LOCUS CR542053 918 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A0836D for gene PPT1, palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile); complete cds, without stopcodon. ACCESSION CR542053 VERSION CR542053.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 918) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 918) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A0836D, ORFNo 4342 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A0836D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_000310 (GI:4506030) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..918 /db_xref="H-InvDB:HIT000268922" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A0836D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>918 /codon_start=1 /gene="PPT1" /db_xref="GOA:P50897" /db_xref="H-InvDB:HIT000268922.12" /db_xref="HGNC:HGNC:9325" /db_xref="InterPro:IPR002472" /db_xref="InterPro:IPR029058" /db_xref="InterPro:IPR030294" /db_xref="PDB:3GRO" /db_xref="UniProtKB/Swiss-Prot:P50897" /protein_id="CAG46850.1" /translation="MASPGCLWLLAVALLPWTCASRALQHLDPPAPLPLVIWHGMGDS CCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKD PKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHIC DFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKN LMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDN AGQLVFLATEGDHLQLSEEWFYAHIIPFLG" BASE COUNT 232 a 217 c 246 g 223 t ORIGIN 1 atggcgtcgc ccggctgcct gtggctcttg gctgtggctc tcctgccatg gacctgcgct 61 tctcgggcgc tgcagcatct ggacccgccg gcgccgctgc cgttggtgat ctggcatggg 121 atgggagaca gctgttgcaa tcccttaagc atgggtgcta ttaaaaaaat ggtggagaag 181 aaaatacctg gaatttacgt cttatcttta gagattggga agaccctgat ggaggacgtg 241 gagaacagct tcttcttgaa tgtcaattcc caagtaacaa cagtgtgtca ggcacttgct 301 aaggatccta aattgcagca aggctacaat gctatgggat tctcccaggg aggccaattt 361 ctgagggcag tggctcagag atgcccttca cctcccatga tcaatctgat ctcggttggg 421 ggacaacatc aaggtgtttt tggactccct cgatgcccag gagagagctc tcacatctgt 481 gacttcatcc gaaaaacact gaatgctggg gcgtactcca aagttgttca ggaacgcctc 541 gtgcaagccg aatactggca tgaccccata aaggaggatg tgtatcgcaa ccacagcatc 601 ttcttggcag atataaatca ggagcggggt atcaatgagt cctacaagaa aaacctgatg 661 gccctgaaga agtttgtgat ggtgaaattc ctcaatgatt ccattgtgga ccctgtagat 721 tcggagtggt ttggatttta cagaagtggc caagccaagg aaaccattcc cttacaggag 781 acctccctgt acacacagga ccgcctgggg ctaaaggaaa tggacaatgc aggacagcta 841 gtgtttctgg ctacagaagg ggaccatctt cagttgtctg aagaatggtt ttatgcccac 901 atcataccat tccttgga //