LOCUS       CR541852                 864 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E0432D for
            gene DSCR2, Down syndrome critical region gene 2; complete cds,
            without stopcodon.
ACCESSION   CR541852
VERSION     CR541852.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 864)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 864)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E0432D, ORFNo 3800
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0432D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH130894.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence AJ006291
            we found AA exchange(s) at position (first base of changed
            triplet):
            10(thr->ser)
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..864
                     /db_xref="H-InvDB:HIT000268722"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E0432D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>864
                     /codon_start=1
                     /gene="DSCR2"
                     /db_xref="GOA:O95456"
                     /db_xref="H-InvDB:HIT000268722.13"
                     /db_xref="HGNC:HGNC:3043"
                     /db_xref="InterPro:IPR016565"
                     /db_xref="UniProtKB/Swiss-Prot:O95456"
                     /protein_id="CAG46650.1"
                     /translation="MAASFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARK
                     REVRLLRRQTKTSLEVSLLEKYPCSKFIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLW
                     NEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRK
                     NMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAA
                     VLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKL
                     MTTNEIQSNIYT"
BASE COUNT          252 a          174 c          210 g          228 t
ORIGIN      
        1 atggcggcct cgttcttcgg agaggtggtg aaggcgccgt gccgagctgg gactgaggac
       61 gaagaggagg aggaggaggg gcggagggag acgcccgagg acagggaggt gcgtctgcag
      121 ctggcgcgga agagggaagt gcggctcctt cgaagacaaa caaaaacatc tttggaagtt
      181 tctttgctag aaaaatatcc gtgctccaag tttataattg ctataggaaa taatgcagta
      241 gcatttctgt catcatttgt tatgaattca ggagtctggg aggaagttgg ttgtgccaaa
      301 ctctggaatg aatggtgtag aacaacagac actacacatc tgtcctccac agaggctttt
      361 tgtgtgtttt atcatctaaa atccaatccc tcggtttttc tctgtcagtg cagttgctat
      421 gttgcagaag atcaacagta tcagtggctg gaaaaggttt ttggctcttg tccaaggaag
      481 aacatgcaga taactattct cacatgtcga catgttaccg attataaaac ctcagaatcc
      541 accggcagcc ttccttctcc tttcctgaga gccctaaaaa cacagaattt caaagactcg
      601 gcgtgttgtc cattgctaga acaaccgaat atagtacacg accttcctgc agcagttcta
      661 agctactgtc aagtatggaa aatcccagca attctgtact tgtgttatac tgatgtgatg
      721 aaattagacc taatcacagt ggaagctttt aagcctatac tttctaccag aagcttgaag
      781 ggtttggtta agaatattcc ccaaagcact gagatactaa agaaattgat gacaacaaat
      841 gagattcaga gtaacattta taca
//