LOCUS       EU010084                 306 bp    DNA     linear   BCT 22-OCT-2007
DEFINITION  Providencia stuartii strain ATCC 29914 CTP synthetase (pyrG) gene,
            partial cds.
ACCESSION   EU010084
VERSION     EU010084.1
KEYWORDS    .
SOURCE      Providencia stuartii
  ORGANISM  Providencia stuartii
            Bacteria; Pseudomonadota; Gammaproteobacteria; Enterobacterales;
            Morganellaceae; Providencia.
REFERENCE   1  (bases 1 to 306)
  AUTHORS   Salerno,A., Deletoile,A., Lefevre,M., Ciznar,I., Krovacek,K.,
            Grimont,P. and Brisse,S.
  TITLE     Recombining population structure of Plesiomonas shigelloides
            (Enterobacteriaceae) revealed by multilocus sequence typing
  JOURNAL   J. Bacteriol. 189 (21), 7808-7818 (2007)
   PUBMED   17693512
REFERENCE   2  (bases 1 to 306)
  AUTHORS   Salerno,A., Deletoile,A., Lefevre,M., Ciznar,I., Krovacek,K.,
            Grimont,P.A.D. and Brisse,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUL-2007) Unite Biodiversite des Bacteries Pathogenes
            Emergentes, Institut Pasteur, 28 rue du Docteur Roux, Paris 75015,
            France
FEATURES             Location/Qualifiers
     source          1..306
                     /organism="Providencia stuartii"
                     /mol_type="genomic DNA"
                     /strain="ATCC 29914"
                     /type_material="type strain of Providencia stuartii"
                     /db_xref="ATCC:29914"
                     /db_xref="taxon:588"
                     /note="type strain of Providencia stuartii"
     gene            <1..>306
                     /gene="pyrG"
     CDS             <1..>306
                     /gene="pyrG"
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthetase"
                     /protein_id="ABS43081.1"
                     /translation="ILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDL
                     DLGHYERFIRTKMTRRNNFTTGRVYSEVLRKERRGDYLGATIQVIPHITNEIKDRIIR
                     "
BASE COUNT           91 a           76 c           67 g           72 t
ORIGIN      
        1 atactcgaag cccgtggact caatgtcacc attatgaaac tggatccgta catcaacgtt
       61 gatccaggga caatgagccc aacccaacac ggggaagttt tcgttacaga agacggcgct
      121 gaaactgact tggatttagg tcattatgag cgtttcatcc gtaccaaaat gacgcgtcgc
      181 aacaacttta caacggggcg cgtttattca gaagtattgc gcaaagaacg tcgcggagac
      241 tatcttggcg cgactatcca agttatccct catattacca atgaaattaa agaccgcatc
      301 atccgt
//