LOCUS       CR457325                 777 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834G109D for
            gene C20orf39, chromosome 20 open reading frame 39; complete cds,
            incl. stopcodon.
ACCESSION   CR457325
VERSION     CR457325.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 777)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 777)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834G109D, ORFNo 2380
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G109D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_024893 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..777
                     /db_xref="H-InvDB:HIT000268175"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834G109D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..777
                     /codon_start=1
                     /gene="C20orf39"
                     /db_xref="GOA:Q9H7V2"
                     /db_xref="H-InvDB:HIT000268175.11"
                     /db_xref="HGNC:HGNC:15885"
                     /db_xref="InterPro:IPR007593"
                     /db_xref="UniProtKB/Swiss-Prot:Q9H7V2"
                     /protein_id="CAG33606.1"
                     /translation="MDGIIEQKSMLVHSKISDAGKRNGLINTRNLMAESRDGLVSVYP
                     APQYQSHRVGASTVPASLDSSRSEPMQQLLDPNTLQQSVESRYRPNIILYSEGVLRSW
                     GDGVAADCCETTFIEDRSPTKDSLEYPDGKFIDLSADDIKIHTLSYDVEEEEEFQELE
                     SDYSSDTESEDNFLMMPPRDHLGLSVFSMLCCFWPLGIAAFYLSHETNKAVAKGDLHQ
                     ASTSSRRALFLAVLSITIGTGVYVGVAVALIAYLSKNNHL"
BASE COUNT          174 a          234 c          224 g          145 t
ORIGIN      
        1 atggatggca tcattgaaca gaagagcatg ctggtgcaca gtaaaatcag tgatgctggc
       61 aagaggaatg gtttaattaa caccagaaac ttgatggccg agagcagaga tggtctggtg
      121 tctgtttacc cagcgcccca gtaccagagc caccgggtgg gggccagcac agtgccggcc
      181 agcctggaca gcagcaggag tgagccgatg cagcagctgc tggaccccaa caccctgcag
      241 cagtcagtgg agtcccgcta ccggcccaac atcatcctct attcagaggg cgtgctgcgc
      301 tcctgggggg acggtgtggc cgccgactgc tgcgagacca ccttcatcga ggaccggtcg
      361 cccaccaaag acagcctcga gtacccggat gggaagttca ttgacctctc agctgatgac
      421 ataaaaatcc acaccctgtc ctacgatgtg gaggaggagg aggagttcca ggagctggag
      481 agcgactact caagcgacac agagagtgag gacaatttcc tcatgatgcc cccgcgggac
      541 cacctgggcc tcagtgtctt ctccatgctc tgctgcttct ggcctctggg catcgcagcc
      601 ttctacttgt cccatgagac caacaaagcc gtggccaagg gggacttgca ccaggccagc
      661 accagctccc ggcgggccct attcctggca gtgctgtcca tcaccattgg gactggcgtc
      721 tatgtgggcg tggccgtggc cctcatcgcc tacctctcca agaacaacca cctttaa
//