LOCUS       HUMDJ1                   822 bp    mRNA    linear   HUM 22-APR-2003
DEFINITION  Homo sapiens mRNA for DJ-1 protein, complete cds.
ACCESSION   D61380
VERSION     D61380.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 822)
  AUTHORS   Ariga,H., Nagakubo,D., Maeda,J., Taira,T. and Iguchi-Ariga,S.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUN-1995) to the DDBJ/EMBL/GenBank databases.
            Contact:Hiroyoshi Ariga
            Hokkaido University, Graduate School of  Pharmaceutical Sciences;
            Kita 12, Nishi 6, Kita-ku, Sapporo, Hokkaido 060-0812, Japan
REFERENCE   2
  AUTHORS   Nagakubo,D., Taita,T., Kitaura,H., Ikeda,M., Tamai,K.,
            Iguchi-Ariga,S.M. and Ariga,H.
  TITLE     DJ-1, a novel oncogene product
  JOURNAL   Biochem. Biophys. Res. Commun. 231, 509-513 (1997)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..822
                     /cell_line="HeLa"
                     /clone="DJ-1"
                     /db_xref="H-InvDB:HIT000101667"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /organism="Homo sapiens"
     5'UTR           1..6
     CDS             7..576
                     /codon_start=1
                     /product="DJ-1 protein"
                     /protein_id="BAA09603.2"
                     /translation="MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPV
                     QCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLI
                     AAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGT
                     SFEFALAIVEALNGKEVAAQVKAPLVLKD"
     3'UTR           577..822
     polyA_signal    780..784
BASE COUNT          247 a          164 c          215 g          196 t
ORIGIN      
        1 ataaaaatgg cttccaaaag agctctggtc atcctggcta aaggagcaga ggaaatggag
       61 acggtcatcc ctgtagatgt catgaggcga gctgggatta aggtcaccgt tgcaggcctg
      121 gctggaaaag acccagtaca gtgtagccgt gatgtggtca tttgtcctga tgccagcctt
      181 gaagatgcaa aaaaagaggg accatatgat gtggtggttc taccaggagg taatctgggc
      241 gcacagaatt tatctgagtc tgctgctgtg aaggagatac tgaaggagca ggaaaaccgg
      301 aagggcctga tagccgccat ctgtgcaggt cctactgctc tgttggctca tgaaataggt
      361 tttggaagta aagttacaac acaccctctt gctaaagaca aaatgatgaa tggaggtcat
      421 tacacctact ctgagaatcg tgtggaaaaa gacggcctga ttcttacaag ccgggggcct
      481 gggaccagct tcgagtttgc gcttgcaatt gttgaagccc tgaatggcaa ggaggtggcg
      541 gctcaagtga aggctccact tgttcttaaa gactagagca gcgaactgcg acgatcactt
      601 agagaaacag gccgttagga atccattctc actgtgttcg ctctaaacaa aacagtggta
      661 ggttaatgtg ttcagaagtc gctgtcctta ctacttttgc ggaagtatgg aagtcacaac
      721 tacacagaga tttctcagcc tacaaattgt gtctatacat ttctaagcct tgtttgcaga
      781 ataaacaggg catttagcaa actaaaaaaa aaaaaaaaaa aa
//