LOCUS EU010084 306 bp DNA linear BCT 22-OCT-2007 DEFINITION Providencia stuartii strain ATCC 29914 CTP synthetase (pyrG) gene, partial cds. ACCESSION EU010084 VERSION EU010084.1 KEYWORDS . SOURCE Providencia stuartii ORGANISM Providencia stuartii Bacteria; Pseudomonadota; Gammaproteobacteria; Enterobacterales; Morganellaceae; Providencia. REFERENCE 1 (bases 1 to 306) AUTHORS Salerno,A., Deletoile,A., Lefevre,M., Ciznar,I., Krovacek,K., Grimont,P. and Brisse,S. TITLE Recombining population structure of Plesiomonas shigelloides (Enterobacteriaceae) revealed by multilocus sequence typing JOURNAL J. Bacteriol. 189 (21), 7808-7818 (2007) PUBMED 17693512 REFERENCE 2 (bases 1 to 306) AUTHORS Salerno,A., Deletoile,A., Lefevre,M., Ciznar,I., Krovacek,K., Grimont,P.A.D. and Brisse,S. TITLE Direct Submission JOURNAL Submitted (02-JUL-2007) Unite Biodiversite des Bacteries Pathogenes Emergentes, Institut Pasteur, 28 rue du Docteur Roux, Paris 75015, France FEATURES Location/Qualifiers source 1..306 /organism="Providencia stuartii" /mol_type="genomic DNA" /strain="ATCC 29914" /type_material="type strain of Providencia stuartii" /db_xref="ATCC:29914" /db_xref="taxon:588" /note="type strain of Providencia stuartii" gene <1..>306 /gene="pyrG" CDS <1..>306 /gene="pyrG" /codon_start=1 /transl_table=11 /product="CTP synthetase" /protein_id="ABS43081.1" /translation="ILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDL DLGHYERFIRTKMTRRNNFTTGRVYSEVLRKERRGDYLGATIQVIPHITNEIKDRIIR " BASE COUNT 91 a 76 c 67 g 72 t ORIGIN 1 atactcgaag cccgtggact caatgtcacc attatgaaac tggatccgta catcaacgtt 61 gatccaggga caatgagccc aacccaacac ggggaagttt tcgttacaga agacggcgct 121 gaaactgact tggatttagg tcattatgag cgtttcatcc gtaccaaaat gacgcgtcgc 181 aacaacttta caacggggcg cgtttattca gaagtattgc gcaaagaacg tcgcggagac 241 tatcttggcg cgactatcca agttatccct catattacca atgaaattaa agaccgcatc 301 atccgt //