LOCUS CR457400 897 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C0514D for gene SLC25A6, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6; complete cds, incl. stopcodon. ACCESSION CR457400 VERSION CR457400.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 897) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 897) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C0514D, ORFNo 2578 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0514D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BC008935 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..897 /db_xref="H-InvDB:HIT000268250_04" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C0514D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..897 /codon_start=1 /gene="SLC25A6" /db_xref="GOA:Q6I9V5" /db_xref="H-InvDB:HIT000268250_03.4" /db_xref="InterPro:IPR002067" /db_xref="InterPro:IPR002113" /db_xref="InterPro:IPR018108" /db_xref="InterPro:IPR023395" /db_xref="UniProtKB/TrEMBL:Q6I9V5" /protein_id="CAG33681.1" /translation="MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQ IAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGG VDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKSGTEREFRGLGDC LVKITKSDGIRGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQ TVTAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWS NVLRGMGGAFVLVLYDELKKVI" BASE COUNT 174 a 274 c 287 g 162 t ORIGIN 1 atgacggaac aggccatctc cttcgccaaa gacttcttgg ccggaggcat cgccgccgcc 61 atctccaaga cggccgtggc tccgatcgag cgggtcaagc tgctgctgca ggtccagcac 121 gccagcaagc agatcgccgc cgacaagcag tacaagggca tcgtggactg cattgtccgc 181 atccccaagg agcagggcgt gctgtccttc tggaggggca accttgccaa cgtcattcgc 241 tacttcccca ctcaagccct caacttcgcc ttcaaggata agtacaagca gatcttcctg 301 gggggcgtgg acaagcacac gcagttctgg aggtactttg cgggcaacct ggcctccggc 361 ggtgcggccg gcgcgacctc cctctgcttc gtgtacccgc tggatttcgc cagaacccgc 421 ctggcagcgg acgtgggaaa gtcaggcaca gagcgcgagt tccgaggcct gggagactgc 481 ctggtgaaga tcaccaagtc cgacggcatc cggggcctgt accagggctt cagtgtctcc 541 gtgcagggca tcatcatcta ccgggcggcc tacttcggcg tgtacgatac ggccaagggc 601 atgctccccg accccaagaa cacgcacatc gtggtgagct ggatgatcgc gcagaccgtg 661 acggccgtgg ccggcgtggt gtcctacccc ttcgacacgg tgcggcggcg catgatgatg 721 cagtccgggc gcaaaggagc tgacatcatg tacacgggca ccgtcgactg ttggaggaag 781 atcttcagag atgagggggg caaggccttc ttcaagggtg cgtggtccaa cgtcctgcgg 841 ggcatggggg gcgccttcgt gctggtcctg tacgacgagc tcaagaaggt gatttaa //