LOCUS       CP058257             6580692 bp    DNA     circular BCT 28-SEP-2020
DEFINITION  Pseudomonas aeruginosa strain PA179 chromosome.
ACCESSION   CP058257
VERSION     CP058257.1
DBLINK      BioProject: PRJNA640813
            BioSample: SAMN15332912
KEYWORDS    .
SOURCE      Pseudomonas aeruginosa
  ORGANISM  Pseudomonas aeruginosa
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Pseudomonadaceae; Pseudomonas.
REFERENCE   1  (bases 1 to 6580692)
  AUTHORS   Alamri,A.M. and Alnimr,A.M.
  TITLE     Whole Genome Sequence of an extensively Drug resistant Pseudomonas
            aeruginosa
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6580692)
  AUTHORS   Alamri,A.M. and Alnimr,A.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2020) Department of Clinical Laboratory Sciences,
            Imam Abdulrahman Bin Faisal University, Dammam 35211, Saudi Arabia
COMMENT     The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Date             :: 20-JUN-2020
            Assembly Method           :: SOAPdenovo v. 1.05
            Genome Representation     :: Full
            Expected Final Version    :: Yes
            Reference-guided Assembly :: NC_002516.2
            Genome Coverage           :: 100.0x
            Sequencing Technology     :: Illumina HiSeq
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 06/29/2020 17:07:23
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 6,083
            CDSs (total)                      :: 6,023
            Genes (coding)                    :: 5,942
            CDSs (with protein)               :: 5,942
            Genes (RNA)                       :: 60
            tRNAs                             :: 56
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 81
            CDSs (without protein)            :: 81
            Pseudo Genes (ambiguous residues) :: 6 of 81
            Pseudo Genes (frameshifted)       :: 33 of 81
            Pseudo Genes (incomplete)         :: 47 of 81
            Pseudo Genes (internal stop)      :: 7 of 81
            Pseudo Genes (multiple problems)  :: 10 of 81
            CRISPR Arrays                     :: 3
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..6580692
                     /organism="Pseudomonas aeruginosa"
                     /mol_type="genomic DNA"
                     /strain="PA179"
                     /isolation_source="blood"
                     /host="Homo sapiens"
                     /db_xref="taxon:287"
                     /country="Saudi Arabia: Khobar"
                     /lat_lon="26.217192 N 50.197140 E"
                     /collection_date="2017"
                     /collected_by="Aisha Alamri"
     gene            483..2027
                     /gene="dnaA"
                     /locus_tag="HWH41_00005"
     CDS             483..2027
                     /gene="dnaA"
                     /locus_tag="HWH41_00005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_064721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="QOD45346.1"
                     /translation="MSVELWQQCVDLLRDELPSQQFNTWIRPLQVEAEGDELRVYAPN
                     RFVLDWVNEKYLGRLLELLGERGEGQLPALSLLIGSKRSRTPRAAIVPSQTHVAPPPP
                     VAPPPAPVQPVSAAPVVVPREELPPVTTAPSVSSDPYEPEEPSIDPLAAAMPAGAAPA
                     VRTERNVQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNLKHGYNPLFLY
                     GGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSV
                     DALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFG
                     WGLTVAVEPPELETRVAILMKKAEQAKIELPHDAAFFIAQRIRSNVRELEGALKRVIA
                     HSHFMGRPITIELIRESLKDLLALQDKLVSIDNIQRTVAEYYKIKISDLLSKRRSRSV
                     ARPRQVAMALSKELTNHSLPEIGVAFGGRDHTTVLHACRKIAQLRESDADIREDYKNL
                     LRTLTT"
     gene            2056..3159
                     /gene="dnaN"
                     /locus_tag="HWH41_00010"
     CDS             2056..3159
                     /gene="dnaN"
                     /locus_tag="HWH41_00010"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_064722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="QOD45347.1"
                     /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSL
                     TGTDLEVELVGRVVLEDAAEPGEITVPARKLMDICKSLPNDVLIDIRVEEQKLLVKAG
                     RSRFTLSTLPANDFPTVEEGPGSLNFSIAQSKLRRLIDRTSFAMAQQDVRYYLNGMLL
                     EVNGGTLRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIV
                     LGQHHIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQQLREAFSRTAILSN
                     EKYRGIRLQLSNGLLKIQANNPEQEEAEEEVQVEYNGGNLEIGFNVSYLLDVLGVIGT
                     EQVRFILSDSNSSALVHEADNDDSAYVVMPMRL"
     gene            3169..4278
                     /gene="recF"
                     /locus_tag="HWH41_00015"
