRLIKKQQYDKVISVLDSSILQ
                     TQRIANLLTQYHEKLTTGSTILQPVNILSILIRVETLLENEIKTGKIKVIKHVCDDLP
                     MIFSDPLWIEQIFHNLISNAIQAQQEKNQAEHKNWICIDITYADEMIKIVITDGGPGL
                     SNEALKNVFIPFFTTRQQGMGLGMTLTETLVQKLGGDISAENCETGGARFIILLPAKK
                     GKEE"
     misc_feature    order(88633..88701,89149..89217)
                     /note="2 probable transmembrane helices predicted for
                     PAT2123 by TMHMM2.0 at aa 10-32 and 182-204"
     misc_feature    89287..89484
                     /note="HMMPfam hit to PF00512, His Kinase A
                     (phosphoacceptor) domain, score 0.0032"
                     /inference="protein motif:Pfam:PF00512"
     misc_feature    89617..89955
                     /note="HMMSmart hit to SM00387, no description, score
                     1.1e-20"
                     /inference="protein motif:Smart:SM00387"
     misc_feature    89617..89952
                     /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
                     gyrase B-, and HSP90, score 7.6e-27"
                     /inference="protein motif:Pfam:PF02518"
     CDS             89970..90599
                     /transl_table=11
                     /locus_tag="PAU_00087"
                     /old_locus_tag="PAT2124"
                     /product="two component transcriptional regulator, luxr
                     family"
                     /db_xref="EnsemblGenomes-Gn:PAU_00087"
                     /db_xref="EnsemblGenomes-Tr:CAQ82180"
                     /db_xref="GOA:C7BU28"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="UniProtKB/TrEMBL:C7BU28"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000316"
                     /protein_id="CAQ82180.1"
                     /translation="MAEMIYLIDDDEAIRDSLSILLETMNWSVVSFPGAQEFLDVINK
                     KNISELQGCILLDIRMPGKPGLTLQDDLLKLNNTLPVIIMTGHGNIDICRRAFKNGAF
                     EFLTKPIDADLLIETVSNALSFHQKIFKQHQVYEQLKVKFSQLSDRESEVMKIILEGK
                     TSKQIAQQLALSPRTIEVHRANIFHKLDIHSLPQLVKEYELLKSLSFCD"
     misc_feature    89976..90326
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 4.2e-22"
                     /inference="protein motif:Pfam:PF00072"
     misc_feature    89976..90323
                     /note="HMMSmart hit to SM00448, no description, score
                     3.9e-22"
                     /inference="protein motif:Smart:SM00448"
     misc_feature    90372..90530
                     /note="HMMPfam hit to PF08281, Sigma-70, region, score
                     0.0016"
                     /inference="protein motif:Pfam:PF08281"
     misc_feature    90393..90566
                     /note="HMMSmart hit to SM00421, no description, score
                     6.8e-20"
                     /inference="protein motif:Smart:SM00421"
     CDS             90700..91188
                     /transl_table=11
                     /locus_tag="PAU_00088"
                     /old_locus_tag="PAT2125"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00088"
                     /db_xref="EnsemblGenomes-Tr:CAQ82181"
                     /db_xref="InterPro:IPR005624"
                     /db_xref="UniProtKB/TrEMBL:C7BU29"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000316"
                     /protein_id="CAQ82181.1"
                     /translation="MKHSLFYTILAAGLFAQSAFASSLITERNITLELANKLASEAIQ
                     SCKSSNYNVTVAVVDKSGVLKAVQRMDKAGLHTVEASKMKAYTALSTQRTSEDVMKTA
                     QSNLGAQYLGDIPGFLLLAGGVPVKSGDEVIGAIGIGGAPSGSLDQQCALDAIQKVSS
                     EL"
     sig_peptide     90700..90762
                     /locus_tag="PAU_00088"
                     /note="Signal peptide predicted for PAT2125 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.997 between residues 21 and 22"
     misc_feature    90781..91164
                     /note="HMMPfam hit to PF03928, Domain of unknown function
                     (DUF336), score 1.7e-38"
                     /inference="protein motif:Pfam:PF03928"
     CDS             91961..92314
                     /transl_table=11
                     /locus_tag="PAU_00089"
                     /old_locus_tag="PAT2126"
                     /product="Hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00089"
                     /db_xref="EnsemblGenomes-Tr:CAQ82182"
                     /db_xref="UniProtKB/TrEMBL:C7BU30"
                     /inference="similar to DNA sequence:INSD:AL591973"
                     /protein_id="CAQ82182.1"
                     /translation="MITQTRDLDILSDTTKSHKFIFNVEGKLAIGSISKKVNPKMLSH
                     PVLAKEAGGSRVISAGYMYRYRDAVYLVNHSGHYRPSVGRLLPVSGFIRNNFGYHTKI
                     VPAETFKHGMLKFFR"
     CDS             92399..92599
                     /transl_table=11
                     /locus_tag="PAU_00090"
                     /old_locus_tag="PAT2127"
                     /product="Hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00090"
                     /db_xref="EnsemblGenomes-Tr:CAQ82183"
                     /db_xref="UniProtKB/TrEMBL:C7BU31"
                     /inference="similar to AA sequence:UniProt:Q2QLW4"
                     /protein_id="CAQ82183.1"
                     /translation="MFKINFAFILDKFNRECLTTFSINVRYKIILLCFMQFTSSLCNK
                     RLLHYYRAQYHENAPPPAFYSP"
     CDS             92710..95982
                     /transl_table=11
                     /gene="pulA"
                     /locus_tag="PAU_00091"
                     /old_locus_tag="PAT2128"
                     /product="alpha-dextrin endo-1,6-alpha-glucosidase
                     (pullulanase)"
                     /db_xref="EnsemblGenomes-Gn:PAU_00091"
                     /db_xref="EnsemblGenomes-Tr:CAQ82184"
                     /db_xref="GOA:C7BU32"
                     /db_xref="InterPro:IPR004193"
                     /db_xref="InterPro:IPR005323"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR011839"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR013784"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR024561"
                     /db_xref="UniProtKB/TrEMBL:C7BU32"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:BA000032"
                     /protein_id="CAQ82184.1"
                     /translation="MVAHFGKKAYRALLSGTFVLLSGCDSNGPSPNPPKEPMAHLPIK
                     IPGEAARAGDLQAVIHLVDIAALNKNNPTTDRDYSTNSLYLWNDESCDSLAFPSLNWN
                     DTSIVPTGSDSYGPYWVVPLTKNEGCINFIVRDGNNTKLIDNDLKISFSDFSNRTISV
                     IPGSNQIYGSRAEAFNSVFGVSQASAHWVDKQTLLWSGGADKPYVRLYHNRNDKVGAD
                     DEGNFTDSYLTLTPTTLSQKTAERFPHLTKLTAFRLPADTDVDKLLTGDLVALATNKE
                     GLLLSATQVQTAGVLDDRFANAADTLEYGALVSGSGVTFHLWAPTAQQVALVIYDTDK
                     QVIANYAMNRNPASGSWSWQGDKDLIGAYYRYALTVYHPRSRNVEHYEVTDPYSHSLS
                     TNSEYSQVINLDDEALKPQNWDSLIMPRSQSTQADIARMTIYESHVRDLSIADSTVPE
                     AWRGKYLALTANNSDMFKHLKALSQAGVTHMELLPVFDVASINEFSNQVADLNHPFSR
                     LCQVNAMVRNSRFADYCNGLQTVGEVLQELKNGDSANNPQVQELNAMIAETDSYNWGY
                     DPFHYSVPEGSYATDAEGSVRIKEFRAMVQAIKQQLGMNVIMDVAYNHTDAAGPTDRS
                     SVLDKIVPWYYHRLNEISGNVESNTCCHDTAPEHRMFAKLIEDSLVTWVKDYKIDAFR
                     FDLMGFHPKAQILSALAKVRMINPSVYFLGEGWNSGQDDRFEIASQINLKGSGIGTFS
                     DRLRDAVQGGGPFDSANSIRINQGVGNGAGTLPNEMTWLNADEVRHLADLVRLGMAGN
                     LADFVLINKDGAVKTGREIDYKGAIAGYAADPTEVINYVSKHDNQTLWDIISYKAARE
                     ANLATRVRMQAISLATTFLGQGLAFAQHGSELLRSKSFTRDSYNAGDWFNRVSYTYQD
                     NNYDVGMPGWRDDGENYALIEQVKNLVDKPGQTELLQMTSFYQELLRLRQFSPLMTLG
                     DGKSVKQRVDFRNVGPNQQLGLFVMTIDDGNTTDDDRDLRFDGLVVMINAASQTATVS
                     DLNVRGLKLNDIQGELGNASLAAGIRIAEDGSVTLPAWSVAVLVLPQDGVRSIGLPVR
                     GK"
     misc_feature    92884..93237
                     /note="HMMPfam hit to PF03714, Bacterial
                     pullanase-associated domain, score 2.9e-22"
                     /inference="protein motif:Pfam:PF03714"
     misc_feature    93616..93873
                     /note="HMMPfam hit to PF02922, Isoamylase N-terminal
                     domain, score 5.5e-14"
                     /inference="protein motif:Pfam:PF02922"
     misc_feature    94045..95541
                     /note="HMMPfam hit to PF00128, Alpha amylase, catalytic
                     domain, score 5.9e-07"
                     /inference="protein motif:Pfam:PF00128"
     misc_feature    94246..95274
                     /note="HMMSmart hit to SM00642, no description, score
                     0.0077"
                     /inference="protein motif:Smart:SM00642"
     CDS             96316..96786
                     /transl_table=11
                     /gene="cynS"
                     /locus_tag="PAU_00092"
                     /old_locus_tag="PAT2129"
                     /product="cyanate hydratase"
                     /EC_number="4.2.1.104"
                     /db_xref="EnsemblGenomes-Gn:PAU_00092"
                     /db_xref="EnsemblGenomes-Tr:CAQ82185"
                     /db_xref="GOA:C7BU33"
                     /db_xref="InterPro:IPR003712"
                     /db_xref="InterPro:IPR008076"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="UniProtKB/TrEMBL:C7BU33"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82185.1"
                     /translation="MTQSQYSQTPRQILTDAIIDAKIRKNLTFEDIAQGTGLSLAFVT
                     AALLGQHPLPENAAKIVVDRLELDENALRLLQTIPVRGSIPGGVPTDPTIYRFYEMVQ
                     IYGSTLKALVHEKFGDGIISAIDFKLDIKKVDDPNGGSRAVITLDGKYLPTKPF"
     misc_feature    96562..96783
                     /note="HMMPfam hit to PF02560, Cyanate lyase C-terminal
                     domain, score 2.6e-48"
                     /inference="protein motif:Pfam:PF02560"
     CDS             complement(96979..98490)
                     /transl_table=11
                     /locus_tag="PAU_00093"
                     /old_locus_tag="PAT2130"
                     /product="putative monooxygenase"
                     /db_xref="EnsemblGenomes-Gn:PAU_00093"
                     /db_xref="EnsemblGenomes-Tr:CAQ82186"
                     /db_xref="GOA:C7BU36"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:C7BU36"
                     /inference="similar to DNA sequence:INSD:AB193037"
                     /inference="similar to DNA sequence:INSD:CP000076"
                     /protein_id="CAQ82186.1"
                     /translation="MNKSAPDHNPQIDISRATDVEIIIIGAGFAGLGMGTQLKRRSQH
                     SFLILERADDVGGTWRDNTYPGIACDIPSHLYSFSFRPNPDWSYVFSPGHEILAYLQA
                     TARDEGLLPHIRLGTNVQKAYWDNQEERWIIITTTGVFSGRFLVAGTGHLTDENIPQI
                     EGLNSFTGEVFHSARWKHHIPLQGKRVGIIGSGASAIQIVPEVANSVSELVIFQRSAP
                     YILPRPDRSYSEAEKRLFRRDPKSIPALRSDIFWHFESLYPACRSIPEYLAELKRIAF
                     DHLKQQISDPELCAKLIPNYEPGCKRILAANNYYPALLRDNVQLETSALKRIDGQNAI
                     SVSGNSYPLDLLIFCTGFQTTQPPYTHLIHGRDGLSLADHWTQGMEAFASTTVTGFPN
                     FFIINGPSATLTHNSIIYIIESQIEYILGAIEYSRKNSNYVLEVSAEAQESYVNELQH
                     QLKDTVWVSGGCTSWYLDPRNKRPTLIWPGFAHTFRKHNSNFDPAPYIHRVTT"
     CDS             complement(98517..99392)
                     /transl_table=11
                     /locus_tag="PAU_00094"
                     /old_locus_tag="PAT2131"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00094"
                     /db_xref="EnsemblGenomes-Tr:CAQ82187"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C7BU37"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AB193037"
                     /protein_id="CAQ82187.1"
                     /translation="MNRPEQEFSANESVIKVDGKNVKFFTSTPQGPIKNNDKKNPVVL
                     VHGTGGSTQIHFSSLFQLLATEHRVISLDFTQPVNADETLTLEHLGKQVEAVIKTAAP
                     GESVTLIGYSLGAAVVAAVAAQHPDLVRNLVLIAGWMKSDLQLKRFAAVWHQLYEIQS
                     PVITEFMMYCAFRGPCHVNMLPDQLANGFENINPGEFDALQITLDSQVDITQLVPTIK
                     ATTLIIGCKYDHIVPTYHSKALFGAIQDARYTEIECGHAVIYERPFQLVRVIDQFCTD
                     PSFYPAGTIIPTDQP"
     misc_feature    complement(98577..99194)
                     /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
                     score 1.9e-05"
                     /inference="protein motif:Pfam:PF00561"
     CDS             100202..100687
                     /transl_table=11
                     /locus_tag="PAU_00095"
                     /old_locus_tag="PAT2131A"
                     /product="putative transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00095"
                     /db_xref="EnsemblGenomes-Tr:CAQ82188"
                     /db_xref="GOA:C7BU38"
                     /db_xref="UniProtKB/TrEMBL:C7BU38"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82188.1"
                     /translation="MSTQAVNEYAIAEGEKRAIRTIKLFIALGFIAEFGFLLMSFILF
                     PDNGPLVWRLVWALGLCGIGMGAAVGGLTYLVSSRFTPGSTGAYTMTAVSSALLFSVC
                     QTLCWGLDHNVGLNYWGSIEMPLLFLIKGYTAALLAGILGSFLLNSVKGARFLDCLKV
                     F"
     misc_feature    order(100262..100330,100358..100426,100460..100528,
                     100571..100639)
                     /note="4 probable transmembrane helices predicted for
                     PAT2132 by TMHMM2.0 at aa 21-43, 53-75, 87-109 and
                     124-146"
     CDS             100669..101160
                     /transl_table=11
                     /locus_tag="PAU_00096"
                     /old_locus_tag="PAT2132"
                     /product="hypothetical transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00096"
                     /db_xref="EnsemblGenomes-Tr:CAQ82189"
                     /db_xref="GOA:C7BU39"
                     /db_xref="UniProtKB/TrEMBL:C7BU39"
                     /inference="similar to DNA sequence:INSD:AALM01000022"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82189.1"
                     /translation="MLEGVLVSKKSSLPNSFAISVFLAVLAACLNLILWRADILEMAH
                     NVPLKGLMAIWYVLGWGFAPGCLTALTIHSIRGRLPQITGSVVAMFISFLLITGICGL
                     VYTYLTNSVFMQMAMGGMAEHHSVANNGTILGFISMLLPSLCATVISIISAFSIKMGK
                     WFR"
     misc_feature    order(100705..100773,100816..100884,100921..100989,
                     101062..101130)
                     /note="4 probable transmembrane helices predicted for
                     PAT2132 by TMHMM2.0 at aa 13-35, 50-72, 85-107 and
                     132-154"
     CDS             101469..101765
                     /transl_table=11
                     /locus_tag="PAU_00097"
                     /old_locus_tag="PAT2133"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00097"
                     /db_xref="EnsemblGenomes-Tr:CAQ82190"
                     /db_xref="UniProtKB/TrEMBL:C7BU40"
                     /inference="similar to DNA sequence:INSD:AE017340"
                     /inference="similar to DNA sequence:INSD:CR628336"
                     /protein_id="CAQ82190.1"
                     /translation="MICQSGWSEHELYFSHYRDKDQIEVDLVIEDGRRIWGEVKKTAS
                     IPPKDGMGLARLASLVDRDWQSGILLYTGNNCLPISHIPNTICSTNECALGLIS"
     CDS             complement(101805..103046)
                     /transl_table=11
                     /gene="yhiN"
                     /locus_tag="PAU_00098"
                     /old_locus_tag="PAT2134"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00098"
                     /db_xref="EnsemblGenomes-Tr:CAQ82191"
                     /db_xref="GOA:C7BU41"
                     /db_xref="InterPro:IPR004792"
                     /db_xref="InterPro:IPR023166"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:C7BU41"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82191.1"
                     /translation="MQHVRGNSPLNYSVIKRKTVERFDAIIIGAGAAGLFCAAQAGQL
                     GLRVLVLDNGKKAGRKILMSGGGRCNFTNMYTEPSAYLSTNPHFCKSALARYTQWDFI
                     ELVQRYGIAYHEKTLGQLFCDDSAQQIVDMLLKECEAGQVNIRLRSEVSHVEKKEQDF
                     VITVNGKEVSTRSLVIASGGLSMPGLGATPFGYRIAEQFGLQVLPTRAALVPFTLHKP
                     LLEQLHVLSGVSVPAIVTAANGTLFKENILFTHRGLSGPAILQISSYWQPGEFVSINL
                     LPDTDLDAFLEQERSSHPNQSVKNSLAKLLPKRLTECLQMLDQIPNIALKQLNSIQQK
                     QLVLNLQSWQVQPNGTEGYRTAEVTIGGIDTHQLSSKTMEANQVKGLYFIGEVVDVTG
                     WLGGYNFQWAWSSAWACAQAL"
     misc_feature    complement(101811..102980)
                     /note="HMMPfam hit to PF03486, HI0933-like protein, score
                     1.2e-235"
                     /inference="protein motif:Pfam:PF03486"
     misc_feature    complement(101811..102977)
                     /note="HMMPfam hit to PF01266, FAD dependent
                     oxidoreductase, score 9.3e-06"
                     /inference="protein motif:Pfam:PF01266"
     misc_feature    complement(101850..102977)
                     /note="HMMPfam hit to PF00890, FAD binding domain, score
                     0.0046"
                     /inference="protein motif:Pfam:PF00890"
     misc_feature    complement(101871..102977)
                     /note="HMMPfam hit to PF07992, Pyridine
                     nucleotide-disulphide oxidored, score 8.8e-05"
                     /inference="protein motif:Pfam:PF07992"
     sig_peptide     complement(102924..103046)
                     /gene="yhiN"
                     /locus_tag="PAU_00098"
                     /note="Signal peptide predicted for PAT2134 by SignalP 2.0
                     HMM (Signal peptide probability 0.823) with cleavage site
                     probability 0.759 between residues 41 and 42"
     CDS             103290..104780
                     /transl_table=11
                     /gene="pitA"
                     /locus_tag="PAU_00099"
                     /old_locus_tag="PAT2135"
                     /product="low-affinity inorganic phosphate transporter 1"
                     /note="phosphate transporter"
                     /db_xref="EnsemblGenomes-Gn:PAU_00099"
                     /db_xref="EnsemblGenomes-Tr:CAQ82192"
                     /db_xref="GOA:C7BU42"
                     /db_xref="InterPro:IPR001204"
                     /db_xref="UniProtKB/TrEMBL:C7BU42"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82192.1"
                     /translation="MLHLFTGLDFHTSLMLVLALLFVLFYEAINGFHDTANAVATVIY
                     TRAMRAQFAVVMAGVFNFFGVLLGGLSVAYAIVHLLPTDLLLNVSSAHGLAMVFSMLL
                     AAIVWNLGTWYFGLPASSSHTLIGSIIGIGLTNAIVTSSSVVDALNVPKMIQIFLSLI
                     LSPLIGLIIAGAVVFLLRRYWSGTKKRKRIHLTPAQREKKDGKRKPPFWTRTALILSA
                     VGVSFSHGANDGQKGIGLIMLVLIGVAPAGFVVNMNANGYDIARTYDAVTHLQQYYQQ
                     HGTALSHAIELTPSVAIVENEPEGKFHCDSTRAVVVLNQTESILKGIQSYSELNPEQR
                     NNMRRMLMCIADTAESVAKLPETTAEDARFLNKLRKDLLHTVEYAPVWIIIAVALALS
                     LGTLVGWKRVAVTIGEKIGKKGMTYAQGVSAQMTAAVSIGVASYTGMPVSTTQVLSSA
                     VAGTMLVDGGGVQGKTIKNIMLAWILTLPVSIALSGTLYWFALKLI"
     misc_feature    order(103317..103385,103443..103511,103569..103637,
                     103656..103724,103752..103820,103908..103961,
                     103989..104057,104415..104483,104697..104765)
                     /note="9 probable transmembrane helices predicted for
                     PAT2135 by TMHMM2.0 at aa 10-32, 52-74, 94-116, 123-145,
                     155-177, 207-224, 234-256, 376-398 and 470-492"
     misc_feature    103377..104744
                     /note="HMMPfam hit to PF01384, Phosphate transporter
                     family, score 1.3e-102"
                     /inference="protein motif:Pfam:PF01384"
     CDS             complement(104955..105326)
                     /transl_table=11
                     /gene="uspB"
                     /locus_tag="PAU_00100"
                     /old_locus_tag="PAT2136"
                     /product="conserved hypothetical protein"
                     /note="Universal stress protein B"
                     /db_xref="EnsemblGenomes-Gn:PAU_00100"
                     /db_xref="EnsemblGenomes-Tr:CAQ82193"
                     /db_xref="GOA:C7BU43"
                     /db_xref="InterPro:IPR019598"
                     /db_xref="UniProtKB/TrEMBL:C7BU43"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82193.1"
                     /translation="MTALANHSKEGIMFSTIALFWALCLVCIMNMMRYFSSLRVLLSI
                     LRQSDPLLYQSVDGNGFFTTHGQLNKQMRLVRYINSQRYLDHHDPEVVLLCERLRKQF
                     ILTSALSGLVVVCLISMLIWY"
     misc_feature    complement(order(104964..105023,105240..105299))
                     /note="2 probable transmembrane helices predicted for
                     PAT2136 by TMHMM2.0 at aa 10-29 and 102-121"
     CDS             105813..106292
                     /transl_table=11
                     /locus_tag="PAU_00101"
                     /old_locus_tag="PAT2137"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00101"
                     /db_xref="EnsemblGenomes-Tr:CAQ82194"
                     /db_xref="InterPro:IPR008514"
                     /db_xref="UniProtKB/TrEMBL:C7BU44"
                     /inference="similar to DNA sequence:INSD:CP000308"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82194.1"
                     /translation="MANLIYLTLKGRKQGLISAGCSSIDSIGNKGQVNHTDQILVYSL
                     SHSISREQNVSHHPIVIKKPIDKSSPLLGLAISDNEVLDAIFECYRTNQSGAQELYYT
                     IKVVDATISDLTAVHPHNITHTGSEPQETLSLRYKSITWTHHIAGTSAYSIWDDRNY"
     misc_feature    105822..106244
                     /note="HMMPfam hit to PF05638, Protein of unknown function
                     (DUF796), score 7.4e-62"
                     /inference="protein motif:Pfam:PF05638"
     CDS             complement(106637..106819)
                     /transl_table=11
                     /locus_tag="PAU_00102"
                     /old_locus_tag="PAT2138"
                     /product="Hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00102"
                     /db_xref="EnsemblGenomes-Tr:CAQ82195"
                     /db_xref="UniProtKB/TrEMBL:C7BU45"
                     /inference="similar to DNA sequence:INSD:BX571861"
                     /protein_id="CAQ82195.1"
                     /translation="MLRGIRSLAVAMHLEIYWVYINTDLLYGLKNRGIKMMSIEEIII
                     EIVSDISTAYGYMRSN"
     CDS             complement(106822..107607)
                     /transl_table=11
                     /locus_tag="PAU_00103"
                     /old_locus_tag="PAT2139"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00103"
                     /db_xref="EnsemblGenomes-Tr:CAQ82196"
                     /db_xref="InterPro:IPR025320"
                     /db_xref="UniProtKB/TrEMBL:C7BU46"
                     /inference="similar to DNA sequence:INSD:CP000308"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82196.1"
                     /translation="MMDVLDEFYGRNPWARGYFDDATQKERQLMKIQMDKQNELIIVM
                     NSVANKFIKWSLAKDHFINEVIAYSQDITAKINTGELSILEAIDLLEEEIKSLKEQDR
                     MISQKNVRQAIVVQKEVIDSPRNSKRREFDKLIIAGVGFISGGLQIVGGLTVTRLSRS
                     GYGGLLLAHGYNNVIENGYYILYREDYAGPVRFVYRQVAKETFNMNERDADALYASVD
                     IGISLTGMLTYQLLPDHQRLYRYTCYLSSCLFVGFTHSPRSHS"
     CDS             107627..107767
                     /transl_table=11
                     /locus_tag="PAU_00104"
                     /old_locus_tag="PAT2140"
                     /product="Hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00104"
                     /db_xref="EnsemblGenomes-Tr:CAQ82197"
                     /db_xref="UniProtKB/TrEMBL:C7BU47"
                     /inference="similar to DNA sequence:INSD:AF300528"
                     /protein_id="CAQ82197.1"
                     /translation="MSCIVIYINKNKQIEQVYFLIIVICNPNLTSQHYLKMNPYFIKA
                     II"
     CDS             108580..109011
                     /transl_table=11
                     /gene="uspA"
                     /locus_tag="PAU_00105"
                     /old_locus_tag="PAT2141"
                     /product="universal stress protein a"
                     /note="The universal stress protein UspA is a small
                     cytoplasmic bacterial protein whose expression is enhanced
                     when the cell is exposed to stress agents. UspA enhances
                     the rate of cell survival during prolonged exposure to
                     such conditions, and may provide a general stress
                     endurance activity."
