LOCUS       CR542053                 918 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834A0836D for
            gene PPT1, palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis,
            neuronal 1, infantile); complete cds, without stopcodon.
ACCESSION   CR542053
VERSION     CR542053.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 918)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 918)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834A0836D, ORFNo 4342
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A0836D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_000310 (GI:4506030)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..918
                     /db_xref="H-InvDB:HIT000268922"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834A0836D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>918
                     /codon_start=1
                     /gene="PPT1"
                     /db_xref="GOA:P50897"
                     /db_xref="H-InvDB:HIT000268922.12"
                     /db_xref="HGNC:HGNC:9325"
                     /db_xref="InterPro:IPR002472"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR030294"
                     /db_xref="PDB:3GRO"
                     /db_xref="UniProtKB/Swiss-Prot:P50897"
                     /protein_id="CAG46850.1"
                     /translation="MASPGCLWLLAVALLPWTCASRALQHLDPPAPLPLVIWHGMGDS
                     CCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKD
                     PKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHIC
                     DFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKN
                     LMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDN
                     AGQLVFLATEGDHLQLSEEWFYAHIIPFLG"
BASE COUNT          232 a          217 c          246 g          223 t
ORIGIN      
        1 atggcgtcgc ccggctgcct gtggctcttg gctgtggctc tcctgccatg gacctgcgct
       61 tctcgggcgc tgcagcatct ggacccgccg gcgccgctgc cgttggtgat ctggcatggg
      121 atgggagaca gctgttgcaa tcccttaagc atgggtgcta ttaaaaaaat ggtggagaag
      181 aaaatacctg gaatttacgt cttatcttta gagattggga agaccctgat ggaggacgtg
      241 gagaacagct tcttcttgaa tgtcaattcc caagtaacaa cagtgtgtca ggcacttgct
      301 aaggatccta aattgcagca aggctacaat gctatgggat tctcccaggg aggccaattt
      361 ctgagggcag tggctcagag atgcccttca cctcccatga tcaatctgat ctcggttggg
      421 ggacaacatc aaggtgtttt tggactccct cgatgcccag gagagagctc tcacatctgt
      481 gacttcatcc gaaaaacact gaatgctggg gcgtactcca aagttgttca ggaacgcctc
      541 gtgcaagccg aatactggca tgaccccata aaggaggatg tgtatcgcaa ccacagcatc
      601 ttcttggcag atataaatca ggagcggggt atcaatgagt cctacaagaa aaacctgatg
      661 gccctgaaga agtttgtgat ggtgaaattc ctcaatgatt ccattgtgga ccctgtagat
      721 tcggagtggt ttggatttta cagaagtggc caagccaagg aaaccattcc cttacaggag
      781 acctccctgt acacacagga ccgcctgggg ctaaaggaaa tggacaatgc aggacagcta
      841 gtgtttctgg ctacagaagg ggaccatctt cagttgtctg aagaatggtt ttatgcccac
      901 atcataccat tccttgga
//