     CDS             3169..4278
                     /gene="recF"
                     /locus_tag="HWH41_00015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_064723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication/repair protein RecF"
                     /protein_id="QOD45348.1"
                     /translation="MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIH
                     LLGLARSFRSARLQPVIQYEEAACTVFGQVMLANGIASNLGISRERQGEFTIRIDGQN
                     ARSAAQLAETLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPVWQRLQKALR
                     QRNSWLRHGKLDPASQAAWDRELSLASDEIDAYRRSYIQALKPVFEETLAELVSLDDL
                     TLSYYRGWDKDRDLLEVLASSLLRDQQMGHTQAGPQRADLRIRLAGHNAAEILSRGQQ
                     KLVVCALRIAQGHLINRAKRGQCVYLVDDLPSELDEQHRMALCRLLEDLGCQVFITCV
                     DPQLLKDGWRTDTPVSMFHVEHGKVSQTTTIGSEA"
     gene            4275..6695
                     /gene="gyrB"
                     /locus_tag="HWH41_00020"
     CDS             4275..6695
                     /gene="gyrB"
                     /locus_tag="HWH41_00020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_064724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase (ATP-hydrolyzing) subunit B"
                     /protein_id="QOD45349.1"
                     /translation="MSENNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFE
                     VVDNSIDEALAGYCSEISITIHTDESITVRDNGRGIPVDIHKEEGVSAAEVIMTVLHA
                     GGKFDDNTYKVSGGLHGVGVSVVNALSHELRLTIRRHNKVWEQVYHHGVPQFPLREVG
                     ETDGSGTEVHFKPSPETFSNIHFSWDILAKRIRELSFLNSGVGILLRDERTGKEELFK
                     YEGGLKAFVEYLNTNKTAVNEVFHFNVQREEDGVGVEVALQWNDSFNENLLCFTNNIP
                     QRDGGTHLAGFRSALTRNLNNYIEAEGLAKKFKIATTGDDAREGLTAIISVKVPDPKF
                     SSQTKDKLVSSEVKTAVEQEMGKYFADFLLENPNEAKAVVGKMIDAARAREAARKARE
                     MTRRKGALDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRRTQAILPLKG
                     KILNVEKARFDKMLSSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHI
                     RTLLLTFFFRQMPELIERGYIYIAQPPLYKVKRGKQEQYIKDDQAMEEYMTQSALEDA
                     SLHVNEHAPGLSGAALEKLVNEYRGVIATLKRLSRLYPQELTEHFIYLPTVSVDDLAN
                     ESAMQGWLEKFQARLTAAEKSGLTYKASLREDRERHLWLPEVELVAHGLSSYVTFNRD
                     FFASNDYRSVSLLGDQLNSLLEDGAYVQKGERKRPISAFKDGLDWLMAEGTKRHSIQR
                     YKGLGEMNPEQLWETTMDPNVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNA
                     LAVSNLDV"
     gene            7279..12159
                     /locus_tag="HWH41_00025"
     CDS             7279..12159
                     /locus_tag="HWH41_00025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020312235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="QOD45350.1"
                     /translation="MSALSALLHTFRSASVTEREKGTYFEELICAYLRNEATYRDLYD
                     KVWTYADWAKEQGLSGKDAGIDLVARTQGTGEYHAIQCKLYAEDYKVQKKDIDSFFTA
                     SGKAPFSHRVIVTTTNNWSEHAEDALQGQQPPVSKIDLQALEDSQVDWAKYQPNQAVV
                     LKARKQLRDHQQTALNAVVAGLKDAERGKLIMACGTGKTFTSLKIAEQQAGKGKRVLF
                     LVPSLSLLSQTLTEWTQESATLLHSFAVCSDSDVGKKRKAEDDAVQVFTHELRYPATT
                     KADRLASEMLKRHDAEHMSVVFSTYHSIDVISRAQADHGLPAFDLVICDEAHRTTGAT
                     FGDDDESNFVRIHDGDYIRAAKRLYMTATPRIYGDSAKIKAESGEVTLCSMDDEALYG
                     KELFVINFSEAVQRGLLTDYKVLVLTVEESTISRRLQDMLKDENNQLKVDDAAKIVGC
                     WKALAKQGLHEQLIGDDEPMKRAVAFCQVISPNYKGTKHKVSSINIASMFQAVVEAYQ
                     ESEEIDEASRLICEAEHVDGGMNASAKEAKLNWLKEEPLANTCRILSNVRCLSEGVDV
                     PALDAVLFLTPRNSQVDVVQSVGRVMRNAPGKKRGYVVLPVVIPAGMEPHEALNDNQT
                     YKVVWQVLQALRSHDDSFDAMVNKLDLIGSDPRKMEVIAITDKAEKNAKKATGTTNGK
                     AGKGQYGIGSKNHDVPGQMTQQAELTYEVGEIEKAIYAKIVEKCGNRHHWEDWANDIA
                     KIARTHIDRIQGILENPANTQEQAAFNVFAAELRDDLNDSISDGEIVEMLAQHLVTKP
                     VFDALFDEYSFASHNPMSKAMQGVLDALHEHHLAKEADTLEKFYASVRQRAAGIDNAQ
                     GKQKIIVELYDKFFRNAFPKMTERLGIVYTPVEVVDFILHSVNHLLQQEFGQTLGSKG
                     VHIIDPFTGTGTFITRLIQSGLIKPEELPHKYKHEIHANELVLLAYYIAAINIEAAYH
                     GEVIDEYTPFEGICLTDTFQMYEKEDLIDEVLVDNSARRKRQKALDIRVIVGNPPYSV
                     GQKSENDNNDNVDYPKLDADIRATYAARSSATLAKGLYDSYIRAIRWASNRIGDTGII
                     GFVTNAGFLDANTTDGLRKCLADEFSSLYVFHLRGNQRTSGETSRKEGGKIFGSGSRA
                     PIAISLLVKNPAAQGHGQIYFHDIGDYLSREEKLEKVAGYASVAGIEQWQRITPDEHG
                     DWLKQRDNSFNRFIVLGEKKSDAPKLFENFSLGVVTNRDAWAYNASQSKLATNMTSMI
                     GFYNGEVERFNAKYSGLDTKARQAQVDGFIDTDPTRISWTHNVKQDLVRNHIYAFESG
                     NMVSSLYRPFTKQWLYYNRRFNERVYQMPRIFPDAGTENLVIGVSAAGEKVAFSALIS
                     RHVPSLHFVDIEGSQCFPLYLYDEAAQASDSDLFAEPIDGGLRRRDAVTDAGLAHFQS