                     /db_xref="EnsemblGenomes-Gn:PAU_00105"
                     /db_xref="EnsemblGenomes-Tr:CAQ82198"
                     /db_xref="GOA:C7BU48"
                     /db_xref="InterPro:IPR006015"
                     /db_xref="InterPro:IPR006016"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C7BU48"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82198.1"
                     /translation="MAYKHILVAVDLSPESQVLLQKAVSVAKPYNAKVSLIHVDVNYS
                     DLYTGLIDVNLGDMQQRITDETRNALKDLSAESDYGIQETLSGSGDLGQVLVDAIKKY
                     DIDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDDE"
     misc_feature    108583..108993
                     /note="HMMPfam hit to PF00582, Universal stress protein
                     family, score 3.6e-18"
                     /inference="protein motif:Pfam:PF00582"
     CDS             109269..110612
                     /transl_table=11
                     /gene="gdhA"
                     /locus_tag="PAU_00106"
                     /old_locus_tag="PAT2142"
                     /product="nadp-specific glutamate dehydrogenase
                     (nadp-gdh)"
                     /db_xref="EnsemblGenomes-Gn:PAU_00106"
                     /db_xref="EnsemblGenomes-Tr:CAQ82199"
                     /db_xref="GOA:C7BU49"
                     /db_xref="InterPro:IPR006095"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR006097"
                     /db_xref="InterPro:IPR014362"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR033524"
                     /db_xref="InterPro:IPR033922"
                     /db_xref="UniProtKB/TrEMBL:C7BU49"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82199.1"
                     /translation="MSCLLSLSSFLGSIQRRDEYQPEYLQAVREVFTSLWPFLEQNPK
                     YREQSLLERMVEPERVIQFRVCWVDDQGKVQVNRAWRVQFNSAIGPYKGGMRFHPSVN
                     LSILKFLGFEQTLKNALTTLPMGGGKGGSDFDPKGKSQGEVMRFCQALMTELYRHLGP
                     DTDVPAGDIGVGGREVAFMSGMMKKLSNNTACVFTGKGLSFGGSLIRPEATGYGLVYF
                     TNAMLKRHGMGFEGMRVSVSGAGNVAQYTIEKCMALGAKVVTASDSGGTVVDEEGFTL
                     EKLAHLEEIKNQHYGRVEEYAKERGLAFLKGLQPWSVPVDIALPCATQNELDLDAAKV
                     LIKNGVKAVAEGANMPATISATEAFIEAGVLFAPGKAANAGGVATSGLEMAQNAARLG
                     WKAEKVDARLHHIMLDIHHACVKYGGEGKQTNYVQGANIAGFVKVADAMLAQGIL"
     misc_feature    109437..109829
                     /note="HMMPfam hit to PF02812, Glu/Leu/Phe/Val
                     dehydrogenase, dimeri, score 8.4e-86"
                     /inference="protein motif:Pfam:PF02812"
     misc_feature    109872..110603
                     /note="HMMPfam hit to PF00208,
                     Glutamate/Leucine/Phenylalanine/Valin, score 1.1e-134"
                     /inference="protein motif:Pfam:PF00208"
     CDS             complement(110648..111391)
                     /transl_table=11
                     /gene="yhiQ"
                     /locus_tag="PAU_00107"
                     /old_locus_tag="PAT2143"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00107"
                     /db_xref="EnsemblGenomes-Tr:CAQ82200"
                     /db_xref="GOA:C7BU50"
                     /db_xref="InterPro:IPR007536"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C7BU50"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82200.1"
                     /translation="MDICLICEQGADSSALSQLAKRWHLIHDESAVMALVLTPQHLEL
                     RKLDEPKLGGIYVDFVSGVMAHRRRFGGGRGEAVAKAVGIKKDYLPTVVDATAGLGRD
                     AFVLASLGCHVRMLERHPVVAALLDDGLQRGYQDAEIGGWLQERMTLLHASSITALVD
                     ITPQPDVVYLDPMYPHKQKSALVKKEMRVFQSLVGADEDANHLLAPARALAKRRVVVK
                     RPDYAEPLAGVAASAAITTKNHRFDIYPC"
     misc_feature    complement(110651..111352)
                     /note="HMMPfam hit to PF04445, Protein of unknown function
                     (DUF548), score 5.6e-162"
                     /inference="protein motif:Pfam:PF04445"
     CDS             complement(111397..113439)
                     /transl_table=11
                     /gene="opdA"
                     /gene_synonym="prlC"
                     /locus_tag="PAU_00108"
                     /old_locus_tag="PAT2144"
                     /product="oligopeptidase A"
                     /EC_number="3.4.15.5"
                     /db_xref="EnsemblGenomes-Gn:PAU_00108"
                     /db_xref="EnsemblGenomes-Tr:CAQ82201"
                     /db_xref="GOA:C7BU51"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024080"
                     /db_xref="InterPro:IPR034005"
                     /db_xref="UniProtKB/TrEMBL:C7BU51"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82201.1"
                     /translation="MTNPLLVPSGLPKFSSIKPEHVVPAVKEVIANYRQTVEKILTEN
                     TVFTWDNLCQPLAEAGDKQSRAWSPVNHLNSVKNSPELRAVYEESLPLLSEFSTWLGQ
                     HKGLYQAYKSLRESAEFEKLSQPQRKAVENSLRDFKLSGIGLPEEKQKRYGEISARLS
                     DLSSLFNNNVLDATMGWTKLITNVKELSGLPESAIAAAKAQAEAKGQKGWLLTLEAPS
                     YQPVITYADNRELRREIYHAYNTRASDQGPNAGKWDNSEVIAEILALRHEQAQLLGLK
                     NYAEQSLATKMAKTPKEVLDFLNDLTKRARPQGQEEVDELKGFAKWHHCAHKLEAWDM
                     TYYGEKQKQYEFSINDEQLRPYFPEQKAVEGLFEVVRRIYGITAKERHDVETWHPDVR
                     FFDLFDDTNELRGSFYMDLYARENKRGGAWMDECISKMRRSNGELQKPVAYLNCNFNR
                     PVGDKPALFTHNEVNTLFHEFGHCLHLMLTQIETASVSGTNGVPWDAVEMPSQFMENW
                     CWEPEALAFISGHYETQEPLPKSMLDNLLAAKNYQAAMRILRQLEFGQFDFRLHVEYD
                     PKKGAQTMKTLKEVKKLVSVVPSPEWGRFPHSFTHIFSGGYAAGYYSYLWADVLAADA
                     YSRFEEEGIFNRETGQSFLDNILSRGGSEEPMELFKRFRGREPKLDAMLRKAGIKG"
     misc_feature    complement(111406..112776)
                     /note="HMMPfam hit to PF01432, Peptidase family M3, score
                     3e-214"
                     /inference="protein motif:Pfam:PF01432"
     tRNA            113677..113767
                     /product="transfer RNA-SeC(p)"
                     /anticodon=(pos:113711..113713,aa:SeC)
                     /note="tRNA SeC(p) anticodon TCA, Cove score 69.81"
     CDS             114306..115229
                     /transl_table=11
                     /locus_tag="PAU_00109"
                     /old_locus_tag="PAT2145"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00109"
                     /db_xref="EnsemblGenomes-Tr:CAQ82202"
                     /db_xref="GOA:C7BU52"
                     /db_xref="InterPro:IPR014940"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C7BU52"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AAPS01000002"
                     /protein_id="CAQ82202.1"
                     /translation="MKAYCFNLRQKVLTSILIFTCYIGFVYPSTHKQFFRHDGSEITY
                     YLKQRGGKNLLVLIQGSDCNSIANNKFVNETFSDIYPDTDVLTVEKYGIDALLPWSDA
                     GERSDCPKAYIKSDTPEQRVKDYIQIIGYLKNQNKYKKIIILGGSEGAMVANLITSQV
                     NYIDRTISLNGGGRYLADDVIHSIKSEVPPEHVNQAMKGFREFQQRIHTNNNLEMSNH
                     GVNWWKISLGINQYRVLDQTKRPILIIQTLNDNSVSVSAAMAMEQQLKKDNITFYQYP
                     GLSHGFKNSEGVLQVTPIVEDIRNWLSRVSG"
     misc_feature    114339..114392
                     /note="1 probable transmembrane helix predicted for
                     PAT2145 by TMHMM2.0 at aa 12-29"
     CDS             116157..116477
                     /transl_table=11
                     /gene="cipB"
                     /locus_tag="PAU_00110"
                     /old_locus_tag="PAT2146"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00110"
                     /db_xref="EnsemblGenomes-Tr:CAQ82203"
                     /db_xref="UniProtKB/TrEMBL:C7BU53"
                     /inference="similar to DNA sequence:INSD:AP006852"
                     /inference="similar to DNA sequence:INSD:U89925"
                     /protein_id="CAQ82203.1"
                     /translation="MEFIIMMIKKDILLHEELIVDDELRVGKVEKVNIDILSPSSVIV
                     SLNILGVVDDFHLLVVDGDKDKEKIVLLYLSLLRVLHEKLDVKVKIAKSNLTKIKYIV
                     GVEI"
     CDS             117119..118255
                     /transl_table=11
                     /locus_tag="PAU_00111"
                     /old_locus_tag="PAT2147"
                     /product="l-arginine:lysine amidinotransferase, putative"
                     /db_xref="EnsemblGenomes-Gn:PAU_00111"
                     /db_xref="EnsemblGenomes-Tr:CAQ82204"
                     /db_xref="GOA:C7BU54"
                     /db_xref="InterPro:IPR033195"
                     /db_xref="UniProtKB/TrEMBL:C7BU54"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000058"
                     /protein_id="CAQ82204.1"
                     /translation="MRRHNIQISGEDMLDPNLIDSDSKISSPVNSFNEWDPLEEVIVG
                     AVDGARFPGWHMAIEPVLPPNQIETFHRNAGRSFPKERIEAASRELEEFVHILESEGV
                     KVRRPEPQDQSQVFGAPGWSSTGLYCAMPRDSLLVIGDDIIECPLAWRSRYFETAAYK
                     TLLKDYFKQGARWSSGPKPQLIDEQYDFEWYKPDGKDSTRLAVTEFEPTFDAADFIRC
                     GRDIIAQKSHVTNEFGIEWLRRHIGDDYRIHVFEFNDDSPMHIDATFFPMAPGKLLIN
                     PEKVLKIPELFKGWDVLCAPEPVIPDEHPLYMTSKWINMNILMLDEKRVIVEKQDEPM
                     IAAMKRWGFTPIPCNFRNFNSFGGSFHCATVDVRRRGILQSYFN"
     misc_feature    117215..118225
                     /note="HMMPfam hit to PF02274, Amidinotransferase, score
                     2.3e-05"
                     /inference="protein motif:Pfam:PF02274"
     CDS             118264..119220
                     /transl_table=11
                     /locus_tag="PAU_00112"
                     /old_locus_tag="PAT2148"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00112"
                     /db_xref="EnsemblGenomes-Tr:CAQ82205"
                     /db_xref="GOA:C7BU55"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="UniProtKB/TrEMBL:C7BU55"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE016853"
                     /protein_id="CAQ82205.1"
                     /translation="MAIWRYSYWDSVMFILSILHTIATVTLVVYWDNFTIMGWLGNIV
                     LLTLMTTYNIIVISHFFSHTPWFVSRTVNMFVSILNSMNIGQSVQAYHLSHVRNHHKY
                     NNDRGVGESGPQDTSSTFINGKEIGEHSTLWNYSALGGIFTLYNSFVRMFWAIFIWQK
                     PLSKADKGYEKLLSMDRKRKVEELLQLRLDRLFQAVWVIILFTLSWKWVLFCYLPALY
                     FSFVLVNIQNYYEHYGAQPENRFANSVSYYGRIYNLLTFNDGYHQEHHISGNTHWKSL
                     PDLRQKYSTKLSAQERIVSPVPAILGFLHKRRPLLHRSINKK"
     misc_feature    order(118297..118356,118366..118434,118657..118725,
                     118846..118914)
                     /note="4 probable transmembrane helices predicted for
                     PAT2148 by TMHMM2.0 at aa 12-31, 35-57, 132-154 and
                     195-217"
     misc_feature    118375..119121
                     /note="HMMPfam hit to PF00487, Fatty acid desaturase,
                     score 1.8e-06"
                     /inference="protein motif:Pfam:PF00487"
     CDS             119271..120146
                     /transl_table=11
                     /locus_tag="PAU_00113"
                     /old_locus_tag="PAT2149"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00113"
                     /db_xref="EnsemblGenomes-Tr:CAQ82206"
                     /db_xref="InterPro:IPR016946"
                     /db_xref="UniProtKB/TrEMBL:C7BU56"
                     /inference="similar to DNA sequence:INSD:AL672114"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82206.1"
                     /translation="MMQEKFGIRGTKLAKSEFIVYETSNNISMNAVSDLLDGHLAVCR
                     INHFLLPEQRKKIIENFWRSSALTPRYGDGIDGIDGVEGYFIGASHIEKNTRQYIEEV
                     ENFRPAISEIFQDTINPIDRFIEQITHFSGDNPQVTRPAMYHGVAAGNVKIVYWNNFG
                     EFLLLPHDDLAQLSDPRQSDFEVQQINRVMAVNFYADVPQNGGQLKVWNIQPDNQSRS
                     ALGLTYSGFPYPVELLENHANMVINIKAGDLVLLNGNLVHAVLNGNAISAPERRLLVT
                     CFMGVQQNGDLVWWT"
     CDS             120455..121345
                     /transl_table=11
                     /locus_tag="PAU_00114"
                     /old_locus_tag="PAT2150"
                     /product="membrane protein, putative"
                     /db_xref="EnsemblGenomes-Gn:PAU_00114"
                     /db_xref="EnsemblGenomes-Tr:CAQ82207"
                     /db_xref="GOA:C7BU57"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="UniProtKB/TrEMBL:C7BU57"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000076"
                     /protein_id="CAQ82207.1"
                     /translation="MIPMISKALWVSYGSTLLFVLLWSSGAIFSRWGLDHSTAFAILL
                     MRFAVALIFLIFLGLLFGRKGHFLPEQGTRKQVASTGVLLIGGYSICYFFALDNGITP
                     GVLATVMGIQPIITLLVIERRFSAVRLAGLLLALLGLILVVYQSLVLSRFSLAGITFA
                     LVALACMSIGAILQKRIHQAPSVVLPLQYGVSLLLCLLFVPFQPFEFQLVPGFIISLL
                     WLGLVISVVAQLLLYRLIQAGNLVNVTSLFYLVPGVTAVMDYLFLGNSLPDLSLLGMV
                     AILSGLILVFRTKKISLSTE"
     sig_peptide     120455..120544
                     /locus_tag="PAU_00114"
                     /note="Signal peptide predicted for PAT2150 by SignalP 2.0
                     HMM (Signal peptide probability 0.640) with cleavage site
                     probability 0.269 between residues 30 and 31"
     misc_feature    order(120473..120541,120569..120637,120683..120742,
                     120752..120814,120833..120901,120914..120973,
                     120992..121060,121088..121156,121175..121243,
                     121253..121312)
                     /note="10 probable transmembrane helices predicted for
                     PAT2150 by TMHMM2.0 at aa 7-29, 39-61, 77-96, 100-120,
                     127-149, 154-173, 180-202, 212-234, 241-263 and 267-286"
     misc_feature    120515..120886
                     /note="HMMPfam hit to PF00892, Integral membrane protein
                     DUF6, score 4.5e-10"
                     /inference="protein motif:Pfam:PF00892"
     misc_feature    120947..121315
                     /note="HMMPfam hit to PF00892, Integral membrane protein
                     DUF6, score 4.3e-12"
                     /inference="protein motif:Pfam:PF00892"
     CDS             121561..123150
                     /transl_table=11
                     /locus_tag="PAU_00115"
                     /old_locus_tag="PAT2151"
                     /product="conserved hypothetical protein"
                     /note="similar to penicillin-binding protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00115"
                     /db_xref="EnsemblGenomes-Tr:CAQ82208"
                     /db_xref="InterPro:IPR001466"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="UniProtKB/TrEMBL:C7BU58"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AY167420"
                     /protein_id="CAQ82208.1"
                     /translation="MESAISTDNIKLFIKKIDELVNIEDKKKGGALAVAVTHGDETIY
                     QRHIGQASIEHAVAIQPDTKFYLASASKQFTAFCIALLEKEGKLSVKDKVGKYLDDFP
                     ARFSDITIEHLIHHTSGLRDIFLLYNLAGKNSDFDYCNADLVRKLAHRQQELSFTPGE
                     YSLYSNTGYHFLGEIISVVSGQTLRKYAEENVFAPLKMKDTLICDDITEIIPNRAMGY
                     TYNEDSHQWIRSDINNSVVGSAAVHSTVNDLCRWIRAFYSPSIVQELLPQLSRTPDLT
                     NGNRNKYAYGLDIDQREGQRIIHHSGTYAGFRANIVILPDAKLGIAITSATNVNVAKW
                     VDKNIDILFNTGIKPEKPHCLTSDIDITGIFRGIESYPYIITKEDVYLLSNLLEEGKP
                     IIFNVDGTFQEQGGVIKFRPIVENNSVIALEKIDENGNVFYFKKMKDEENIDIKLLLG
                     KYYSHETEAMVDIISSGDGIAIGGIIYPSKKEVLRRIHGNSYFSPRTELIIDFAFDPN
                     ANKHSLYISDSRCWKVEFVAV"
     misc_feature    121597..122598
                     /note="HMMPfam hit to PF00144, Beta-lactamase, score
                     5.2e-59"
                     /inference="protein motif:Pfam:PF00144"
     CDS             123371..124966
                     /transl_table=11
                     /locus_tag="PAU_00116"
                     /old_locus_tag="PAT2152"
                     /product="conserved hypothetical protein"
                     /note="similar to penicillin binding protein, beta
                     lactamase precursor"
                     /db_xref="EnsemblGenomes-Gn:PAU_00116"
                     /db_xref="EnsemblGenomes-Tr:CAQ82209"
                     /db_xref="InterPro:IPR001466"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="UniProtKB/TrEMBL:C7BU59"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AAIA01000048"
                     /protein_id="CAQ82209.1"
                     /translation="MMESTISTDKIKLFLNKIDELINIENKKKGGALAVAVTHGNKII
                     YQRHIGKADIEHSVAVKPNTKFYLASVSKQFAAFCIALLEKEGKLCVKDKVGQYLDYF
                     PAHFSDITIEHLVHHTSGLRDEFLLYSLAGKNSDFDHRHIELVRKLTQRQYSLNFTPG
                     EYYLYSNTGYNLLAEIVSVVSGKSLRKYAEENVFIPLKMKDTFFYDDITEIIPDRAMG
                     YAYNEESHQWRRDDLNDVVVGGSGLYSTVNDLCSWMKAFYSPSIVQDLWPQLSRTPDL
                     TNGNRNNYAYGFAINQREGQKIIRHDGGYGGFRSEVCILPDAELGIAVTSAMNTNVSK
                     LVQQCFDVLFNPNDTKPEKQPCRTSDADITGIFKGLQPYPYIITKEDCYLLGNLFEKG
                     NPIIFNSDGTFQAEDGKIRFRPVIENDNVIALEQINENGNVFYLDKMIDDGGADIQLL
                     LGHYYNHETEAVLTVAASGDELYIDAIISPERKEVLHRVYGNSYFSPSTKLIIDFALD
                     PETNEPQLYLSNGRCWNIEFVAF"
     misc_feature    123410..124414
                     /note="HMMPfam hit to PF00144, Beta-lactamase, score
                     4.4e-61"
                     /inference="protein motif:Pfam:PF00144"
     CDS             125256..126848
                     /transl_table=11
                     /locus_tag="PAU_00117"
                     /old_locus_tag="PAT2153"
                     /product="conserved hypothetical protein"
                     /note="similar to penicillin binding protein, beta
                     lactamase"
                     /db_xref="EnsemblGenomes-Gn:PAU_00117"
                     /db_xref="EnsemblGenomes-Tr:CAQ82210"
                     /db_xref="InterPro:IPR001466"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="UniProtKB/TrEMBL:C7BU60"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AY167420"
                     /protein_id="CAQ82210.1"
                     /translation="MESTISTDKIKLFINKIDELVNIENKKKGGALAVAVTHGNKIIY
                     QRHIGKADIEHSVAVKPNTKFYLASVSKQFAAFCIALLEKEGKLCIKDKVGQYLDYFP
                     AHFSDITIEHLIHHTSGLRDEFLFYSLAGKNSDFDHRHIELVRKLMQRQQALNFTPGE
                     YYLYSNTGYNLLAEIVRVVSGKSLRKYAEENVFVPLKMKDTFFYDDITEIIPDRAMGY
                     AYNEESHQWRRDDLNDVVVGGSGLHSTVNDLCRWMRAFYSPSIVQDLLPQLSRTPDLT
                     NGNRNNYAYGLMISQREGQKIIQHGGSYTGFKSHVCILPDAKLGIAITAATGAEVTGW
                     VEQHIDILFHTDIEREEPYCLTNDIDITGIFRGIEPYPYIITKEDTYLLGNLFEKGNP
                     IIFNSDGTFQEQGGKIRFRPIIENDSVIALEQIDENGNIFYLKKRVDDGGVDIQLLSG
                     RYYSHEAEAMLFISSSDNGIYIDGIVYPGKKEVLRRIYGNSYFSPSTELIIDFELDSD
                     TNKPRLYINDSRCWNVELVQFN"
     misc_feature    125292..126293
                     /note="HMMPfam hit to PF00144, Beta-lactamase, score
                     1.3e-65"
                     /inference="protein motif:Pfam:PF00144"
     CDS             126988..128577
                     /transl_table=11
                     /locus_tag="PAU_00118"
                     /old_locus_tag="PAT2154"
                     /product="conserved hypothetical protein"
                     /note="similar to penicillin binding protein, beta
                     lactamase"
                     /db_xref="EnsemblGenomes-Gn:PAU_00118"
                     /db_xref="EnsemblGenomes-Tr:CAQ82211"
                     /db_xref="InterPro:IPR001466"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="UniProtKB/TrEMBL:C7BU61"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AY167420"
                     /protein_id="CAQ82211.1"
                     /translation="MMALTISRDNIKFLLKKIDNLIDIENKKNGGALAVAVTHENETI
                     YKRYIGQASIEHSAAITPNTKFYMASVSKQFTAFCIALLEKAGKLNVKDKVGKYVDYF
                     PTRFSDITIEHLIHHTSGLRDKYVPYGLAGKNSDFDHRSMGLLRKLIQRQQALNFTPG
                     ERFRYSNTGYNLLAEIIKVVSGKSLREYAKENIFIPLKMNNTSFYDEVTEIIDDRAIG
                     YVYNEDAKQWKRSDHNDSTIGSAGLRSTVSDLCRWMKAFYSPSIVRDMLPHLSRTPNL
                     TNGNRNNYAYGLMISQREGQKIIRHDGSYGGFKAEVCVLPDIKLGIVITAATGINTVE
                     FTNQCLNILFNTDITEPEHCRTSNIDITGMFKGEDPYPYIITKEDCYLLGNLFEKGNP
                     IIFNADGTFQEKGGDIRFRAVIGNNEVIALEQIDENGNIFYLKKMIDKADIDIQRLSG
                     RYYNHETESIINIESSGDKLYLDAVVLPGKKEALRWAYENSYFSQATELIIDFKLDSD
                     TNKPHLYVNDSRCWKIEFVPV"
     misc_feature    127048..128028
                     /note="HMMPfam hit to PF00144, Beta-lactamase, score
                     5.5e-60"
                     /inference="protein motif:Pfam:PF00144"
     CDS             129096..130604
                     /transl_table=11
                     /locus_tag="PAU_00119"
                     /old_locus_tag="PAT2155"
                     /product="similar to deoxycytidylate deaminase-related
                     protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00119"
                     /db_xref="EnsemblGenomes-Tr:CAQ82212"
                     /db_xref="GOA:C7BU62"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR015517"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR035105"
                     /db_xref="UniProtKB/TrEMBL:C7BU62"
                     /inference="similar to DNA sequence:INSD:AE016853"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82212.1"
                     /translation="MEIIHMIDINKTYLSEDNQMPCDFDSEVVIGLVGAVGTDLEIIK
                     DSITQKLNAFRYDVQEVRISSEIISVLRDIPLTKDNYEKISCLMTEGNNLREVSQDNS
                     ILALAAVAEINKRREKKNSLPIPSIRRAYIINSLKHPDEVNALREIYANGFFLIGVYT
                     SESQRLKNLTVDKGIDREKAKELISRDSNEGNEWGQHTRDTYELSDFFISYDGNKNRA
                     DNSIWRILDLIFGNPYVTPTFDEYAMFMAFSASLRSGDLSRQVGAVLTKNKNIISTGA
                     NDVPKFGGGLYWPEYVGDEIEDAKNGRDYKVGEDSNAKEKRLIIEDILKDVKDEKKEE
                     FKEYLLRSKIKDITEYGRVVHAEMEAILACARSNISTYNGILYCTTFPCHNCAKHIVA
                     SGIKRVVYIEPYPKSKAFDFHPDSISTPGVDDNKVIFEPFVGVGPRCFFNLFSINLGV
                     GYKIKRKNKEGKTLNWDRRDGKLRMKMLSLSYIEKETESAANVDRLIKELKK"
     misc_feature    129804..130301
                     /note="HMMPfam hit to PF00383, Cytidine and
                     deoxycytidylate deaminas, score 4.4e-23"
                     /inference="protein motif:Pfam:PF00383"
     CDS             complement(130958..132145)
                     /transl_table=11
                     /gene="uxuA"
                     /locus_tag="PAU_00120"
                     /old_locus_tag="PAT2156"
                     /product="mannonate dehydratase"
                     /EC_number="4.2.1.8"
                     /db_xref="EnsemblGenomes-Gn:PAU_00120"
                     /db_xref="EnsemblGenomes-Tr:CAQ82213"
                     /db_xref="GOA:C7BGN4"
                     /db_xref="InterPro:IPR004628"
                     /db_xref="InterPro:IPR013022"
                     /db_xref="UniProtKB/TrEMBL:C7BGN4"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82213.1"
                     /translation="MEQTWRWFGPNDPVSLDDIRQAGATGIVTALHHIPNGHVWHQDE
                     ILARKTLIENKGLIWSVVESIPVHEEIKTQTGHYQQWINNYKTSLKNLAECGINTVCY
                     NFMPVLDWTRTDLEYLLPDGSKALRFDQIAFAAFEIYILKRPGAEADYTVEEQAQAKV
                     YYDNMSAADIEKLTANIIAGLPGAEEGYTLAEFQAQLDRYQDITHDKLREHLAYFLHQ
                     IVPVCEEYSLRLAIHPDDPPRPILGLPRIISTIEDIEWLTTIEPSPVNGITMCTGSYG
                     VRSDNDLVEMIKRYGNRIYFTHLRSTQREENSKTFHEAAHLAGDVDMYNVIMEILREE
                     YRRKAAGDNRLIPMRPDHGHQIIDDLKKQTNPGYSCIGRLKGLAEIRGLELGLRRAFF
                     ENK"
     misc_feature    complement(130979..132145)
                     /note="HMMPfam hit to PF03786, D-mannonate dehydratase
                     (UxuA), score 1.5e-244"
                     /inference="protein motif:Pfam:PF03786"
     CDS             complement(132235..133035)
                     /transl_table=11
                     /gene="uxuR"
                     /locus_tag="PAU_00121"
                     /old_locus_tag="PAT2157"
                     /product="uxu operon transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:PAU_00121"
                     /db_xref="EnsemblGenomes-Tr:CAQ82214"
                     /db_xref="GOA:C7BGN5"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR008920"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C7BGN5"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:BA000007"
                     /protein_id="CAQ82214.1"
                     /translation="MQLIDSHRNGSNMMKHLLESKRPYQEVGISLRQMIANQQYHIGD
                     RLPPERELAELLGVSRTVVREALIMLELENLIEVRKGSGVYIISLPHLLPASSCSVNA
                     AGPFELLQARQLLESNIAEFAAMQVTPNNIANMRRALQKESEDLASGEDESGDREFHL
                     AIAEATHNSMLVELLKQSWAWRENNPMWQKLHTRITDKDYRKEWLHDHQIILSAMIKK
                     DPAAAKQAMWQHLENVKLRLLELSDIDDPYFDGYLFNSYPYEIAKKRN"
     misc_feature    complement(132337..132717)
                     /note="HMMPfam hit to PF07729, FCD domain, score 4.2e-36"
                     /inference="protein motif:Pfam:PF07729"
     misc_feature    complement(132778..132969)
                     /note="HMMPfam hit to PF00392, Bacterial regulatory
                     proteins, gntR family, score 2.9e-25"
                     /inference="protein motif:Pfam:PF00392"
     misc_feature    complement(132778..132957)
                     /note="HMMSmart hit to SM00345, no description, score
                     4.7e-23"
                     /inference="protein motif:Smart:SM00345"
     CDS             complement(133116..134096)
                     /transl_table=11
                     /locus_tag="PAU_00122"
                     /old_locus_tag="PAT2158"
                     /product="putative c4-dicarboxylate transport system
                     binding protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00122"
                     /db_xref="EnsemblGenomes-Tr:CAQ82215"
                     /db_xref="GOA:C7BGN6"
                     /db_xref="InterPro:IPR004682"
                     /db_xref="InterPro:IPR018389"
                     /db_xref="UniProtKB/TrEMBL:C7BGN6"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82215.1"
                     /translation="MNNSKRILCTVIGTIFTLGASQVIAVTTLKLSHNHNRDHAVHKA
                     MTQFADEVRQKTNGDVRIRIYPDAQLGNQRESMELMQNGALDLVKSNAAEQEAFSPAY
                     SAFNLPYLFRDQAHYEKIKNGEIGKEILASSKNRGFVGITFYEAGARSFYAKKPIRTP
                     ADLKGMKIRVQPSPTAISMVKNLGGNPTSLAYGELYTALQQGVVDAAENNIPSFSLSR
                     HSEVAGYFSLDKHTMVPDVLVISNKSLNKLSSEQQKILMSAATHSSEYMTKLWEKSEE
                     KERQHAEKIGVKFVDVDKKSFEEAVKPIYDDIKKSDPMLYHMVERIRAVK"
     misc_feature    complement(133161..134006)
                     /note="HMMPfam hit to PF03480, Bacterial extracellular
                     solute-binding prot, score 3.9e-101"
                     /inference="protein motif:Pfam:PF03480"
     misc_feature    complement(134010..134078)
                     /note="1 probable transmembrane helix predicted for
                     PAT2158 by TMHMM2.0 at aa 7-29"
     sig_peptide     complement(134022..134096)
                     /locus_tag="PAU_00122"
                     /note="Signal peptide predicted for PAT2158 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.993 between residues 25 and 26"
     CDS             134396..134902
                     /transl_table=11
                     /locus_tag="PAU_00123"
                     /old_locus_tag="PAT2159"
                     /product="trap-type c4-dicarboxylate transport system,
                     small permease component"
                     /db_xref="EnsemblGenomes-Gn:PAU_00123"
                     /db_xref="EnsemblGenomes-Tr:CAQ82216"
                     /db_xref="GOA:C7BGN7"
                     /db_xref="InterPro:IPR007387"
                     /db_xref="UniProtKB/TrEMBL:C7BGN7"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE016796"
                     /protein_id="CAQ82216.1"
                     /translation="MKNLVDCINKGLAFFTICLFVFLVFCVTWQVVSRYVLGTPSTVT
                     DELARYLFIWVAMIGAAYTTGQHRHLAIDLLAMKLKGIGKNIVGLVILASIALFASVV
                     LVYGGSVLAISTLETGQITPALGLQMGYVYLCLPISGVLMIFYTLTDSVALIQNFSGK
                     DTVVYESR"
     misc_feature    order(134432..134491,134534..134590,134651..134719,
                     134762..134830)
                     /note="4 probable transmembrane helices predicted for
                     PAT2159 by TMHMM2.0 at aa 13-32, 47-65, 86-108 and
                     123-145"
     misc_feature    134462..134863
                     /note="HMMPfam hit to PF04290, Tripartite ATP-independent
                     periplasmic trans, score 1.4e-34"
                     /inference="protein motif:Pfam:PF04290"
     CDS             134930..136231
                     /transl_table=11
                     /gene="ygiK"
                     /locus_tag="PAU_00124"
                     /old_locus_tag="PAT2160"
                     /product="similar to dicarboxylate transport system"
                     /db_xref="EnsemblGenomes-Gn:PAU_00124"
                     /db_xref="EnsemblGenomes-Tr:CAQ82217"
                     /db_xref="GOA:C7BGN8"
                     /db_xref="InterPro:IPR004681"
                     /db_xref="InterPro:IPR010656"
                     /db_xref="UniProtKB/TrEMBL:C7BGN8"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82217.1"
                     /translation="MDWQVVLVLFGSFAILLALGIPVSFAISLSSLLAIMMTLPIEAA
                     VTVVAQRMAVGVDNFSLLAIPFFILAGNIMNQGGIATRLINLAKVMGGRLPGSLVHVN
                     IMANMFFGAISGSAVASAAAVGGTMAPMQKKEGYEPEYSAAVNIASCPAGLLIPPSNT
                     LIVYSLVSGGTSIAALFLAGYIPGILMGVSLMIVSAIIAKRRGYPVSPRPTWNEFFIT
                     LVRALPSLMLIVVVMGGIIAGIFTATEASAIAVLYSFVLAVLIYREVSIIKLPKIILD
                     SAVTTSIVLLLIGASMGMSWAMANADLPYLIADALMVVSENPLVILLVINIILLLVGT
                     FMDMTPAILIFTPIFLPVAQSMGIDPVHFGIIMTFNLAIGICTPPVGSALFVGCSIGE
                     VSINKVLKPLVPMYCALIIALMLVTFMPQLSLWLPQMLLNY"
     sig_peptide     134930..135058
                     /gene="ygiK"
                     /locus_tag="PAU_00124"
                     /note="Signal peptide predicted for PAT2160 by SignalP 2.0
                     HMM (Signal peptide probability 0.996) with cleavage site
                     probability 0.600 between residues 43 and 44"
     misc_feature    order(134942..135010,135023..135091,135104..135172,
                     135230..135298,135359..135427,135455..135523,
                     135584..135652,135665..135724,135761..135829,
                     135857..135925,135944..136003,136031..136099,
                     136133..136201)
                     /note="13 probable transmembrane helices predicted for
                     PAT2160 by TMHMM2.0 at aa 5-27, 32-54, 59-81, 101-123,
                     144-166, 176-198, 219-241, 246-265, 278-300, 310-332,
                     339-358, 368-390 and 402-424"
     misc_feature    134957..136198
                     /note="HMMPfam hit to PF06808, DctM-like transporters,
                     score 4.8e-148"
                     /inference="protein motif:Pfam:PF06808"
     CDS             136270..137727
                     /transl_table=11
                     /gene="uxuB"
                     /locus_tag="PAU_00125"
                     /old_locus_tag="PAT2161"
                     /product="mannonate oxidoreductase (d-mannonate
                     oxidoreductase)"
                     /db_xref="EnsemblGenomes-Gn:PAU_00125"
                     /db_xref="EnsemblGenomes-Tr:CAQ82218"
                     /db_xref="GOA:C7BGN9"
                     /db_xref="InterPro:IPR000669"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013118"
                     /db_xref="InterPro:IPR013131"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023027"
                     /db_xref="UniProtKB/TrEMBL:C7BGN9"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82218.1"
                     /translation="MSRNIANCKINPAVSLPSYDRNRLITRIVHLGCGAFHRAHQAVF
                     THHMLEKTDSDWGICEVSLFSGHRLIQQLNDQDCLCTIAEKGAEKTELKVIGSMIDAL
                     HPEFVGQQGILETIAQPQVAIVSLTITEKGYCIDAVNGKLDVNNALIQWDLANPTAPT
                     SAIGYIVEALRLRYERGLSPLSVMSCDNVKENGNVAREAVVGFARLRDEKLAQWIELN
                     VTFPCTMVDRIVPAATSESLGEIAEQLGVYDPCAITCEPFCQWVIEDNFANGRPNWDV
                     AGAQFVKDVMPFETMKLRMLNGSHSFLAYLGYLAGYAHIADTMANADYRQAVLDLMLK
                     EQAPTLTMPVGTDLSQYAHLLIERFSNPSLKHQTWQIAMDGSQKLPQRMFDSVAYHLA
                     NGSDYRYLALGIAGWMCYVSGQDEQGKLIDVRDPMVDQFKSIYQKYGLSVDVVPALLA
                     VFGNPLLANPHFVRVVTEAYQRLLDYGARRAVAAL"
     misc_feature    136345..136836
                     /note="HMMPfam hit to PF01232, Mannitol dehydrogenase
                     Rossmann domain, score 1.5e-77"
                     /inference="protein motif:Pfam:PF01232"
     misc_feature    136918..137655
                     /note="HMMPfam hit to PF08125, Mannitol dehydrogenase
                     C-terminal domai, score 2e-110"
                     /inference="protein motif:Pfam:PF08125"
     CDS             137749..139173
                     /transl_table=11
                     /gene="uxaC"
                     /locus_tag="PAU_00126"
                     /old_locus_tag="PAT2162"
                     /product="uronate isomerase"
                     /EC_number="5.3.1.12"
                     /db_xref="EnsemblGenomes-Gn:PAU_00126"
                     /db_xref="EnsemblGenomes-Tr:CAQ82219"
                     /db_xref="GOA:C7BGP0"
                     /db_xref="InterPro:IPR003766"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="UniProtKB/TrEMBL:C7BGP0"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82219.1"
                     /translation="MKNFMCEDFLLNNETARQLYHEYAVDMPIYDYHCHLNPREIAEN
                     RLFDNLGQIWLEGDHYKWRAMRSVGIDESLITGKQTGDNEKYQAWAKTVPLTLGNPLY
                     HWTHLELRRPFGITGKLFGPQTADEIWHQCNEKLATPEFSARGIMQQMNVRMVGTTDD
                     PVDSLEYHRQIATDEDFDIEVLPSWRPDRVFKIELEGFIEYIQQLEAVADVSISSFAD
                     VLSALGRRLEHFAAHGCRAADHGIENLRYAPIPDEAVLNSILQKRFAGGTLSELEIAQ
                     YTTAVLVWLGRQYAARGWVMQLHIGAIRNNNTRMFRLLGADSGFDSIGDNNIARSLSR
                     LLDSMDVTDELPKTILYCLNPRDNEVIATMAGNFQGGGIAGKVQFGSGWWFNDQKDGM
                     LRQLEQLSQLGLLSRFVGMLTDSRSFLSYTRHEYFRRILCNLLGKWVENGEVPNDRTM
                     LGRMVEDICFNNARRYFALPGENS"
     misc_feature    137749..139164
                     /note="HMMPfam hit to PF02614, Glucuronate isomerase,
                     score 0"
                     /inference="protein motif:Pfam:PF02614"
     CDS             139170..140132
                     /transl_table=11
                     /gene="kdgK"
                     /locus_tag="PAU_00127"
                     /old_locus_tag="PAT2163"
                     /product="2-dehydro-3-deoxygluconokinase
                     (2-keto-3-deoxygluconokinase) (3-deoxy 2-oxo-d-gluconate
                     kinase) (kdg kinase)"
                     /EC_number="2.7.1.45"
                     /db_xref="EnsemblGenomes-Gn:PAU_00127"
                     /db_xref="EnsemblGenomes-Tr:CAQ82220"
                     /db_xref="GOA:C7BGP1"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C7BGP1"
                     /inference="similar to DNA sequence:INSD:AAPH01000001"
                     /inference="similar to DNA sequence:INSD:L42023"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82220.1"
                     /translation="MKQIALLGECMIELNGVPFGTLHQTFGGDVLNSAVYLARASQQK
                     IAVNFVTALGMDSLSEGMIKRWQDEGIHTHLVLRDPAHQPGLYLIQLDEQGERTFLYW
                     RNDSAARYMVRHPDFTSISQALQQMDVVYLSGISLAILPADDREKLLNLLAELAEQGK
                     TIVFDSNYRSALWESIAETQVCYQKLLSCTSLALVTDDDEENLWGDKSVKATMTRLKR
                     AGVKEAVIKAGEVGCYYQNLGRGTPLELIPTEPVAKVIDTTAAGDAFNAGFLAGYLMD
                     CPIQQAAIMGHRLAGIVIQHKGAIIPSSVTKTMTDSFFSEQEKN"
     misc_feature    139170..140090
                     /note="HMMPfam hit to PF00294, pfkB family carbohydrate
                     kinase, score 5.7e-66"
                     /inference="protein motif:Pfam:PF00294"
     CDS             140132..140779
                     /transl_table=11
                     /gene="eda"
                     /locus_tag="PAU_00128"
                     /old_locus_tag="PAT2164"
                     /product="khg/kdpg aldolase"
                     /EC_number="4.1.2.14"
                     /db_xref="EnsemblGenomes-Gn:PAU_00128"
                     /db_xref="EnsemblGenomes-Tr:CAQ82221"
                     /db_xref="GOA:C7BGP2"
                     /db_xref="InterPro:IPR000887"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR031337"
                     /db_xref="InterPro:IPR031338"
                     /db_xref="UniProtKB/TrEMBL:C7BGP2"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82221.1"
