LOCUS       CR456918                 231 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E1115D for
            gene SNRPG, small nuclear ribonucleoprotein polypeptide G; complete
            cds, incl. stopcodon.
ACCESSION   CR456918
VERSION     CR456918.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 231)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 231)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E1115D, ORFNo 1284
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E1115D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_003096 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..231
                     /db_xref="H-InvDB:HIT000267768"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E1115D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..231
                     /codon_start=1
                     /gene="SNRPG"
                     /db_xref="GOA:P62308"
                     /db_xref="H-InvDB:HIT000267768.12"
                     /db_xref="HGNC:HGNC:11163"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR034098"
                     /db_xref="PDB:3CW1"
                     /db_xref="PDB:3JCR"
                     /db_xref="PDB:3PGW"
                     /db_xref="PDB:4F7U"
                     /db_xref="PDB:4PJO"
                     /db_xref="PDB:4V98"
                     /db_xref="PDB:4WZJ"
                     /db_xref="PDB:5MQF"
                     /db_xref="PDB:5O9Z"
                     /db_xref="PDB:5XJC"
                     /db_xref="PDB:5XJL"
                     /db_xref="PDB:5XJQ"
                     /db_xref="PDB:5XJR"
                     /db_xref="PDB:5XJT"
                     /db_xref="PDB:5XJU"
                     /db_xref="PDB:5YZG"
                     /db_xref="PDB:5Z56"
                     /db_xref="PDB:5Z57"
                     /db_xref="PDB:5Z58"
                     /db_xref="PDB:6AH0"
                     /db_xref="PDB:6AHD"
                     /db_xref="PDB:6FF7"
                     /db_xref="PDB:6ICZ"
                     /db_xref="PDB:6ID0"
                     /db_xref="PDB:6ID1"
                     /db_xref="PDB:6QDV"
                     /db_xref="PDB:6QW6"
                     /db_xref="PDB:6QX9"
                     /db_xref="UniProtKB/Swiss-Prot:P62308"
                     /protein_id="CAG33199.1"
                     /translation="MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDE
                     CVEMATSGQQNNIGMVVIRGNSIIMLEALERV"
BASE COUNT           79 a           32 c           59 g           61 t
ORIGIN      
        1 atgagcaaag ctcaccctcc cgagttgaaa aaatttatgg acaagaagtt atcattgaaa
       61 ttaaatggtg gcagacatgt ccaaggaata ttgcggggat ttgatccctt tatgaacctt
      121 gtgatagatg aatgtgtgga gatggcgact agtggacaac agaacaatat tggaatggtg
      181 gtaatacgag gaaatagtat catcatgtta gaagccttgg aacgagttta a
//