                     AYPGESLSKEDLFYYVYGILHSPDYRERFADNLSKELPRIPAVKKAADFWAFSQAGRA
                     LADLHLNYETVEPYPLTIEAKSPLTGADYRVEKMKFAKKGDKSTVIYNHRITLKDIPR
                     AAWDYVVNGKAALDWVMERQAVRTDKASGIVNDANDWAIETMGNPKYPLELFQRVVTV
                     SLETTKIVKGLPPLDI"
     gene            12615..12821
                     /locus_tag="HWH41_00030"
     CDS             12615..12821
                     /locus_tag="HWH41_00030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020799818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD51077.1"
                     /translation="MHNNEDARVNISSAPQQKDKKGEGVKARAVQAAQVVKRIPYYVW
                     LWEKAGEAWGWVCEHAESILEVIS"
     gene            12974..>13062
                     /locus_tag="HWH41_00035"
     CDS             12974..>13062
                     /locus_tag="HWH41_00035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014504811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="QOD51078.1"
                     /translation="MKKRFTEEQILDFLKQAEAGVPVKELCRR"
     assembly_gap    13063..13073
                     /estimated_length=11
                     /gap_type="within scaffold"
                     /linkage_evidence="align genus"
     gene            complement(13877..14650)
                     /locus_tag="HWH41_00040"
     CDS             complement(13877..14650)
                     /locus_tag="HWH41_00040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_064725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="QOD45351.1"
                     /translation="MSTVQAIRTVLFYLLLSASAFVWGTLSFFIAPILPFRARYRFVV
                     QNWCRFAIWLTRVVAGIRYEVRGLENIPEKPCVILSKHQSTWETFFLSGFFEPLSQVL
                     KRELLYVPFFGWALALLKPIAIDRSQPKLALKQLAKQGDECLKKGAWVLIFPEGTRIP
                     VGQMGKFSRGGTALAVNAGLPVLPIAHNAGQYWPKAGWAKYPGTIQVVIGPAMYAEGE
                     GPRAIAELNQRAEAWVSETMAEISPIQQRVSHPEPSVVS"
     gene            complement(14662..15198)
                     /gene="gmhB"
                     /locus_tag="HWH41_00045"
     CDS             complement(14662..15198)
                     /gene="gmhB"
                     /locus_tag="HWH41_00045"
                     /EC_number="3.1.3.82"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_064726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-glycero-beta-D-manno-heptose 1,7-bisphosphate
                     7-phosphatase"
                     /protein_id="QOD45352.1"
                     /translation="MSRSLLILDRDGVINLDSDDYIKTLDEWIPIPSSIEAIARLSQA
                     GWTVAVATNQSGIARGYYDLAVLEAMHARLRELVAEQGGEVGLIVYCPHGPDDGCDCR
                     KPKPGMLRQIGEHYGVDLSGIWFVGDSIGDLEAARAVDCQPVLVKTGKGVRTLGKPLP
                     EGTLIFDDLAAVASALLQ"
     gene            15530..17236
                     /locus_tag="HWH41_00050"
     CDS             15530..17236
                     /locus_tag="HWH41_00050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_064727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45353.1"
                     /translation="MKRLKKTLHLSSLSLVSLALSSAALAAAPVMLDQGKEWTESHRQ
                     DFYSRDQGSQVMPLPWLKALRQPDGTPFLADSLARYGYLPNPKAPAEGLPVGFTVAGT
                     GARQMVGMTCSACHTRQIEVKGTAYRIDGGPAIVDFQAFLADLDRAVGPLTSDDAAFD
                     AFAKQILGANPPPGARDALLAAVKEWYEPYHTLIERALPKDTWGPARLDAVSMIFNRL
                     TGLDIGTAPPYLIPDNIKAADAPVRYPFLWNAARQNKTQWPGFAANGNDLLGLARNVG
                     EVYGVFATFHPQKSKFHLLGMDYLKVNSANFHGLGKLEELIKKIGPPKWPWAVDKHLA
                     RKGALIFARKTDEGGCVECHGIRIKDLVLWDTPLRDVGSDSRQHAILDGQVQTGVMEG
                     ARMPFGQPLKATDGAFDVLAVAVAGSILQHFVPILGEKHDAKAAAVKPESVMTDETRQ
                     LLTAFQKPVRTQADPYPYESRVLQGIWAAAPYLHNGSVPTLEELLKPAAERVESFPVG
                     SAYDVDKVGLAAQQTQFGSYVLKTTGCEQRDSGNSRCGHEYGTSLSAEEKRALLEYLK
                     VL"
     gene            complement(17293..19347)
                     /locus_tag="HWH41_00055"
     CDS             complement(17293..19347)
                     /locus_tag="HWH41_00055"
                     /EC_number="6.1.1.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_064728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine--tRNA ligase subunit beta"
                     /protein_id="QOD45354.1"
                     /translation="MSAKDFLVELGTEELPPKALNSLGEAFLSGIEKGLKAAGLSYAA
                     ARFYAAPRRLAVLVEQLAVQQPDRTVNLDGPPLQAAFDASGNPTQAALGFAKKCGVDL
                     QQIDKSGPKLRFSQTIAGQPAAGLLPGIVEASLNELPIPKRMRWAARREEFVRPTQWL
                     VMLFGDDVVECEILAQKAGRESRGHRFHNPDNVRISSPAAYLEDLRGAHVLADFAERR
                     ELIAKRVAELAAEQQGSAIVPPSLLDEVTALVEWPVPLVCSFEERFLEVPQEALITTM
                     QDNQKYFCLLDANGKLLPRFITVANVESKAPENIVSGNEKVVRPRLTDAEFFFKQDKK
                     QPLESFNERLRNVVFQAQLGTVFEKAQRVSGLAAYIAERIGGNAQNAARAGILSKCDL