                     /translation="MKQIIVQLRQLKIVPVIEVDRAEDIISLGKALADNGLPVAEITF
                     RSAAAEEAIRLLRKAQPNMLIGAGTVLNRGQVMAAKQAGATFIVSPGFNPNTVKACQE
                     LNIPIIPGVNNPSAIEGAMELGLKLLKFFPAEPSGGLPMIKAILSPYTELQIMPTGGI
                     GPKNICDYLAVPRIVACGGSWMVSKVLVDSQNWQEIGRLTREAVDLVNGINNRTD"
     misc_feature    140141..140728
                     /note="HMMPfam hit to PF01081, KDPG and KHG aldolase,
                     score 6.3e-103"
                     /inference="protein motif:Pfam:PF01081"
     CDS             140900..141382
                     /transl_table=11
                     /locus_tag="PAU_00129"
                     /old_locus_tag="PAT2165"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00129"
                     /db_xref="EnsemblGenomes-Tr:CAQ82222"
                     /db_xref="UniProtKB/TrEMBL:C7BGP3"
                     /inference="similar to DNA sequence:INSD:AAOU01000013"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82222.1"
                     /translation="MPGVSLPNPEELFSVGAINNINNKSDLPHKESSLPHSYSGIQIH
                     RDELGRLAPSSFSLPFIDDLKYITSDLREKLREIAKPACENRRLELEQMQSIIMKLCE
                     SHYIRIDVLSILLNRSAKNLRQRHIKPLLNKQNLMMAFPQTPNHPNQGYTVKALLQKD
                     "
     CDS             complement(141736..142623)
                     /transl_table=11
                     /locus_tag="PAU_00130"
                     /old_locus_tag="PAT2166"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00130"
                     /db_xref="EnsemblGenomes-Tr:CAQ82223"
                     /db_xref="GOA:C7BGP4"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="UniProtKB/TrEMBL:C7BGP4"
                     /inference="similar to DNA sequence:INSD:AY502024"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82223.1"
                     /translation="MIIDMNINELLTAEASFMLATLTLESNIIGVMKYENGAILITQD
                     SPFYPKNYKWPDQLHDNGIISIDDKELAVTKVYTAGLINGNLYIDQEITKQATSPAKI
                     MPAHYLPDLQGISERDLIGKTVTLSINDKTRYRVSAAHSMAHFMSLALNKATNHIWSK
                     VYDTDDLGNYNLDKAAIYQSSITELKSVDIYRFGKSLKKKGFDKNILIENLDKINREV
                     NSTLNNWLTQGVEITVEYKSKEISDTRLWKSTIDSTVVTIPCGGTHIKNINEVKGVNI
                     EIKIGESVDFIQITTRCEI"
     CDS             142746..143441
                     /transl_table=11
                     /locus_tag="PAU_00131"
                     /old_locus_tag="PAT2167"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00131"
                     /db_xref="EnsemblGenomes-Tr:CAQ82224"
                     /db_xref="UniProtKB/TrEMBL:C7BGP5"
                     /inference="similar to DNA sequence:INSD:BX936398"
                     /protein_id="CAQ82224.1"
                     /translation="MDYLSYKKQSDHVIAKNIDNVTRKSAPIVYSTMEDIYLGLVRLR
                     NSQAFLYKDIYGKQISNEDQRMIDAAIKTIFKKGDVIYDIVSTIINTMYDFIPERTQR
                     IISEKFHLIVATYGVQTATKISVATAITSLISIKINAVPSVKTKIATFLNISINSLAI
                     YGIFEKAARSARKLKIESPVTYLALKKKGLEMLYFLVEPYMEKLINIYRKNIMTLEDE
                     KLLLDEIERLIYL"
     CDS             complement(143686..144165)
                     /transl_table=11
                     /locus_tag="PAU_00132"
                     /old_locus_tag="PAT2168"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00132"
                     /db_xref="EnsemblGenomes-Tr:CAQ82225"
                     /db_xref="InterPro:IPR008514"
                     /db_xref="UniProtKB/TrEMBL:C7BGP6"
                     /inference="similar to DNA sequence:INSD:CP000308"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82225.1"
                     /translation="MSFSIYLKLNGRKQGLISSGCSTSDSIGNRYQIGHEDEIQVLSF
                     VHSLTREQNSDHHPVDFIKIIDKSSPLLGIAISNNEVLNAFFDFYRINSFGVMEKFYT
                     VELRDASIVDICANYPHSIDSSNTIPFETISLAYKSITWKHHIAGTSGYSIWDDRVY"
     misc_feature    complement(143734..144156)
                     /note="HMMPfam hit to PF05638, Protein of unknown function
                     (DUF796), score 7.8e-61"
                     /inference="protein motif:Pfam:PF05638"
     CDS             complement(144497..145999)
                     /transl_table=11
                     /gene="glpD"
                     /locus_tag="PAU_00133"
                     /old_locus_tag="PAT2169"
                     /product="aerobic glycerol-3-phosphate dehydrogenase"
                     /EC_number="1.1.99.5"
                     /db_xref="EnsemblGenomes-Gn:PAU_00133"
                     /db_xref="EnsemblGenomes-Tr:CAQ82226"
                     /db_xref="GOA:C7BGP7"
                     /db_xref="InterPro:IPR000447"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="InterPro:IPR031656"
                     /db_xref="UniProtKB/TrEMBL:C7BGP7"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82226.1"
                     /translation="METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLAKATSSA
                     SSKLIHGGLRYLEHYEFRLVSEALAEREVLLNLAPHIAFPMRFRLPHQPHLRPAWMIR
                     IGLFLYDNLGKRVSLPSSKGLKFGANSVLKPELVRGFEYSDCWVDDARLVVLNAQEVK
                     KHDGEVRTRTKVTRAWREHDGWMVEAEDLRTGKTHTWRAKGLVNATGPWVKEFFDDSL
                     KLKSPYGIRLIKGSHIVVPRVHDEPQAYILQNEDHRIVFVIPWMDEFSIIGTTDVEYT
                     GDPKEVKIDDQEINYLLKVYNAHFKKQLSREDIVWTYSGVRPLCDDESDSPQAITRDY
                     TLDIHDEQGKAPLLSVFGGKLTTYRKLAEHATEKLMQYYPNAGKAWTKNGQLPGGNLE
                     GCDRDGYARLLRKRYNWLPEGVAVRYARTYGSHSELILQSANNLADLGKSFGHGLYEA
                     ELRYLVDNEWVVELDDAIWRRTKLGMWLNEEQKQHVAAWLVENAKPRSEI"
     misc_feature    complement(144923..145987)
                     /note="HMMPfam hit to PF01266, FAD dependent
                     oxidoreductase, score 6.4e-69"
                     /inference="protein motif:Pfam:PF01266"
     CDS             complement(146355..147113)
                     /transl_table=11
                     /gene="glpR"
                     /locus_tag="PAU_00134"
                     /old_locus_tag="PAT2170"
                     /product="glycerol-3-phosphate regulon repressor"
                     /note="glycerol-3-phosphate regulon repressor"
                     /db_xref="EnsemblGenomes-Gn:PAU_00134"
                     /db_xref="EnsemblGenomes-Tr:CAQ82227"
                     /db_xref="GOA:C7BGP8"
                     /db_xref="InterPro:IPR001034"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014036"
                     /db_xref="InterPro:IPR018356"
                     /db_xref="UniProtKB/TrEMBL:C7BGP8"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82227.1"
                     /translation="MKQTQRHDAIVELVRLQGYVSTEELVEHFNVSPQTIRRDLNDLA
                     DKNKIQRHHGGAALPSSSVNTAYHDRKIMWSEEKARIAQRVASQIPDGATLFIDIGTT
                     PEAVAHALLNHKDLRIVTNNLNVATLLMAKEDFRLILAGGEVRTRDGGIIGEATLDFI
                     SQFRLDYGILGISGIDMDGSLLEFDYHEVRIKRAIIENSRCVMLVTDHSKFGRNAMVN
                     LGNMNLIDCLFTDQTPPASIQKVIEQHNVQLELC"
     misc_feature    complement(146421..146891)
                     /note="HMMPfam hit to PF00455, Bacterial regulatory
                     proteins, deoR family, score 4.2e-76"
                     /inference="protein motif:Pfam:PF00455"
     misc_feature    complement(146928..147098)
                     /note="HMMPfam hit to PF08220, DeoR-like helix-turn-helix
                     domain, score 1.1e-28"
                     /inference="protein motif:Pfam:PF08220"
     misc_feature    complement(146940..147098)
                     /note="HMMSmart hit to SM00420, no description, score
                     1.5e-25"
                     /inference="protein motif:Smart:SM00420"
     misc_feature    complement(146943..147098)
                     /note="HMMPfam hit to PF08279, HTH domain, score 0.00042"
                     /inference="protein motif:Pfam:PF08279"
     CDS             complement(147130..147894)
                     /transl_table=11
                     /gene="glpG"
                     /locus_tag="PAU_00135"
                     /old_locus_tag="PAT2171"
                     /product="putative membrane protein glpg"
                     /db_xref="EnsemblGenomes-Gn:PAU_00135"
                     /db_xref="EnsemblGenomes-Tr:CAQ82228"
                     /db_xref="GOA:C7BGP9"
                     /db_xref="InterPro:IPR002610"
                     /db_xref="InterPro:IPR022732"
                     /db_xref="InterPro:IPR022764"
                     /db_xref="InterPro:IPR023662"
                     /db_xref="UniProtKB/TrEMBL:C7BGP9"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82228.1"
                     /translation="MHPGHDERHVELWLEDDTKLALVQQELEKFTRDPLNERYQAASW
                     QSGKISHSLKYQNNLNWHYLSRQAGPLTITVLILNIAVYLWMQFAGDYQVMYWLAWPD
                     NSQHMELWRWVTHGLLHFSLLHIIFNLMWWWYLGGQTEKRLGTGKLFVITIVSAVFSG
                     WGQSLFSGSNFGGLSGVVYALIGYVWLTGERAPEHGIGVPRGLMAFSILWLIVGYFDT
                     FGLSIANAAHFSGLTIGLLMALWDNRHTFKNNNRHF"
     misc_feature    complement(147154..147588)
                     /note="HMMPfam hit to PF01694, Rhomboid family, score
                     2.8e-31"
                     /inference="protein motif:Pfam:PF01694"
     misc_feature    complement(order(147172..147240,147253..147306,
                     147331..147384,147394..147453,147490..147558,
                     147625..147693))
                     /note="6 probable transmembrane helices predicted for
                     PAT2171 by TMHMM2.0 at aa 68-90, 113-135, 148-167,
                     171-188, 197-214 and 219-241"
     CDS             complement(147989..148324)
                     /transl_table=11
                     /gene="glpE"
                     /locus_tag="PAU_00136"
                     /old_locus_tag="PAT2172"
                     /product="thiosulfate sulfurtransferase GlpE"
                     /EC_number="2.8.1.1"
                     /db_xref="EnsemblGenomes-Gn:PAU_00136"
                     /db_xref="EnsemblGenomes-Tr:CAQ82229"
                     /db_xref="GOA:C7BGQ0"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR023695"
                     /db_xref="UniProtKB/TrEMBL:C7BGQ0"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82229.1"
                     /translation="MEHFQTISPEQAYQHWQDKSAIMVDIRDPQSFQAGHVCGAFHLT
                     NETLNEFMLQANFEQPVMVMCYHGHSSQSAAQYLLNLGFEAVYSINGGFEAWLKNYPH
                     AVDSLRNPA"
     misc_feature    complement(148019..148306)
                     /note="HMMSmart hit to SM00450, no description, score
                     1.4e-19"
                     /inference="protein motif:Smart:SM00450"
     misc_feature    complement(148028..148303)
                     /note="HMMPfam hit to PF00581, Rhodanese-like domain,
                     score 5e-16"
                     /inference="protein motif:Pfam:PF00581"
     CDS             complement(148420..148995)
                     /transl_table=11
                     /gene="gntY"
                     /locus_tag="PAU_00137"
                     /old_locus_tag="PAT2173"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00137"
                     /db_xref="EnsemblGenomes-Tr:CAQ82230"
                     /db_xref="GOA:C7BGQ1"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="InterPro:IPR001075"
                     /db_xref="InterPro:IPR017726"
                     /db_xref="UniProtKB/TrEMBL:C7BGQ1"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82230.1"
                     /translation="MINITEAAQAHFAKLLANQEPGTQIRVFVINPGTPTAECGVSYC
                     PPDAVEATDTELKFEKLSAYVDELSAPFLEEAEIDFVTDQLGSQLTLKAPNAKMRKVS
                     DDAPLVERVEYVLQSQINPQLAGHGGRVSLMEITDEGFAILQFGGGCNGCSMVDVTLK
                     EGIEKELLNMFPELKGVKDLTEHQRGEHSYY"
     misc_feature    complement(148456..148665)
                     /note="HMMPfam hit to PF01106, NifU-like domain, score
                     1.8e-07"
                     /inference="protein motif:Pfam:PF01106"
     misc_feature    complement(148714..148992)
                     /note="HMMPfam hit to PF01521, Iron-sulphur cluster
                     biosynthesis, score 9.8e-32"
                     /inference="protein motif:Pfam:PF01521"
     CDS             complement(149055..149519)
                     /transl_table=11
                     /gene="gntX"
                     /locus_tag="PAU_00138"
                     /old_locus_tag="PAT2174"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00138"
                     /db_xref="EnsemblGenomes-Tr:CAQ82231"
                     /db_xref="GOA:C7BGQ2"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:C7BGQ2"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82231.1"
                     /translation="MSRLIRRYKYHSTPQLASVLARLFLLHWQQGYRDGRWFKPNILL
                     SVPLHRHRRWKRGFDQGELMAKQLSEWLQCDYQQSILQRTRATLPQRNLSAAQRRTNL
                     RKAFQLCGPVAGQHVAILDDVITTGATITEISRLLIRAGARSVQVWAICRTL"
     CDS             complement(149494..149949)
                     /transl_table=11
                     /gene="OSJNAa0079B05.15"
                     /locus_tag="PAU_00139"
                     /old_locus_tag="PAT2175"
                     /product="Hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00139"
                     /db_xref="EnsemblGenomes-Tr:CAQ82232"
                     /db_xref="UniProtKB/TrEMBL:C7BGQ3"
                     /inference="similar to DNA sequence:INSD:CR382137"
                     /protein_id="CAQ82232.1"
                     /translation="MDQNISRVSITVFGDATENAERIAFQWNARLPHSAPIRAAAQDH
                     ANLHQKSAKTDQPLLFSTLFAIKEEAYANNGWVLLAMPSTPLVSTSWNMQFLQQAAET
                     FDKHVPMLRPALRINFITLWALHQETASMGKYDSDHRLSPSIEPPYSPL"
     CDS             150369..151568
                     /transl_table=11
                     /gene="tyrS2"
                     /locus_tag="PAU_00140"
                     /old_locus_tag="PAT2176"
                     /product="tyrosyl-trna synthetase 2"
                     /EC_number="6.1.1.1"
                     /db_xref="EnsemblGenomes-Gn:PAU_00140"
                     /db_xref="EnsemblGenomes-Tr:CAQ82233"
                     /db_xref="GOA:C7BGQ4"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002307"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR024088"
                     /db_xref="InterPro:IPR024108"
                     /db_xref="UniProtKB/TrEMBL:C7BGQ4"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AAPM01000001"
                     /protein_id="CAQ82233.1"
                     /translation="MKENIDKLLSNIAIMEPPSGLQDKLALARQENRKLTIKLGFDPT
                     APDLHLGHSVVLQKLKDFQDEGHRIVVIIGDFTAGIGDPTGRNKLRPPLTLEQINKNS
                     QTYINQLAKVINIENIEIRKNSEWFSNMPFSNVIKLISKITLAQIMHRDDFKTRFESK
                     SPVHLHEIIYPILQGYDSVMIDADIELGGTDQLFNNLVGRTLQEAYEKKGQIVITMPL
                     LEGLDGIEKMSKSKNNYIGLTDNANDMYGKVMSIPDSVIINYLTLATDMEAEKQSAIV
                     SQLELGLNPMKVKKDIAYNIVKRYHDDISAKEAAEHFERVVQKRTPEEADHDVLILPK
                     GSYITLLDLCSVALPTISRSELRRLIRSGAVRVDKSKEDNEIKNIEVIPGMLIWIGKR
                     YKFRIDG"
     misc_feature    150456..151322
                     /note="HMMPfam hit to PF00579, tRNA synthetases class I (W
                     and Y), score 2.6e-89"
                     /inference="protein motif:Pfam:PF00579"
     misc_feature    151380..151529
                     /note="HMMPfam hit to PF01479, S4 domain, score 0.017"
                     /inference="protein motif:Pfam:PF01479"
     CDS             complement(151579..152376)
                     /transl_table=11
                     /gene="spnH"
                     /locus_tag="PAU_00141"
                     /old_locus_tag="PAT2177"
                     /product="conserved hypothetical protein"
                     /product="similarities with putative methyltransferase"
                     /product="probable o-methyltransferase"
                     /db_xref="EnsemblGenomes-Gn:PAU_00141"
                     /db_xref="EnsemblGenomes-Tr:CAQ82234"
                     /db_xref="InterPro:IPR008884"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C7BGQ5"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AY007564"
                     /protein_id="CAQ82234.1"
                     /translation="MKPEKEIIPFSPEMIQKLISEGKDPHYYVIQDFMEDKSLNLSEL
                     DKQSLVDSHYLISKKIISPHSTEDIFTFIKEILSIPSSREGCIVEAGSYKGSSTAKFS
                     LAAKLTGRELVVCDSFMGLPFHNEVHGISIEGREAVFREGDFAGSLQEVKNNIIKYGN
                     ISSCTFIKGWFETSLANWSRPIAAIYLDVDLQKSTRDCLKYLYPWLTPGGSLYSQDGH
                     LPLVLDVFEDVNFWRKEIGTQPPTVVGIRKKKLIKITKPDTPSLPLL"
     CDS             complement(152379..154031)
                     /transl_table=11
                     /locus_tag="PAU_00142"
                     /old_locus_tag="PAT2178"
                     /product="predicted fe-s oxidoreductase"
                     /EC_number="2.1.1.-"
                     /db_xref="EnsemblGenomes-Gn:PAU_00142"
                     /db_xref="EnsemblGenomes-Tr:CAQ82235"
                     /db_xref="GOA:C7BGQ6"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C7BGQ6"
                     /inference="similar to DNA sequence:INSD:BA000001"
                     /inference="similar to DNA sequence:INSD:AE010388"
                     /protein_id="CAQ82235.1"
                     /translation="MLDLSLLRDSGTFSIDGGSPRLALVHHGFRTTQLGATDKRQDKY
                     AARYASLGLLNLARSAQVDFERGRIPFQPEIQYFDEDNFTDDVELAKAISDWLRPSKA
                     RFVLVSLYSLAFERTKNMLSNLNPEEVCIMVGGAHPTVAPEIDFVHLVARGEGGNALR
                     HVLRLFLHPEFGMGNEARGLCFMLDGKVQMGEVVFDKSLEDIPSPAFSYELIQNDTSF
                     AGQSRERWWKAVGESQQIYICTQSCRARCTFCSTYLIHGKLVSRPVELIAGDIEHLLT
                     FGHDSIQFHDDDLLQHENLHELLDLLLEFNIAWTCNARSEVITPALARRMYDAGCKKV
                     FLGVESLDQRSLNYYNKATTVEMNINAVNALNSSGIGVICGYIIGAPHDTVESILADL
                     DRVLALPIYFLATAILTPDIGTVEYRRALRRIPLLQELGNDGTKMNIRPRPEIFGTSA
                     PYGLPTVAEAISKEELNELYALINCEFFLRKEYINRVIKYTSNDRLNEALSWCSLQKL
                     KAEELAESATLASVQERTVQLLQKIDADYPYYGVLSEFAEAR"
     misc_feature    complement(152745..153335)
                     /note="HMMSmart hit to SM00729, no description, score
                     2e-21"
                     /inference="protein motif:Smart:SM00729"
     misc_feature    complement(152847..153323)
                     /note="HMMPfam hit to PF04055, Radical SAM superfamily,
                     score 3.1e-18"
                     /inference="protein motif:Pfam:PF04055"
     CDS             complement(154042..155025)
                     /transl_table=11
                     /locus_tag="PAU_00143"
                     /old_locus_tag="PAT2179"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00143"
                     /db_xref="EnsemblGenomes-Tr:CAQ82236"
                     /db_xref="InterPro:IPR008775"
                     /db_xref="UniProtKB/TrEMBL:C7BGQ7"
                     /inference="similar to DNA sequence:INSD:CP000362"
                     /inference="similar to DNA sequence:INSD:BC097873"
                     /protein_id="CAQ82236.1"
                     /translation="MLSNQCVNIIDQYRNDGYVVIRNVLNPVTDLLPVIKEYGELANK
                     LANQWLGQGIITSYDKNAPEENRLLQLMKQTDGNCFQELDITLPVEAEIKEDSPVHLG
                     EAIFNLLRNQTILDVVENIIGSEIYSVPVQHMRIKPPEAQITDETQSHTLTLTGKTFW
                     HQDLAVVTQDADNTDMLSVWLPLNEATEKNGCLVVIPGSHTKGLVHHCDTPVLQGIPD
                     SLIGENIRPIPAKPGDMVLLHPLMIHASLSNISTHGRWSLDLRYCPTGQPTGRRWFPG
                     FIARSKSHPEKELSDYEVWVESWHFARQTLAGQPHPKFDRWDKNDPSPLCA"
     misc_feature    complement(154255..154995)
                     /note="HMMPfam hit to PF05721, Phytanoyl-CoA dioxygenase
                     (PhyH), score 5e-17"
                     /inference="protein motif:Pfam:PF05721"
     CDS             complement(155076..155990)
                     /transl_table=11
                     /locus_tag="PAU_00144"
                     /old_locus_tag="PAT2180"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00144"
                     /db_xref="EnsemblGenomes-Tr:CAQ82237"
                     /db_xref="InterPro:IPR008775"
                     /db_xref="UniProtKB/TrEMBL:C7BGQ8"
                     /inference="similar to DNA sequence:INSD:AAEH02000007"
                     /inference="similar to DNA sequence:INSD:CP000362"
                     /protein_id="CAQ82237.1"
                     /translation="MKTILYMERKMCSDINRLEPGLIKKYKEEGFLLIPSLISEEDLI
                     ILEATIQNIIRDVENHETATQVIEYENTQVDGLWLPRRLFNPFELHEQFRRIATSEQI
                     LGHVISLIGQDIALQHSKLNMKPRKVGAAVEWHQDFTYFPHTNDDLVGVLIYLDDATS
                     ENGCLEVLPRQHTRSFDHSLPDGSFAGMITEEIDEENYGQPVTLAAKAGGTIFLHPFT
                     PHRSAPNVSEQPRKTLIFEYRAADAFPIYTGSQLVSMESYVHHLHGNPATYARFGGPS
                     PAIYTPKNIPKSLYELQEVSSKILKPKE"
     misc_feature    complement(155292..155921)
                     /note="HMMPfam hit to PF05721, Phytanoyl-CoA dioxygenase
                     (PhyH), score 4e-26"
                     /inference="protein motif:Pfam:PF05721"
     CDS             complement(156089..156676)
                     /transl_table=11
                     /locus_tag="PAU_00145"
                     /old_locus_tag="PAT2181"
                     /product="Hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00145"
                     /db_xref="EnsemblGenomes-Tr:CAQ82238"
                     /db_xref="UniProtKB/TrEMBL:C7BGQ9"
                     /inference="similar to AA sequence:UniProt:Q23TZ6"
                     /protein_id="CAQ82238.1"
                     /translation="MVSQNELCRISNNADAIRAKAMELTDSWEGVMFALSAEELENIA
                     LALEFSPDIADKIHNELKTLQYAKIQSQVGPSFIATYHVLDVSLLALRGVTDFDNALS
                     HVNDFNLQSFLNENQYTFQKIRAALPGHAARMNFKPETAAAVLKALGANISPDLLYEL
                     CPKYGTSSVIDLEGRRGVTTEFIRSVTLTLGMTLV"
     CDS             157600..158817
                     /transl_table=11
                     /gene="ydeF"
                     /locus_tag="PAU_00146"
                     /old_locus_tag="PAT2182"
                     /product="putative membrane transport protein"
                     /note="MFS transporters are single-polypeptide secondary
                     carriers capable only of transporting small solutes in
                     response to chemiosmotic ion gradients"
                     /db_xref="EnsemblGenomes-Gn:PAU_00146"
                     /db_xref="EnsemblGenomes-Tr:CAQ82239"
                     /db_xref="GOA:C7BGR0"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C7BGR0"
                     /inference="similar to DNA sequence:INSD:AE009952"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82239.1"
                     /translation="MNYNISLLHVFKNERIVSFFLFSSLLLTIGRGASLPYLAIYLSV
                     ELNFSPVIVGYIISSSMVFGIITSLIGGMLADNKKFKLPILSSLLTFLFCFLIFPYFK
                     NSILISFLLALVNLAYSLFEVLLKSYFSDYLPQSIKIRLFSLNYTLINVGWSVGPLIG
                     ALLSGYNHSFPFILSGLTALLPMIFIIIYYSSCFHSLPILSQRNNRLLADTISNIKPL
                     KNHLLFLITISSVLGSFVYGSTISYLSQYLIVYTNKEFSYTAIAAMMVTNAMVVIGFQ
                     YHVGKYIKDDYIGRWLTGGAIFFILGIFGFIYSEQNLIYWIIAMFSFSLGEIIFIPVL
                     YALTDSIAPEGFRGHYFAIQNLGSLGAAVSPVLMGYLISYYKSPYIFLILIVTISFSY
                     FILLVVKHAYIKQ"
     misc_feature    order(157654..157722,157750..157818,157843..157902,
                     157915..157983,158020..158088,158131..158199,
                     158260..158328,158371..158439,158458..158526,
                     158536..158604,158665..158724,158734..158793)
                     /note="12 probable transmembrane helices predicted for
                     PAT2182 by TMHMM2.0 at aa 19-41, 51-73, 82-101, 106-128,
                     141-163, 178-200, 221-243, 258-280, 287-309, 313-335,
                     356-375 and 379-398"
     misc_feature    157657..158718
                     /note="HMMPfam hit to PF07690, Major Facilitator
                     Superfamily, score 4e-35"
                     /inference="protein motif:Pfam:PF07690"
     CDS             complement(158880..159164)
                     /transl_table=11
                     /locus_tag="PAU_00147"
                     /old_locus_tag="PAT2183"
                     /product="Hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00147"
                     /db_xref="EnsemblGenomes-Tr:CAQ82240"
                     /db_xref="UniProtKB/TrEMBL:C7BGR1"
                     /inference="similar to DNA sequence:INSD:CR382137"
                     /inference="similar to DNA sequence:INSD:CT573326"
                     /protein_id="CAQ82240.1"
                     /translation="MLFSTLFAIKEEAYANNGWVLLAMPSTSLVSTSWNMQFLQQAAE
                     TFDKHVPMLRPALRINFTALWALYQDTASMGKYDSDHRLSPSIERPYSPL"
     CDS             159164..159940
                     /transl_table=11
                     /gene="bioH"
                     /locus_tag="PAU_00148"
                     /old_locus_tag="PAT2184"
                     /product="carboxylesterase BioH"
                     /EC_number="3.1.1.1"
                     /db_xref="EnsemblGenomes-Gn:PAU_00148"
                     /db_xref="EnsemblGenomes-Tr:CAQ82241"
                     /db_xref="GOA:C7BGR2"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR010076"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C7BGR2"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82241.1"
                     /translation="MADLFWQTSDGDSRDLVLLHGWGLNAEVWRSIEMRCAPHFRLHL
                     VDLPGYGRSQKYGPMSLADMADEVWRHAPENALWLGWSLGGLVASRIALDHQDKVAGL
                     ITVASSPHFSAEGDWPGIKPEVLSDFEHQLSEDFQRTVERFLALQTMGTDSARQDARL
                     LKSVVLVQPMPAVEVLHVGLEILCTEDLRESLAALTIPFLRIYGYLDGLVPRKILNIL
                     DEKWPRSVSTIMRHAAHAPFISHPDEFVGLLTEFVGREAL"
     misc_feature    159281..159916
                     /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
                     score 1.1e-23"
                     /inference="protein motif:Pfam:PF00561"
     CDS             160538..160837
                     /transl_table=11
                     /locus_tag="PAU_00149"
                     /old_locus_tag="PAT2185"
                     /product="similar to protein gp48 from prophage n15"
                     /db_xref="EnsemblGenomes-Gn:PAU_00149"
                     /db_xref="EnsemblGenomes-Tr:CAQ82242"
                     /db_xref="GOA:C7BGR3"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C7BGR3"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE009952"
                     /protein_id="CAQ82242.1"
                     /translation="MSDNDYDIIPFSEAKTLLLEDAATLEAYNDIQIRKALMKQLKDA
                     RKALHLTQQDVAQKIGTQKQNISRMENGKSVPNLDTLSRYAAALGGRFVFQMPVS"
     misc_feature    160655..160822
                     /note="HMMSmart hit to SM00530, no description, score
                     3.7e-13"
                     /inference="protein motif:Smart:SM00530"
     misc_feature    160658..160822
                     /note="HMMPfam hit to PF01381, Helix-turn-helix, score
                     7.9e-15"
                     /inference="protein motif:Pfam:PF01381"
     CDS             complement(160962..161201)
                     /transl_table=11
                     /gene="yhgG"
                     /locus_tag="PAU_00150"
                     /old_locus_tag="PAT2186"
                     /product="similar to putative DNA-binding transcriptional
                     regulator protein yhgg of escherichia coli"
                     /db_xref="EnsemblGenomes-Gn:PAU_00150"
                     /db_xref="EnsemblGenomes-Tr:CAQ82243"
                     /db_xref="GOA:C7BGR4"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR015102"
                     /db_xref="InterPro:IPR023732"
                     /db_xref="UniProtKB/TrEMBL:C7BGR4"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82243.1"
                     /translation="MISLLQVRDAVALNGRADAKLLSHQLSASLSMVEAMLEQLTVMG
                     KLEKINATACLSGGCKQCPEAQKCDTAVYRIAGGH"
     CDS             complement(161211..163523)
                     /transl_table=11
                     /gene="feoB"
                     /locus_tag="PAU_00151"
                     /old_locus_tag="PAT2187"
                     /product="ferrous iron transport protein b"
                     /note="iron(II) transport system (feo) which may make an
                     important contribution to the iron supply of the cell
                     under anaerobic conditions. FeoB has been identified as
                     part of this transport system and may play a role in the
                     transport of ferrous iron."
                     /db_xref="EnsemblGenomes-Gn:PAU_00151"
                     /db_xref="EnsemblGenomes-Tr:CAQ82244"
                     /db_xref="GOA:C7BGR5"
                     /db_xref="InterPro:IPR003373"
                     /db_xref="InterPro:IPR011640"
                     /db_xref="InterPro:IPR011642"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR030389"
                     /db_xref="UniProtKB/TrEMBL:C7BGR5"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82244.1"
                     /translation="MKALTIGLIGNPNAGKTTLFNQLTGARQRVGNWAGVTVEQKTGR
                     FITADHKIELVDLPGTYSLTTISEQTSLDEQIACHYILSGDADMLINVVDASNLERNL
                     YLTLQLLELGIPCIIALNMLDIAKNQHIQIDIAELEQRLGCPVIPMVSTRATGLNELK
                     QAIDHHKQNSGQPLIRYPDSLLQEVDKLSGAISDNFNPQQRRWLALQMLEGDIYSLGR
                     SGLATSMLAESKECLQQQQHEEPELVIADARYQGINALCMAVIDTQKAMPNKLTQAID
                     KIILNRWLGVPIFLIVMYLMFVLAINIGGALQPIFDSGSIAIFIHGVQWLGHTLSFPE
                     WLTVFLAQGIGGGINTVLPLVPQIGMMYLFLSFLEDSGYMARAAFVMDRLMQVLGLPG
                     KSFVPLIVGFGCNVPSIMGARTLDAPRERLITIMMAPFMSCGARLAIFAVFAAAFFGK
                     NGATIVFSLYILGIVVAILTGLMLKYTIMRGEASPFVMELPVYHIPHLKTLLLQAWQR
                     LKGFVIRAGKVIVIASMFIGALNSFSFSGQAVDSINESALASVSKAITPVLQPIGVHS
                     DNWQATVGLITGAMAKEVVVGTLNTLYTAESITNEPFDADGFNLLGELKDAVNETWDS
                     LKDTFTLSVLSNPIEASKGDGEMDSGSMGTMSTKFGSAISAYSYLIFVLLYVPCVSVM
                     GAIARETSRGWMTFSILWGLNVAYSISTLFYQMVTFSQHSQSSLIIILTVITFNALVF
                     YFLRRARSRVTMKLISNPGNNCHCSSGNCH"
     misc_feature    complement(order(161295..161354,161382..161450,
                     161469..161537,161925..161993,162096..162164,
                     162192..162260,162297..162365,162423..162491,
                     162510..162578,162621..162689))
                     /note="10 probable transmembrane helices predicted for
                     PAT2187 by TMHMM2.0 at aa 279-301, 316-338, 345-367,
                     387-409, 422-444, 454-476, 511-533, 663-685, 692-714 and
                     724-743"
     misc_feature    complement(161445..161987)
                     /note="HMMPfam hit to PF07670, Nucleoside recognition,
                     score 2e-16"
                     /inference="protein motif:Pfam:PF07670"
     misc_feature    complement(162000..162161)
                     /note="HMMPfam hit to PF07664, Ferrous iron transport
                     protein B C terminus, score 3.3e-24"
                     /inference="protein motif:Pfam:PF07664"
     misc_feature    complement(162168..162473)
                     /note="HMMPfam hit to PF07670, Nucleoside recognition,
                     score 6.3e-16"
                     /inference="protein motif:Pfam:PF07670"
     misc_feature    complement(162483..163058)
                     /note="HMMPfam hit to PF02421, Ferrous iron transport
                     protein B, score 2.6e-46"
                     /inference="protein motif:Pfam:PF02421"
     misc_feature    complement(163155..163514)
                     /note="HMMPfam hit to PF01926, GTPase of unknown function,
                     score 1.5e-39"
                     /inference="protein motif:Pfam:PF01926"
     CDS             complement(163586..163810)
                     /transl_table=11
                     /gene="feoA"
                     /locus_tag="PAU_00152"
                     /old_locus_tag="PAT2188"
                     /product="ferrous iron transport protein a"
                     /note="iron(II) transport system (feo) which may make an
                     important contribution to the iron supply of the cell
                     under anaerobic conditions."
                     /db_xref="EnsemblGenomes-Gn:PAU_00152"
                     /db_xref="EnsemblGenomes-Tr:CAQ82245"
                     /db_xref="GOA:C7BGR6"
                     /db_xref="InterPro:IPR007167"
                     /db_xref="InterPro:IPR008988"
                     /db_xref="UniProtKB/TrEMBL:C7BGR6"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82245.1"
                     /translation="MQLLPDHSYKIIGFSPKISPAYRQKLLSLGMLPGSSFHVVRLAP
                     LGDPIQIETRRVSLILRKKDLEFLTLDNAQ"
     misc_feature    complement(163595..163810)
                     /note="HMMPfam hit to PF04023, FeoA domain, score 4.2e-09"
                     /inference="protein motif:Pfam:PF04023"
     CDS             complement(164054..166408)
                     /transl_table=11
                     /gene="yhgF"
                     /locus_tag="PAU_00153"
                     /old_locus_tag="PAT2189"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00153"
                     /db_xref="EnsemblGenomes-Tr:CAQ82246"
                     /db_xref="GOA:C7BGR7"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR006641"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018974"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR023319"
                     /db_xref="InterPro:IPR023323"
                     /db_xref="InterPro:IPR032639"
                     /db_xref="UniProtKB/TrEMBL:C7BGR7"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82246.1"
                     /translation="MKPIHQKKTHMNESLSQIIASELQAQPHQVLSAINLLDEGNTVP
                     FIARYRKEVTGGLDDTQLRQLDSRLGYLRELSDRRQTILKSIDEQGKLTPELAEAING
                     TLSKTELEDLYLPYKPKRRTRGQIAIEAGLEPLADSLWQDPQQEPDLAAAAFVDTDKG
                     VADTKTALDGARYILMERFAEDAALLAKVRDYLWKNAHLVAKVVTGKEEEGAKFRDYF
                     EHHEPVAQVPSHRALAMFRGRNEGILQLSLNADPQFDEPPKESYCEQIITQHLNLRLN
                     NAPADSWRKAVVNWTWRVKVLLHLETELMSTLREKAEDEAIKVFARNLQDLLMAAPAG
                     MRATMGLDPGLRTGVKVAVVDATGKLIATDTIYPHTGQANKAAASVAALCIKHQVELV
                     AIGNGTASRETERFFADIQKQFPEIKAQKVIVSEAGASVYSASELAAQEFPDLDVSLR
                     GAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVSQTQLAKKLDAVVEDCVNAVGVDLN
                     TASVPLLTKVAGLTRMIAQNIVNWRDENGRFNNRAQLMKVNRLGPKAFEQCAGFLRIN
                     HGDNPLDASTVHPEAYPVVEKILAATEQKLQELMGNPSSLRGLKPEDFTTEQFGVPTV
                     SDILKELEKPGRDPRPEFKTATFAEGVETMNDLRPGMVLEGSVTNVTNFGAFVDIGVH
                     QDGLVHISSLSDRFVADPHTVVKAGDIVKVKVLEVDLNRKRIALTMRLDEQPGETNSR
                     RSSNPQADRRTERNDRSRNTPRSPASAGNSAMSDALAAAFGKKR"
     misc_feature    complement(164222..164443)
                     /note="HMMPfam hit to PF00575, S1 RNA binding domain,
                     score 3.2e-28"
                     /inference="protein motif:Pfam:PF00575"
     misc_feature    complement(164222..164437)
                     /note="HMMSmart hit to SM00316, no description, score
                     4.6e-26"
                     /inference="protein motif:Smart:SM00316"
     misc_feature    complement(165110..165403)
                     /note="HMMSmart hit to SM00732, no description, score
                     3.9e-37"
                     /inference="protein motif:Smart:SM00732"
     CDS             complement(166684..166794)
                     /transl_table=11
                     /locus_tag="PAU_00154"
                     /old_locus_tag="PAT2190"
                     /product="Hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00154"
                     /db_xref="EnsemblGenomes-Tr:CAQ82247"
                     /db_xref="UniProtKB/TrEMBL:C7BGR8"
                     /inference="similar to DNA sequence:INSD:BA000040"
                     /protein_id="CAQ82247.1"
                     /translation="MVCIWMRTILLAWNHKISRSAVNRVSSNDIGFQITY"
     CDS             complement(166879..167352)
                     /transl_table=11
                     /gene="greB"
                     /locus_tag="PAU_00155"
                     /old_locus_tag="PAT2191"
                     /product="transcription elongation factor greb (transcript
                     cleavage facto greb)"
                     /note="GreB promotes transcription elongation by
                     stimulating an endogenous, endonucleolytic transcript
                     cleavage activity of the RNA polymerase, allowing RNA
                     transcription to continue past template-encoded arresting
                     sites."
