LOCUS D83674 1163 bp mRNA linear ROD 27-DEC-2006 DEFINITION Mus musculus mRNA for MesP1, complete cds. ACCESSION D83674 VERSION D83674.1 KEYWORDS basic helix-loop-helix protein. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1163) AUTHORS Saga,Y. TITLE Direct Submission JOURNAL Submitted (29-FEB-1996) to the DDBJ/EMBL/GenBank databases. Contact:Yumiko Saga Banyu Tsukuba Research Institute, Molecular Medicine; Okubo 3, Tsukuba, Ibaraki 300-33, Japan REFERENCE 2 AUTHORS Saga,Y., Hata,N., Kobayashi,S., Magnuson,T., Seldin,M.F. and Taketo,M.M. TITLE MesP1: A novel basic helix-loop-helix ptrotein expressed in the nascent mesodermal cells during mouse gastrulation JOURNAL Unpublished (1996) REFERENCE 3 AUTHORS Saga,Y., Hata,N., Kobayashi,S., Magnuson,T., Seldin,M.F. and Taketo,M.M. TITLE MesP1: a novel basic helix-loop-helix protein expressed in the nascent mesodermal cells during mouse gastrulation JOURNAL Development 122, 2769-2778 (1996) COMMENT FEATURES Location/Qualifiers source 1..1163 /chromosome="7" /db_xref="taxon:10090" /dev_stage="7.5 dpc" /map="Fes region" /mol_type="mRNA" /note="Common name: Mouse" /organism="Mus musculus" /strain="ICR" CDS 127..858 /codon_start=1 /gene="Mesp1" /product="MesP1" /protein_id="BAA12041.1" /translation="MAQPLCEPRSESWILSPAGRQPPMPSDGNSVCSPAWSSDPWDGA QASSPAPPCARPARRAGTPGRRGTHGSRLGSGQRQSASEREKLRMRTLARALHELRRF LPPSVAPTGQNLTKIETLRLAIRYIGHLSAVLGLSEDNLRRQRHAVSPRGCPLCPDSD LAQSQSLGPGLSPAVCSGVSWGSPPAYPRPRVAAESWDPSFQYAETASQERQEMEPSP SSPLFSSDMLALLETWTPPQEWPPA" regulatory 1117..1122 /regulatory_class="polyA_signal_sequence" BASE COUNT 225 a 379 c 352 g 207 t ORIGIN 1 ctagtggatc ccccgggctg caggaattcg atatcaagct tgatatcgaa ttctggaagg 61 ggcccgcttc acacctaggg ctcaggataa agctacagcg gacccaatgg tcaggcctcc 121 gttgccatgg cccagcccct gtgcgagccg cgctccgagt cctggatcct gagtcccgct 181 ggtcggcagc caccgatgcc ttccgatggg aacagcgtct gctccccagc ctggtcctcg 241 gacccgtggg acggtgccca ggccagcagc cctgcaccac cctgcgcccg cccggcccgg 301 cgtgctggga ccccgggtag gcgcgggacg cacggtagcc gcctgggtag cggacagcgg 361 cagagcgcca gcgagcggga gaagctacgt atgcgcacac tcgcccgcgc gctgcacgag 421 ctgcgccgct tcttgccgcc atccgtggca ccaaccggcc agaacctgac caagatcgag 481 acgctgcgcc tggccatccg ctacattggc cacctgtcgg ctgtgctggg actcagcgag 541 gacaacctcc ggcgacagcg gcacgcggtg tcacctcgag gctgcccgct gtgccccgac 601 agcgacctgg cgcagtcgca gtcactcggt cctggtttaa gcccggccgt ctgcagcggg 661 gtgtcgtggg gatccccgcc tgcctaccct agaccccgag tcgccgcaga atcgtgggac 721 ccatcgttcc agtacgcaga aacagcatcc caggaaaggc aggaaatgga gcccagtccc 781 tcatctccgc tcttcagcag cgacatgctg gctcttctag aaacctggac gccgccgcag 841 gagtggccgc ctgcctgaag agtggagggg acaatgcaac ggatgattgt caccctgtct 901 gagcacagac acttttcctt tggtcttggc accttcggag ggagtagatc ctggaagagg 961 cggcagtgat accaacatgg gcatcccggg gtgggagctg gccctcatcc agactgtacc 1021 attccaaccc tccttggaag gaggcgccca atagggtaca cgctctaaag atgaagcagg 1081 cacaagcttt gcctggtgtg tatttattta tttgtgaata aaccgattgt gctagtgtca 1141 aaacctggat agtcgatcca cta //