                     ATEMVGEFPEMQGIAGYYYATHGGEAEDVALALNEQYMPRGAGAELPSTLTGAAVAVA
                     DKLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLVAAVNAAVEQYGD
                     KVKAAGLAEQVLDFVFDRLRARYEDEGVDVAVYQSVRALKPSSPLDFDQRVQAVQAFR
                     QLPEAEALAAANKRVSNILAKSEDEVPPSVDASLLVEAAEKALGSAVANAESEVAPLA
                     AARDYRAALARLAALREPVDTFFADVMVNVDDAAVRANRYALLAKLRGLFLGVADISL
                     LG"
     gene            complement(19347..20294)
                     /gene="glyQ"
                     /locus_tag="HWH41_00060"
     CDS             complement(19347..20294)
                     /gene="glyQ"
                     /locus_tag="HWH41_00060"
                     /EC_number="6.1.1.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_064729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine--tRNA ligase subunit alpha"
                     /protein_id="QOD45355.1"
                     /translation="MSQTTPAVRTFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHT
                     ATFLRAIGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPNPENFQELYLG
                     SLKAIGIDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYP
                     VTGEITYGLERLAMYLQGVDSVYDLVWTDGPFGKVTYGDVFHQNEVEQSTFNFEHANV
                     PKLFELFDFYESEANRLIALELPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRV
                     RTLARAVAQSYLQARARLGFPMATPELRDEVLAKLKEAE"
     gene            20399..20950
                     /gene="tag"
                     /locus_tag="HWH41_00065"
     CDS             20399..20950
                     /gene="tag"
                     /locus_tag="HWH41_00065"
                     /EC_number="3.2.2.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase I"
                     /protein_id="QOD45356.1"
                     /translation="MPRCFWCNDDPLYMAYHDEEWGVPQRDPDALFELLLLEGFQAGL
                     SWITVLKKRERYREVLFGFDVQRVAQMSDAEIDELMLDPGIIRNRAKLNAARQNAQAW
                     LELDDPAGFLWSFVGGQPKINHFAGRAEVPAITPEAEAMSKALRRAGFNFVGPTICYA
                     LMQASGMVMDHTQDCDRYAQLVG"
     gene            21095..21982
                     /locus_tag="HWH41_00070"
     CDS             21095..21982
                     /locus_tag="HWH41_00070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysophospholipid acyltransferase"
                     /protein_id="QOD45357.1"
                     /translation="MEKFKGALVVGALRLFALLPWRAVQGVGAGIGWLMWKLPNRSRE
                     VVRINLSKCFPELSETELEKLVGQSLMDIGRTLTESACAWIWPPEKSLRYIREVEGME
                     VLEEALASGDGLVGITSHLGNWEVLNHFYCSYAKPIIFYRPPKLKAVDELLKKQRVQL
                     GNRVAPSTPEGILSVIKEVKKGGCVGIPADPEPARTAGLFVPYLGTTALISKFVPQLL
                     SRGKARGVFFHAVRLPDGSGYKVILEAAPADMYDKDLEVSVAAMSRELAKYVRAYPSQ
                     YMWSMKRFKNRPDGEKKWY"
     gene            22067..22333
                     /locus_tag="HWH41_00075"
     CDS             22067..22333
                     /locus_tag="HWH41_00075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PilZ domain-containing protein"
                     /protein_id="QOD45358.1"
                     /translation="MDNQRQYPRTPLKCRIRISHPLFGELMAQTRDLSDTGVYVKHPD
                     LTQLPTGSVVTGQVQDLPIDAPILQMEVVRVDAEGVGLRFLSEA"
     gene            22480..23133
                     /locus_tag="HWH41_00080"
     CDS             22480..23133
                     /locus_tag="HWH41_00080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="7-cyano-7-deazaguanine/7-aminomethyl-7-
                     deazaguanine transporter"
                     /protein_id="QOD45359.1"
                     /translation="MSASSPAAWRGTLAGLIAFHIVIIIASNYLVQLPITLFGWHTTW
                     GAFSFPFIFLATDLTVRLLGKGPARLVIARVMIPALIASYVVSVLFQEAAFRGFSALL
                     EFNTFVARISLASFLAYVLGQILDIQVFDRLRRSRHWWTAPVASTILGNLLDTFTFFF
                     VAFWRSDNPFMAQHWVEIATVDYGVKLSISLLLFVPLYGMLLNGILKMLPGRPQSNA"
     gene            complement(23195..23467)
                     /locus_tag="HWH41_00085"
     CDS             complement(23195..23467)
                     /locus_tag="HWH41_00085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45360.1"
                     /translation="MSKHERSVPSYVEYPYEQAILYVHRNASANEMLESVQERLRALL
                     GLLQALERIEVRTGQGVPIQRVAHILVTLGGDALTLLTAAHRATTS"
     gene            complement(23782..24099)
                     /locus_tag="HWH41_00090"
     CDS             complement(23782..24099)
                     /locus_tag="HWH41_00090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="QOD45361.1"
                     /translation="MMIEGLEKMLAKGVDNALLRFGLGKGYLDAGDAERATEHLQRCV
                     EQDPKYSAGWKLLGKARQAAGDLAGARQAWEQGLAAAATHGDKQAEKEMTVFLRKLDR
                     ART"
     gene            complement(24248..25621)