                     /db_xref="EnsemblGenomes-Gn:PAU_00155"
                     /db_xref="EnsemblGenomes-Tr:CAQ82248"
                     /db_xref="GOA:C7BGR9"
                     /db_xref="InterPro:IPR001437"
                     /db_xref="InterPro:IPR006358"
                     /db_xref="InterPro:IPR018151"
                     /db_xref="InterPro:IPR022691"
                     /db_xref="InterPro:IPR023459"
                     /db_xref="InterPro:IPR028624"
                     /db_xref="UniProtKB/TrEMBL:C7BGR9"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82248.1"
                     /translation="MKTKLITREGYNKLKKELDYLWREERPEVTKKVTWAASLGDRSE
                     NADYQYNKKRLREIDRRVRYLTKSLEELRCVDYSPQQDGKVFFGAWVEIENAQGEIKR
                     FRIVGYDEIFGRKDYISIDSPMARALLKKEVGDSVIVHTPTGEVMWYVNEIEYVK"
     misc_feature    complement(166888..167115)
                     /note="HMMPfam hit to PF01272, Prokaryotic transcription
                     elongation fact, score 1.1e-38"
                     /inference="protein motif:Pfam:PF01272"
     misc_feature    complement(167131..167352)
                     /note="HMMPfam hit to PF03449, Prokaryotic transcription
                     elongation fact, score 4e-40"
                     /inference="protein motif:Pfam:PF03449"
     CDS             complement(167377..167598)
                     /transl_table=11
                     /locus_tag="PAU_00156"
                     /old_locus_tag="PAT2192"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00156"
                     /db_xref="EnsemblGenomes-Tr:CAQ82249"
                     /db_xref="UniProtKB/TrEMBL:C7BGS0"
                     /inference="similar to DNA sequence:INSD:BX571872"
                     /inference="similar to DNA sequence:INSD:BX571867"
                     /protein_id="CAQ82249.1"
                     /translation="MGDYRIQSWEQKVVLSPVLDLYNGEIIHTLWISRCIATARERIP
                     GSIANYVTGMSECSQQRGSLKDNGYIKAN"
     CDS             167939..168655
                     /transl_table=11
                     /locus_tag="PAU_00157"
                     /old_locus_tag="PAT2193"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00157"
                     /db_xref="EnsemblGenomes-Tr:CAQ82250"
                     /db_xref="UniProtKB/TrEMBL:C7BGS1"
                     /inference="similar to DNA sequence:INSD:CP000308"
                     /protein_id="CAQ82250.1"
                     /translation="MNQQDTNVSILAGNSRVYLDKDNEIVVEAQLKAFEAALLFSRQS
                     QDKCGQLPRISMAFDHHGIFRLQFLTENLTNSQKRNPRLSHLHASIRNVFLPVAEKYQ
                     IPLSEIRVIHEDSARQHLVHILASGEIPETVTRRMVSKNLADSKPPTSDASYEAPTQK
                     LTCAAITKEYFEKAAGDHKGQDAILEVFFEDCAWSRALAYVRGLQLSHMLGVSTAIRL
                     NLVNEEGDVSKGDIITAQQI"
     CDS             168701..169882
                     /transl_table=11
                     /gene="iscS"
                     /locus_tag="PAU_00158"
                     /old_locus_tag="PAT2194"
                     /product="cysteine desulfurase"
                     /EC_number="4.4.1.-"
                     /db_xref="EnsemblGenomes-Gn:PAU_00158"
                     /db_xref="EnsemblGenomes-Tr:CAQ82251"
                     /db_xref="GOA:C7BGS2"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR016454"
                     /db_xref="UniProtKB/TrEMBL:C7BGS2"
                     /inference="similar to DNA sequence:INSD:BX571862"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82251.1"
                     /translation="MYNLARPIYLDNNATTPLDPDVLQSMMPYFTNAYGNASSNNHVF
                     GWKAMEAVDDARQVISTSINATSHADIIFTSGATESNNLAIMGLQHRGKGGHVITSTI
                     EHKAVLDCCGRLESMGTEVTYLPPQSDGIVSPDSISRAIRDDTYLVSIMAANNEIGSI
                     QKIEEIGAICKARDIPLHTDATQALGKIEFDVQRMNVSLASFSAHKIYGPKGIGALYI
                     NSRDKNISLTPLIVGGGHERGLRSGTLNVPGIVGFGRAVELSVKNLTAESMRLRYLRD
                     LLRLYIIENVADVRINGHLTECLPGLLNVSFNGIDADSLLLELSEVALSSGSACTSAN
                     RAPSHVLKAIGVSDALAQASVRFGLGRFNNEDEIRYVCLRLEKAVNKLRSMAPKSFVT
                     Q"
     misc_feature    168719..169630
                     /note="HMMPfam hit to PF00282, Pyridoxal-dependent
                     decarboxylase con, score 0.00035"
                     /inference="protein motif:Pfam:PF00282"
     misc_feature    168722..169813
                     /note="HMMPfam hit to PF00266, Aminotransferase class-V,
                     score 1.9e-100"
                     /inference="protein motif:Pfam:PF00266"
     misc_feature    168836..169597
                     /note="HMMPfam hit to PF01212, Beta-eliminating lyase,
                     score 0.00018"
                     /inference="protein motif:Pfam:PF01212"
     CDS             169905..171098
                     /transl_table=11
                     /locus_tag="PAU_00159"
                     /old_locus_tag="PAT2195"
                     /product="similarities with MFS transporter protein"
                     /note="MFS transporters are single-polypeptide secondary
                     carriers capable only of transporting small solutes in
                     response to chemiosmotic ion gradients"
                     /db_xref="EnsemblGenomes-Gn:PAU_00159"
                     /db_xref="EnsemblGenomes-Tr:CAQ82252"
                     /db_xref="GOA:C7BGS3"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C7BGS3"
                     /inference="similar to DNA sequence:INSD:BX571862"
                     /inference="similar to DNA sequence:INSD:AE009952"
                     /protein_id="CAQ82252.1"
                     /translation="MRTMSALFLLFGTLFTAGGYGATFLISAYFRSQGGSDIDAGTTL
                     GVALVGTLIGVPLVGWFAGRLEASRLAALAALAMSCGYLLLGGFNGELSYIPRIAAFL
                     IGLGWGMFYISGPMALSERVTDADRGQWFTRFSAFQMAGICGSPILLATAVEQVGMPI
                     RTTFLFVGVVGILASLLLATFGIREPNGQQELSLRPWVKKITKIATSSAIRPIIMVGL
                     GGGVFSGMMSFQSSLVEGTRANASAFFAVHAATVVVSRLLLARRLSTMPRIPLVTVLM
                     SCLIMGILALLGMPVHPVFQIVAAMLTGIGYGLVYPVIQTWAVNDSALEDRHAALTWF
                     VVAYFVGIFGFPVIGGWILVSSGKLLFILVLAVIASLELVVALLGGRWFRRIKDGLTT
                     QKEIR"
     sig_peptide     169905..169967
                     /locus_tag="PAU_00159"
                     /note="Signal peptide predicted for PAT2195 by SignalP 2.0
                     HMM (Signal peptide probability 0.999) with cleavage site
                     probability 0.890 between residues 21 and 22"
     misc_feature    order(169923..169991,170034..170093,170112..170168,
                     170196..170255,170292..170360,170388..170456,
                     170514..170582,170625..170681,170715..170783,
                     170793..170861,170898..170966,170979..171047)
                     /note="12 probable transmembrane helices predicted for
                     PAT2195 by TMHMM2.0 at aa 7-29, 44-63, 70-88, 98-117,
                     130-152, 162-184, 204-226, 241-259, 271-293, 297-319,
                     332-354 and 359-381"
     misc_feature    169929..170966
                     /note="HMMPfam hit to PF07690, Major Facilitator
                     Superfamily, score 7.6e-23"
                     /inference="protein motif:Pfam:PF07690"
     CDS             172454..173173
                     /transl_table=11
                     /gene="ompR"
                     /locus_tag="PAU_00160"
                     /old_locus_tag="PAT2196"
                     /product="transcriptional regulatory protein ompr"
                     /db_xref="EnsemblGenomes-Gn:PAU_00160"
                     /db_xref="EnsemblGenomes-Tr:CAQ82253"
                     /db_xref="GOA:C7BGS4"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="UniProtKB/TrEMBL:C7BGS4"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82253.1"
                     /translation="MQEGNKILVVDDDMRLRTLLERYLTEQGFQVRSAANAEQMDRLL
                     TRESISLIVLDLMLPGEDGLSVCQRLRNQNNSVPIIMVTARGEEVDRIVGLEIGADDY
                     IPKPFNPRELLARIRAVLRRQANKLLGVPTEDDAIINFGKFSLNLSTREMFQGDEHIP
                     LTSGEFSVLKVLVSYPSVPLSRNKLMNLALGREYSTMKRSIDVLISRLRRVIEEDPAH
                     PRYIQTIWGLGYVFVPDGSCV"
     misc_feature    172466..172804
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 1.1e-39"
                     /inference="protein motif:Pfam:PF00072"
     misc_feature    172466..172801
                     /note="HMMSmart hit to SM00448, no description, score
                     2.5e-45"
                     /inference="protein motif:Smart:SM00448"
     misc_feature    172919..173149
                     /note="HMMPfam hit to PF00486, Transcriptional regulatory
                     protein, C te, score 4.6e-15"
                     /inference="protein motif:Pfam:PF00486"
     CDS             173170..174501
                     /transl_table=11
                     /gene="envZ"
                     /locus_tag="PAU_00161"
                     /old_locus_tag="PAT2197"
                     /product="osmolarity sensor protein EnvZ"
                     /EC_number="2.7.3.-"
                     /db_xref="EnsemblGenomes-Gn:PAU_00161"
                     /db_xref="EnsemblGenomes-Tr:CAQ82254"
                     /db_xref="GOA:C7BGS5"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="UniProtKB/TrEMBL:C7BGS5"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82254.1"
                     /translation="MKLLRFSPRSTFTRTLFLIMAILFISLVSSYLVVVNFVIMPSLQ
                     QFNKVLAYEVRTLMAEKLKLEDGSFLVISPIVRREIYQELGITLYSESDAEMQGLRWA
                     RHYDFLSEKMSQYLGGEADLRLEISKDTPILWLNSYLAPDIWVRVPLTEIEQNQFSPI
                     FRYILAILLLTVGCIWLYIRFQNRPLLEMEYAARQTGKGIMMPAVREAGSQEVRASIR
                     AFNQMSAGIKLLESDRTILMAGVSHDLRTPLTRIRLATEMMSKEDAYLSESINKDIEE
                     CNAIIEQFIDYLRTGQEMPMEFCELNSILKEVISAENGYEQDIENNLSLNPITVNANP
                     ISIKRALANMLVNANRYGNGWIKVSSGQTNKFAWFQVEDNGAGIKQEDLPRLFQPFVR
                     GERARSNSGTGLGLAIVQRIIDAHEGKIEVGTSPRGGLSIRACIPVVEDNF"
     sig_peptide     173170..173271
                     /gene="envZ"
                     /locus_tag="PAU_00161"
                     /note="Signal peptide predicted for PAT2197 by SignalP 2.0
                     HMM (Signal peptide probability 0.999) with cleavage site
                     probability 0.590 between residues 34 and 35"
     misc_feature    order(173212..173280,173647..173706)
                     /note="2 probable transmembrane helices predicted for
                     PAT2197 by TMHMM2.0 at aa 15-37 and 160-179"
     misc_feature    173647..173856
                     /note="HMMPfam hit to PF00672, HAMP domain, score 0.0038"
                     /inference="protein motif:Pfam:PF00672"
     misc_feature    173866..174048
                     /note="HMMSmart hit to SM00388, no description, score
                     3.4e-11"
                     /inference="protein motif:Smart:SM00388"
     misc_feature    174163..174489
                     /note="HMMSmart hit to SM00387, no description, score
                     3.8e-27"
                     /inference="protein motif:Smart:SM00387"
     misc_feature    174163..174486
                     /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
                     gyrase B-, and HSP90, score 8.2e-32"
                     /inference="protein motif:Pfam:PF02518"
     CDS             174514..175722
                     /transl_table=11
                     /gene="pstS"
                     /locus_tag="PAU_00162"
                     /old_locus_tag="PAT2198"
                     /product="phosphate-binding periplasmic protein psts"
                     /db_xref="EnsemblGenomes-Gn:PAU_00162"
                     /db_xref="EnsemblGenomes-Tr:CAQ82255"
                     /db_xref="GOA:C7BGS6"
                     /db_xref="InterPro:IPR005673"
                     /db_xref="InterPro:IPR024370"
                     /db_xref="UniProtKB/TrEMBL:C7BGS6"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82255.1"
                     /translation="MTVLCQSQTESHFAVIKMSYLRHFAVTKLTYFLLGTLFNLTKYI
                     PLLILNIPLGGIMKLMRTTVVSVMVATFSLTTLSVFATTSLTGAGATFPAPVYAKWAD
                     SYQKETGNKVNYQGIGSSGGVKQILANTVDFGASDAPLSDEKLAADGLFQFPTVIGGV
                     VLAVNIPGIKSGELTLDGKTLGDIYLGKVKKWNDPAITKLNPGVKLPEQDIAVVRRAD
                     GSGTSFVFTNYLSKVNEEWKEKVGVGSTVSWPVGLGGKGNDGIAAFVQRLTGSIGYVE
                     YAYAKQNHLAYTKLVSADGNVVSPTEVSFSAAARKAAWHKTFAQDLTNQSGEHAWPIT
                     STTFILVHKQQKDSVKGAEVLKFFDWTYENGSKQANDLDYATLPKEVVEQVRAAWKTH
                     VKDSSGKALY"
     misc_feature    order(174598..174666,174703..174771)
                     /note="2 probable transmembrane helices predicted for
                     PAT2198 by TMHMM2.0 at aa 29-51 and 64-86"
     misc_feature    174706..175617
                     /note="HMMPfam hit to PF01547, Bacterial extracellular
                     solute-binding prot, score 8.3e-31"
                     /inference="protein motif:Pfam:PF01547"
     CDS             175931..176902
                     /transl_table=11
                     /gene="pstC"
                     /locus_tag="PAU_00163"
                     /old_locus_tag="PAT2199"
                     /product="phosphate transport system permease protein
                     pstc"
                     /db_xref="EnsemblGenomes-Gn:PAU_00163"
                     /db_xref="EnsemblGenomes-Tr:CAQ82256"
                     /db_xref="GOA:C7BGS7"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR011864"
                     /db_xref="UniProtKB/TrEMBL:C7BGS7"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82256.1"
                     /translation="MRISSMAEQKTAIKAPSKNGDLIFSALVRLAALITLFLLGGIII
                     SLIIASWPSIQQFGIAFLWHKEWDVPTEQFGALVPIYGTLVTSLIALIIAVPVSFGIA
                     LFLTELAPNWLKRPLGVAIELLAAIPSIVYGMWGLFVFAPLFATYFQQPVGHILSSIP
                     VVGELFSGPAFGIGILAAGVILAIMIIPYIASVMRDVFEQTPVMMKESAYGIGCTTWE
                     VIWHIVLPYTRNGVIGGVMLGLGRALGETMAVTFIIGNTYQLDSFSLFMPGNSITSAL
                     ANEFAEAESGLHTAALMELGLILFVITFIVLALSKLMIMRLAKDEGR"
     misc_feature    order(176009..176077,176177..176245,176279..176347,
                     176441..176509,176624..176692,176789..176857)
                     /note="6 probable transmembrane helices predicted for
                     PAT2199 by TMHMM2.0 at aa 27-49, 83-105, 117-139, 171-193,
                     232-254 and 287-309"
     misc_feature    176168..176887
                     /note="HMMPfam hit to PF00528, Binding-protein-dependent
                     transport syst, score 6.7e-14"
                     /inference="protein motif:Pfam:PF00528"
     CDS             176904..177788
                     /transl_table=11
                     /gene="pstA"
                     /locus_tag="PAU_00164"
                     /old_locus_tag="PAT2200"
                     /product="phosphate transport system permease protein
                     psta"
                     /db_xref="EnsemblGenomes-Gn:PAU_00164"
                     /db_xref="EnsemblGenomes-Tr:CAQ82257"
                     /db_xref="GOA:C7BGS8"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR005672"
                     /db_xref="UniProtKB/TrEMBL:C7BGS8"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:BA000007"
                     /protein_id="CAQ82257.1"
                     /translation="MAIMDGQQPVNVDARSRKQAWRRHKNRLALLLSMATMLFGLFWL
                     VWILFSTVTKGFDGMSLALFTEMTPPPNTAGGGLANAIVGSGLLILWATIIGTPLGIM
                     AGIYLAEYGRRSWLAEVIRFINDILLSAPSIVVGLFVYTVIVMKMQHFSGWAGVIALA
                     LLQVPIVIRTTENMLKLVPDSLREAAYALGTPKWKMISAITLKASVSGIITGVLLAIA
                     RIAGETAPLLFTSLSNQFWSTDLSQPIANLPVTIFKFAMSPFSEWQQLAWAGVLLITL
                     CVLLINIVARVLFAKKKH"
     misc_feature    order(176985..177053,177162..177230,177267..177335,
                     177348..177407,177501..177569,177702..177770)
                     /note="6 probable transmembrane helices predicted for
                     PAT2200 by TMHMM2.0 at aa 28-50, 87-109, 122-144, 149-168,
                     200-222 and 267-289"
     misc_feature    177147..177785
                     /note="HMMPfam hit to PF00528, Binding-protein-dependent
                     transport syst, score 2.8e-38"
                     /inference="protein motif:Pfam:PF00528"
     CDS             177815..178591
                     /transl_table=11
                     /gene="pstB"
                     /locus_tag="PAU_00165"
                     /old_locus_tag="PAT2201"
                     /product="phosphate import ATP-binding protein"
                     /EC_number="3.6.3.27"
                     /db_xref="EnsemblGenomes-Gn:PAU_00165"
                     /db_xref="EnsemblGenomes-Tr:CAQ82258"
                     /db_xref="GOA:C7BGS9"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005670"
                     /db_xref="InterPro:IPR015850"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C7BGS9"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82258.1"
                     /translation="MSRVNDIAGSKIQVHNLNFYYGKFHALKNITLNIAKNKVTAFIG
                     PSGCGKSTLLRTFNKMYELYGEQRAEGEILLDGNNILMDKQDVALLRAKVGMVFQKPT
                     PFPMSIYDNIAFGVRLFEKLSRAEMDERVQWALTKAALWNETKDKLYQSGYSLSGGQQ
                     QRLCIARGIAIRPEVLLLDEPCSALDPISTGRIEELISELKSEYTVVIVTHNMQQAAR
                     CSDHTAFMYLGELIEFSDTDTLFTTPKKKQTEDYITGRYG"
     misc_feature    177920..178528
                     /note="HMMSmart hit to SM00382, no description, score
                     2.9e-10"
                     /inference="protein motif:Smart:SM00382"
     misc_feature    177923..178501
                     /note="HMMPfam hit to PF00005, ABC transporter, score
                     2e-68"
                     /inference="protein motif:Pfam:PF00005"
     CDS             178588..179325
                     /transl_table=11
                     /gene="phoU"
                     /locus_tag="PAU_00166"
                     /old_locus_tag="PAT2202"
                     /product="phosphate transport system protein phou"
                     /db_xref="EnsemblGenomes-Gn:PAU_00166"
                     /db_xref="EnsemblGenomes-Tr:CAQ82259"
                     /db_xref="GOA:C7BGT0"
                     /db_xref="InterPro:IPR026022"
                     /db_xref="InterPro:IPR028366"
                     /db_xref="UniProtKB/TrEMBL:C7BGT0"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82259.1"
                     /translation="MITGRNMDNLNLNKHISGQFNAELEHIRTELMAMGGLVEEQLCK
                     AINAMHNQDAALAREVIEGDHRVNMMEVAIDEACVRIIAKRQPTASDLRLIMSISKTI
                     AELERIGDVAKKICQTALEKFSHQHQPLLVSLESLGRHTIQMLHDVLDAFARMDLEEA
                     IRIYHEDKKVDKEYEGIVRQLMTYMMEDSRTIPSVLIALLCARSIERIGDRCQNICEF
                     IFYYVKGQDFRHVGGDELERLLTKENK"
     misc_feature    178678..178944
                     /note="HMMPfam hit to PF01895, PhoU family, score 1.9e-31"
                     /inference="protein motif:Pfam:PF01895"
     misc_feature    178987..179244
                     /note="HMMPfam hit to PF01895, PhoU family, score 8.4e-29"
                     /inference="protein motif:Pfam:PF01895"
     CDS             179578..180441
                     /transl_table=11
                     /gene="fliY"
                     /locus_tag="PAU_00167"
                     /old_locus_tag="PAT2203"
                     /product="putative periplasmic binding transport protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00167"
                     /db_xref="EnsemblGenomes-Tr:CAQ82260"
                     /db_xref="GOA:C7BGT1"
                     /db_xref="InterPro:IPR001320"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="InterPro:IPR018313"
                     /db_xref="UniProtKB/TrEMBL:C7BGT1"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82260.1"
                     /translation="MINYHQECSMKSRVLVTALLAGLALVTGVAKADKLDDIKKAGTV
                     RIAVFDSNPPFGFIDPQTKKLAGYDVDIANAIANDLGVKLELRPTNPANRLPLLASKK
                     IDLIAANFTVTDERAKQVDFSIPYFATGQKFIARKGVLKSPEDIKNLRIGADKGTVQE
                     ITLREHYPTAKVISYDDTPLAFAALRNGNVQAITQDDAKLVGLLANVPAAQKAEFEIS
                     PFSITREYQAVAAAKGEGRLVEVVNQTLLKLEKEGEAEKIYNHWFGPDTKSAQPRGDF
                     KFAPLEQQAKF"
     sig_peptide     179578..179673
                     /gene="fliY"
                     /locus_tag="PAU_00167"
                     /note="Signal peptide predicted for PAT2203 by SignalP 2.0
                     HMM (Signal peptide probability 0.995) with cleavage site
                     probability 0.910 between residues 32 and 33"
     misc_feature    179614..179667
                     /note="1 probable transmembrane helix predicted for
                     PAT2203 by TMHMM2.0 at aa 13-30"
     misc_feature    179704..180375
                     /note="HMMSmart hit to SM00062, no description, score
                     1.9e-68"
                     /inference="protein motif:Smart:SM00062"
     misc_feature    179707..180372
                     /note="HMMPfam hit to PF00497, Bacterial extracellular
                     solute-binding prot, score 3.1e-71"
                     /inference="protein motif:Pfam:PF00497"
     misc_feature    179710..180372
                     /note="HMMSmart hit to SM00079, no description, score
                     0.0045"
                     /inference="protein motif:Smart:SM00079"
     CDS             180510..181247
                     /transl_table=11
                     /locus_tag="PAU_00168"
                     /old_locus_tag="PAT2204"
                     /product="similar to amino acid permease component of abc
                     transporter"
                     /db_xref="EnsemblGenomes-Gn:PAU_00168"
                     /db_xref="EnsemblGenomes-Tr:CAQ82261"
                     /db_xref="GOA:C7BGT2"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /db_xref="UniProtKB/TrEMBL:C7BGT2"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE009952"
                     /protein_id="CAQ82261.1"
                     /translation="MFELFVTEHLLAPQYLEWLWQGFLITLWISFCTVVASTLLGFLL
                     AAARDSQLKILRWPVTAYTTLFRNTPLLVQLFFWYFASGQILPQDVMLWLNTPHEINL
                     LGLPLSWPSFEFLAGFIGLTLYSAPFVAEELRAGIQGIGRGQKYAAHALGLTGWQAMR
                     YVVLPQALKIAMPPLLGQYMNIVKNSSLTMAIGVAELSYASRQVETETLKTFEAFGVA
                     TVLYIATIAVMEGWGQWRQQQAIARGH"
     misc_feature    180564..181235
                     /note="HMMPfam hit to PF00528, Binding-protein-dependent
                     transport syst, score 1.7e-16"
                     /inference="protein motif:Pfam:PF00528"
     misc_feature    order(180573..180641,180702..180770,180828..180896)
                     /note="3 probable transmembrane helices predicted for
                     PAT2204 by TMHMM2.0 at aa 22-44, 65-87 and 107-129"
     CDS             181249..181992
                     /transl_table=11
                     /locus_tag="PAU_00169"
                     /old_locus_tag="PAT2205"
                     /product="similar to amino acid permease component of abc
                     transporter"
                     /db_xref="EnsemblGenomes-Gn:PAU_00169"
                     /db_xref="EnsemblGenomes-Tr:CAQ82262"
                     /db_xref="GOA:C7BGT3"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /db_xref="UniProtKB/TrEMBL:C7BGT3"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to AA sequence:UniProt:Q0W9S8"
                     /protein_id="CAQ82262.1"
                     /translation="MDFSVIAENWRYLLFGTFPDGPLEGAALTLVISLIAGVISIVLG
                     TVAGVALAMQKGFWVNLLAAVLGFFRAIPVIMLIFWTYFLLPVMLGMEIPEITTVVCA
                     LALITSAYLAHGVKAGIIAIGAGQWQAGLSLGFNRWQVLWYIVLPQALRMMVPSFINQ
                     WIALIKDTSLAYIVGVAELSFLATQVNNRSMVYPTEVFLFVAFIYFVMCLTLELAANY
                     IARRFSLQRRKIPFFRFWRKEKLVLAPQL"
     misc_feature    181312..181923
                     /note="HMMPfam hit to PF00528, Binding-protein-dependent
                     transport syst, score 1.5e-20"
                     /inference="protein motif:Pfam:PF00528"
     misc_feature    order(181327..181395,181414..181482,181525..181593,
                     181729..181797,181840..181908)
                     /note="5 probable transmembrane helices predicted for
                     PAT2205 by TMHMM2.0 at aa 27-49, 56-78, 93-115, 161-183
                     and 198-220"
     CDS             182111..182263
                     /transl_table=11
                     /gene="yieG"
                     /locus_tag="PAU_00170"
                     /old_locus_tag="PAT2206"
                     /product="Hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00170"
                     /db_xref="EnsemblGenomes-Tr:CAQ82263"
                     /db_xref="UniProtKB/TrEMBL:C7BGT4"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /inference="similar to DNA sequence:INSD:CP000026"
                     /protein_id="CAQ82263.1"
                     /translation="MILFNLLIIHLVFQLQRHCAWFYRVLCHESSPCVVVTLLFVLKM
                     VFVDAH"
     CDS             182341..182847
                     /transl_table=11
                     /locus_tag="PAU_00171"
                     /old_locus_tag="PAT2207"
                     /product="transposase, orfa, is3/is911 family"
                     /db_xref="EnsemblGenomes-Gn:PAU_00171"
                     /db_xref="EnsemblGenomes-Tr:CAQ82264"
                     /db_xref="GOA:C7BGT5"
                     /db_xref="InterPro:IPR010921"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C7BGT5"
                     /inference="similar to DNA sequence:INSD:CP000082"
                     /inference="similar to DNA sequence:INSD:AAAK03000003"
                     /protein_id="CAQ82264.1"
                     /translation="MSKYSRELKIIIAKRCLAGNTSDKLSAEYSISSRQIRYWAQVVA
                     IHGDNAFLPTSHSLCAVTKFQALKLMWTHDWSLTHTSAVLNLTTPGTLSVWLDKYNET
                     GIKGLESHQRGRPPMKSRPKTPPKSDDKMTVEELKEELAYLRAENAVLKKLEELEQKK
                     RPLAKKKR"
     CDS             182916..183689
                     /transl_table=11
                     /gene="insK"
                     /locus_tag="PAU_00172"
                     /old_locus_tag="PAT2208"
                     /product="putative transposase InsK for insertion sequence
                     element IS150"
                     /db_xref="EnsemblGenomes-Gn:PAU_00172"
                     /db_xref="EnsemblGenomes-Tr:CAQ82265"
                     /db_xref="GOA:C7BGT6"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR025948"
                     /db_xref="UniProtKB/TrEMBL:C7BGT6"
                     /inference="similar to DNA sequence:INSD:BX664015"
                     /inference="similar to DNA sequence:INSD:U00039"
                     /protein_id="CAQ82265.1"
                     /translation="MFYYQCQALKKTRAYEQEIEMIKTIYHEHKGRYGYRRIHLALRK
                     NGFKINHKTVQRLMGQLNLKSTVRPKKYRSYRGEVGKTAPNWLARDFRATKPNEKWVT
                     DVTEFKVNEQKVYLSPIIDLFNQEVIAYNVAKKASLPLVTEMLKGALDGLDAHSKPLI
                     HSDQGWQYRHRAYQKQLADKDIKQSMSRKGNCLDNAMAENFFALLKTEMYHQQHFKSA
                     DELIEKIEEYIEYYNTKRIKVKLKGLTPIEYRNQALHAV"
     misc_feature    183189..183668
                     /note="HMMPfam hit to PF00665, Integrase core domain,
                     score 2.2e-42"
                     /inference="protein motif:Pfam:PF00665"
     CDS             complement(183750..185213)
                     /transl_table=11
                     /locus_tag="PAU_00173"
                     /old_locus_tag="PAT2209"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00173"
                     /db_xref="EnsemblGenomes-Tr:CAQ82266"
                     /db_xref="GOA:C7BGT7"
                     /db_xref="UniProtKB/TrEMBL:C7BGT7"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AP008232"
                     /protein_id="CAQ82266.1"
                     /translation="MPIFDTSSHKSVYWWVAGYAFLWIIVSYSFDPTVPYDAVEALNW
                     GKNGEWGSPKNPWLVGAMMLPAIYISGISLSFYWYFIHFIAIAIGLLGVWHLAFRLTG
                     KKELAWLAMLTLNLSGIINFDIIPYNDNYLLIMLWPWTMLFFLRAVYDNPRWWLVFAL
                     CSGLATMGKYSTLALVGSIFLLTLFVPKVRQCYRQPALYIALIIWFMLVLPNVWWLWN
                     NDFAAFKWVDSQIDSGFNLHTTRSLLSVFYPLIIVSTVIYALGGRISWPKEQPNRLVN
                     IAILLPLLIIYCWFSFNEGGRMTEWLQPFMSVASALLVGSITRFPQKSLRSTLQGLTV
                     VAILVWMGYVLIMVANVRGAGHKFEGIKDFSWQLEQRWHQLYPTPLHYVGGEYLHQWL
                     TFYAPSQPETIQPWTLEGQAPNIYNRHVKESDIVRDGTILVGAKGKTCEQEDFHGVLQ
                     DWPILRINSTDEFLFQPEPETQPTPVCVGFVSPEKYQ"
     misc_feature    complement(order(184161..184229,184335..184394,
                     184428..184487,184563..184622,184656..184724,
                     184767..184820,184839..184892,184920..184988,
                     184992..185045,185112..185180))
                     /note="10 probable transmembrane helices predicted for
                     PAT2209 by TMHMM2.0 at aa 12-34, 57-74, 76-98, 108-125,
                     132-149, 164-186, 198-217, 243-262, 274-293 and 329-351"
     CDS             185406..185918
                     /transl_table=11
                     /gene="yihI"
                     /locus_tag="PAU_00174"
                     /old_locus_tag="PAT2210"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00174"
                     /db_xref="EnsemblGenomes-Tr:CAQ82267"
                     /db_xref="GOA:C7BGT8"
                     /db_xref="InterPro:IPR007336"
                     /db_xref="UniProtKB/TrEMBL:C7BGT8"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82267.1"
                     /translation="MNQLKKKAPARASAGKQKRKSREELNAEGRARKRQKKHRGNPAG
                     SRHQERSSDKHQSSRKQSDPRLGSKVPVPLIIGEQPTKPVATKPKTEIKPRISPQEEL
                     AMLESDDRLDALLERLENGEKLSQEENTYVDTTLDRIDALMEELGIKLDEEESEEEKQ
                     DDIMQLLKGN"
     misc_feature    185418..185915
                     /note="HMMPfam hit to PF04220, Protein of unknown
                     function, DUF414, score 6.3e-46"
                     /inference="protein motif:Pfam:PF04220"
     CDS             186112..187485
                     /transl_table=11
                     /gene="hemN"
                     /locus_tag="PAU_00175"
                     /old_locus_tag="PAT2211"
                     /product="oxygen-independent coproporphyrinogen III
                     oxidase"
                     /EC_number="1.3.3.3"
                     /db_xref="EnsemblGenomes-Gn:PAU_00175"
                     /db_xref="EnsemblGenomes-Tr:CAQ82268"
                     /db_xref="GOA:C7BGT9"
                     /db_xref="InterPro:IPR004558"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010723"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR034505"
                     /db_xref="UniProtKB/TrEMBL:C7BGT9"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82268.1"
                     /translation="MSEQAIVWDLPLIQKYNYSGPRYTSYPTALEFNQQYDNAAFMQA
                     AVLYPERPLSLYIHIPFCHKLCYFCGCNKLITRQKHKVDQYLQLLEREIRERSKLFSG
                     RKVSQMHWGGGTPTYLDKDQISKLMGVLRDHFDFLPDAEISIEIDPREIELDMIDHLH
                     HQGFNRLSMGVQDFNKEVQRLVNREQDEDFIFALVARARETGFNSTSIDLIYGLPKQT
                     SESFAFTLERVLALAPDRMSIFNYAHLPNLFAAQRKIKEHDLPSAEQKLDILQQTIAT
                     LTGSGYQFIGMDHFARPDDELAVAQREGKLHRNFQGYTTQGDCDLLGIGVSAISLLGD
                     SYSQNQKELKTYYVELEKQGHALWRGLTLSQDDCIRRDVIKALICNFRLNFANIEQQY
                     GLNFTHYFAEDLQLLVPLAEDGLVEVNEKRIQVMPRGRLLIRNICMCFDIYLRHQVRL
                     RQFSSVI"
     misc_feature    186265..186927
                     /note="HMMSmart hit to SM00729, no description, score
                     7.6e-53"
                     /inference="protein motif:Smart:SM00729"
     misc_feature    186277..186798
                     /note="HMMPfam hit to PF04055, Radical SAM superfamily,
                     score 1.2e-23"
