LOCUS EU009864 327 bp cRNA linear VRL 26-JUL-2016 DEFINITION Mumps virus strain MuV/S10150/Irl05 small hydrophobic protein and hemagglutinin-neuramidase genes, partial cds. ACCESSION EU009864 VERSION EU009864.1 KEYWORDS . SOURCE Mumps orthorubulavirus ORGANISM Mumps orthorubulavirus Viruses; Riboviria; Orthornavirae; Negarnaviricota; Haploviricotina; Monjiviricetes; Mononegavirales; Paramyxoviridae; Rubulavirinae; Orthorubulavirus; Orthorubulavirus parotitidis. REFERENCE 1 (bases 1 to 327) AUTHORS Reid,F., Hassan,J., Irwin,F., Waters,A., Hall,W. and Connell,J. TITLE Epidemiologic and diagnostic evaluation of a recent mumps outbreak using oral fluid samples JOURNAL J. Clin. Virol. 41 (2), 134-137 (2008) PUBMED 18354822 REFERENCE 2 (bases 1 to 327) AUTHORS Reid,F., Hassan,J., Waters,A., Hall,W. and Connell,J. TITLE Direct Submission JOURNAL Submitted (02-JUL-2007) School of Medicine and Medical Sciences, National Virus Reference Laboratory and Centre for Research in Infectious Diseases, University College-Dublin, Belfield, Dublin D4, Ireland FEATURES Location/Qualifiers source 1..327 /organism="Mumps orthorubulavirus" /mol_type="viral cRNA" /strain="MuV/S10150/Irl05" /db_xref="taxon:2560602" /country="Ireland" /collection_date="2005" /note="genotype: J" CDS <1..61 /note="SH" /codon_start=2 /product="small hydrophobic protein" /protein_id="ABV45450.1" /translation="QHAALYQRSLFRWSFDHSF" CDS 234..>327 /codon_start=1 /product="hemagglutinin-neuramidase" /protein_id="ABV45451.1" /translation="MEPSKLFTISDDATFAPGPVINAADKKTFRT" BASE COUNT 108 a 88 c 60 g 71 t ORIGIN 1 acaacatgca gcgctgtacc agagatcctt atttcgctgg agtttcgatc actcattcta 61 gatagatctc catttaggac aagtcccaat ccatcatacg agaacaagct gcatttgaat 121 gatgccgtcc aatcatgaga tataaagaaa aaagcaagcc agaacaaact taagatcaca 181 atacaacaca gaaccccagc tgctatcaca accgtgctcc ggccgctcaa aagatggagc 241 cctcgaaact attcacaata tcggatgatg ccacctttgc acctgggcct gttatcaatg 301 cggctgacaa gaagacattc cgaacct //