                     /gene="trkA"
                     /locus_tag="HWH41_00095"
     CDS             complement(24248..25621)
                     /gene="trkA"
                     /locus_tag="HWH41_00095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Trk system potassium transporter TrkA"
                     /protein_id="QOD45362.1"
                     /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLD
                     IRTVQGKASFPTVLRQAGADDADMLVAVTNSDETNMVACQVAYTLFNTPTKIARVREP
                     AYLTRTGLFDNEAIPVDVLISPEQVVTNYIKRLIEHPGALQVIDFAEGKAQLVGIKAY
                     YGGPLVGQELRQLREHMPNVDTRVAAIYRRNRPIIPQGDTVIEADDEVFFIAAKAHIR
                     AVMGEMRRLDDSYKRIIIAGGGNVGERLAEAIESRYQVKIIERSPLRCRHLSDTLDST
                     IVLNGSASDRDLLLEENIGETDVFLALTNDDEANIMSSLLAKRLGASKVMTLINNPAY
                     VDLVQGGEIDIAISPQLATIGTLLAHVRRGDIESVHSLRRGAAEAIEVVAHGDAKSSK
                     VIGRSINEIKLPPGTTIGALVRDEEVLIAHGDTHIESGDHVLLFLVDKKYIRDVERLF
                     QAGLTFF"
     gene            complement(25648..26952)
                     /gene="rsmB"
                     /locus_tag="HWH41_00100"
     CDS             complement(25648..26952)
                     /gene="rsmB"
                     /locus_tag="HWH41_00100"
                     /EC_number="2.1.1.176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA (cytosine(967)-C(5))-methyltransferase
                     RsmB"
                     /protein_id="QOD45363.1"
                     /translation="MNPRLAACQALAAVLAGRASLSGALPPQLDKVAPRDRGLTQELA
                     FGAARWQPRLQALAARLLQKPFKAADTDIHALLLIGLYQLLYTRIPPHAAIGETVGCA
                     DKLKKGWAKGVLNAVLRRAQREGETLLAEVDRDPSARLGHPRWLLKALKQAWPEQLDT
                     LCAANNAHPPMTLRVNRRHGERDAYLAELAEAGIEARACDYSRDGIQLAAPRDVRELP
                     GFAEGRVSVQDEAAQLAAELLESAPGQRVLDACCAPGGKTCHLLETQPGLAEVIAVDL
                     EESRLVRVRENLQRLGLQASLVAADARATGEWWDGKPFQRILLDAPCSATGVIRRHPD
                     IKLARKPEDIAALAHLQGELLDALWPTLEVGGVLLYATCSVMPAENSDSIAAFLARTP
                     GARELDLPGPWGMKQPHGRQLLPQVEGHDGFYYAKLIKISAR"
     gene            complement(26949..27893)
                     /gene="fmt"
                     /locus_tag="HWH41_00105"
     CDS             complement(26949..27893)
                     /gene="fmt"
                     /locus_tag="HWH41_00105"
                     /EC_number="2.1.2.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="QOD45364.1"
                     /translation="MSQALRIVFAGTPEFAAEHLKALLDTPHRIVAVYTQPDRPAGRG
                     QKLMPSAVKSLALEHGLPVMQPQSLRNAEAQAELAALRADLMVVVAYGLILPQAVLDI
                     PRLGCINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMQMEAGLDTGPMLLKVSTPIS
                     AADTGGSLHDRLAALGPKAVVEAIAGLAAGTLHGEVQDDALATYAHKLNKDEARLDWS
                     RPAVELERQVRAFTPWPVCHTSLADAPLKVLGASLGQGSGAPGTILEASRDGLLVACG
                     EGALRLTRLQVPGGKPLAFADLYNSRREQFATGQVLGQ"
     gene            complement(27948..28454)
                     /locus_tag="HWH41_00110"
     CDS             complement(27948..28454)
                     /locus_tag="HWH41_00110"
                     /EC_number="3.5.1.88"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="QOD45365.1"
                     /translation="MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPG
                     IGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEDMDQYQEGCLSVPGFYENV
                     DRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKL
                     EKQHRQQA"
     gene            28593..29618
                     /locus_tag="HWH41_00115"
     CDS             28593..29618
                     /locus_tag="HWH41_00115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysM peptidoglycan-binding domain-containing
                     protein"
                     /protein_id="QOD45366.1"
                     /translation="MRKSLVALLLLAASGLAQAQVDLREGHPDRYTVVRGDTLWDISG
                     KFLRQPWKWPELWHANPQIQNPHLIYPGDTLSLVYVDGQPRLVLNRGESRGTIKLSPK
                     IRSTPIAEAIPTIPLDKINSFLLANRIVDDEKTFTSAPYIVAGNAERIVSGTGDRIYA
                     RGKFADGQPAYGIFRQGKVYIDPKTKEVLGINADDIGGGEVVATEGDVATLALTRTTQ
                     EVRLGDRLFPTEERAVNSTFMPGEPSREVKGEIIDVPRGVTQIGQFDVVTLNRGQRDG
                     LAEGNVLAIYKVGETVRDRVTGESVKIPDERAGLLMVFRTYKKLSYALVLMASRPLSV
                     TDRVQNP"
     gene            29753..30841
                     /gene="dprA"
                     /locus_tag="HWH41_00120"
     CDS             29753..30841
                     /gene="dprA"
                     /locus_tag="HWH41_00120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-protecting protein DprA"
                     /protein_id="QOD45367.1"
                     /translation="MKNHSPAELEARLRLHGLPELGPMRFLRLIEAFGSASSALAAPA