                     /inference="protein motif:Pfam:PF04055"
     misc_feature    187042..187404
                     /note="HMMPfam hit to PF06969, HemN C-terminal region,
                     score 1.4e-51"
                     /inference="protein motif:Pfam:PF06969"
     CDS             complement(188416..188760)
                     /transl_table=11
                     /locus_tag="PAU_00176"
                     /old_locus_tag="PAT2211A"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00176"
                     /db_xref="EnsemblGenomes-Tr:CAQ82269"
                     /db_xref="GOA:C7BGU0"
                     /db_xref="UniProtKB/TrEMBL:C7BGU0"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82269.1"
                     /translation="MIKLCSIIFGVIIFYSLFVGMMQVLLINFYIFRDYFGWWEIPAK
                     VSATIASVYVFYLLFNFLPLIIVIFICSLAIVVNVWHWSLWTSIFIFIWPVIVVFLYC
                     ILTKRLKYNTSD"
     CDS             complement(189489..190949)
                     /transl_table=11
                     /gene="glnG"
                     /locus_tag="PAU_00177"
                     /old_locus_tag="PAT2212"
                     /product="nitrogen regulation protein nr(i)"
                     /db_xref="EnsemblGenomes-Gn:PAU_00177"
                     /db_xref="EnsemblGenomes-Tr:CAQ82270"
                     /db_xref="GOA:C7BGU1"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR010114"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR025662"
                     /db_xref="InterPro:IPR025944"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C7BGU1"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82270.1"
                     /translation="MTMQPGKIWIVDDDNSIRWVLERALSSTGMECSCFTDADSVLTA
                     LAQNTPDVLISDIRMPGMNGLNLLNNIKQSNPLLPVIIMTAHSDLDAAVSAYQQGAFD
                     YLPKPFDIDEAVALMERALSHSREQNQPTRNPQAVTPVSDMIGEAPAMQDVYRIIGRL
                     SRSSISVLINGESGTGKELVAHALHRHSPRANQPFIALNMAAIPKDLIESELFGHEKG
                     AFTGANQVRHGRFEQANHGSLFLDEIGDMPLDIQTRLLRVLAEGQFYRIGGYAPVKVD
                     VRIIAATHQDLERLVQKGKFREDLYHRLNVIRMQLPPLRDRVEDIPRLTRHFLQQTAK
                     ELGVETKILHPDAEMALMRLPWPGNVRQLENICRWLTVMAASQEILVQDLPSELFELH
                     RTETGTTIPVNTILTSPTPINTMQETWPQLLTHWATNALENGQQDLLSEALPLLERTL
                     LNCALKHTKGHKQEAARLLGWGRNTITRKLKELGLE"
     misc_feature    complement(189501..189623)
                     /note="HMMPfam hit to PF02954, Bacterial regulatory
                     protein, Fis fam, score 2.3e-13"
                     /inference="protein motif:Pfam:PF02954"
     misc_feature    complement(189858..190523)
                     /note="HMMPfam hit to PF00158, Sigma-54 interaction
                     domain, score 3.1e-145"
                     /inference="protein motif:Pfam:PF00158"
     misc_feature    complement(190014..190454)
                     /note="HMMPfam hit to PF07728, ATPase family associated
                     with various, score 0.00055"
                     /inference="protein motif:Pfam:PF07728"
     misc_feature    complement(190032..190463)
                     /note="HMMSmart hit to SM00382, no description, score
                     3.8e-12"
                     /inference="protein motif:Smart:SM00382"
     misc_feature    complement(190596..190934)
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 2.2e-36"
                     /inference="protein motif:Pfam:PF00072"
     misc_feature    complement(190599..190934)
                     /note="HMMSmart hit to SM00448, no description, score
                     6.9e-35"
                     /inference="protein motif:Smart:SM00448"
     CDS             complement(190953..192002)
                     /transl_table=11
                     /gene="glnL"
                     /locus_tag="PAU_00178"
                     /old_locus_tag="PAT2213"
                     /product="nitrogen regulation protein nr(II)"
                     /EC_number="2.7.13.3"
                     /db_xref="EnsemblGenomes-Gn:PAU_00178"
                     /db_xref="EnsemblGenomes-Tr:CAQ82271"
                     /db_xref="GOA:C7BGU2"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="UniProtKB/TrEMBL:C7BGU2"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82271.1"
                     /translation="MKTENLPDTGQILNSLINSVLVLDTDLVIRYANHSALQLLAQSA
                     RKLFGTPLPVLFSYFSLDTELMRSSLVSGQSFTDNEVTLVVDNRSHIMSLSAQPISEQ
                     FILLELAPMDSQRRLSQEQVQQAQQIAARELVRGLAHEIKNPLGGLRGAAQLLSRALP
                     DPALQEYTQVIIEQADRLRHLVDRLLGPQHPGEQIKQSIHYVAERVYQLVSLEMPDNV
                     TLIKDYDPSLPELAHYPDQIEQVLLNITRNALQALGKQGGSITLRTRTAFQITLHGKR
                     YRLAARIDVADNGPGIPPQIQDTLFYPMVSAHEGGTGLGLSIARNLIDQHSGKIEFTS
                     WPGHTEFSIYLPIKK"
     misc_feature    complement(190956..191306)
                     /note="HMMSmart hit to SM00387, no description, score
                     3.7e-30"
                     /inference="protein motif:Smart:SM00387"
     misc_feature    complement(190959..191306)
                     /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
                     gyrase B-, and HSP90, score 3.3e-28"
                     /inference="protein motif:Pfam:PF02518"
     misc_feature    complement(191421..191618)
                     /note="HMMSmart hit to SM00388, no description, score
                     1.6e-15"
                     /inference="protein motif:Smart:SM00388"
     misc_feature    complement(191670..191984)
                     /note="HMMPfam hit to PF00989, PAS fold, score 0.0038"
                     /inference="protein motif:Pfam:PF00989"
     misc_feature    complement(191778..191984)
                     /note="HMMSmart hit to SM00091, no description, score
                     0.00059"
                     /inference="protein motif:Smart:SM00091"
     misc_feature    192091..229242
                     /note="mGOT9n"
     CDS             complement(192160..193569)
                     /transl_table=11
                     /gene="glnA"
                     /locus_tag="PAU_00179"
                     /old_locus_tag="PAT2214"
                     /product="glutamine synthetase (glutamate--ammonia
                     ligase)"
                     /EC_number="6.3.1.2"
                     /db_xref="EnsemblGenomes-Gn:PAU_00179"
                     /db_xref="EnsemblGenomes-Tr:CAQ82272"
                     /db_xref="GOA:B6VM09"
                     /db_xref="InterPro:IPR001637"
                     /db_xref="InterPro:IPR004809"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="InterPro:IPR008147"
                     /db_xref="InterPro:IPR014746"
                     /db_xref="InterPro:IPR027302"
                     /db_xref="InterPro:IPR027303"
                     /db_xref="UniProtKB/TrEMBL:B6VM09"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82272.1"
                     /translation="MSAEHVLTMIEEHQVKFIDLRFTDTKGKEQHMTIPAHQVNADFF
                     EDGKMFDGSSIGGWKGINESDMVLMPDPSTAMLDPFFDDATLILRCDILEPGTMQGYD
                     RDPRSISKRAEDFLRSSGIADTVLCGPEPEFFLFDDVRFGSSMSGSYYHIDDIEAAWN
                     SGTRYEGGNKGHRPAVKGGYAPMPPVDSSQDLRSAMCLTMEEMGLVVEAHHHEVGTAG
                     QNEIATRFNTMTKKADETQIYKYVVHNVAHNFGKTATFMPKPLVGDNGSGMHCHMSLS
                     KNGTNLFAGDKYGGLSELALFYIGGIIKHARALNAFTNPTTNSYKRLVPGYEAPVMLA
                     YSARNRSASIRIPVVASTKARRIEIRFPDPAANPYLAFAAQLMAGLDGIINKIHPGDA
                     MDKNLYDLPPEEAKEIPTVASSLDEALAALDTDREFLTRGGVFTDDAIDAYIELKNSE
                     MERVRLTPHPLEFELYYSV"
     misc_feature    complement(192421..193266)
                     /note="HMMPfam hit to PF00120, Glutamine synthetase,
                     catalytic domain, score 6.9e-171"
                     /inference="protein motif:Pfam:PF00120"
     misc_feature    complement(193285..193530)
                     /note="HMMPfam hit to PF03951, Glutamine synthetase,
                     beta-Grasp domain, score 2.6e-47"
                     /inference="protein motif:Pfam:PF03951"
     CDS             193977..195818
                     /transl_table=11
                     /gene="typA"
                     /locus_tag="PAU_00180"
                     /old_locus_tag="PAT2215"
                     /product="gtp-binding protein typa/bipa (tyrosine
                     phosphorylated protein a)"
                     /db_xref="EnsemblGenomes-Gn:PAU_00180"
                     /db_xref="EnsemblGenomes-Tr:CAQ82273"
                     /db_xref="GOA:B6VM10"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006298"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR031157"
                     /db_xref="UniProtKB/TrEMBL:B6VM10"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82273.1"
                     /translation="MPEAKFVIEKLRNIAIIAHVDHGKTTLVDKLLQQSGTFGDRATA
                     TERVMDSNDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVMSMVDSVL
                     LLVDAMDGPMPQTRFVTQKAFAHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLGAT
                     DEQLDFPIIYASALMGIAGTDHEDMAEDMTPLYQAIVDHVEPPKVDLNGAFQMQISQL
                     DYNNYVGVIGIGRIKRGTVKPNQNVTIIDSEGKTRNGKVGKVLGHLGLERIESEQAEA
                     GDIIAITGLGELNISDTLCDTNAVEALPPLAVDEPTVSMYFCVNTSPFCGREGKYVTS
                     RQILERLKKELVHNVALRVEETEDPDAFRVSGRGELHLSVLIENMRREGFELAVSRPK
                     VIFREIDGRKQEPFEQVTLDIEEQHQGDVMQALGERKADLRDMLPDGKGRVRLDYVIP
                     SRGLIGFRTEFMTMTSGTGLLYATFSHYDDIRPGEIGRRQNGVMISNGQGKAVAYALY
                     SLQDRGKLFLGHGAEVYEGQVIGIHSRSNDLTVNCLTGKKLTNVRASGTDEATTLSPH
                     IKKTLEQALEFIDDDELVEVTPVSIRLRKRYLTENERRRAYRSKEAS"
     misc_feature    194001..194588
                     /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
                     binding domain, score 7.3e-72"
                     /inference="protein motif:Pfam:PF00009"
     misc_feature    194649..194861
                     /note="HMMPfam hit to PF03144, Elongation factor Tu
                     domain, score 1e-14"
                     /inference="protein motif:Pfam:PF03144"
     misc_feature    195177..195443
                     /note="HMMPfam hit to PF00679, Elongation factor G
                     C-terminus, score 1.4e-17"
                     /inference="protein motif:Pfam:PF00679"
     CDS             complement(195887..196456)
                     /transl_table=11
                     /locus_tag="PAU_00181"
                     /old_locus_tag="PAT2216"
                     /product="putative membrane protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00181"
                     /db_xref="EnsemblGenomes-Tr:CAQ82274"
                     /db_xref="GOA:B6VM11"
                     /db_xref="InterPro:IPR003752"
                     /db_xref="InterPro:IPR023380"
                     /db_xref="UniProtKB/TrEMBL:B6VM11"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014613"
                     /protein_id="CAQ82274.1"
                     /translation="MNQVLATKQNTSYGMIFNIIGLFGISAALTVAFYYQLVLSELPC
                     PLCLLQRTGMIMIGFGFLFNLRFGIKSAHYGIALIGCIVTGIIAIRQVFLHILPGDIG
                     YGSALFGIHFYTWALLSSVIAIIAISVMLILKSLEKTTEEKGNTPVFGQILIGFFVLL
                     ITANLISTVLECGGGQCDDNPTFYQLLGK"
     misc_feature    complement(order(195947..196015,196049..196117,
                     196175..196243,196262..196315,196352..196420))
                     /note="5 probable transmembrane helices predicted for
                     PAT2216 by TMHMM2.0 at aa 13-35, 48-65, 72-94, 114-136 and
                     148-170"
     CDS             complement(197345..198799)
                     /transl_table=11
                     /locus_tag="PAU_00182"
                     /old_locus_tag="PAT2217"
                     /product="carbon starvation protein csta"
                     /note="carbon starvation protein CstA is a predicted
                     membrane protein. It has been suggested that CstA is
                     involved in peptide utilization ."
                     /db_xref="EnsemblGenomes-Gn:PAU_00182"
                     /db_xref="EnsemblGenomes-Tr:CAQ82275"
                     /db_xref="GOA:B6VM12"
                     /db_xref="InterPro:IPR003706"
                     /db_xref="InterPro:IPR025299"
                     /db_xref="UniProtKB/TrEMBL:B6VM12"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AALS01000038"
                     /protein_id="CAQ82275.1"
                     /translation="MLWFILCIALLLAGYFIYGKLIEKIFAIRPERKTPAISMADGVD
                     YVAMSTPKVWLIQLLNIAGVGPIFGPILGALYGPLAMLWIVFGCIFAGAVHDYFSGML
                     SVRARGASVPVIVGNELGKTMKHFMNIFAVILLMLVGVVFVLSPAGLLNNLFKDSIGW
                     DNIGIWVGVIFAYYILATLVPIDKIIGRLYPLFGALLLFMSVALIVGLVMSDKPFYSQ
                     GLDFTTNFNPKDLPVWPLLFVTIACGAISGFHATQSPLMARCMQNEKNGRFVFYGAMI
                     GEGIIALIWCTLGLSFYEDTNALQAVIDKGTASLVVHEVSTSLLGTVGGILAILGVVI
                     LPITSGDTAFRSARLIIAEFLDIPQQKMIKRLLLSVPMFIVGYLITKTDFNIIWRYFG
                     WANQTTAMVMLWAASAWLLRRDKFHWITTLPAMFMTAVCFTYLAFAPEGFALNWNTSV
                     IIGLSAMAVVTIVFFAKVRSKSVSNNIETEAFNE"
     misc_feature    complement(order(197405..197473,197486..197554,
                     197567..197626,197636..197704,197789..197857,
                     197927..197995,198053..198109,198167..198235,
                     198254..198313,198356..198424,198497..198565,
                     198575..198643,198734..198790))
                     /note="13 probable transmembrane helices predicted for
                     PAT2217 by TMHMM2.0 at aa 4-22, 53-75, 79-101, 126-148,
                     163-182, 189-211, 231-249, 269-291, 315-337, 366-388,
                     392-411, 416-438 and 443-465"
     misc_feature    complement(197828..198799)
                     /note="HMMPfam hit to PF02554, Carbon starvation protein
                     CstA, score 1.5e-79"
                     /inference="protein motif:Pfam:PF02554"
     CDS             198951..199562
                     /transl_table=11
                     /gene="yihX"
                     /locus_tag="PAU_00183"
                     /old_locus_tag="PAT2218"
                     /product="conserved hypothetical protein"
                     /note="deleted EC_number 3.3.2.3"
                     /db_xref="EnsemblGenomes-Gn:PAU_00183"
                     /db_xref="EnsemblGenomes-Tr:CAQ82276"
                     /db_xref="GOA:B6VM13"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:B6VM13"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82276.1"
                     /translation="MVMLYILDMGNVIIDIDFKRVLAVWSNLSGTPLATLTKSFSMGE
                     MFEKHERGQITDLEFADTLCQEMSISLSFEQFTAGWQAIFIDIRPEVIQIMEKLREAG
                     HRVVVLSNTNRLHQDYWPHNYPEIAASADYLYLSQDLAMRKPEPDIFKYVLEKEGFSP
                     DQAVFFDDVLENVEAASALGIKGIHVVDRQTVPDYFKEIGFSE"
     misc_feature    198954..199517
                     /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
                     hydrolase, score 3.6e-17"
                     /inference="protein motif:Pfam:PF00702"
     CDS             199627..200064
                     /transl_table=11
                     /gene="dtd"
                     /locus_tag="PAU_00184"
                     /old_locus_tag="PAT2219"
                     /product="d-tyrosyl-tRNA(tyr) deacylase"
                     /EC_number="3.1.-.-"
                     /db_xref="EnsemblGenomes-Gn:PAU_00184"
                     /db_xref="EnsemblGenomes-Tr:CAQ82277"
                     /db_xref="GOA:B6VM14"
                     /db_xref="InterPro:IPR003732"
                     /db_xref="InterPro:IPR023509"
                     /db_xref="UniProtKB/TrEMBL:B6VM14"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82277.1"
                     /translation="MIALIQRVTQANVVIENEIVGEIGHGLLVLLGVEKEDDQQKAKR
                     LCEKVIGYRIFNDEQDKMNLNVQQVGGSLLVVSQFTLAADTQKGMRPSFSGGASPDKA
                     DELYRYFVERCRQSGVKTESGRFAADMKVSLINNGPVTFWLQV"
     misc_feature    199708..200061
                     /note="HMMPfam hit to PF02580, D-Tyr-tRNA(Tyr) deacylase,
                     score 8.4e-78"
                     /inference="protein motif:Pfam:PF02580"
     CDS             200136..201053
                     /transl_table=11
                     /gene="yiiD"
                     /locus_tag="PAU_00185"
                     /old_locus_tag="PAT2220"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00185"
                     /db_xref="EnsemblGenomes-Tr:CAQ82278"
                     /db_xref="GOA:B6VM15"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR012660"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:B6VM15"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82278.1"
                     /translation="MYHLRVPETEQELEAYYRFRWEMLRKPLNQPVGSEKDGYDTMAH
                     HQMVVDEKGNPVAVGRLYINADSEGAIRFLAVHPHVQGKGLGKLIAMALESVARQEGV
                     KRVVCSAREYAVDFFSKLGFENRGPITSPQTTPVRHFLMIKPVATLDDILHRPDWCNE
                     LQKAWYKYIPLSEKMGVRISQYTGQSFITTMPESGNQNPHQTLFAGSLFSLATLTGWG
                     LIWLLLQERQLGGDIILVDANIRYKKPVVGRPRAVADLKNMSGDLARLAQGSKARVKL
                     EVAVSGDHGVGAVFTGTYMVLPNAYTAIA"
     misc_feature    200274..200504
                     /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
                     family, score 1.9e-16"
                     /inference="protein motif:Pfam:PF00583"
     CDS             201313..201549
                     /transl_table=11
                     /gene="dinJ2"
                     /locus_tag="PAU_00186"
                     /old_locus_tag="PAT2221"
                     /product="Hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00186"
                     /db_xref="EnsemblGenomes-Tr:CAQ82279"
                     /db_xref="GOA:B6VM16"
                     /db_xref="InterPro:IPR007337"
                     /db_xref="InterPro:IPR010985"
                     /db_xref="InterPro:IPR013321"
                     /db_xref="UniProtKB/TrEMBL:B6VM16"
                     /inference="similar to DNA sequence:INSD:BX897699"
                     /inference="similar to AA sequence:UniProt:Q0XJY5"
                     /protein_id="CAQ82279.1"
                     /translation="MNTAILKVRVPEELKNAVARAAQDNSLDMSSFVRLVLTRATKER
                     HIPNATTQAAIRELESGGGTSVDTVDEFWDEIFK"
     misc_feature    201319..201540
                     /note="HMMPfam hit to PF04221, RelB antitoxin, score
                     0.00062"
                     /inference="protein motif:Pfam:PF04221"
     CDS             201553..201825
                     /transl_table=11
                     /gene="ef0033"
                     /locus_tag="PAU_00187"
                     /old_locus_tag="PAT2222"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00187"
                     /db_xref="EnsemblGenomes-Tr:CAQ82280"
                     /db_xref="InterPro:IPR004386"
                     /db_xref="InterPro:IPR007712"
                     /db_xref="UniProtKB/TrEMBL:B6VM17"
                     /inference="similar to DNA sequence:INSD:AE016830"
                     /inference="similar to DNA sequence:INSD:BX908798"
                     /protein_id="CAQ82280.1"
                     /translation="MLKIRYSSAFKKDLKPFQHDKSAISVINTVLKLLATGKPLPREY
                     KEHSLKGDYIGYLECHGKPDLLLIYKRTEQEVFLYRVGSHAKLFKL"
     misc_feature    201562..201816
                     /note="HMMPfam hit to PF05016, Plasmid stabilisation
                     system protein, score 1.6e-07"
                     /inference="protein motif:Pfam:PF05016"
     CDS             complement(201883..203619)
                     /transl_table=11
                     /gene="yicH"
                     /locus_tag="PAU_00188"
                     /old_locus_tag="PAT2223"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00188"
                     /db_xref="EnsemblGenomes-Tr:CAQ82281"
                     /db_xref="UniProtKB/TrEMBL:B6VM18"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82281.1"
                     /translation="MFSHLSWGLMMKWLGKSLVTLLLLLILAVVTIYVAIQTNWGAYQ
                     LSQWLSHHSRYQVQIGDIEHRWLQPGTLAFSNIVIRNKQHTFTLEAQVAAFDFNWQQL
                     TSPRHFHRLLLQQGQLTIKGPQQSLPFSANILQLNQMAIQSENADWQIQGQNITGGIT
                     PWNPQSNKLAGNGKFQFSADKLNFNDISLAKVIMQGDSQQNTLIIRSLGATLAQGSIS
                     GNGQRLPDGSWQWDNLLISNVRWQTPMTFEELWLKVSQLPAISIKDLSLTNAKLEGKN
                     WSANYLDASVKNIGLANGSWQAKEGILDFNVMDTTLNDLHFTDAIGHLLLAGNELRIT
                     NLTTRWEKGLFHVKAQWNHQTKQFNIANATVAGLTYTLPQNWYQSLKKSLPQWISGFS
                     INQLTINNSLLIDINPDFPFQLTALTGYINDMELLKEGEWGIWNGSSNLSATSATFNK
                     VELHRPYLKLHTEGNKLIIDQLDASVDDGLLKVKGTVDQQAQKPFTLDFRGIDADLAI
                     LPQWQWVPLKLPGKGNFTLSIQGDLAADDIKSTIDGTLTATDKQSGKETQVIDKGQIS
                     IQNCETCSVIRL"
     misc_feature    complement(201910..203589)
                     /note="HMMPfam hit to PF05170, AsmA family, score 7.9e-62"
                     /inference="protein motif:Pfam:PF05170"
     misc_feature    complement(203515..203583)
                     /note="1 probable transmembrane helix predicted for
                     PAT2223 by TMHMM2.0 at aa 13-35"
     sig_peptide     complement(203518..203619)
                     /gene="yicH"
                     /locus_tag="PAU_00188"
                     /note="Signal peptide predicted for PAT2223 by SignalP 2.0
                     HMM (Signal peptide probability 0.976) with cleavage site
                     probability 0.447 between residues 34 and 35"
     CDS             204278..205831
                     /transl_table=11
                     /gene="hpaB"
                     /locus_tag="PAU_00189"
                     /old_locus_tag="PAT2224"
                     /product="4-hydroxyphenylacetate 3-monooxygenase oxygenase
                     component"
                     /EC_number="1.14.14.-"
                     /db_xref="EnsemblGenomes-Gn:PAU_00189"
                     /db_xref="EnsemblGenomes-Tr:CAQ82282"
                     /db_xref="GOA:B6VM19"
                     /db_xref="InterPro:IPR004925"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR024674"
                     /db_xref="InterPro:IPR024677"
                     /db_xref="InterPro:IPR024719"
                     /db_xref="UniProtKB/TrEMBL:B6VM19"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:Z29081"
                     /protein_id="CAQ82282.1"
                     /translation="MSDEMKQESPDENNTRITRPLNGKEFLEGLNDGREIWAYGERIH
                     DIANHPAFQNPARAVAKLYDALHDPAYRDVLTTATDTGSCGVTHPFFRIPRSQEDLIA
                     DRDAIAAWARISYGWLGRSPDYKASFLTTLGVNPEFYGDFADNAKTWYTRSQEQVLYW
                     NHALINPPIDRHLPADEIGDVCIHVEKECDDGLIVSGAKVVATGSAITHYNFIGHYGL
                     PIKKREFALVCTLPMNSPGLKLICRPSYALAADKMGSPFDYPLSSRFDENDTIIVLDK
                     VKVPWENIFIYGDVEKTSSFFAEAGFFHRALLHGVTRLAVKLDFLCGLIIKGVEATGT
                     QAFRGVQTRVGEVLAWRNMFWAISDAMVKSPQPWHGDALLPRSEYGMAYRWFMTLGYP
                     RIKEIIEQDLGSALIYVNSHARDFTNPELAPYLNKYVRGSNGYSAVERVKLMKLIWDS
                     IGTEFAGRHELYERNYSGNHENIRIELLLTAQESGLMDQFKGFAEQCMSEYDLHGWIG
                     NDFIWPSSR"
     misc_feature    204650..205765
                     /note="HMMPfam hit to PF03241, 4-hydroxyphenylacetate
                     3-hydroxylase family, score 5.4e-162"
                     /inference="protein motif:Pfam:PF03241"
     CDS             complement(205922..207307)
                     /transl_table=11
                     /gene="yicE"
                     /locus_tag="PAU_00190"
                     /old_locus_tag="PAT2225"
                     /product="similar to xanthine/uracil permease family
                     protein yice of escherichi coli"
                     /db_xref="EnsemblGenomes-Gn:PAU_00190"
                     /db_xref="EnsemblGenomes-Tr:CAQ82283"
                     /db_xref="GOA:B6VM20"
                     /db_xref="InterPro:IPR006042"
                     /db_xref="InterPro:IPR006043"
                     /db_xref="InterPro:IPR017588"
                     /db_xref="UniProtKB/TrEMBL:B6VM20"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82283.1"
                     /translation="MFTSSPEQAATIPVKKPDSELIYRLEDRPPLLQTLFAACQHLLA
                     MFVAVITPAILICQALGLPAHDTQRIISMSLFASGIASLIQIRAWGPVGSGLLSIQGT
                     SFNFVSPLIMGGLALKNGGADIPTMMAALFGTLMLASVTEILLSRVLHLARRIITPLV
                     SGVVVMIIGLSLIQVGLTSIGGGFSAIENHTFGSPENLFLAGVVLAVIVLLNRQRNPY
                     LRVASLVIAMSVGYVVAWLMGMLPQATVPENSSLITIPTPLYYGLSFDWHLLLPLMLI
                     FMVTSLETIGDITATSDVSEQPVSGPLYMKRIKGGVLANGLNSMLSAVFNTFPNSCFG
                     QNNGVIQLTGVASRHVGYAVALMLILLGLFPAVAGFVQQIPEPVLGGATIVMFGTIAA
                     SGVRIVSREALNRRAIMIIALSLAVGMGVAQQPLILQFAPDWLKTLLSSGIAAGGLTA
                     IVLNLIFPQEK"
     misc_feature    complement(order(205937..205996,206024..206092,
                     206111..206179,206192..206260,206462..206530,
                     206588..206656,206675..206734,206777..206845,
                     206870..206938,207041..207100,207119..207187))
                     /note="11 probable transmembrane helices predicted for
                     PAT2225 by TMHMM2.0 at aa 41-63, 70-89, 124-146, 155-177,
                     192-211, 218-240, 260-282, 350-372, 377-399, 406-428 and
                     438-457"
     misc_feature    complement(206027..207214)
                     /note="HMMPfam hit to PF00860, Permease family, score
                     9.2e-150"
                     /inference="protein motif:Pfam:PF00860"
     CDS             207545..208753
                     /transl_table=11
                     /gene="gltS"
                     /locus_tag="PAU_00191"
                     /old_locus_tag="PAT2226"
                     /product="sodium/glutamate symport carrier protein
                     (glutamate permease)"
                     /db_xref="EnsemblGenomes-Gn:PAU_00191"
                     /db_xref="EnsemblGenomes-Tr:CAQ82284"
                     /db_xref="GOA:B6VM21"
                     /db_xref="InterPro:IPR004445"
                     /db_xref="UniProtKB/TrEMBL:B6VM21"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82284.1"
                     /translation="MYHLDVYGTLVASALVLLLGRKLVQSVPFLEKYTIPEPVAGGLL
                     VALILLILQQTTGWEISFDLSLKDPLMLTFFATIGLNANLASLKAGGKVLLTFVFVVV
                     GLLLVQNTVGIALAELLGLDPLMGLLAGSVTLSGGHGTGAAWGKLFSERYGFENATEV
                     AMACATFGLVLGGLIGGPVARFLVKNTKTPGLRADDTEVPTAFEKPYTGRMITALVML
                     ETIALIAICLMAGNFVSEFLQGTWFELPTFVCVLFIGVILSNSLSVLGFYRVFDRAVS
                     VLGNVSLSLFLAMALMSLKLWQMASLALPMLIILTIQAIVMALYAIFVTYRVMGKNYD
                     AAVLAAGHCGFGLGATPTAIANMQAITDRFGPSHVAFLVVPMVGAFFIDIVNAIVIKL
                     YLLLPVFPAV"
     misc_feature    207548..208642
                     /note="HMMPfam hit to PF03616, Sodium/glutamate symporter,
                     score 4.8e-235"
                     /inference="protein motif:Pfam:PF03616"
     misc_feature    order(207554..207607,207641..207709,207752..207805,
                     207824..207892,208028..208096,208181..208249,
                     208277..208345,208364..208420,208448..208516,
                     208553..208621,208664..208732)
                     /note="11 probable transmembrane helices predicted for
                     PAT2226 by TMHMM2.0 at aa 4-21, 33-55, 70-87, 94-116,
                     162-184, 213-235, 245-267, 274-292, 302-324, 337-359 and
                     374-396"
     CDS             209055..209822
                     /transl_table=11
                     /locus_tag="PAU_00192"
                     /old_locus_tag="PAT2227"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00192"
                     /db_xref="EnsemblGenomes-Tr:CAQ82285"
                     /db_xref="InterPro:IPR003812"
                     /db_xref="UniProtKB/TrEMBL:B6VM22"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82285.1"
                     /translation="MKLFNALGFHWDRSAVPLIVPIHSIERVCFRFHRMLPEFVWDAS
                     VLEGNPFTFPEVKTLLDGVTVGGRKVSDQEQVLNLAESSRCLLSLVKKGQFELTKATF
                     TELHSIVARNEALEWGAFRGEGREINYTPDVGLGEYGRHTPLPTEPDAPELNRVFHEG
                     IAVLSECQPFEQATAFFLFGALQQFFFDGNKRTSRFMMNGILMSNGIDAISVPAAKLH
                     EFNEKMVRFYLSKDATEMMMFLMDCHPDKVANPDFFK"
     CDS             209993..210247
                     /transl_table=11
                     /gene="relB"
                     /locus_tag="PAU_00193"
                     /old_locus_tag="PAT2228"
                     /product="negative regulator of translation relb protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00193"
                     /db_xref="EnsemblGenomes-Tr:CAQ82286"
                     /db_xref="InterPro:IPR007337"
                     /db_xref="UniProtKB/TrEMBL:B6VM23"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:X02405"
                     /protein_id="CAQ82286.1"
                     /translation="MSTIQIRVDEELKKSAYQTFEKLNLSPSDALRLFLRYVVENEKL
                     PFAEVSVMVADHDEDAEILAVVRNRLKNPARRIRVNLDDI"
     misc_feature    209993..210244
                     /note="HMMPfam hit to PF04221, RelB antitoxin, score
                     2.2e-11"
                     /inference="protein motif:Pfam:PF04221"
     CDS             210237..210527
                     /transl_table=11
                     /gene="relE"
                     /locus_tag="PAU_00194"
                     /old_locus_tag="PAT2229"
                     /product="similar to rele-like protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00194"
                     /db_xref="EnsemblGenomes-Tr:CAQ82287"
                     /db_xref="InterPro:IPR007712"
                     /db_xref="UniProtKB/TrEMBL:B6VM24"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:X02405"
                     /protein_id="CAQ82287.1"
                     /translation="MIFNIDFDERALKEWCKLDQTIRDQFKKKLRKLQNNPYIESARL
                     HGDLAGCFKIKLRSSGFRLVYQVIEEEIVIWVIAVGKREDEKTYEIACKRII"
     misc_feature    210249..210494
                     /note="HMMPfam hit to PF05016, Plasmid stabilisation
                     system protein, score 1.4e-12"
                     /inference="protein motif:Pfam:PF05016"
     CDS             complement(211032..211301)
                     /transl_table=11
                     /locus_tag="PAU_00195"
                     /old_locus_tag="PAT2230"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00195"
                     /db_xref="EnsemblGenomes-Tr:CAQ82288"
                     /db_xref="InterPro:IPR006442"
                     /db_xref="UniProtKB/TrEMBL:B6VM25"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CR377818"
                     /protein_id="CAQ82288.1"
                     /translation="MEIIPAQLAKNQFGDLLMKVQREPVEISKHGKRVAVVISPEEYD
                     QFAQLKLQNLKAVLAESIAQADRGELHSIDDVFAPLTVDELEGKA"
     misc_feature    complement(211098..211301)
                     /note="HMMPfam hit to PF02604, Phd_YefM, score 6.1e-18"
                     /inference="protein motif:Pfam:PF02604"
     CDS             complement(212263..214383)
                     /transl_table=11
                     /gene="recG"
                     /locus_tag="PAU_00196"
                     /old_locus_tag="PAT2231"
                     /product="ATP-dependent DNA helicase RecG"
                     /EC_number="3.6.1.-"
                     /db_xref="EnsemblGenomes-Gn:PAU_00196"
                     /db_xref="EnsemblGenomes-Tr:CAQ82289"
                     /db_xref="GOA:B6VM26"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004609"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR033454"
                     /db_xref="UniProtKB/TrEMBL:B6VM26"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82289.1"
                     /translation="MTNCHAINGEKNRMKGQLLDAIPLTSLHGVGASQAAKLAKMGLI
