LOCUS       CR457400                 897 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834C0514D for
            gene SLC25A6, solute carrier family 25 (mitochondrial carrier;
            adenine nucleotide translocator), member 6; complete cds, incl.
            stopcodon.
ACCESSION   CR457400
VERSION     CR457400.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 897)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 897)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834C0514D, ORFNo 2578
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0514D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence BC008935 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..897
                     /db_xref="H-InvDB:HIT000268250_04"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834C0514D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..897
                     /codon_start=1
                     /gene="SLC25A6"
                     /db_xref="GOA:Q6I9V5"
                     /db_xref="H-InvDB:HIT000268250_03.4"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002113"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6I9V5"
                     /protein_id="CAG33681.1"
                     /translation="MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQ
                     IAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGG
                     VDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKSGTEREFRGLGDC
                     LVKITKSDGIRGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQ
                     TVTAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWS
                     NVLRGMGGAFVLVLYDELKKVI"
BASE COUNT          174 a          274 c          287 g          162 t
ORIGIN      
        1 atgacggaac aggccatctc cttcgccaaa gacttcttgg ccggaggcat cgccgccgcc
       61 atctccaaga cggccgtggc tccgatcgag cgggtcaagc tgctgctgca ggtccagcac
      121 gccagcaagc agatcgccgc cgacaagcag tacaagggca tcgtggactg cattgtccgc
      181 atccccaagg agcagggcgt gctgtccttc tggaggggca accttgccaa cgtcattcgc
      241 tacttcccca ctcaagccct caacttcgcc ttcaaggata agtacaagca gatcttcctg
      301 gggggcgtgg acaagcacac gcagttctgg aggtactttg cgggcaacct ggcctccggc
      361 ggtgcggccg gcgcgacctc cctctgcttc gtgtacccgc tggatttcgc cagaacccgc
      421 ctggcagcgg acgtgggaaa gtcaggcaca gagcgcgagt tccgaggcct gggagactgc
      481 ctggtgaaga tcaccaagtc cgacggcatc cggggcctgt accagggctt cagtgtctcc
      541 gtgcagggca tcatcatcta ccgggcggcc tacttcggcg tgtacgatac ggccaagggc
      601 atgctccccg accccaagaa cacgcacatc gtggtgagct ggatgatcgc gcagaccgtg
      661 acggccgtgg ccggcgtggt gtcctacccc ttcgacacgg tgcggcggcg catgatgatg
      721 cagtccgggc gcaaaggagc tgacatcatg tacacgggca ccgtcgactg ttggaggaag
      781 atcttcagag atgagggggg caaggccttc ttcaagggtg cgtggtccaa cgtcctgcgg
      841 ggcatggggg gcgccttcgt gctggtcctg tacgacgagc tcaagaaggt gatttaa
//