LOCUS CR456918 231 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E1115D for gene SNRPG, small nuclear ribonucleoprotein polypeptide G; complete cds, incl. stopcodon. ACCESSION CR456918 VERSION CR456918.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 231) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 231) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E1115D, ORFNo 1284 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E1115D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_003096 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..231 /db_xref="H-InvDB:HIT000267768" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E1115D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..231 /codon_start=1 /gene="SNRPG" /db_xref="GOA:P62308" /db_xref="H-InvDB:HIT000267768.12" /db_xref="HGNC:HGNC:11163" /db_xref="InterPro:IPR001163" /db_xref="InterPro:IPR010920" /db_xref="InterPro:IPR034098" /db_xref="PDB:3CW1" /db_xref="PDB:3JCR" /db_xref="PDB:3PGW" /db_xref="PDB:4F7U" /db_xref="PDB:4PJO" /db_xref="PDB:4V98" /db_xref="PDB:4WZJ" /db_xref="PDB:5MQF" /db_xref="PDB:5O9Z" /db_xref="PDB:5XJC" /db_xref="PDB:5XJL" /db_xref="PDB:5XJQ" /db_xref="PDB:5XJR" /db_xref="PDB:5XJT" /db_xref="PDB:5XJU" /db_xref="PDB:5YZG" /db_xref="PDB:5Z56" /db_xref="PDB:5Z57" /db_xref="PDB:5Z58" /db_xref="PDB:6AH0" /db_xref="PDB:6AHD" /db_xref="PDB:6FF7" /db_xref="PDB:6ICZ" /db_xref="PDB:6ID0" /db_xref="PDB:6ID1" /db_xref="PDB:6QDV" /db_xref="PDB:6QW6" /db_xref="PDB:6QX9" /db_xref="UniProtKB/Swiss-Prot:P62308" /protein_id="CAG33199.1" /translation="MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDE CVEMATSGQQNNIGMVVIRGNSIIMLEALERV" BASE COUNT 79 a 32 c 59 g 61 t ORIGIN 1 atgagcaaag ctcaccctcc cgagttgaaa aaatttatgg acaagaagtt atcattgaaa 61 ttaaatggtg gcagacatgt ccaaggaata ttgcggggat ttgatccctt tatgaacctt 121 gtgatagatg aatgtgtgga gatggcgact agtggacaac agaacaatat tggaatggtg 181 gtaatacgag gaaatagtat catcatgtta gaagccttgg aacgagttta a //