                     NLQDLLLHFPLRYEDQTRLYTINDLLPGISATVTGEILHTNIIFGRRRMMICQISDGT
                     GVLTLRFFNFSAAMKNNLAKGKQVVAYGEIRRGSQGAEIIHPEYKIQTYAGNVRLQET
                     LTPIYPTTEGIRQATLRKLIEQALQLLDTCAINELLPEELSRSMISLPQALHTLHRPT
                     PDIVLADLETGKHPAHRRLILEELLAHHLSMLEVKVGAQRYHAQSLPTENKLKQQFLN
                     RLPFTPTNAQQRVVAEIEQDLAKDIPMMRLIQGDVGSGKTLVAALAALRAIAHGKQVA
                     LMAPTELLAEQHANTFRQWLEPLDIQIGWLAGKQKGKARQKQQEAIASGQVAMIVGTH
                     AMFQEQVKFSGLALVIIDEQHRFGVHQRLALWEKGREQGFHPHQLIMTATPIPRTLAM
                     TAYADLDTSIIDELPPGRTPVTTVAIPDTRREEVIKRIKNACLDENRQAYWVCTLIED
                     SDVLEAQAAQVTSEELTLALPELKVGLVHGRMKAAEKLAVMEAFKCGELQLLVATTVI
                     EVGVDVPNASLMIIDNPERLGLAQLHQLRGRVGRGAIASHCVLLYKTPLSSTARIRLQ
                     VLRDSNDGFVIAQKDLEIRGPGELLGTRQTGNAEFKVADLLRDQGMLPEVQRIARHIH
                     QRYPEHARALIERWLPERTHYSNA"
     misc_feature    complement(212578..212832)
                     /note="HMMSmart hit to SM00490, no description, score
                     3.6e-21"
                     /inference="protein motif:Smart:SM00490"
     misc_feature    complement(212578..212811)
                     /note="HMMPfam hit to PF00271, Helicase conserved
                     C-terminal domain, score 6.4e-22"
                     /inference="protein motif:Pfam:PF00271"
     misc_feature    complement(212968..213552)
                     /note="HMMSmart hit to SM00487, no description, score
                     1.8e-31"
                     /inference="protein motif:Smart:SM00487"
     misc_feature    complement(213031..213537)
                     /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
                     score 1e-32"
                     /inference="protein motif:Pfam:PF00270"
     misc_feature    complement(213049..213549)
                     /note="HMMPfam hit to PF04851, Type III restriction
                     enzyme, res subunit, score 3.1e-05"
                     /inference="protein motif:Pfam:PF04851"
     misc_feature    complement(213937..214161)
                     /note="HMMPfam hit to PF01336, OB-fold nucleic acid
                     binding domain, score 8.9e-10"
                     /inference="protein motif:Pfam:PF01336"
     CDS             214807..215373
                     /transl_table=11
                     /gene="fimB"
                     /locus_tag="PAU_00197"
                     /old_locus_tag="PAT2232"
                     /product="type 1 fimbriae regulatory protein fimb"
                     /db_xref="EnsemblGenomes-Gn:PAU_00197"
                     /db_xref="EnsemblGenomes-Tr:CAQ82290"
                     /db_xref="GOA:B6VM27"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013762"
                     /db_xref="UniProtKB/TrEMBL:B6VM27"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82290.1"
                     /translation="MGQRKYLTQSEVESMLEMAKVGANPERNYCLVYMSFIHGFRVSE
                     ARHLRLSDMELNERCLYIRRLKGGFCTNHPLLRREIRAIKAWLKVRKTFLGADSDWLF
                     LSRSGKPLTRQRIYQIISRLGQLANIAVVPHPHMLRHACGFALADRGVDTRLIQDYLG
                     HKNIRHTVRYTASNAERFQGVWGMKGKR"
     misc_feature    214849..215346
                     /note="HMMPfam hit to PF00589, Phage integrase family,
                     score 4.1e-41"
                     /inference="protein motif:Pfam:PF00589"
     CDS             215803..216420
                     /transl_table=11
                     /locus_tag="PAU_00198"
                     /old_locus_tag="PAT2233"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00198"
                     /db_xref="EnsemblGenomes-Tr:CAQ82291"
                     /db_xref="GOA:B6VM28"
                     /db_xref="InterPro:IPR000259"
                     /db_xref="InterPro:IPR008966"
                     /db_xref="UniProtKB/TrEMBL:B6VM28"
                     /inference="similar to DNA sequence:INSD:BX571866"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82291.1"
                     /translation="MKKILKISAVAALVMGAASAALAAGEATEEGHVGKNTMVTITGN
                     VVAATCDVTSPNANGKVNLGNASENAFLASAFTDQKGIVSYAKESSRPITIALSNCDD
                     KNTVADKVQLHVTGPVLGGSNNLIFNNSEDGKNVGAILTYKDKDAKETVVSNNSNVLL
                     GAKGSTGAEFNGQSITFTAYMASIVPKPGSNQHVNAPITFSYAYN"
     sig_peptide     215803..215871
                     /locus_tag="PAU_00198"
                     /note="Signal peptide predicted for PAT2233 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.885 between residues 23 and 24"
     misc_feature    215911..216417
                     /note="HMMPfam hit to PF00419, Fimbrial protein, score
                     5.9e-05"
                     /inference="protein motif:Pfam:PF00419"
     CDS             216547..217293
                     /transl_table=11
                     /gene="aufB"
                     /locus_tag="PAU_00199"
                     /old_locus_tag="PAT2234"
                     /product="similarities with putative fimbrial chaperone"
                     /note="Periplasmic chaperones assist pili assembly by
                     binding to the subunits, thereby preventing premature
                     aggregation"
                     /db_xref="EnsemblGenomes-Gn:PAU_00199"
                     /db_xref="EnsemblGenomes-Tr:CAQ82292"
                     /db_xref="GOA:B6VM29"
                     /db_xref="InterPro:IPR001829"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR016147"
                     /db_xref="InterPro:IPR016148"
                     /db_xref="UniProtKB/TrEMBL:B6VM29"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82292.1"
                     /translation="MINKLRLPNIIVKSLILGAFLFASQSQAEGGFGIDVTRIIFLQD
                     KAEATTVSVRNTTTNIPYLVTTKITRTVDGKGKAPFYVSPPLFRLEPKGTNVLRILGD
                     TSKLPTDRESVFYFNASAIPGSNNPPGQRFESAKIGGGIAYAIGNTIKLFYRPTGLVG
                     TPEQAYKALRFTHAPDGIQVSNNSPYHISFTQIKVDGVPVKFSESHPQMLAPFSSHVY
                     PAQNNQNKKKVEWAVISDLGGGENFNGEIQ"
     sig_peptide     216547..216630
                     /gene="aufB"
                     /locus_tag="PAU_00199"
                     /note="Signal peptide predicted for PAT2234 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.991 between residues 28 and 29"
     misc_feature    216637..217023
                     /note="HMMPfam hit to PF00345, Gram-negative pili assembly
                     chaperone, score 8.6e-26"
                     /inference="protein motif:Pfam:PF00345"
     misc_feature    217033..217281
                     /note="HMMPfam hit to PF02753, Gram-negative pili assembly
                     chaperone, score 9.1e-10"
                     /inference="protein motif:Pfam:PF02753"
     CDS             217331..217897
                     /transl_table=11
                     /locus_tag="PAU_00200"
                     /old_locus_tag="PAT2235"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00200"
                     /db_xref="EnsemblGenomes-Tr:CAQ82293"
                     /db_xref="GOA:B6VM30"
                     /db_xref="InterPro:IPR000259"
                     /db_xref="InterPro:IPR008966"
                     /db_xref="UniProtKB/TrEMBL:B6VM30"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82293.1"
                     /translation="MNYIGIGGILWLSSGPLWAANSAIATFKADIAYGTCDVTVDNNN
                     IDLGKVQFASLVSGNAYGETNLTLRNCSDVIDANRVAPAITITGEHFGTNDNTLFRSQ
                     KSEDSVSKAVGVTVRLKKLNGTEWSSNIADGEPFYLADKGTVINDQTPSVPVRFSLVC
                     APAAGETVMVCKKPGKIYANVNFTFDYR"
     sig_peptide     217331..217387
                     /locus_tag="PAU_00200"
                     /note="Signal peptide predicted for PAT2235 by SignalP 2.0
                     HMM (Signal peptide probability 0.998) with cleavage site
                     probability 0.996 between residues 19 and 20"
     CDS             217959..218657
                     /transl_table=11
                     /gene="papA"
                     /locus_tag="PAU_00201"
                     /old_locus_tag="PAT2236"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00201"
                     /db_xref="EnsemblGenomes-Tr:CAQ82294"
                     /db_xref="GOA:B6VM31"
                     /db_xref="InterPro:IPR000259"
                     /db_xref="InterPro:IPR008966"
                     /db_xref="UniProtKB/TrEMBL:B6VM31"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82294.1"
                     /translation="MTRQEKNRVGDQPAFLSNGGCSTLRIVVLRFCWGVMLAALFLAG
                     SVMAESEDPKPPFPSTKSSGINVDLFITVVPEPCDVGISGDDINGSELNFGSLPAAEF
                     SQAGHISNPRRFNLELTNCGDPDVSPSRPVITVSGNTIDAEQGSIFRGPVSGSYDNAS
                     EGLGFIVHLGGEGKIDWGNLVINNHENRLDSLFFDDGRAQLPVTVAVARGKDSKVIRP
                     GSLIARVAFTYSYP"
     sig_peptide     217959..218102
                     /gene="papA"
                     /locus_tag="PAU_00201"
                     /note="Signal peptide predicted for PAT2236 by SignalP 2.0
                     HMM (Signal peptide probability 0.776) with cleavage site
                     probability 0.767 between residues 48 and 49"
     misc_feature    218034..218102
                     /note="1 probable transmembrane helix predicted for
                     PAT2236 by TMHMM2.0 at aa 26-48"
     CDS             218793..219392
                     /transl_table=11
                     /locus_tag="PAU_00202"
                     /old_locus_tag="PAT2237"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00202"
                     /db_xref="EnsemblGenomes-Tr:CAQ82295"
                     /db_xref="GOA:B6VM32"
                     /db_xref="InterPro:IPR000259"
                     /db_xref="InterPro:IPR008966"
                     /db_xref="UniProtKB/TrEMBL:B6VM32"
                     /inference="similar to DNA sequence:INSD:AY626368"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82295.1"
                     /translation="MILIGWIIGCVSLSVQADGKNIEITIKGNLLRPTCALSVNGKYG
                     GSSGGSYDDTMPQVYANQLRNSKYVESSALDLEVQLSHCSPGQSPALYIWSLYAGNSD
                     DSELFMPADGTASAEGVGIRLLDVSTNQFVKVKPINDPFKVPLPSAGDGTTRTFRAYV
                     GGLGDKNNPATCKSDGTNVLCGGTANVQIHFEFSYEHLK"
     sig_peptide     218793..218843
                     /locus_tag="PAU_00202"
                     /note="Signal peptide predicted for PAT2237 by SignalP 2.0
                     HMM (Signal peptide probability 0.822) with cleavage site
                     probability 0.795 between residues 17 and 18"
     misc_feature    218859..219380
                     /note="HMMPfam hit to PF00419, Fimbrial protein, score
                     0.00063"
                     /inference="protein motif:Pfam:PF00419"
     CDS             219469..220188
                     /transl_table=11
                     /gene="afaB"
                     /locus_tag="PAU_00203"
                     /old_locus_tag="PAT2238"
                     /product="similar to pilli chaperone"
                     /product="afab"
                     /note="Periplasmic chaperones assist pili assembly by
                     binding to the subunits, thereby preventing premature
                     aggregation"
                     /db_xref="EnsemblGenomes-Gn:PAU_00203"
                     /db_xref="EnsemblGenomes-Tr:CAQ82296"
                     /db_xref="GOA:B6VM33"
                     /db_xref="InterPro:IPR001829"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR016147"
                     /db_xref="InterPro:IPR016148"
                     /db_xref="UniProtKB/TrEMBL:B6VM33"
                     /inference="similar to DNA sequence:INSD:AF072900"
                     /protein_id="CAQ82296.1"
                     /translation="MGMLGIWAVVASSSAHAGLMLRKTRIIYQQGDKVQSISLQNSGE
                     EVYLVQAAVTPWDNPNTRSSEFTVLPPLFRMEGNSLNVMRVMRTGGDFPDDRESLFRF
                     RINAIPAKKTVDNGQENSSGKQDEIGASLSISLGMNIKLIYRPDKLPMTPEQARGRLT
                     FTQSGNSVVVTNPTPYYQTFAQLKFDGKAVDFDKAPSILVPFGQTTFPLAGKAGSKVE
                     WSMITDIGGVSKLQSGTLQAG"
     sig_peptide     219469..219519
                     /gene="afaB"
                     /locus_tag="PAU_00203"
                     /note="Signal peptide predicted for PAT2238 by SignalP 2.0
                     HMM (Signal peptide probability 0.972) with cleavage site
                     probability 0.971 between residues 17 and 18"
     misc_feature    219520..219915
                     /note="HMMPfam hit to PF00345, Gram-negative pili assembly
                     chaperone, score 9e-27"
                     /inference="protein motif:Pfam:PF00345"
     misc_feature    219925..220167
                     /note="HMMPfam hit to PF02753, Gram-negative pili assembly
                     chaperone, score 5.1e-19"
                     /inference="protein motif:Pfam:PF02753"
     CDS             220217..221011
                     /transl_table=11
                     /gene="agg3D"
                     /locus_tag="PAU_00204"
                     /old_locus_tag="PAT2239"
                     /product="similar to putative fimbrial chaperone"
                     /note="Periplasmic chaperones assist pili assembly by
                     binding to the subunits, thereby preventing premature
                     aggregation"
                     /db_xref="EnsemblGenomes-Gn:PAU_00204"
                     /db_xref="EnsemblGenomes-Tr:CAQ82297"
                     /db_xref="GOA:B6VM34"
                     /db_xref="InterPro:IPR001829"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR016147"
                     /db_xref="InterPro:IPR016148"
                     /db_xref="InterPro:IPR018046"
                     /db_xref="UniProtKB/TrEMBL:B6VM34"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AF411067"
                     /protein_id="CAQ82297.1"
                     /translation="MAERKVSIKQRVTSVLCALAMILPVLPLRAEEALMGALYINDAR
                     VLYLESFNNGVPSTFINNSDSNYLIQSTVRELDPATGLPLDIKAPFIVIPPIAKVDAH
                     ERQVLKILRTGGDFPKDRESLFFLNVRMLPSEKPSSVSKGFSGKVKMTTALAVKVFYR
                     PEGLPKEGVAGAVKQLSASVKESVVTLTNPSPFWITLQALHVSSFAVPEQDLFRMVPP
                     FGQQSWSLPVGKVLPGNNVTISWRAIDEFGLGTDEESRSITVSGSG"
     sig_peptide     220217..220306
                     /gene="agg3D"
                     /locus_tag="PAU_00204"
                     /note="Signal peptide predicted for PAT2239 by SignalP 2.0
                     HMM (Signal peptide probability 0.996) with cleavage site
                     probability 0.985 between residues 30 and 31"
     misc_feature    220250..220306
                     /note="1 probable transmembrane helix predicted for
                     PAT2239 by TMHMM2.0 at aa 12-30"
     misc_feature    220325..220711
                     /note="HMMPfam hit to PF00345, Gram-negative pili assembly
                     chaperone, score 7.2e-22"
                     /inference="protein motif:Pfam:PF00345"
     CDS             221128..223878
                     /transl_table=11
                     /gene="lpfC"
                     /locus_tag="PAU_00205"
                     /old_locus_tag="PAT2240"
                     /product="similar to outer membrane usher protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00205"
                     /db_xref="EnsemblGenomes-Tr:CAQ82298"
                     /db_xref="GOA:B6VM35"
                     /db_xref="InterPro:IPR000015"
                     /db_xref="InterPro:IPR018030"
                     /db_xref="InterPro:IPR025885"
                     /db_xref="InterPro:IPR025949"
                     /db_xref="UniProtKB/TrEMBL:B6VM35"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AY057066"
                     /protein_id="CAQ82298.1"
                     /translation="MATLIMKMLIPMINCCLERPPIYHRVNQNISISLVLLKCSVKLR
                     LSLIFCRMVLVFLTGWGVQATARDYFDPALLDFGSNSGQPVDLSQFETAGGQAPGTYR
                     VDIYVNGTFFDSRDITFQRNGDSELVPVLTPDLLETAGVNISDTPALKTLPADKPIES
                     PLDKFIPQATARLNFSQMRLNLSIPQIAMKPSANGQVDPKLWQEGIPAFILNYSINGS
                     QNRRSQFGNKQANQSLFGSFNSGLNLGAWRLRNTATYSYSTQTYNRYDSLNDAMKKTT
                     QSQQRWNFLQTYLQRDVVALRSDLTIGDTSTGSVAGQVFDGFPYRGIGLATSDSMIPG
                     RQSGFAPIISGIAKSNAQVTVTQNGSVIYQTNVAPGPFRITDLVGSSTGGDLQVTITE
                     ADGTHHGFSQAYSSLPMMLRQGQFKYEAAAGRYHSSGYSSGGHKPVFGMVSMIYGLPG
                     NVTVYGGGLVAQSYQSAALGTGLSLGMMGALSADITTSRARLKNMADIQRGESYRAKY
                     SKSMLTSGTTVDLTAYRYSTRNYLSFSDVNTQGYTVWGELPSWMSQRRRSSWQMRLSQ
                     SLPGNYSLWLSGQRDNYWGSSKTNTTLSMGLNGSFYRVGWGLNYSIDRIRGNGDWPEN
                     RQVSLNVNIPLSLFGSYAALNNAYANYSLFHDSTGRSSNQLGLGGSLLDDNSLSWSVS
                     QSQANKGQGNSGSVSMGYRGSLGQASLGYNYDSSGGRGVNYGVSGGLIAHQHGVTLTS
                     RVGDAAVLVRTSGVGGIRVMNSDSISTNRWGYAVVPYAQTYSRNSISLDPSSLPEGAD
                     MAQGSKNVFPTKGAVVMVDYPVRIGQQLLMNLLYHGKPVPFGAMARLKGDTTTNLAAI
                     VGEGGQVYLSGMPPNGVLKVKWGSAPDSQCEVVFNLGPPPVKAKKDKSWSPMRQLNET
                     CR"
     misc_feature    221329..223806
                     /note="HMMPfam hit to PF00577, Fimbrial Usher protein,
                     score 5.3e-303"
                     /inference="protein motif:Pfam:PF00577"
     CDS             224026..225366
                     /transl_table=11
                     /locus_tag="PAU_00206"
                     /old_locus_tag="PAT2241"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00206"
                     /db_xref="EnsemblGenomes-Tr:CAQ82299"
                     /db_xref="GOA:B6VM36"
                     /db_xref="UniProtKB/TrEMBL:B6VM36"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82299.1"
                     /translation="MKISNIATGKLLPVGQPMNTKKTFINKLKQDIGWMAVCCRKWPI
                     WVAMICLSVVAIFSSPSVFAESLNWNADTTLKVLGPERMVKRSDGVITYPAAGKATLD
                     VFPFYRKRIASKTTSYDQKFLEDVRFQLRAGRGEIFKVPRVVSGSYECTIIAKSHYYH
                     TKNPIEGTAIQHFTVSLDKPYPNENLSQPLYFQPENPNNQDDKNIAEGRISDLDFDVS
                     CRGVNFSWQRNPDEKVEFDSDDNAPILSILADGEEFMSWSKPRFPPIKDPVTVLDPPV
                     CGLDFGTPGAFVGVVPMGEVLRSLGPYPALLPTNSLSDEYTPFFPMNIICTVSDKNST
                     GGVATLQFSASQLADNNESIVVPNFDNALRIKVVPNVIGGNTQLAAPNVKDRPVKFGP
                     PTNPADVLYFTVGNTPNTYVSQNRFNVQLWQVKALDPGTSGEFQTTMNVTLVVR"
     sig_peptide     224026..224217
                     /locus_tag="PAU_00206"
                     /note="Signal peptide predicted for PAT2241 by SignalP 2.0
                     HMM (Signal peptide probability 0.983) with cleavage site
                     probability 0.982 between residues 64 and 65"
     misc_feature    224149..224217
                     /note="1 probable transmembrane helix predicted for
                     PAT2241 by TMHMM2.0 at aa 42-64"
     CDS             225496..225987
                     /transl_table=11
                     /gene="yheC"
                     /locus_tag="PAU_00207"
                     /old_locus_tag="PAT2242"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00207"
                     /db_xref="EnsemblGenomes-Tr:CAQ82300"
                     /db_xref="GOA:B6VM37"
                     /db_xref="InterPro:IPR020357"
                     /db_xref="UniProtKB/TrEMBL:B6VM37"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AP002527"
                     /protein_id="CAQ82300.1"
                     /translation="MTINVNDSVLLQMSGNQTDLPGSQTITGKQSNHGDFRLPVCLSH
                     LNDTPLYLAVAYWGLLKGRGFTKNEISQVFRVSERRARDVMNYIYNERRDVISCEKVF
                     FREKRRSRRLMLIVTAVAKPMPQRNQILVTKTVKSASSLTSARIHHMRTWFLQRACGP
                     FIS"
     CDS             <225984..226448
                     /transl_table=11
                     /locus_tag="PAU_00208"
                     /old_locus_tag="PAT2243"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00208"
                     /db_xref="EnsemblGenomes-Tr:CAQ82301"
                     /db_xref="GOA:B6VM38"
                     /db_xref="UniProtKB/TrEMBL:B6VM38"
                     /inference="similar to DNA sequence:INSD:AALN01000061"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82301.1"
                     /translation="LKYMTHVVVWRDIMEDEFLSILCGMPYGMLISRVVLVIIVVLLT
                     VGGLLLGNKIRHSLYPRMLLAYWCRTWIVPLLFIVIGLVLMFGVGEEGWLGHLLDEID
                     SVLVGLLFENQGDVSSSLMLSCGFAVNSTVGCSPAELHGLPGAENNNQKQVL"
     misc_feature    order(226068..226136,226170..226238)
                     /note="2 probable transmembrane helices predicted for
                     PAT2243 by TMHMM2.0 at aa 29-51 and 63-85"
     CDS             complement(226471..228588)
                     /transl_table=11
                     /gene="spoT"
                     /locus_tag="PAU_00209"
                     /old_locus_tag="PAT2244"
                     /product="guanosine-3',5'-bis(diphosphate)
                     3'-pyrophosphohydrolase"
                     /EC_number="2.7.6.5"
                     /db_xref="EnsemblGenomes-Gn:PAU_00209"
                     /db_xref="EnsemblGenomes-Tr:CAQ82302"
                     /db_xref="GOA:B6VM39"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR004811"
                     /db_xref="InterPro:IPR007685"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR033655"
                     /db_xref="UniProtKB/TrEMBL:B6VM39"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82302.1"
                     /translation="MYLFESLNLLIQKYLPESQIELLKQAYSVARDAHEGQTRTSGEP
                     YITHPVAVACILAEMRLDHETLMAALLHDVIEDTPATFQDIAQPFGPVVAGLVEGVSK
                     LDKLNFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGALRPDKRRRIAR
                     ETLEIYSPLAHRLGIHHLKTELEELGFEALHPNRYRVIKEVVKAARGNRKEMIQKILS
                     EIAGRLAEANIECKVSGREKHLYSIYRKMHLKEQRFHSIMDIYAFRVIVNNVDICYRV
                     LGQMHSLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMEQMAEMG
                     VAAHWTYKEQGESGTAAQVRAQRWMQSLLELQQSAGNSFEFIESVKSDLFPDEIYVFT
                     PKGRIVELPAGSTPVDFAYAVHTDIGHACVGSRVDRQPYPLSQSLTNGQTVEIITAPG
                     ARPNAAWLNFVVSSKARAKIRQLLKNLKREDSIGLGRRLLNHALGNGKKLVDIPPENI
                     NKELTRMKLVTIDDLLAEIGLGNTMSIVVARNLLGAQENTASTSSHNSGARKLPIKGA
                     DGVLITFAKCCRPIPGDPIIAHISPGKGLVIHHESCRNIRGYQKEPEKFMAVEWDKEI
                     NSDFIAEIKVDMFNHQGALANLTAAINAVNSNIQSMNTEEKDGRVYCAFIRLTTKDRI
                     QLANIMRKIRIMPDVMRVSRNRN"
     misc_feature    complement(227248..227427)
                     /note="HMMPfam hit to PF02824, TGS domain, score 3.3e-27"
                     /inference="protein motif:Pfam:PF02824"
     misc_feature    complement(227554..227886)
                     /note="HMMPfam hit to PF04607, Region found in RelA / SpoT
                     proteins, score 1e-47"
                     /inference="protein motif:Pfam:PF04607"
     misc_feature    complement(228130..228468)
                     /note="HMMSmart hit to SM00471, no description, score
                     8.3e-12"
                     /inference="protein motif:Smart:SM00471"
     misc_feature    complement(228157..228456)
                     /note="HMMPfam hit to PF01966, HD domain, score 5.9e-16"
                     /inference="protein motif:Pfam:PF01966"
     CDS             complement(228606..228881)
                     /transl_table=11
                     /gene="rpoZ"
                     /locus_tag="PAU_00210"
                     /old_locus_tag="PAT2245"
                     /product="DNA-directed RNA polymerase omega chain"
                     /EC_number="2.7.7.6"
                     /db_xref="EnsemblGenomes-Gn:PAU_00210"
                     /db_xref="EnsemblGenomes-Tr:CAQ82303"
                     /db_xref="GOA:B6VM40"
                     /db_xref="InterPro:IPR003716"
                     /db_xref="InterPro:IPR006110"
                     /db_xref="InterPro:IPR012293"
                     /db_xref="UniProtKB/TrEMBL:B6VM40"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82303.1"
                     /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQLQTGGKDPLVAEEND
                     KVTVIALREVEEGLINGKILDVRERQEQQEQEAAEMQAVSAIAESRR"
     misc_feature    complement(228687..228848)
                     /note="HMMPfam hit to PF01192, RNA polymerase Rpb6, score
                     7e-22"
                     /inference="protein motif:Pfam:PF01192"
     CDS             complement(228936..229559)
                     /transl_table=11
                     /gene="gmk"
                     /locus_tag="PAU_00211"
                     /old_locus_tag="PAT2246"
                     /product="guanylate kinase"
                     /EC_number="2.7.4.8"
                     /db_xref="EnsemblGenomes-Gn:PAU_00211"
                     /db_xref="EnsemblGenomes-Tr:CAQ82304"
                     /db_xref="GOA:C7BHD6"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR008145"
                     /db_xref="InterPro:IPR017665"
                     /db_xref="InterPro:IPR020590"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C7BHD6"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82304.1"
                     /translation="MIQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRAM
                     RPGENHGEHYFFITEQAFRQMIDNNEFLEHARVFGNYYGTSRKVIEETLASGVDVFLD
                     IDWQGAQQIRKQMPSARSIFILPPSKEELCRRLRGRGQDSEDIIEKRMEQAVAEMVHY
                     NEYDYLIVNDDFNTALADLHTIIRSERLHRERQAQRHDALISKLLAD"
     misc_feature    complement(228999..229553)
                     /note="HMMSmart hit to SM00072, no description, score
                     1.6e-76"
                     /inference="protein motif:Smart:SM00072"
     misc_feature    complement(229125..229439)
                     /note="HMMPfam hit to PF00625, Guanylate kinase, score
                     1.2e-53"
                     /inference="protein motif:Pfam:PF00625"
     CDS             230048..230485
                     /transl_table=11
                     /locus_tag="PAU_00212"
                     /old_locus_tag="PAT2247"
                     /product="putative hth-type transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:PAU_00212"
                     /db_xref="EnsemblGenomes-Tr:CAQ82305"
                     /db_xref="InterPro:IPR031807"
                     /db_xref="InterPro:IPR035069"
                     /db_xref="UniProtKB/TrEMBL:C7BHD7"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /inference="similar to AA sequence:UniProt:Q0WCU1"
                     /protein_id="CAQ82305.1"
                     /translation="MFNYPIKLEYDEETGSYVASCRDLPLFNSVGDSVDEALLESIDG
                     LVTAISIEIDKRRPIPEASMLEAGEYIVTLPILVVMKVALHNAMVETGTRKADLARRL
                     GQKGPQIDRLLDVEHSSKVEVVELALHQLNRKLDIVVNTTLHH"
     misc_feature    230054..230200
                     /note="HMMPfam hit to PF03681, Uncharacterised protein
                     family (UPF0150), score 1.2e-11"
                     /inference="protein motif:Pfam:PF03681"
     CDS             complement(230778..231638)
                     /transl_table=11
                     /locus_tag="PAU_00213"
                     /old_locus_tag="PAT2248"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00213"
                     /db_xref="EnsemblGenomes-Tr:CAQ82306"
                     /db_xref="GOA:C7BHD8"
                     /db_xref="UniProtKB/TrEMBL:C7BHD8"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82306.1"
                     /translation="MNTEKTFINRVKQNVGRNRRWSAWVMCASIGALFSTSVLAATEC
                     PKVPVQDLGYPATPPWNPKVLFRALGQPIINGKDNQGKPVHYPARGSTNLVGVFPPVV
                     DYDFPTPTGDLMLKDAKFWVRAQNRIFKVPHVVTGMYHCKMVAKRKDGAPGRATANLY
                     TDAIVVNHDTHKFQGDQNVMESSVTDLVYTATCKGAGFSWERKPEEKFEWESKWENGV
                     PSIEMLDNCHWIHNVAFWTPPDDNPNDKFKDPAVLRPTSAENANPKKSVPHDNPDNFP
                     WKRKADSNNQ"
     misc_feature    complement(231510..231578)
                     /note="1 probable transmembrane helix predicted for
                     PAT2248 by TMHMM2.0 at aa 21-43"
     sig_peptide     complement(231519..231638)
                     /locus_tag="PAU_00213"
                     /note="Signal peptide predicted for PAT2248 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.996 between residues 40 and 41"
     CDS             complement(232545..233405)
                     /transl_table=11
                     /locus_tag="PAU_00214"
                     /old_locus_tag="PAT2249"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00214"
                     /db_xref="EnsemblGenomes-Tr:CAQ82307"
                     /db_xref="UniProtKB/TrEMBL:C7BHD9"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82307.1"
                     /translation="MNTEKAFINRVKQNVGRNRRWSAWVMCASIGALFSTSVLAATEC
                     PKVPVKDLGYPATPPWNPEVLFRALGQPIINGKDNQGKPVHYPARGSTNLVGVFPPVV
                     DYDFPTPTGDLKLKDGLFWVSAPNRIFKVPHVVTGKYHCKMIAKRKDGAPGRATATLE
                     TDAVVANHIIHRFQGDKNVLESSVTDLVYTVTCRGTGFSWERKPEEKFEWESVWDNSV
                     PLIRMQDLCNWVHNVAFWTPPSDNPNDRFKDPAVLRPMSAESADLKKSDANATPDNLS
                     GTKRADSGNK"
     misc_feature    complement(233277..233345)
                     /note="1 probable transmembrane helix predicted for
                     PAT2249 by TMHMM2.0 at aa 21-43"
     sig_peptide     complement(233286..233405)
                     /locus_tag="PAU_00214"
                     /note="Signal peptide predicted for PAT2249 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.996 between residues 40 and 41"
     CDS             complement(234276..235901)
                     /transl_table=11
                     /locus_tag="PAU_00215"
                     /old_locus_tag="PAT2250"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00215"
                     /db_xref="EnsemblGenomes-Tr:CAQ82308"
                     /db_xref="GOA:C7BHE0"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="InterPro:IPR016186"
                     /db_xref="UniProtKB/TrEMBL:C7BHE0"
                     /inference="similar to DNA sequence:INSD:BX571860"
                     /inference="similar to DNA sequence:INSD:CP000094"
                     /protein_id="CAQ82308.1"
                     /translation="MKIFNMPTGEQSPSEYPMNTEKTFINRVKQGVGRIAVRYRRWSA
                     WVMCVSIGALFFTSVLAATEYPSKPTPDLGYPATPPWDAEYIFKSLGQPIINGKDNKA
                     SITSTYTATAMLLTNGRIVAWGDEGGGGSIPPEIAKLQDIVSLSSTGYAFAALRADRS
                     VVAWGDERYGGTLPEEIAKLQDIVSLSSTNYAFSALRADGSVVAWGDQKYGGKLPAEI
                     AELKDIISINSIHNLSDHVCAAWWPDRNQFYCGDDNRGKHKFNAVYNFTNDTFTALRA
                     NGSVVSWGKVRVPPDIAKLQDIISLSVINNTFIARRADLTVVTWPGYSIPPEIAKWQD
                     IVNLSITTYALAALRANRSVVAWGHQDYGGQVPPEIASLRDIISLSATNGAFAALRTD
                     RSVVAWGEPSSGGQIPPEIAALKDIVSLYSSRTTFIALRADRSVVSWGTISVPPEVAK
                     LKDIVSLSTTDLDDSSRGHYAFAALRANRSVVAWGFKELNIQIPPGITQLQDIISLSA
                     SSSAFTVLRANGQRLAWDLLDMGDNIVHSEYDD"
     misc_feature    complement(235710..235778)
                     /note="1 probable transmembrane helix predicted for
                     PAT2250 by TMHMM2.0 at aa 42-64"
     sig_peptide     complement(235719..235901)
                     /locus_tag="PAU_00215"
                     /note="Signal peptide predicted for PAT2250 by SignalP 2.0
                     HMM (Signal peptide probability 0.661) with cleavage site
                     probability 0.648 between residues 61 and 62"
     CDS             complement(236281..236610)
                     /transl_table=11
                     /locus_tag="PAU_00216"
                     /old_locus_tag="PAT2251"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00216"
                     /db_xref="EnsemblGenomes-Tr:CAQ82309"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="InterPro:IPR016186"
                     /db_xref="UniProtKB/TrEMBL:C7BHE1"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82309.1"