                     GAWRTLGVPAEAAAARRSPAVREAAGEALRWLEGPRRHLLMWDDPGYPALLAEVADAP
                     PLLYVEGAPETLERPQLAMVGSRRASPAGLGTARSFARSLAQGGFAITSGLALGIDGA
                     AHEGALEVGGATVAVLGTGLRRLYPRRHEALARRIVEGGGALVSELPLDSPPLPANFP
                     RRNRIISGLSLGVLVVEASPASGSLITARLAAEQGREVYAIPGSIHHPGARGCHQLIR
                     DGALLVESVGHVLEALRGWAQAEPAEAPVQPLPHPLLALLRAAPYTSEGLAAASGMTL
                     PDVLATLSELELDGRVACEAGTWVHRSG"
     gene            30882..31439
                     /locus_tag="HWH41_00125"
     CDS             30882..31439
                     /locus_tag="HWH41_00125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonylcarbamoyl-AMP synthase"
                     /protein_id="QOD45368.1"
                     /translation="MISSFRAQCAARVVREGGVIAYPTEAVWGLGCDPWNEDAVYRLL
                     ALKARPVEKGLIVVAANIHQLDFLLEDLPDVWLDRLAGTWPGPNTWLVPHQERLPEWV
                     TGVHDSVAVRVTDHPLVQELCHLTGPLISTSANPAGRPAARTRLRVEQYFHDELDAIL
                     GGALGGRRNPSLIRDLVTGQVIRPA"
     gene            complement(31449..32426)
                     /locus_tag="HWH41_00130"
     CDS             complement(31449..32426)
                     /locus_tag="HWH41_00130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="QOD45369.1"
                     /translation="MAKRIQFAAYGGPEVLEYRDYQPAEPGPREVRVRNRAIGLNFID
                     TYYRSGLYPAPGLPSGLGSEGAGEVEAVGSEVTRFKVGDRVAYATGPLGAYSELHVLA
                     EEKLVHLPDGIDFEQAAAVMLKGLTTQYLLRQTYELRGGETILFHAAAGGVGLFACQW
                     AKALGVQLIGTVSSPEKARLARQHGAWETIDYSHENVARRVLELTDGKKCPVVYDSVG
                     KDTWETSLDCVAPRGLLVSFGNASGPVTGVNLGILSQKGSLYVTRPTLGSYANTPEKL
                     QAMADELFGLIERGDIRIEINQRFALAEAARAHTELAARRTTGSTVLLP"
     gene            32617..33534
                     /gene="hemF"
                     /locus_tag="HWH41_00135"
     CDS             32617..33534
                     /gene="hemF"
                     /locus_tag="HWH41_00135"
                     /EC_number="1.3.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxygen-dependent coproporphyrinogen oxidase"
                     /protein_id="QOD45370.1"
                     /translation="MTDRIAAVKTYLLDLQDRICAALEAEDGKARFAEDAWERPAGGG
                     GRTRVIGDGALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPH
                     VPTSHANVRFFCAEKEGEEPVWWFGGGFDLTPYYAHEEDCVHWHRVARDACAPFGADV
                     YPRYKEWCDRYFHLKHRNEPRGIGGLFFDDLNQWDFDTCFAFIRAIGDAYIDAYLPIV
                     QRRKHTPFDERQREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRWG
                     YDWKPEPGSEEARLTEYFLADRDWLAGQP"
     gene            33592..34416
                     /gene="aroE"
                     /locus_tag="HWH41_00140"
     CDS             33592..34416
                     /gene="aroE"
                     /locus_tag="HWH41_00140"
                     /EC_number="1.1.1.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate dehydrogenase"
                     /protein_id="QOD45371.1"
                     /translation="MDRYCVFGNPIGHSKSPLIHRLFAEQTGEALVYDAQLAPLDDFP
                     GFARRFFEQGKGANVTVPFKEEAYRLVDELSERATRAGAVNTLIRLADGRLRGDNTDG
                     AGLLRDLTANAGVELRGKRVLLLGAGGAVRGVLEPFLGECPAELLIANRTARKAVDLA
                     ERFADLGAVRGCGFAEVEGPFDLVVNGTSASLAGDVPPLAQSVIEPGRTVCYDMMYAK
                     EPTAFNRWAAERGAARTLDGLGMLVEQAAEAFFLWRGVRPASAPVLETLRRQLATV"
     gene            34527..35513
                     /locus_tag="HWH41_00145"
     CDS             34527..35513
                     /locus_tag="HWH41_00145"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase"
                     /protein_id="QOD45372.1"
                     /translation="MKTFARLAAGLCICAIASQANAWSQPTHKNIVKDALAFMNSSYA
                     TEEMRQAYRFYVSAAGSEAQAGEILGQAAFDVDDFKDTRLGGWWVGYEHAPLWGAASG
                     IVNYTSYWHFLNLARDGDSHGNPHGGYDYRYHKVDGGIADVDWYAMVYLYNRELKRED
                     FDTTEAHYRQGTRSDWQEHYGDFQTAAFQPIDNLATYWFEQFRAAPSLQTIGYALHAT
                     GDVAQPHHVWITSANGHSSWEGWVDDHYASEKLNDPAAVANLVGRYDPSKSIRDLLTQ
                     TGQVAYARPEPLYDTSYETRLRVAKELIPESIALTVTVLTKGANSFDAQTAL"
     gene            35494..36780
                     /locus_tag="HWH41_00150"
     CDS             35494..36780
                     /locus_tag="HWH41_00150"
                     /inference="COORDINATES: protein motif:HMM:NF024545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="QOD45373.1"
                     /translation="MHRLLSDRARGWRRALCGVALGLLAWSAHGVPAKAPQDLRIDGE
                     VLPGKSVDLLEQALSRVKFNTDPQQLRRGLVENRLLARAVEDQLTAQSRADLDASVEI
                     EAGNLLEQVYGRRYREDLGPYLRQPRALSAERLREVLAPRSRGLVENSLLLDETQRRE
                     AAGVELIGWQFPGQPAQVLDLLSLYEGDNVQGQVELQQGNLAYLARQVQTRIRRDYLW
                     YRLARDGFGPAERQGVRTLVRDKLVRHRYLHQIGLYSDFHHESEALRELAGKVSDKDA
