LOCUS CR450319 186 bp mRNA linear HUM 18-MAY-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G121D for gene PCP4, Purkinje cell protein 4; complete cds; without stopcodon. ACCESSION CR450319 VERSION CR450319.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 186) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 186) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (18-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G121D, ORFNo 170 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G121D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence BC013791 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..186 /db_xref="H-InvDB:HIT000267228" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G121D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>186 /codon_start=1 /gene="PCP4" /db_xref="GOA:P48539" /db_xref="H-InvDB:HIT000267228.11" /db_xref="HGNC:HGNC:8742" /db_xref="InterPro:IPR033236" /db_xref="PDB:2N77" /db_xref="UniProtKB/Swiss-Prot:P48539" /protein_id="CAG29315.1" /translation="MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAV AIQSQFRKFQKKKAGSQS" BASE COUNT 66 a 33 c 54 g 33 t ORIGIN 1 atgagtgagc gacaaggtgc tggggcaacc aatggaaaag acaagacatc tggtgaaaat 61 gatggacaga agaaagttca agaagaattt gacattgaca tggatgcacc agagacagaa 121 cgtgcagcgg tggccattca gtctcagttc agaaaattcc agaagaagaa ggctgggtct 181 cagtcc //