                     /translation="MNQNNDPSPNIDTGSNPTKQYWQPNRSNHADNNTPIASTRGATA
                     MLLPNGRVIAWGNDSSSQIPPDIAQLQDIVSLSASRHSFTVLRADGQRVGWGSTGDNK
                     LHYEYDY"
     CDS             complement(237254..237532)
                     /transl_table=11
                     /locus_tag="PAU_00217"
                     /old_locus_tag="PAT2252"
                     /product="similar to gp48 proteins of bacteriophage n15"
                     /db_xref="EnsemblGenomes-Gn:PAU_00217"
                     /db_xref="EnsemblGenomes-Tr:CAQ82310"
                     /db_xref="GOA:C7BHE2"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="UniProtKB/TrEMBL:C7BHE2"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CR628336"
                     /protein_id="CAQ82310.1"
                     /translation="MSSLKSLKSKALANPDVKAEYDALEPEFELINTLLRMRHAAGLT
                     QNQVAQRMGTKEANISRLEKGNGNPTLKTLLNYAKACNCKLHFGFKTT"
     misc_feature    complement(237269..237436)
                     /note="HMMSmart hit to SM00530, no description, score
                     3.2e-10"
                     /inference="protein motif:Smart:SM00530"
     misc_feature    complement(237269..237433)
                     /note="HMMPfam hit to PF01381, Helix-turn-helix, score
                     8.2e-11"
                     /inference="protein motif:Pfam:PF01381"
     CDS             complement(237723..237980)
                     /transl_table=11
                     /gene="s045"
                     /gene_synonym="CBU1692"
                     /locus_tag="PAU_00218"
                     /old_locus_tag="PAT2253"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00218"
                     /db_xref="EnsemblGenomes-Tr:CAQ82311"
                     /db_xref="InterPro:IPR009241"
                     /db_xref="UniProtKB/TrEMBL:C7BHE3"
                     /inference="similar to DNA sequence:INSD:AY055428"
                     /inference="similar to DNA sequence:INSD:CR378675"
                     /protein_id="CAQ82311.1"
                     /translation="MNMNWNIEFYDGVEGVILDMPPGIQARILKLLELIEEYGANLGE
                     PHTKPIGKGLFEIRAKAQEGIGRGLFCYTLWISRCIATARE"
     CDS             complement(238434..238757)
                     /transl_table=11
                     /locus_tag="PAU_00219"
                     /old_locus_tag="PAT2254"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00219"
                     /db_xref="EnsemblGenomes-Tr:CAQ82312"
                     /db_xref="GOA:C7BHE4"
                     /db_xref="InterPro:IPR002712"
                     /db_xref="InterPro:IPR011067"
                     /db_xref="UniProtKB/TrEMBL:C7BHE4"
                     /inference="similar to DNA sequence:INSD:BX571866"
                     /inference="similar to DNA sequence:INSD:AAQF01000115"
                     /protein_id="CAQ82312.1"
                     /translation="MPQQFDVYRNPSAKTNRLWPFYLIIQNDYFDDLTTRIIVPLVSK
                     NDISLNQKRITPQVVINNNSYYIFTPAITFLDAKKINKSDFVCNVASSRNEIISALDA
                     IITNT"
     CDS             complement(238757..239080)
                     /transl_table=11
                     /locus_tag="PAU_00220"
                     /old_locus_tag="PAT2255"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00220"
                     /db_xref="EnsemblGenomes-Tr:CAQ82313"
                     /db_xref="InterPro:IPR009956"
                     /db_xref="UniProtKB/TrEMBL:C7BHE5"
                     /inference="similar to DNA sequence:INSD:BX571866"
                     /inference="similar to DNA sequence:INSD:CP000267"
                     /protein_id="CAQ82313.1"
                     /translation="MIVFPLPIILMRIPLRIGVNTMNTVTSPRNSIKRSTKRSTNVYL
                     TASLVDKAHSMDMNLSATLDILLAQAIKAKQDEREKEKEDMQAMNIFMAKAGMLTDDE
                     FFGSL"
     CDS             239330..241066
                     /transl_table=11
                     /gene="yicF"
                     /locus_tag="PAU_00221"
                     /old_locus_tag="PAT2256"
                     /product="similar to putative dna ligase-like protein yicf
                     of escherichia coli"
                     /db_xref="EnsemblGenomes-Gn:PAU_00221"
                     /db_xref="EnsemblGenomes-Tr:CAQ82314"
                     /db_xref="GOA:C7BHE6"
                     /db_xref="InterPro:IPR004150"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013839"
                     /db_xref="InterPro:IPR013840"
                     /db_xref="InterPro:IPR020923"
                     /db_xref="UniProtKB/TrEMBL:C7BHE6"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82314.1"
                     /translation="MLNLLILILFIVFSTPVVATETLNTEKDCPAWSQDKLQRETKSL
                     MQQMARWDQLYRQKGISEIDDEVYDQLMADLIHWQLCLKQEPHSDFPATVFPDNKLVH
                     PVAHTGLSKLKDEREINRWLHGRLPVWLQPKIDGVAVTLVYQQGKLVSLISRGNGSEG
                     VDWTAKSPYISEIPQEIENAPPYMVLQGELFLHKNGHIQQSSGSDGARNRVAGLMMRK
                     EHSPELKQVGVFIWSWPDGPVDMDGKLQKLANMGFPLALRYSHKIERPEQVQKLRMHY
                     FEQPMPFATDGIVLKQEIEPKGNQWRSGSNSWAVAWKHPLRHQVTQVREVSFTIGRTG
                     KISVVLGLDKVKLDDRQVSRVNIGSVRRWQQLDVLPGDRVTLTLAGHGIPKLAQVVWR
                     IKERQDIQPPDKQRYHALSCLTLTAGCEQQFNARLKWLGEHLHMTGVSSGSWAMLTEQ
                     KLVTDLTSWLTLSVQDIAALPGIGDKRAQAIYSQFSKAKNQPFSYWMKGIGVPYMDKL
                     SNDVDHWQQLEQKLAEAQLKQQLTSGQLKKLSEFVNDTRIKAIAEKLSVSGIKGFGRE
                     NGAGPNPVSMNQ"
     sig_peptide     239330..239386
                     /gene="yicF"
                     /locus_tag="PAU_00221"
                     /note="Signal peptide predicted for PAT2256 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.998 between residues 19 and 20"
     misc_feature    239432..240280
                     /note="HMMPfam hit to PF01653, NAD-dependent DNA ligase
                     adenylation, score 3.4e-19"
                     /inference="protein motif:Pfam:PF01653"
     misc_feature    239435..240634
                     /note="HMMSmart hit to SM00532, no description, score
                     2.6e-41"
                     /inference="protein motif:Smart:SM00532"
     misc_feature    240284..240535
                     /note="HMMPfam hit to PF03120, NAD-dependent DNA ligase
                     OB-fold doma, score 1.5e-17"
                     /inference="protein motif:Pfam:PF03120"
     CDS             complement(241060..241677)
                     /transl_table=11
                     /gene="yicG"
                     /locus_tag="PAU_00222"
                     /old_locus_tag="PAT2257"
                     /product="similar to putative inner membrane protein yicg
                     of escherichia coli"
                     /db_xref="EnsemblGenomes-Gn:PAU_00222"
                     /db_xref="EnsemblGenomes-Tr:CAQ82315"
                     /db_xref="GOA:C7BHE7"
                     /db_xref="InterPro:IPR005115"
                     /db_xref="UniProtKB/TrEMBL:C7BHE7"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82315.1"
                     /translation="MLLSVLYIIGITAEAMTGALAAGRRKMDMFGVIIIASVTAIGGG
                     SVRDILLGHYPLGWVKHPEYIVTVACAAVITTWVAPMMKHLRRLFLILDAIGLIVFSI
                     IGAQIALDMNYSPIIASIAAVITGVFGGVLRDMLCNTIPLVFQKEIYAGVSFAAAWLY
                     IGLQHTPLPQNSIVLITLIAGLTARLVAIRYRLGLPVFNYEHSDH"
     misc_feature    complement(order(241111..241164,241192..241260,
                     241279..241347,241357..241416,241435..241488,
                     241525..241593,241612..241665))
                     /note="7 probable transmembrane helices predicted for
                     PAT2257 by TMHMM2.0 at aa 5-22, 29-51, 64-81, 88-107,
                     111-133, 140-162 and 172-189"
     misc_feature    complement(241123..241413)
                     /note="HMMPfam hit to PF03458, UPF0126 domain, score
                     3.8e-34"
                     /inference="protein motif:Pfam:PF03458"
     misc_feature    complement(241414..241671)
                     /note="HMMPfam hit to PF03458, UPF0126 domain, score
                     2.2e-37"
                     /inference="protein motif:Pfam:PF03458"
     CDS             241812..243101
                     /transl_table=11
                     /gene="yidR"
                     /locus_tag="PAU_00223"
                     /old_locus_tag="PAT2258"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00223"
                     /db_xref="EnsemblGenomes-Tr:CAQ82316"
                     /db_xref="InterPro:IPR011659"
                     /db_xref="InterPro:IPR022223"
                     /db_xref="UniProtKB/TrEMBL:C7BHE8"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82316.1"
                     /translation="MDFQERQITFDNRSHQLTNINVWTPDSQWLAYDVRPHGASFTGL
                     TIEKIHVHSGKSDIIYQAEEGAHVGVVTVSPTEPVRYAFIHGPEFPDEQWHYDFHHRR
                     GVIVSEDAPGKAVTLDAMDITAPYTPGALRGGSHVHVFSPDGSRLSFTYNDHVMHELD
                     PALDLRNIAVAVPLKSVEPPKQHPREYDGNYFSVVVSSTESQPEPGSDEINRAYEECW
                     VGQAGYCKEDGNWQRWALAFIGDTISATGEKVPEIYIVDLPEQDTDYAIAGEKPLEGT
                     ETTLPAPPANVMQRRLTFTNHKRWPGVVNNPRHWLRASPDGEQIGFLMKDDNSIVQLW
                     TISPNGGKPRQITKGSYGIQSAFSWDRSGQYVVFICDNSVMLCDVQNSQMQRLTKRTE
                     KAPAAEAVVISPDSRHVAFMREVDGYTQIFLVETGLK"
     CDS             complement(243365..243685)
                     /transl_table=11
                     /gene="yidQ"
                     /locus_tag="PAU_00224"
                     /old_locus_tag="PAT2259"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00224"
                     /db_xref="EnsemblGenomes-Tr:CAQ82317"
                     /db_xref="InterPro:IPR010780"
                     /db_xref="UniProtKB/TrEMBL:C7BHE9"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82317.1"
                     /translation="MKSNKLILLCVTLGWLLISGCTSIMTHSGPSRGYYPGTKANIEM
                     LKDDNTGWVVRPLLAIDLPFSALLDTFLLPYDYIKSDEDQSANSPKERIEKIEKAQNQ
                     PKTN"
     misc_feature    complement(243452..243673)
                     /note="HMMPfam hit to PF07119, Protein of unknown function
                     (DUF1375), score 3.7e-34"
                     /inference="protein motif:Pfam:PF07119"
     misc_feature    complement(243599..243667)
                     /note="1 probable transmembrane helix predicted for
                     PAT2259 by TMHMM2.0 at aa 7-29"
     sig_peptide     complement(243608..243685)
                     /gene="yidQ"
                     /locus_tag="PAU_00224"
                     /note="Signal peptide predicted for PAT2259 by SignalP 2.0
                     HMM (Signal peptide probability 0.998) with cleavage site
                     probability 0.408 between residues 26 and 27"
     CDS             complement(244381..245634)
                     /transl_table=11
                     /gene="avtA"
                     /locus_tag="PAU_00225"
                     /old_locus_tag="PAT2260"
                     /product="alanine-alpha-ketoisovalerate (or
                     valine-pyruvate) transaminase transaminase c
                     (valine-pyruvate transaminase)"
                     /db_xref="EnsemblGenomes-Gn:PAU_00225"
                     /db_xref="EnsemblGenomes-Tr:CAQ82318"
                     /db_xref="GOA:C7BHF0"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C7BHF0"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82318.1"
                     /translation="MIFSQFGNKFTQDAGITRLMNDLNQGLRTPGAIMLGGGNPAHIP
                     EMDDYFQQLLTEMAANGQLADTLCNYDGPQGKDTLIQALAKMLREKFGWEIGTQNIAL
                     TNGSQSAFFYLFNLLAGRSEDGSIRKVLFPLAPEYIGYSDSGLNDDLFVANKPNIELL
                     PEGQFKYHVDFDHLKITEDIGLICVSRPTNPTGNVITDEELQRLDRLAQQHQIPLLID
                     NAYGVPFPSIIFSEATPLWNPNIILCMSLSKLGLPGSRCGIIIANDKIINAVSNMNGI
                     ISLAPGGVGPAIALEMIRRNDLLRLSQEVIRPFYQQRVQDVIHIIRRYLPTELCLIHK
                     PEGAIFLWLWFKNLPITTEMLYQRLKKRGVLMVPGHYFFPGLEQNWPHAHECMRMNYV
                     PDPTSIEKGIAILAEEIELAHQQAA"
     misc_feature    complement(244420..245547)
                     /note="HMMPfam hit to PF00155, Aminotransferase class I
                     and II, score 1.5e-07"
                     /inference="protein motif:Pfam:PF00155"
     CDS             complement(246444..247001)
                     /transl_table=11
                     /gene="tag"
                     /locus_tag="PAU_00226"
                     /old_locus_tag="PAT2261"
                     /product="dna-3-methyladenine glycosylase i
                     (3-methyladenine-dna glycosylase i constitutive) (tag i)
                     (dna-3-methyladenine glycosidase i)"
                     /EC_number="3.2.2.20"
                     /db_xref="EnsemblGenomes-Gn:PAU_00226"
                     /db_xref="EnsemblGenomes-Tr:CAQ82319"
                     /db_xref="GOA:C7BHF1"
                     /db_xref="InterPro:IPR004597"
                     /db_xref="InterPro:IPR005019"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="UniProtKB/TrEMBL:C7BHF1"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82319.1"
                     /translation="MELTRCHWVTSDPEYLAYHDNEWGKPQKNSQKLFEMICLEGQQS
                     GLSWLTILKKREGYRKCFHQFDPVKIAVMNENDVERLMQDRTIVRNRAKINAIINNAL
                     AYLKMQQQGEEFSAFIWHFVDNKPIINQWKTITAVPVKTEISDALSQALKKRGFKFTG
                     STTCYAFMQATGLVNDHITSCLCRK"
     misc_feature    complement(246447..246980)
                     /note="HMMPfam hit to PF03352, Methyladenine glycosylase,
                     score 3.3e-109"
                     /inference="protein motif:Pfam:PF03352"
     CDS             247197..248111
                     /transl_table=11
                     /gene="glyQ"
                     /locus_tag="PAU_00227"
                     /old_locus_tag="PAT2262"
                     /product="glycyl-tRNA synthetase alpha chain"
                     /EC_number="6.1.1.14"
                     /db_xref="EnsemblGenomes-Gn:PAU_00227"
                     /db_xref="EnsemblGenomes-Tr:CAQ82320"
                     /db_xref="GOA:C7BHF2"
                     /db_xref="InterPro:IPR002310"
                     /db_xref="InterPro:IPR006194"
                     /db_xref="UniProtKB/TrEMBL:C7BHF2"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82320.1"
                     /translation="MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPIT
                     CLRALGPEPIAAAYVQPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSL
                     KELGLDPTVHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVT
                     GEITYGLERLAMYIQGVDSVYDLVWCDGLLGKTTYGDIYHQNEVEQSTYNFEHADVDF
                     LFTCFEQYEKEAQDLLALETPLPLPAYERILKAGHTFNLLDARKAISVTERQRYILRI
                     RTLTKAVAEAYYASREALGFPMCKKNQN"
     misc_feature    247221..248090
                     /note="HMMPfam hit to PF02091, Glycyl-tRNA synthetase
                     alpha subunit, score 4.3e-244"
                     /inference="protein motif:Pfam:PF02091"
     CDS             248121..250190
                     /transl_table=11
                     /gene="glyS"
                     /locus_tag="PAU_00228"
                     /old_locus_tag="PAT2263"
                     /product="glycyl-trna synthetase beta chain (glycine--trna
                     ligase beta chain (glyrs)"
                     /EC_number="6.1.1.14"
                     /db_xref="EnsemblGenomes-Gn:PAU_00228"
                     /db_xref="EnsemblGenomes-Tr:CAQ82321"
                     /db_xref="GOA:C7BHF3"
                     /db_xref="InterPro:IPR006194"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR015944"
                     /db_xref="UniProtKB/TrEMBL:C7BHF3"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82321.1"
                     /translation="MTQQTFLVEIGTEELPPKALRSLAEAFAANFAAELDNANLAHGE
                     VSWFATPRRLALKVANLDEAQADREVEKRGPAIAQAFDAEGKPTKAAEGWARGCGITA
                     AQAERLVTDKGEWLLYRALVKGLSVKELLAGMVNNALSKLPIPKLMRWSDKETQFVRP
                     VHTVTMLFGNELIEGDILGIKSTRVIRGHRFMGESEFTIDNTEQYPEILQQRGKVMAD
                     YVTRKALIKQDVEQAAVKLGGIADISDSLLEEVTSLVEWPVVLTAKFEEKFLEVPAEA
                     LVYTMKGDQKYFPVYDHAGKLMANFIFVANIESSDPQQIISGNEKVVRPRLADAEFFF
                     KTDRKQRLEDNLPRLETVLFQKQLGTLRDKTDRIQALAGWIAEKIGADVNHATRAGLL
                     SKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEEVALALNEQYQPRFAGDELPSTGISC
                     ALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGALRIIVEKKLPLDLQTLTEEAV
                     RLYGDKLTNAKVIDDVVEFMLGRFRAWYQEQGYSIDTIQAVLARRPTQPADFDARVKA
                     VTHFRTLDEATALAAANKRVSNILAKSEETLNEKVSASVLKAPEEVKLATHLVVLQDK
                     LAPLFAEGCYQEALVELASLREVVDAFFDNVMVMDEDQQVRVNRLTLLSELRELFLKV
                     ADISLLQ"
     misc_feature    248136..249788
                     /note="HMMPfam hit to PF02092, Glycyl-tRNA synthetase beta
                     subunit, score 0"
                     /inference="protein motif:Pfam:PF02092"
     misc_feature    249855..250145
                     /note="HMMPfam hit to PF05746, DALR anticodon binding
                     domain, score 1.4e-05"
                     /inference="protein motif:Pfam:PF05746"
     tRNA            250377..250450
                     /product="transfer RNA-Pro"
                     /anticodon=(pos:250411..250413,aa:Pro)
                     /note="tRNA Pro anticodon TGG, Cove score63.52"
     CDS             complement(250836..251237)
                     /transl_table=11
                     /locus_tag="PAU_00229"
                     /old_locus_tag="PAT2264"
                     /product="similar to protein gp48 from phage n15"
                     /db_xref="EnsemblGenomes-Gn:PAU_00229"
                     /db_xref="EnsemblGenomes-Tr:CAQ82322"
                     /db_xref="GOA:C7BHF4"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR009241"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C7BHF4"
                     /inference="similar to DNA sequence:INSD:BX571861"
                     /inference="similar to DNA sequence:INSD:CR942285"
                     /protein_id="CAQ82322.1"
                     /translation="MFELIFHPEAQQEILDLDSAMQGKAFAALDKLESQGNQLRYPHT
                     DIIQDGLFELRAGKKDITRTFFAFAKEELQKLLADMRRRAGINSTQVAERMGITQPAV
                     SKLEKNASKASISTLERYAAACGASIKIVIG"
     misc_feature    complement(250845..251012)
                     /note="HMMSmart hit to SM00530, no description, score
                     3.1e-09"
                     /inference="protein motif:Smart:SM00530"
     misc_feature    complement(250845..251009)
                     /note="HMMPfam hit to PF01381, Helix-turn-helix, score
                     3.7e-10"
                     /inference="protein motif:Pfam:PF01381"
     CDS             251920..252057
                     /transl_table=11
                     /gene="FNV1263"
                     /locus_tag="PAU_00230"
                     /old_locus_tag="PAT2265"
                     /product="Hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00230"
                     /db_xref="EnsemblGenomes-Tr:CAQ82323"
                     /db_xref="GOA:C7BHF5"
                     /db_xref="UniProtKB/TrEMBL:C7BHF5"
                     /inference="similar to DNA sequence:INSD:AABF01000037"
                     /protein_id="CAQ82323.1"
                     /translation="MVYLATKRALRHVFVLIMLIIGFLCVFLLLMTSVEILLTQETTV
                     V"
     sig_peptide     251920..252036
                     /gene="FNV1263"
                     /locus_tag="PAU_00230"
                     /note="Signal peptide predicted for PAT2265 by SignalP 2.0
                     HMM (Signal peptide probability 0.813) with cleavage site
                     probability 0.497 between residues 39 and 40"
     misc_feature    251953..252021
                     /note="1 probable transmembrane helix predicted for
                     PAT2265 by TMHMM2.0 at aa 12-34"
     CDS             252159..253766
                     /transl_table=11
                     /gene="dppA"
                     /locus_tag="PAU_00231"
                     /old_locus_tag="PAT2266"
                     /product="periplasmic dipeptide transport protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00231"
                     /db_xref="EnsemblGenomes-Tr:CAQ82324"
                     /db_xref="GOA:C7BHF6"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="InterPro:IPR023765"
                     /db_xref="InterPro:IPR030678"
                     /db_xref="UniProtKB/TrEMBL:C7BHF6"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82324.1"
                     /translation="MTTSSKKTGLLKLGISLIALAVTASVQAKTLVYCSEGSPEGFNP
                     QLFTAGTTYDASSRPLYNRLVDFETGKTEIIPSLAEKWDISDDGKVYIFHLRKGVKWH
                     GNKEFKPSREFNADDVIYTFMRQKDANHPYHKVSGGSYEYFIGMGMGEMINKVEKVDD
                     YTVRIELSRPEAPFLADLGMDFASILSAEYADKMMKAGTPEKVDLNPIGTGPFQLVQY
                     QKDSRILYKAFKEYWGDKAKVDRLVFSITPDASVRYAKLQKNECQIMPYPNPADIARM
                     KQDKDIVLMEQPGLNVGYVSFNVTKKPLDNVKVRQALAMAVNKDAIIDAVYQGAGQKA
                     KNLIPPTMWSYDNALKDYQYDPEKAKQLLKEAGMSDGFAIDLWAMPVQRPYNPNARRM
                     AEMVQADWAKIGVKAKIVSYEWGEYLKRAKDGEHQIVMMGWTGDNGDPDNFFATLFSC
                     AAKERGSNYSKWCYKPFEDAIQPARIASEHAKRVELYKQAQAVMHEQVPALIIAHSTV
                     YEPVRKEVKGYVVDPLGRHIFSNVSLE"
     sig_peptide     252159..252242
                     /gene="dppA"
                     /locus_tag="PAU_00231"
                     /note="Signal peptide predicted for PAT2266 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.991 between residues 28 and 29"
     misc_feature    252375..253523
                     /note="HMMPfam hit to PF00496, Bacterial extracellular
                     solute-binding prot, score 8.1e-95"
                     /inference="protein motif:Pfam:PF00496"
     CDS             253983..255002
                     /transl_table=11
                     /gene="dppB"
                     /locus_tag="PAU_00232"
                     /old_locus_tag="PAT2267"
                     /product="dipeptide transport system permease protein
                     dppb"
                     /db_xref="EnsemblGenomes-Gn:PAU_00232"
                     /db_xref="EnsemblGenomes-Tr:CAQ82325"
                     /db_xref="GOA:C7BHF7"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="UniProtKB/TrEMBL:C7BHF7"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82325.1"
                     /translation="MLQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVTIMAGERGI
                     SAERHAQLMAEMGLDKPLWQQYFHYVNGVLHGDLGISLKSRISVWEEFVPRFKATLEL
                     GVCAMLFAIAVGIPVGVLAAVKRGSVFDHTAIGLSLTGYSMPIFWWGIMLIMLVSVQL
                     DLTPVSGRISDSVFLDDSNPLTGFMLIDTLIWGEEGDFKDAIMHMILPAIVLGTIPLA
                     VIVRMTRSSMLEVLGEDYIRTARAKGLSRIRVIVVHALRNALLPVVTVIGLQVGIMLA
                     GAILTETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVAIMIILVNLVVDVLYGIVNPR
                     IRHKK"
     misc_feature    order(254007..254075,254277..254345,254382..254450,
                     254586..254645,254757..254825,254907..254975)
                     /note="6 probable transmembrane helices predicted for
                     PAT2267 by TMHMM2.0 at aa 9-31, 99-121, 134-156, 202-221,
                     259-281 and 309-331"
     misc_feature    254268..254993
                     /note="HMMPfam hit to PF00528, Binding-protein-dependent
                     transport syst, score 9.5e-58"
                     /inference="protein motif:Pfam:PF00528"
     CDS             255014..255916
                     /transl_table=11
                     /gene="dppC"
                     /locus_tag="PAU_00233"
                     /old_locus_tag="PAT2268"
                     /product="dipeptide transport system permease protein
                     dppc"
                     /db_xref="EnsemblGenomes-Gn:PAU_00233"
                     /db_xref="EnsemblGenomes-Tr:CAQ82326"
                     /db_xref="GOA:C7BHF8"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR025966"
                     /db_xref="UniProtKB/TrEMBL:C7BHF8"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82326.1"
                     /translation="MSQVTEPVANNAPKIMTPVQEFWYYFKRNKGAVVGLVYIVLMLL
                     IALLAGVLAPHSAAEQFRDSLLTPPVWQEGGSWQFILGTDDVGRDLLSRLMYGARLSL
                     LVGCLVVVLSLLMGVMLGVLAGYFGGVVDIIIMRIVDIMLALPSLLLALVLVAIFGPS
                     IVNASLALTFVALPHYIRLTRAAVLVEVNRDYVTASQVAGAGSMRQMFVNILPNCLAP
                     LIVQASLGFSNAILDMAALGFLGMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAI
                     LLTVLAFNLMGDGLRDALDPKLKQ"
     misc_feature    order(255104..255172,255320..255388,255431..255499,
                     255641..255709,255806..255874)
                     /note="5 probable transmembrane helices predicted for
                     PAT2268 by TMHMM2.0 at aa 31-53, 103-125, 140-162, 210-232
                     and 265-287"
     misc_feature    255305..255913
                     /note="HMMPfam hit to PF00528, Binding-protein-dependent
                     transport syst, score 1.7e-46"
                     /inference="protein motif:Pfam:PF00528"
     CDS             255929..256909
                     /transl_table=11
                     /gene="dppD"
                     /locus_tag="PAU_00234"
                     /old_locus_tag="PAT2269"
                     /product="dipeptide transport atp-binding protein dppd"
                     /db_xref="EnsemblGenomes-Gn:PAU_00234"
                     /db_xref="EnsemblGenomes-Tr:CAQ82327"
                     /db_xref="GOA:C7BHF9"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C7BHF9"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82327.1"
                     /translation="MALLNVEKLSVHFGEEEAPFRAVDRISYRVEQGQVVGIVGESGS
                     GKSVSSLAVMGLIDYPGRVMADKLEFNQRDLTKISEKERRQLVGAEVAMIFQDPMTSL
                     NPCYTVGYQIMEALKVHQGGNRRTRRQRAIDLLTLVGIPDPASRLDVYPHQLSGGMSQ
                     RVMIAMAIACRPKLLIADEPTTALDVTIQAQVIELLLELQQRENMALVLITHDLALVA
                     EAAHHIIVMYAGQVVESGKASEIFRAPRHPYTQALLRALPEFAADKSRLASLPGVVPG
                     KYDRPIGCLLNPRCPYADDYCHQVEPELRTVGERQVKCHMPLDDAGRPTI"
     misc_feature    256022..256621
                     /note="HMMSmart hit to SM00382, no description, score
                     5.9e-13"
                     /inference="protein motif:Smart:SM00382"
     misc_feature    256025..256618
                     /note="HMMPfam hit to PF00005, ABC transporter, score
                     5.2e-60"
                     /inference="protein motif:Pfam:PF00005"
     misc_feature    256625..256819
                     /note="HMMPfam hit to PF08352, Oligopeptide/dipeptide
                     transporter, C-termi, score 6.5e-25"
                     /inference="protein motif:Pfam:PF08352"
     CDS             256906..257925
                     /transl_table=11
                     /gene="dppF"
                     /locus_tag="PAU_00235"
                     /old_locus_tag="PAT2270"
                     /product="putative atp-binding component of dipeptide
                     transport system"
                     /db_xref="EnsemblGenomes-Gn:PAU_00235"
                     /db_xref="EnsemblGenomes-Tr:CAQ82328"
                     /db_xref="GOA:C7BHG0"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C7BHG0"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82328.1"
                     /translation="MSEQTYQERETSTVPLLKAAELKKYYPIKGGLFSPARIVKALDG
                     VSFELEKGKTLAVVGESGCGKSTLGRLLTMIEKPTEGELYYQGQDLLVPNKEAEKLRR
                     QKIQIVFQNPYGSLNPRKKVGQILEEPLLINTKLSAHERKEKVLQMMEKVGLKTEHYG
                     RYPHMFSGGQRQRIAIARGLMLNPDVVIADEPVSALDVSVRAQVLNLMMDLQQDLGLS
                     YVFISHDLSVVEHIADEVMVMYLGRCVEKGSKEMIFSNPRHPYTQALLSATPRLNPEL
                     RRERIKLTGELPSPMNPPPGCAFAARCRRALSMCTQLQPKLNQHGDQLIACFAVDQDE
                     NVAME"
     misc_feature    257056..257634
                     /note="HMMSmart hit to SM00382, no description, score
                     3.3e-12"
                     /inference="protein motif:Smart:SM00382"
     misc_feature    257059..257631
                     /note="HMMPfam hit to PF00005, ABC transporter, score
                     1.4e-62"
                     /inference="protein motif:Pfam:PF00005"
     misc_feature    257638..257835
                     /note="HMMPfam hit to PF08352, Oligopeptide/dipeptide
                     transporter, C-termi, score 8.7e-31"
                     /inference="protein motif:Pfam:PF08352"
     CDS             258154..258894
                     /transl_table=11
                     /gene="yhjK"
                     /locus_tag="PAU_00236"
                     /old_locus_tag="PAT2271"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00236"
                     /db_xref="EnsemblGenomes-Tr:CAQ82329"
                     /db_xref="GOA:C7BHG1"
                     /db_xref="InterPro:IPR033419"
                     /db_xref="UniProtKB/TrEMBL:C7BHG1"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82329.1"
                     /translation="MKMKLRVKRSLTIKQMAAVTGVTLVTIAIFIAIQLCHLIQQRKD
                     DYISQLNNAAVQVQVPLTEALLRSDLSKAKELLIGLRTAGILGRADVVLPENIRVIRL
                     NFATHRPIPELAKRVFGIPVEVSIPLYAYGSVPANAKPLGHLILQVDSNRVYRFAMNT
                     LALMLTAYLLLALILTVSISWCINRIIVHPLRDIARDLNNDQPPEPMTCPKHHQDDEL
                     GLLIRGYNRQFDKHKLPSSRNHPGRFEV"
     sig_peptide     258154..258249
                     /gene="yhjK"
                     /locus_tag="PAU_00236"
                     /note="Signal peptide predicted for PAT2271 by SignalP 2.0
                     HMM (Signal peptide probability 0.791) with cleavage site
                     probability 0.392 between residues 32 and 33"
     misc_feature    order(258196..258264,258634..258702)
                     /note="2 probable transmembrane helices predicted for
                     PAT2271 by TMHMM2.0 at aa 15-37 and 161-183"
     CDS             259037..260521
                     /transl_table=11
                     /gene="yhjJ"
                     /locus_tag="PAU_00237"
                     /old_locus_tag="PAT2272"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00237"
                     /db_xref="EnsemblGenomes-Tr:CAQ82330"
                     /db_xref="GOA:C7BHG2"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:C7BHG2"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82330.1"
                     /translation="MQGTKIRYFIGGIMLVVAGQTQAEVLQPDPAWKQGKLENGFNWQ
                     ILQTPQRPNDRIQLRLVVKTGSLAEKTQQAGYTWLIPKVALFSSKSLSSVKLEQLWNS
                     AIDPKYPLPPAIVSYDFTLYSLSLPHNHPELLKNALSWLADAAGKTAFTPETLQHAMK
                     MANTSVATYPPDIQDPVWRRRLKGSTLLGHDPAQSAAHPVDLDKLKQFYRQWYTPDMM
                     TLYVAGHVDSRALPENISQSFSSLKGKRHTPATVATLSPMKPETIGIISDKKKEDTLS
                     LIWDLNWQPINDSQVLSHYWISDITREALYRYLQLGLEKKNDKALKLGLDCKVQYQRA
                     SCALNLNTTAGNLKPAMEYLAAELVTLRDKGLPKGQFDELYAQKQTQLKQLFAMYGHT
                     STDILINQRLLSQQSNVVDIAPEQYQRLRQAFLASLTPEMLNHELKHILSQEVAFVLI
                     QPKGEAEMDVNQLRNSFNQIMLLAPDKVDPPAQPPVSKPEEKAS"
     sig_peptide     259037..259105
                     /gene="yhjJ"
                     /locus_tag="PAU_00237"
                     /note="Signal peptide predicted for PAT2272 by SignalP 2.0
                     HMM (Signal peptide probability 0.987) with cleavage site
                     probability 0.984 between residues 23 and 24"
     misc_feature    259166..259609
                     /note="HMMPfam hit to PF00675, Insulinase (Peptidase
                     family M16), score 0.049"
                     /inference="protein motif:Pfam:PF00675"
     misc_feature    259631..260170
                     /note="HMMPfam hit to PF05193, Peptidase M16 inactive
