LOCUS CR541852 864 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E0432D for gene DSCR2, Down syndrome critical region gene 2; complete cds, without stopcodon. ACCESSION CR541852 VERSION CR541852.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 864) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 864) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E0432D, ORFNo 3800 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0432D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH130894.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence AJ006291 we found AA exchange(s) at position (first base of changed triplet): 10(thr->ser) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..864 /db_xref="H-InvDB:HIT000268722" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E0432D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>864 /codon_start=1 /gene="DSCR2" /db_xref="GOA:O95456" /db_xref="H-InvDB:HIT000268722.13" /db_xref="HGNC:HGNC:3043" /db_xref="InterPro:IPR016565" /db_xref="UniProtKB/Swiss-Prot:O95456" /protein_id="CAG46650.1" /translation="MAASFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARK REVRLLRRQTKTSLEVSLLEKYPCSKFIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLW NEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRK NMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAA VLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKL MTTNEIQSNIYT" BASE COUNT 252 a 174 c 210 g 228 t ORIGIN 1 atggcggcct cgttcttcgg agaggtggtg aaggcgccgt gccgagctgg gactgaggac 61 gaagaggagg aggaggaggg gcggagggag acgcccgagg acagggaggt gcgtctgcag 121 ctggcgcgga agagggaagt gcggctcctt cgaagacaaa caaaaacatc tttggaagtt 181 tctttgctag aaaaatatcc gtgctccaag tttataattg ctataggaaa taatgcagta 241 gcatttctgt catcatttgt tatgaattca ggagtctggg aggaagttgg ttgtgccaaa 301 ctctggaatg aatggtgtag aacaacagac actacacatc tgtcctccac agaggctttt 361 tgtgtgtttt atcatctaaa atccaatccc tcggtttttc tctgtcagtg cagttgctat 421 gttgcagaag atcaacagta tcagtggctg gaaaaggttt ttggctcttg tccaaggaag 481 aacatgcaga taactattct cacatgtcga catgttaccg attataaaac ctcagaatcc 541 accggcagcc ttccttctcc tttcctgaga gccctaaaaa cacagaattt caaagactcg 601 gcgtgttgtc cattgctaga acaaccgaat atagtacacg accttcctgc agcagttcta 661 agctactgtc aagtatggaa aatcccagca attctgtact tgtgttatac tgatgtgatg 721 aaattagacc taatcacagt ggaagctttt aagcctatac tttctaccag aagcttgaag 781 ggtttggtta agaatattcc ccaaagcact gagatactaa agaaattgat gacaacaaat 841 gagattcaga gtaacattta taca //