                     EAYYRRNLERYRNVAQVQAAHIRLADQASADKVYAELRNGLAFDEAVRRYSLADDRDR
                     DPPGDLGLIRPQDGRLDLLRKTALIQKADTVSQPMRIDGAFEIVRVRSREDRQLPLGD
                     RSVRFEVNQAVAREQLAAQFETRLRNLLAGARVEGL"
     gene            36777..37379
                     /locus_tag="HWH41_00155"
     CDS             36777..37379
                     /locus_tag="HWH41_00155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45374.1"
                     /translation="MKRWLGVALGCSGLAIALACAGVLLAPADMAASSSSPPPARTVA
                     ALPAVDDRPPPLAPVRSQAVAPAYEAEPPAAELDREQAIQFMQMLRDEGDPRSPPLGG
                     LQPRQGATAQELADPKQYQAFEERQTRELVQAYTSGVQQIPEIRARIEAAEQGGERSA
                     EEIDEARAALGQLEMMRDKLQRESPQLLPGDSAPTSPAAP"
     gene            complement(37383..38936)
                     /locus_tag="HWH41_00160"
     CDS             complement(37383..38936)
                     /locus_tag="HWH41_00160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SulP family inorganic anion transporter"
                     /protein_id="QOD45375.1"
                     /translation="MWTRLLPFLAWLPGLHRGMLGREAWVGLNGAILALPQSMAYALI
                     AGLPAEYGLYAAMLPVAIACLWGSSRHLVSGPTAAISVLLFSSVAPLAPLGSPQYVQA
                     VLLLTFLAGAFQWLLGVLRVGSLVNFVSHSVMLGFTLGAALLIVLGQLPYLLGLAASG
                     EGAAPGNGWRLLARFAEFDGPSLLVGGFSFALSLLVRRLRPRWPALLLGLLGGATLVW
                     ALPGTFASVAHVQALSSALPGWNPLVFDSRSILDLLPAAVACGMLGLVTSLSIARALA
                     ARQGDAFDANQEVRAQGLSNLLGPWLSASLSAGSFTRSGLNLEAGARSPLAGAFSALW
                     VALLAVLGARLIEHVPLPAMAAGILLIAWGLIDRPALRALYRSGRAECLVAGLTALAT
                     LLLPLQNAIYAGVLASLVFYLRRTSTPRVLRQHNDEEEVLRIEGSIFFGACDYLQRLM
                     RQCDRPRLVLDARQVNFIDFAGAVLLQQEARRLHAEGRRLVLRHARPQVREALGRQAD
                     EGCRLHYEG"
     gene            complement(38941..39864)
                     /locus_tag="HWH41_00165"
     CDS             complement(38941..39864)
                     /locus_tag="HWH41_00165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="choline ABC transporter substrate-binding
                     protein"
                     /protein_id="QOD45376.1"
                     /translation="MNRLPTCLLAATLFLGSASLYAEDPACARVRLADPGWSDIAVTN
                     ATAAFLLESLGYQVKIDTLSVPIIYGGLRDGQVDAFLGGWMPAHQDYHDKFVASGQVE
                     RLGRNLDGTRFTLAVPRYVWDAGVHRFEDLAAQGQRFNRKLYGIGSGAPANQSIQKMI
                     DANQFGLGDWKLVESSEQAMLAELGRAEKRQRWLVFLGWTPHPMNIRHDLRYLEGGEQ
                     YFGDRGQVYTLARKGYAAQCPNPARLLANLRFDLDMENRLMSDALEGTATPASATRAW
                     LKANPRVLEAWLQGVTSRDGGDALAAVRGQP"
     gene            complement(39881..41392)
                     /gene="betC"
                     /locus_tag="HWH41_00170"
     CDS             complement(39881..41392)
                     /gene="betC"
                     /locus_tag="HWH41_00170"
                     /EC_number="3.1.6.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="choline-sulfatase"
                     /protein_id="QOD45377.1"
                     /translation="MKTSPNILFIMADQMAAPLLPLHDPRSVLRMPHLSRLAERAVVF
                     DSAYCNSPLCAPSRFTLVSGRLPTRIGAWDNAADFAADTPTYAHYLRNLGYRTALSGK
                     MHFCGPDQLHGYEERLTSDIYPADYGWAVNWDEPEVRPSWYHNMSSVLQAGPCVRTNQ
                     LDFDEEVVFKARQYLYDHVRQHAGQPFCLTVSMTHPHDPYSIPASYWNLYRDEDIPLP
                     RQRFAQEEQDPHSQRLLKVIDLWDKPLPEERIRAARRAYFGACSYVDAQIGALLATLE
                     ECGLADDTIVVFSGDHGDMLGERGLWYKMHWFEMAARVPLLVHAPARFAPRRIGASVS
                     TVDLLPTLVELAGGQVDPRLPLEGRSLLPHLRDGSGHDEVIGEYTAEGTLSPLMMIRR
                     GDYKFIYSEQDPCLLYDLRNDPQERENLAASPAHRGTFEAFLDEARRRWDIPAITRAV
                     LDSQRRRRLVAAALARGRLASWDHQPWVDASQQYMRNHIDLDDLERRARFPQP"
     gene            41505..42419
                     /locus_tag="HWH41_00175"
     CDS             41505..42419
                     /locus_tag="HWH41_00175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="QOD45378.1"
                     /translation="MGERLMPLSLDLLRVFESAARQLSFTAAAEELGTTQPAVSQQIK
                     RLEKELATPLFQRVHRGIVLTDAGQLLLRHVAAGLETIDAGIAALGARQRHEVLQVAT
                     DYAFAAYWLMPRLPRFHQAHPHLDVSLVTSERGLAGQRGDIDVAILFGDGRSKHGEAH
                     RLFREEVFPVCSPRLVEGLQLPLAKAHLARLPMLHLKPAQHARWFDWPALFEALAIDR
                     QPIPAVLSFDNYTLLIQAAIAGQGVAIGWRHLVDGLLEQGLLCRPIGESCLSRYGYYA
                     VLPERKRRQRLVDGFVDWLQAELQAGGA"
     gene            42430..42807
                     /locus_tag="HWH41_00180"
     CDS             42430..42807
                     /locus_tag="HWH41_00180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_008719728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DOPA 4,5-dioxygenase family protein"
                     /protein_id="QOD45379.1"