                     domain, score 2.4e-06"
                     /inference="protein motif:Pfam:PF05193"
     CDS             260672..260851
                     /transl_table=11
                     /locus_tag="PAU_00238"
                     /old_locus_tag="PAT2273"
                     /product="Hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00238"
                     /db_xref="EnsemblGenomes-Tr:CAQ82331"
                     /db_xref="UniProtKB/TrEMBL:C7BHG3"
                     /inference="similar to DNA sequence:INSD:CP000250"
                     /protein_id="CAQ82331.1"
                     /translation="MVFSVFISKGILDYAEYHHARQADTTQYCVRGGLYRINMVIARS
                     PAYFKQENGELKKSN"
     CDS             complement(260843..261733)
                     /transl_table=11
                     /gene="ybjE"
                     /locus_tag="PAU_00239"
                     /old_locus_tag="PAT2274"
                     /product="putative membrane protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00239"
                     /db_xref="EnsemblGenomes-Tr:CAQ82332"
                     /db_xref="GOA:C7BHG4"
                     /db_xref="InterPro:IPR005642"
                     /db_xref="UniProtKB/TrEMBL:C7BHG4"
                     /inference="similar to DNA sequence:INSD:AE014613"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82332.1"
                     /translation="MKESITSILIICFLLALGFFLGKLIKENIKAKLVGSITMIVMLL
                     LFMMGIELGEVFINSNLGTSIIIESIVLSSLISISTFLILFKRKFCQIEKKEKQSFLD
                     PFIGCFKAIMFFCLGVLVYKFTHLSLAEHNISSNYALYTLILLVGLDLVNFSFKDIKI
                     NHIKIPIFTIAGTVIGALIFSMLTDYSISESMLISSGYGWFSLSGPMVTSMTNPHYGS
                     LSFMTDLFREIFSIFFLYFLGRSYPQGAIGISGAAALDSALPFIKENCTNEDIKYAIA
                     SGFVLTLLAPLFISVFVGLV"
     misc_feature    complement(order(260849..260917,261020..261088,
                     261182..261250,261269..261328,261371..261424,
                     261482..261541,261584..261637,261671..261724))
                     /note="8 probable transmembrane helices predicted for
                     PAT2274 by TMHMM2.0 at aa 4-21, 33-50, 65-84, 104-121,
                     136-155, 162-184, 216-238 and 273-295"
     misc_feature    complement(260852..261412)
                     /note="HMMPfam hit to PF03956, Membrane protein of unknown
                     function (DUF340, score 1.5e-34"
                     /inference="protein motif:Pfam:PF03956"
     CDS             complement(261733..262491)
                     /transl_table=11
                     /locus_tag="PAU_00240"
                     /old_locus_tag="PAT2275"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00240"
                     /db_xref="EnsemblGenomes-Tr:CAQ82333"
                     /db_xref="InterPro:IPR018724"
                     /db_xref="UniProtKB/TrEMBL:C7BHG5"
                     /inference="similar to DNA sequence:INSD:BX571865"
                     /inference="similar to DNA sequence:INSD:BX571966"
                     /protein_id="CAQ82333.1"
                     /translation="MQNNNLKSEGFSHYQLNLEYSEKDKSNLLNEFSKLEPDAYAPDK
                     VSRFRRYGNAIIIPWLKEPKLYWLPTVKDDNGNNLSGYDQGSNNPEHKNMRYFSALSD
                     EVKNNALLESIILDDFKSTFGLNDHYLPIYVGIHFVKVKCTDNKLPGFSSPDCFHQDG
                     EPFTFAHLINRSENIDGGINYIGKVSARNKKIEDVSDDEIISQFTLENFLESFAVCDE
                     LVSHYISHITLKEDDGEAERSMILIDFSMTKQDI"
     CDS             complement(262904..263110)
                     /transl_table=11
                     /locus_tag="PAU_00241"
                     /old_locus_tag="PAT2276"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00241"
                     /db_xref="EnsemblGenomes-Tr:CAQ82334"
                     /db_xref="GOA:C7BHG6"
                     /db_xref="InterPro:IPR004370"
                     /db_xref="InterPro:IPR014347"
                     /db_xref="InterPro:IPR018191"
                     /db_xref="UniProtKB/TrEMBL:C7BHG6"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE009952"
                     /protein_id="CAQ82334.1"
                     /translation="MPFVNIRITREGATAEQKKQLIEGATQLLVDVLGKNPATTFVII
                     DEVETDNWGIGGQNVTELRAAAKK"
     misc_feature    complement(262925..263107)
                     /note="HMMPfam hit to PF01361, Tautomerase enzyme, score
                     1.9e-23"
                     /inference="protein motif:Pfam:PF01361"
     CDS             complement(263166..264206)
                     /transl_table=11
                     /locus_tag="PAU_00242"
                     /old_locus_tag="PAT2277"
                     /product="similar to putative membrane protein yhjd of
                     escherichia coli"
                     /db_xref="EnsemblGenomes-Gn:PAU_00242"
                     /db_xref="EnsemblGenomes-Tr:CAQ82335"
                     /db_xref="GOA:C7BHG7"
                     /db_xref="InterPro:IPR005274"
                     /db_xref="InterPro:IPR017039"
                     /db_xref="UniProtKB/TrEMBL:C7BHG7"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE009952"
                     /protein_id="CAQ82335.1"
                     /translation="MRSLIFIQSNYLRLYMPKDAERQEIAEHQPERLSRTPLEKGIHH
                     GKTAISLTVRIGNYIRNIPVVAHFIRATLRFNDRMGNQFGAAITYFSFLSLIPILMLS
                     FAIAGFILASNPDLLAKLINGIANSISDPTLANTLKNSVDTAIKQRTTVGLTGLAIAL
                     YSGVNWVSNLRQAILAQFHPVWLRNQEDEKKIYFKYIRDAISLIGLLLALVITLSLTS
                     IAGSAQAIIVEILGLSGIEWLRPSWFLIGLAISIIANYLLFLWLFWVLPHHQPERKAL
                     LKGTLMAAIGFEVIKYIMTMTLPRLASSPSGAAFGSVIGLMTFFYLFARLTLFCAAWI
                     ATADNNQDKNTE"
     misc_feature    263183..356111
                     /note="Region 10"
     misc_feature    complement(263184..263981)
                     /note="HMMPfam hit to PF03631, Ribonuclease BN-like
                     family, score 2.6e-26"
                     /inference="protein motif:Pfam:PF03631"
     misc_feature    complement(order(263202..263270,263313..263381,
                     263415..263483,263541..263609,263703..263762,
                     263874..263942))
                     /note="6 probable transmembrane helices predicted for
                     PAT2277 by TMHMM2.0 at aa 89-111, 149-168, 200-222,
                     242-264, 276-298 and 313-335"
     CDS             264417..264758
                     /transl_table=11
                     /locus_tag="PAU_00243"
                     /old_locus_tag="PAT2278"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00243"
                     /db_xref="EnsemblGenomes-Tr:CAQ82336"
                     /db_xref="UniProtKB/TrEMBL:B6VM43"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82336.1"
                     /translation="MQWRSRFNGRIILMSVTMLSLSISAIAAGPDCSDINGWATQLTA
                     NSLNDFGIDRHNIDFDKTQTSLILSEKLNKSEVAIILQREIAKAERGKVLNDKHEFDD
                     IYLSQPIYRQM"
     sig_peptide     264417..264497
                     /locus_tag="PAU_00243"
                     /note="Signal peptide predicted for PAT2278 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.985 between residues 27 and 28"
     misc_feature    264435..264503
                     /note="1 probable transmembrane helix predicted for
                     PAT2278 by TMHMM2.0 at aa 7-29"
     CDS             264816..265136
                     /transl_table=11
                     /locus_tag="PAU_00244"
                     /old_locus_tag="PAT2279"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00244"
                     /db_xref="EnsemblGenomes-Tr:CAQ82337"
                     /db_xref="UniProtKB/TrEMBL:B6VM44"
                     /inference="similar to DNA sequence:INSD:U70214"
                     /inference="similar to DNA sequence:INSD:BX571871"
                     /protein_id="CAQ82337.1"
                     /translation="MMNVLLVYTLHPSSCCFVGCFHSPQSHSYLCSWGFVYLPPRCNS
                     KFIGYREYLPNFKGNKKILMLALFKNHLHQGGLLSYDLIYKIFVLDGQLLKMVCLAHL
                     LKRI"
     CDS             complement(265201..269643)
                     /transl_table=11
                     /gene="hylA"
                     /gene_synonym="phlA"
                     /locus_tag="PAU_00245"
                     /old_locus_tag="PAT2280"
                     /product="hemolysin phla protein"
                     /note="hemolysin phla protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00245"
                     /db_xref="EnsemblGenomes-Tr:CAQ82338"
                     /db_xref="InterPro:IPR008638"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="InterPro:IPR012334"
                     /db_xref="InterPro:IPR025157"
                     /db_xref="UniProtKB/TrEMBL:B6VM45"
                     /inference="similar to DNA sequence:INSD:AE009952"
                     /inference="similar to DNA sequence:INSD:AL662784"
                     /protein_id="CAQ82338.1"
                     /translation="MKNKKFKLSPTGKLAASMAIILVSCSTSFANDIVGGGDSAHRPD
                     ILAIEGKATVINIVPPSPSGLSHNQYLDYNVGHAGAVLNNALQDGQSQLAGQLAANPN
                     LNGQAASLILNEVISRNPSLLLGQQEVFGIAADYVLANPNGITCNGCGFINTNQASLV
                     VGNPLVEQGNLQSFNTFNNQNGLKIKSDGLTANAVLNLIAPKIDNRGTVTAQKQINAI
                     SGANKISATRDVIDSQQELTGVLDSYYLGSMQAGRIHLLNTAKGSGVNLQGSLTASNE
                     IIVDAHGNLNLEAAHLQGGNIDLLGDNIEVKGKVSESKYNRDGSNNYQSYFRSVYTND
                     SKNSQSITRTKLAGKNISLVANNNHQITATDIVGDDVNLSGANLTLDGQQLNQSTKNI
                     DNQRGYSWRYEVTKESEKQHQAGNNIQAKKNVVLNATEGDVKILGSKIDAKDKLAITA
                     KKGVQIAGLTETEKTSETGYKKNHTAKLQTGSWEESKQTQRLIASELQAGTDLNIKAG
                     TQADILGAKVHAGQNMTVTAGQQLQIDVQKISDNRIVRDDKKYWGGIGGGGNKDNSEL
                     KETSHASELTANGRLLLSGQEGISITGSKVKADQGAFVDANSGKLTIDNAVSHLNQKI
                     DERTGTVFNITNSSQKTNSKQQKSHGSELVSEADLKLLGDEDFNIIGSQVKSAGALNL
                     KTAGNIKVLSYGEQQQVDKQNTSLDLQSHFQPKADKQYRAGVGIEHTSNSQKNQTVIQ
                     KASTLSGGSITLDTDKDVILTGSNLVTTKGDAKISGANVHLLAAEGKKSEEKFQSNKH
                     VGVYLTGGIDKVGSGIYGGYEGNNSNHTNSTAVVSGSQIAGDLNIKANGELIQEGTDH
                     KVSGTYTAEAGKVSNLATSNTESHSNNKLQVGTDIGVNIDYSAVTRPVEKAVKDPVKA
                     ALDGTFTKKGTPNLGADLAANGNNIQTEDKKSEAVVTSVQASNVVIKTNGELYDQGTQ
                     YHANKGNVTLEAGNHTSEAAQNRHESRHNETSGKADLRVYTTTGEDISANGKGKGGTQ
                     SSYTATTQSVTSKITAENDINIRVDRDAEYQGTSLDAKTGKTNIDAGGDIRFDHAANS
                     TTKTSTGYHGEASAKGGNSPEGKNIHIGLGGGYNTDSKNSSTAQVSKIDGQQGVNLNA
                     GNHLTLKGSEVTGKQIDLKAKQGNVELVSAQDRVNNDGWEFNLKGNGGHSNSVKKAED
                     DSTTTTTKQSFGGELKAGVDRLQATTHHNSHIKGENVVINSGGDTTISGARIDADQVT
                     GNIGGDLRVESRKDTEHGLNVGVDAGLNYAKESKVKSDDLPKDEATKDSPPQDDSSKD
                     DILKDDPTKNPTEEPQQKGLQERLTSAFNTINNLKGINGVTGKFKGNVDIKDRESVSE
                     QSVISGNQGVNLDVKGNTHLVGGQIGSEKGNVILNTQNVEQQSVTGYDNGKGGNIALP
                     DSVSGIVKAVQEGVLSGKIPLVKTYSNETENGMTNGEIINHKSQ"
     misc_feature    complement(268777..268995)
                     /note="HMMPfam hit to PF05594, Haemagluttinin repeat,
                     score 2.7e-05"
                     /inference="protein motif:Pfam:PF05594"
     misc_feature    complement(269137..269544)
                     /note="HMMPfam hit to PF05860, haemagglutination activity
                     domain, score 9.3e-43"
                     /inference="protein motif:Pfam:PF05860"
     sig_peptide     complement(269554..269643)
                     /gene="hylA"
                     /locus_tag="PAU_00245"
                     /note="Signal peptide predicted for PAT2280 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.999 between residues 30 and 31"
     CDS             complement(269705..271372)
                     /transl_table=11
                     /gene="phlB"
                     /locus_tag="PAU_00246"
                     /old_locus_tag="PAT2281"
                     /product="phla hemolysin secretion/activation protein
                     phlb"
                     /note="phla hemolysin secretion/activation protein phlb"
                     /db_xref="EnsemblGenomes-Gn:PAU_00246"
                     /db_xref="EnsemblGenomes-Tr:CAQ82339"
                     /db_xref="GOA:B6VM46"
                     /db_xref="InterPro:IPR005565"
                     /db_xref="InterPro:IPR013686"
                     /db_xref="InterPro:IPR027282"
                     /db_xref="InterPro:IPR034746"
                     /db_xref="UniProtKB/TrEMBL:B6VM46"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to AA sequence:UniProt:Q0WAT7"
                     /protein_id="CAQ82339.1"
                     /translation="MIKRISILILWCISSQITASPAEINDILPMTEARRTLQESSREI
                     NQLIEQRRYQQLKQQANTVPESTPAPVLPESRQCLPLTGVYLKGVSLLSVRDLNTLSA
                     LSPECISSHDINRLSHELTRLYISKGYVTARIQFIAPDADGELGLNVVEGFIEKIEGG
                     DRWVNSNMLFPSLEKQPLNITQLDQGLDQANRLQSNKTTLDILPGTVNGGSIIKLHNQ
                     HSKPWLLNVTTDNYGQKSTGKWLARTNASFDSPLGLSDFISLNASSTLDSPSNRYSRA
                     ATLLYSVPYGAATFSGFGSYSQYASHPYLQNKTVKIYGNTQQFGMRSDFAFYRNQSQI
                     NTVSGQLIYKNYNNYINESKIGVSSQTLSVFELGVNHLQIIPTGLITLNLSVEQGLPW
                     FGAQTSTTDLDKQFTKGKLMVNLHQRFMLFNSLYQLNNLLYGQYNRSGLPGVEWLNIT
                     DRNAVRGFSKNTLSGDNGWYLQNTLSRTFPIANSTLSMRIGIDVGQIHGYRSPLGWQS
                     SAGISTGATLKYQRMVFDIEASRGKWLSNHKAVDEPVQVLTRFSYTF"
     misc_feature    complement(269708..270895)
                     /note="HMMPfam hit to PF03865, Haemolysin
                     secretion/activation protein ShlB, score 1.8e-228"
                     /inference="protein motif:Pfam:PF03865"
     misc_feature    complement(270917..271138)
                     /note="HMMPfam hit to PF08479, POTRA domain, ShlB-type,
                     score 1.2e-24"
                     /inference="protein motif:Pfam:PF08479"
     sig_peptide     complement(271316..271372)
                     /gene="phlB"
                     /locus_tag="PAU_00246"
                     /note="Signal peptide predicted for PAT2281 by SignalP 2.0
                     HMM (Signal peptide probability 0.996) with cleavage site
                     probability 0.949 between residues 19 and 20"
     CDS             complement(272071..272667)
                     /transl_table=11
                     /locus_tag="PAU_00247"
                     /old_locus_tag="PAT2282"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00247"
                     /db_xref="EnsemblGenomes-Tr:CAQ82340"
                     /db_xref="InterPro:IPR021087"
                     /db_xref="UniProtKB/TrEMBL:B6VM47"
                     /inference="similar to DNA sequence:INSD:AF021840"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /protein_id="CAQ82340.1"
                     /translation="MSDIIQNRYDSVDGRVVTAEVIFVISVEDILAYLHNHQIDPKLY
                     LDSTNPYRLNSGVYIISYTPTLGVHGMHASCSSGEHIKVPVGSNIRWRATTISDNFNY
                     TVVLYKFYKLHSSGDDIISPPSKIWSHTSSKIIPALLSGVNANEDSPKLEFTETNDHF
                     FQATALTKGKEQYTWAFCVYDGEDLQGYFKYDPYIKVI"
     CDS             complement(273422..273994)
                     /transl_table=11
                     /locus_tag="PAU_00248"
                     /old_locus_tag="PAT2283"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00248"
                     /db_xref="EnsemblGenomes-Tr:CAQ82341"
                     /db_xref="InterPro:IPR021087"
                     /db_xref="UniProtKB/TrEMBL:B6VM48"
                     /inference="similar to DNA sequence:INSD:BX950851"
                     /inference="similar to DNA sequence:INSD:AF021840"
                     /protein_id="CAQ82341.1"
                     /translation="MNSIEYIPSEDRSFKPIDVIVCVDAQTIEDDITAGKLKLSKTQN
                     SPTGISNKYFYYITSQNQLYAPKNNATGELEITDKVGGIVRWRASSLSTQFDYQVFLY
                     HMTGSGVNTYISLPTLIETDFNIVVPEQKGTGLPNHIYPVTFKPRRVYHQQSTLLSPG
                     RAQYTWYISIYNRWNNLIGYCTHDPFINII"
     CDS             complement(274025..274546)
                     /transl_table=11
                     /locus_tag="PAU_00249"
                     /old_locus_tag="PAT2284"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00249"
                     /db_xref="EnsemblGenomes-Tr:CAQ82342"
                     /db_xref="InterPro:IPR021087"
                     /db_xref="UniProtKB/TrEMBL:B6VM49"
                     /inference="similar to DNA sequence:INSD:CP000380"
                     /inference="similar to DNA sequence:INSD:AF021840"
                     /protein_id="CAQ82342.1"
                     /translation="MSEGIDIMVCVDANAIVQRYNLSKRSDLPTKLDKNNKYLYYITG
                     NGNIYAPGNNATAWTAVKVDSGSVIRWRPSSLSQQFEYTVLLYEMKGDAISKGIIDSP
                     SMYSGDITIPYLAFDNEETISTIYKQDNVRQYYHQSTAENKGKGSCNWSMMIYRRESL
                     MGYISHEFSIEIM"
     CDS             complement(275214..275765)
                     /transl_table=11
                     /locus_tag="PAU_00250"
                     /old_locus_tag="PAT2285"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00250"
                     /db_xref="EnsemblGenomes-Tr:CAQ82343"
                     /db_xref="InterPro:IPR021087"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:B6VM50"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AF021840"
                     /protein_id="CAQ82343.1"
                     /translation="MNDKTSFRKINSIDILVAVDVKSIANDIGKINSKLSQDCKKPTP
                     IDDKYFYYITTQDQQYTPKDNATGKTIITGKVGDSIRWRATSLSAQNNHQVFLYHMKA
                     LSNATYTSSPIINKLSSDIYFSKETINPKTVCTPFTAMYISYLETTLLSPGDVQYISY
                     ISIYDNNNSLIGYCSHDPLIHII"
     CDS             complement(275802..276317)
                     /transl_table=11
                     /locus_tag="PAU_00251"
                     /old_locus_tag="PAT2286"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00251"
                     /db_xref="EnsemblGenomes-Tr:CAQ82344"
                     /db_xref="InterPro:IPR021087"
                     /db_xref="UniProtKB/TrEMBL:B6VM51"
                     /inference="similar to DNA sequence:INSD:CP000150"
                     /inference="similar to DNA sequence:INSD:AF021840"
                     /protein_id="CAQ82344.1"
                     /translation="MSEIVDVLVCVDVNSIIKEYSSLSNTPNSPTKIDNKFIRHITSN
                     SNTYLPEKNATGELKIKINIGDTIKLRVMSLTQQFEYGIYPHKIVMLPEKKVTLNASD
                     NYSYTLYLDKSEDSSDICGKYENQQTVDNYIEWKSQTRGQISFYCVLYIYNVKMKLNK
                     YIFYDTKINVL"
     CDS             276798..277526
                     /transl_table=11
                     /gene="sdiA1"
                     /locus_tag="PAU_00252"
                     /old_locus_tag="PAT2287"
                     /product="similar to probable transcription regulator SdiA
                     of Escherichia coli"
                     /db_xref="EnsemblGenomes-Gn:PAU_00252"
                     /db_xref="EnsemblGenomes-Tr:CAQ82345"
                     /db_xref="GOA:B6VM52"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR005143"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="UniProtKB/TrEMBL:B6VM52"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:AE005174"
                     /protein_id="CAQ82345.1"
                     /translation="MNIYRPYISPYKFHELDVDAYFIDEICELIDKISGFRLFSLVLK
                     TRFPVSGREVYFFDNYHESWRALYIEKKYWMIDPVLHFRPVPPTFSRVWDLNFFAESN
                     GKELWYMTQEHGFRSGVTFGLPAFSGTYGIFSVAGKDGPIDNDTMYKCSGEILKVYIR
                     IIRYLISHTKYLQTFYIDEISFSHRELEVLRYTADGMISSEIASTICVTKSTVDFHLM
                     NIVKKLGCRNKFQAIAKAALLGYI"
     misc_feature    276861..277301
                     /note="HMMPfam hit to PF03472, Autoinducer binding domain,
                     score 2.8e-05"
                     /inference="protein motif:Pfam:PF03472"
     misc_feature    277332..277505
                     /note="HMMSmart hit to SM00421, no description, score
                     4.8e-16"
                     /inference="protein motif:Smart:SM00421"
     CDS             277591..277824
                     /transl_table=11
                     /locus_tag="PAU_00253"
                     /old_locus_tag="PAT2288"
                     /product="hypothetical transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00253"
                     /db_xref="EnsemblGenomes-Tr:CAQ82346"
                     /db_xref="GOA:B6VM53"
                     /db_xref="UniProtKB/TrEMBL:B6VM53"
                     /inference="similar to DNA sequence:INSD:BX571863"
                     /inference="similar to DNA sequence:INSD:CP000243"
                     /protein_id="CAQ82346.1"
                     /translation="MIFFKIEKLVQSNTLLLGQNCNITVLLVLYSMFVIDIELYFIPV
                     IFQVASLLAALTHPGHRVIYAPGDSLPGRRDAS"
     misc_feature    order(277627..277695,277705..277758)
                     /note="2 probable transmembrane helices predicted for
                     PAT2288 by TMHMM2.0 at aa 13-35 and 39-56"
     CDS             complement(277912..278502)
                     /transl_table=11
                     /locus_tag="PAU_00254"
                     /old_locus_tag="PAT2289"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00254"
                     /db_xref="EnsemblGenomes-Tr:CAQ82347"
                     /db_xref="InterPro:IPR021087"
                     /db_xref="UniProtKB/TrEMBL:B6VM54"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:BX950851"
                     /protein_id="CAQ82347.1"
                     /translation="MMNEIIQGKDNITARNSVTADVTFVIDVDSIIEYLHTNNIKNSL
                     DPKNPITIRQHVYIANYTPELGLKVASSSGARVTVPINANIRWRATTVSNNFDYTIIL
                     YKFKKLSTGEDVISVPSQIWSQNPIGKKVPMVPSGVNADKDEPTVIFIESKDSYFQAT
                     AHKPGVEQYTWFFAAYDGTKLLGYYRYDPYVEVTNS"
     CDS             279005..279733
                     /transl_table=11
                     /gene="sdiA2"
                     /locus_tag="PAU_00255"
                     /old_locus_tag="PAT2290"
                     /product="similar to probable transcription regulator SdiA
                     of Escherichia coli"
                     /db_xref="EnsemblGenomes-Gn:PAU_00255"
                     /db_xref="EnsemblGenomes-Tr:CAQ82348"
                     /db_xref="GOA:B6VM55"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR005143"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="UniProtKB/TrEMBL:B6VM55"
                     /inference="similar to DNA sequence:INSD:BX571859"
                     /inference="similar to DNA sequence:INSD:X03691"
                     /protein_id="CAQ82348.1"
                     /translation="MNVYRSYTLPYKFHELDVDAHFVSEVFEIINKISGFSLFSLILK
                     ARFPISNREVYFFNNYHESWRNLYIERKYWMIDPTLNFRPVPPSFSKIWDLDFFSESN
                     GQELWYVSQKHGFRSGITFGLPAFSGTYGIFSVAGKDGHIDNETMYKCSGEILGVYIR
                     IIRYLTSHTKYLQFFYVDETSFSNRELEVLRYTADGMTSSEIALTICVTKSTVDFHLM
                     NIVKKLGCRNKFQAIAKAVLLGYI"
     misc_feature    279059..279505
                     /note="HMMPfam hit to PF03472, Autoinducer binding domain,
                     score 5e-06"
                     /inference="protein motif:Pfam:PF03472"
     misc_feature    279539..279712
                     /note="HMMSmart hit to SM00421, no description, score
                     6.6e-18"
                     /inference="protein motif:Smart:SM00421"
     CDS             complement(279936..280955)
                     /transl_table=11
                     /locus_tag="PAU_00256"
                     /old_locus_tag="PAT2291"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00256"
                     /db_xref="EnsemblGenomes-Tr:CAQ82349"
                     /db_xref="UniProtKB/TrEMBL:B6VM56"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /inference="similar to DNA sequence:INSD:BX571865"
                     /protein_id="CAQ82349.1"
                     /translation="MKLKLLLLLSGVIFMFNAKADDPRLYIRSVFDIQYAFCDIKTNG
                     VTGFSNRNSALEGRGFGTASTGSMLFMVNGENEISLEFGALGWFSSDEMSDKARNHFN
                     PEAKCQLELTAMRGKNSQILTAIEVAIDENGQPVATKSKDEPKYAAISTPVIRHVIQA
                     ESTEAGHIEKQYFDPKEFPPNMTLYRFSRNVKISGLPDWEWIKATPYTDTPEQRRQLQ
                     QAYMAVWQAYHAKDVNTIREQQKVSLKAWAWSTGESEESIFTDQSVYHDIKIKSFKMI
                     PINWDDYRVKIMNQGRMVRLVNKSDLRNSPISYYYVDDEDGETVLATVAPIFSLINGR
                     FVQVI"
     sig_peptide     complement(280896..280955)
                     /locus_tag="PAU_00256"
                     /note="Signal peptide predicted for PAT2291 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.999 between residues 20 and 21"
     CDS             complement(281067..282569)
                     /transl_table=11
                     /locus_tag="PAU_00257"
                     /old_locus_tag="PAT2292"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00257"
                     /db_xref="EnsemblGenomes-Tr:CAQ82350"
                     /db_xref="UniProtKB/TrEMBL:B6VM57"
                     /inference="similar to DNA sequence:INSD:BX571865"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82350.1"
                     /translation="MTKQRISPPAGSACMTCNNPNPCLCEVSVTFEKKTQVWPKKPSI
                     NMNLVDNGKGQIGTIKITEKCDHAKHQAKLHGGPKEKTLKFNTPEKVTLFYKEELKSI
                     DIQNGLKSVASYLSNIANPTDMYKAPRYYKLEIKACTGSRKYATIAVYPSVRFMVSVG
                     FSFNLSYDKRSIKERRDEQIKARQAMENVKPKNGNKLRKGWTTRTDEFSLTRETKLKV
                     EYALTVQDKDYSTSFINTKQAKETRKDLDAISLAEKLLGYTKKYLVPAPGSKGKASQN
                     YELLNLKLTPSNIGLAYAYDRTTSVEDSTHFVGFYAAPLMGMTAKLDLIQLGATYCKI
                     EFLAAKFRQALERKNANDKNYLELECCLIVTCDLSFQLGAAYKSKQWTFDAGNKNNLK
                     LSLEGKVSAAFKQKILIVEIALNAKGTIKTAAGFQFDQHNKGIDLVGYHNGITAEIEL
                     SADAEIGRKKKASKKAKNKWTWVIADPLKASESPLRINVLGKERPITVQK"
     CDS             complement(282670..283041)
                     /transl_table=11
                     /locus_tag="PAU_00258"
                     /old_locus_tag="PAT2293"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00258"
                     /db_xref="EnsemblGenomes-Tr:CAQ82351"
                     /db_xref="UniProtKB/TrEMBL:B6VM58"
                     /inference="similar to DNA sequence:INSD:BX571865"
                     /protein_id="CAQ82351.1"
                     /translation="MLKITQEQYAHFNHLFEQRYINKLTHFINEVSYYHEADAINILH
                     SVLSALSDKILINSLPNISAAPSHINEEALIRHQNLAEACFYFCQDNEITDERYIRGF
                     RYLLMERRIEQFQHIPSTWLT"
     CDS             complement(283292..284311)
                     /transl_table=11
                     /locus_tag="PAU_00259"
                     /old_locus_tag="PAT2294"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00259"
                     /db_xref="EnsemblGenomes-Tr:CAQ82352"
                     /db_xref="UniProtKB/TrEMBL:B6VM59"
                     /inference="similar to DNA sequence:INSD:BX571865"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82352.1"
                     /translation="MKLKLLLLLSGVLVMSSANADEPRLYIRSVFDIQYAFCDIKTNG
                     VTGFSNRNSALGGRGFGTGSTGSMLLMANGENEISLEFGALSWFSQDKLSDKARNHFN
                     PEAKCQLELTAMRGKNNQTLTAIEVTIDENGQPVATKSKDEPKYATISTPVIRHVIQA
                     DNVEAGHIEKQYFDPTEYPPNMTLYRFSRNVKISGLPDWEWIKATPYTDTPEQRQQLQ
                     QAYMAVWQAYNAKDVNTIREQQKVALQAWAWSTGENEESIFTDQSVYSNIKTKSFRMI
                     PINWNDYSVQIMNRGKMVKLVNKSILEYSPISYHYVDDEDGETVLSTISPIFSLINGR
                     FVQVI"
     sig_peptide     complement(284252..284311)
                     /locus_tag="PAU_00259"
                     /note="Signal peptide predicted for PAT2294 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.999 between residues 20 and 21"
     CDS             complement(284325..285923)
                     /transl_table=11
                     /locus_tag="PAU_00260"
                     /old_locus_tag="PAT2295"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00260"
                     /db_xref="EnsemblGenomes-Tr:CAQ82353"
                     /db_xref="UniProtKB/TrEMBL:B6VM60"
                     /inference="similar to DNA sequence:INSD:BX571865"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82353.1"
                     /translation="MTQQSTSPPAGAACMTCNNPDPCLCEISVTFEKKTQVWPKKPSI
                     NMNLVDDGKGQTGTIQIAEKCDHTKHQAVLLGGPKEKTLKFNTPEKVTLFYKEHLEDT
                     DIESSLESIVSYLSNIANPSDMYKAPRYYKLVTEACTGRQKYVTIAVYPSVRFMVSVG
                     FGFDFSHGERPIKERRDEQRKARRAMENVKPKDGNKLRGGWTVHTDKFYLTRETTLSV
                     EYALTVQDMDYSNKFAKANKVRKTRESLDAINRVEKLLGYTKKYLAPAPDSKGKGTHD
                     YQLFDLKIAPINIGLAYAYDRTASVDDSTHFVGFSAAPFMGMTAKLDLIQMGAAYCKI
                     DTIAAKFRKAIERKNANDKNYLEIECCLILTCNLSFQLGAAYKSKQWTFDAGDKNDLK
                     LSLEGKINAAFKTKIMIMEVALNAKGAVKTAAGFKFDQHDKGIDLVGYHDGITAEIEV
                     EADIEADGKENSIAKVKKKWVIADPLKASESPLRISLLGEQRPITRPETVPGAETTPW
                     EMGYNPKPKLDNIPFINSGFPGMR"
     CDS             complement(285946..286872)
                     /transl_table=11
                     /locus_tag="PAU_00261"
                     /old_locus_tag="PAT2296"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00261"
                     /db_xref="EnsemblGenomes-Tr:CAQ82354"
                     /db_xref="InterPro:IPR025391"
                     /db_xref="UniProtKB/TrEMBL:B6VM61"
                     /inference="similar to DNA sequence:INSD:BX571865"
                     /inference="similar to DNA sequence:INSD:AE014075"
                     /protein_id="CAQ82354.1"
                     /translation="MAEEKHYAVIDGAAEPRLFFILEHFDPPVTCLYDESLQPELLKV
                     APYLVEVTEKVGLFLAEWETPWGIFLHSQADMRTLRQHLRKYLQVLLPDQAKPVFFRF
                     YDPRNIWDFLSVLSDWEIHCFLGPIDNIATNYAGIDRQDNFHTARKPFPAEARSRQKM
                     LKITQEQYAHFNHLFEQRYINKLTHFINEVSYYHEADAMNMPHSVLSALSDKILINPL
                     PDISSAPSHINEEALIRHQNLAEACFYFCQDNEITDERSIRGFLYLLMERRIDQFQHI
                     PSTWLAQLRDNQGPGYYRMEKLLTSELGFIPK"
     CDS             complement(286872..288842)
                     /transl_table=11
                     /locus_tag="PAU_00262"
                     /old_locus_tag="PAT2297"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00262"
                     /db_xref="EnsemblGenomes-Tr:CAQ82355"
                     /db_xref="InterPro:IPR006531"
                     /db_xref="InterPro:IPR006533"
                     /db_xref="InterPro:IPR017847"
                     /db_xref="UniProtKB/TrEMBL:B6VM62"
                     /inference="similar to DNA sequence:INSD:BX571865"
                     /inference="similar to DNA sequence:INSD:AF044503"
                     /protein_id="CAQ82355.1"
                     /translation="MADSGLVFTLSVGNLPAHTFAVVEFTLNEALSTPFSLDATLTSA
                     DPDIDFKDVLDNAATLSVYRDGLPEREVTGIVTQFEQSTTGRHRTHYSLSLQPALWRA
                     GLRVNSRIFQHQSITDIIDTLLKENGIRDIVYTLGYEHPEREFCVQYDESDLAFLHRL
                     LADEGIFYYFEFNQGKNGQTIFFADSCLALGNRFSVPYNPEPDVLGRQGSIQQFRWRE
                     QVGIQGISLRDRTFKNPPWTAEYHFYESKSANQRTDLTSYYHYDFPGRYKDERGEHMS
                     RYRLEALRRNDLLGHAHSDCFFLWPGLMFTLSHHPKETFNVPWQVISIHHHGRQPQAD
                     ETRSGDTGTTLTNHFTFGDRDRSWRPSPYPKPRIDGLQVATVVGPEGEEIFCDEYGRV
                     RVQFAWDQYGQFNDQSSCWIRVSQAWAGKGWGMITIPRVGQEVLVDFLHGDPDQPIIT
                     GRAYHASNLPPNRLPMAKTQMSIRSKTHKGEGFNELRFEDEKDREEVFIHAQKNLAIQ
                     VRNSRDERINYNRTTSIGHDDELVIAHNRKVTVEGQQEHKTTGNYLAQIDGDKALQVK
                     GDVAQKIQGIFSVDANGDLTVQSGSKISLRVGGNFIVIHAGGVDIKGPAINLNSGGSP
                     GDLLQPANPAILQAAASAGSMFVAHCPMKDNQ"
     CDS             complement(289015..289284)
                     /transl_table=11
                     /locus_tag="PAU_00263"
                     /old_locus_tag="PAT2298"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:PAU_00263"
                     /db_xref="EnsemblGenomes-Tr:CAQ82356"
                     /db_xref="InterPro:IPR008727"