LOCUS       D83674                  1163 bp    mRNA    linear   ROD 27-DEC-2006
DEFINITION  Mus musculus mRNA for MesP1, complete cds.
ACCESSION   D83674
VERSION     D83674.1
KEYWORDS    basic helix-loop-helix protein.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1163)
  AUTHORS   Saga,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-FEB-1996) to the DDBJ/EMBL/GenBank databases.
            Contact:Yumiko Saga
            Banyu Tsukuba Research Institute, Molecular Medicine; Okubo 3,
            Tsukuba, Ibaraki 300-33, Japan
REFERENCE   2
  AUTHORS   Saga,Y., Hata,N., Kobayashi,S., Magnuson,T., Seldin,M.F. and
            Taketo,M.M.
  TITLE     MesP1: A novel basic helix-loop-helix ptrotein expressed in the
            nascent  mesodermal cells during mouse gastrulation
  JOURNAL   Unpublished (1996)
REFERENCE   3
  AUTHORS   Saga,Y., Hata,N., Kobayashi,S., Magnuson,T., Seldin,M.F. and
            Taketo,M.M.
  TITLE     MesP1: a novel basic helix-loop-helix protein expressed in the
            nascent  mesodermal cells during mouse gastrulation
  JOURNAL   Development 122, 2769-2778 (1996)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..1163
                     /chromosome="7"
                     /db_xref="taxon:10090"
                     /dev_stage="7.5 dpc"
                     /map="Fes region"
                     /mol_type="mRNA"
                     /note="Common name: Mouse"
                     /organism="Mus musculus"
                     /strain="ICR"
     CDS             127..858
                     /codon_start=1
                     /gene="Mesp1"
                     /product="MesP1"
                     /protein_id="BAA12041.1"
                     /translation="MAQPLCEPRSESWILSPAGRQPPMPSDGNSVCSPAWSSDPWDGA
                     QASSPAPPCARPARRAGTPGRRGTHGSRLGSGQRQSASEREKLRMRTLARALHELRRF
                     LPPSVAPTGQNLTKIETLRLAIRYIGHLSAVLGLSEDNLRRQRHAVSPRGCPLCPDSD
                     LAQSQSLGPGLSPAVCSGVSWGSPPAYPRPRVAAESWDPSFQYAETASQERQEMEPSP
                     SSPLFSSDMLALLETWTPPQEWPPA"
     regulatory      1117..1122
                     /regulatory_class="polyA_signal_sequence"
BASE COUNT          225 a          379 c          352 g          207 t
ORIGIN      
        1 ctagtggatc ccccgggctg caggaattcg atatcaagct tgatatcgaa ttctggaagg
       61 ggcccgcttc acacctaggg ctcaggataa agctacagcg gacccaatgg tcaggcctcc
      121 gttgccatgg cccagcccct gtgcgagccg cgctccgagt cctggatcct gagtcccgct
      181 ggtcggcagc caccgatgcc ttccgatggg aacagcgtct gctccccagc ctggtcctcg
      241 gacccgtggg acggtgccca ggccagcagc cctgcaccac cctgcgcccg cccggcccgg
      301 cgtgctggga ccccgggtag gcgcgggacg cacggtagcc gcctgggtag cggacagcgg
      361 cagagcgcca gcgagcggga gaagctacgt atgcgcacac tcgcccgcgc gctgcacgag
      421 ctgcgccgct tcttgccgcc atccgtggca ccaaccggcc agaacctgac caagatcgag
      481 acgctgcgcc tggccatccg ctacattggc cacctgtcgg ctgtgctggg actcagcgag
      541 gacaacctcc ggcgacagcg gcacgcggtg tcacctcgag gctgcccgct gtgccccgac
      601 agcgacctgg cgcagtcgca gtcactcggt cctggtttaa gcccggccgt ctgcagcggg
      661 gtgtcgtggg gatccccgcc tgcctaccct agaccccgag tcgccgcaga atcgtgggac
      721 ccatcgttcc agtacgcaga aacagcatcc caggaaaggc aggaaatgga gcccagtccc
      781 tcatctccgc tcttcagcag cgacatgctg gctcttctag aaacctggac gccgccgcag
      841 gagtggccgc ctgcctgaag agtggagggg acaatgcaac ggatgattgt caccctgtct
      901 gagcacagac acttttcctt tggtcttggc accttcggag ggagtagatc ctggaagagg
      961 cggcagtgat accaacatgg gcatcccggg gtgggagctg gccctcatcc agactgtacc
     1021 attccaaccc tccttggaag gaggcgccca atagggtaca cgctctaaag atgaagcagg
     1081 cacaagcttt gcctggtgtg tatttattta tttgtgaata aaccgattgt gctagtgtca
     1141 aaacctggat agtcgatcca cta
//