                     /translation="MNEYSTPRIQGFHAHVYFDAQSIERARALCEEAARRFPLKMGRV
                     HERPVGPHPDWSCQLAFAPEVFGELVPWLAIHRQDLVVFIHPVTGNDLLDHRDRAIWM
                     GAIRPLDLSILDEGPQRYDFAVP"
     gene            complement(42786..43151)
                     /locus_tag="HWH41_00185"
     CDS             complement(42786..43151)
                     /locus_tag="HWH41_00185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hpt domain-containing protein"
                     /protein_id="QOD45380.1"
                     /translation="MRTFDLTAALGDRANQPEISRLLVAQLMTSNNEDTRKLRRAQER
                     EQTQELNELAHRLAGMASLIHAHAVERACHQLEIACGESSVRKLADAVDDLVTALGEL
                     QCELHDWMTMTAPQGTAKS"
     gene            complement(43159..43782)
                     /locus_tag="HWH41_00190"
     CDS             complement(43159..43782)
                     /locus_tag="HWH41_00190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="QOD45381.1"
                     /translation="MSKVLIVDDHPAIRLAVRLLFERDGFTIVGEADNGAEALQVARK
                     KSPDLAILDIGIPKIDGLEVIARLKSLKLDTKVLVLTRQNPAQFAPRCLQAGAMGFVS
                     KRENLSELLLAAKAVLAGYIHFPTGALRSINQQSRDNEARMLESLSDREMTVLQYLAN
                     GNTNKAIAQQLFLSEKTVSTYKSRIMLKLNAHSLAGLIDFARRHELI"
     gene            complement(43968..44774)
                     /locus_tag="HWH41_00195"
     CDS             complement(43968..44774)
                     /locus_tag="HWH41_00195"
                     /EC_number="4.2.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit alpha"
                     /protein_id="QOD45382.1"
                     /translation="MSRLQTRFAQLKQENRAALVTFVTAGDPDYASSLEILKGLPAAG
                     ADVIELGMPFTDPMADGPAIQLANIRALDGGQTLARTLQMVREFRSGDSETPLVLMGY
                     FNPIHHYGVERFIAEAKEVGVDGLIVVDLPPEHNEDLCHPAQAAGLDFIRLTTPTTGD
                     QRLPTVLEGSSGFVYYVSVAGVTGANAATLEHVEEAVARLRRHTDLPIGIGFGIRSAE
                     HAAAVARLADGVVVGSALIDRIAKARDNAQAVKDVLALCGELAEGVRNAR"
     gene            complement(44771..45979)
                     /gene="trpB"
                     /locus_tag="HWH41_00200"
     CDS             complement(44771..45979)
                     /gene="trpB"
                     /locus_tag="HWH41_00200"
                     /EC_number="4.2.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit beta"
                     /protein_id="QOD45383.1"
                     /translation="MTSYRNGPDAKGLFGRFGGQYVAETLMPLILDLAREYEKAKDDP
                     AFQEELAYFQRDYVGRPSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQIL
                     LARRMGKKRIIAETGAGMHGVATATVAARFGLQCVIYMGTTDIDRQQANVFRMKLLGA
                     EVIPVTAGTGTLKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKET
                     REQLAEKEGRLPDSLVACIGGGSNAMGLFHPFLDDAGVQIVGVEAAGHGIDTGKHAAS
                     LNGGVPGVLHGNRTFLLQDADGQIIDAHSISAGLDYPGIGPEHAWLHDTGRVEYTSIT
                     DDEALEAFHTCCRLEGIIPALESSHALAEVFKRAPSLPKEHIMVVNLSGRGDKDMQTV
                     MHHMQQESKA"
     gene            46083..46970
                     /locus_tag="HWH41_00205"
     CDS             46083..46970
                     /locus_tag="HWH41_00205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="QOD45384.1"
                     /translation="MSRDLPSLNALRAFEAAARLHSISLAAEELHVTHGAVSRQVRLL
                     EDDLGVALFGKDGRGVKLTDSGVRLRDACGDAFERLRGVCAELRRQTAEAPFVLGVPG
                     SLLARWFIPRLDRLNRALPDLRLQLSTSEGEFDPRRPGLDAMLWFAEPPWPADMQVFE
                     LAPERMGPVVSPRLAQETGLAQAPAARLLQEPLLHTASRPQAWPAWAASQGLAAEALR
                     YGQGFEHLYYLLEAAVAGLGVAIAPEALVRDDLAAGRLAAPWGFIETDARLALWVPAR
                     LHDPRAGRLAQWLREQLAG"
     gene            47071..47286
                     /locus_tag="HWH41_00210"
     CDS             47071..47286
                     /locus_tag="HWH41_00210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dodecin family protein"
                     /protein_id="QOD45385.1"
                     /translation="MSNHHTYKKIELVGSSKTSIEDAINNALAEAAKSIQHLEWFEVV
                     DTRGHIENGAVGHYQVTLKVGFRIANS"
     gene            47470..47697
                     /locus_tag="HWH41_00215"
     CDS             47470..47697
                     /locus_tag="HWH41_00215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1161 domain-containing protein"
                     /protein_id="QOD51079.1"
                     /translation="MFMKKLMLAVGLFAVAGSAFAAKPCEELKAEIDAKIKANGVPAY
                     TLEIVDKGSVTDKKVVGTCDGGTKEIVYQRG"
     gene            47995..>48143
                     /locus_tag="HWH41_00220"
     CDS             47995..>48143
                     /locus_tag="HWH41_00220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45386.1"
                     /translation="MALHRLAFIFLCLPLMASAAPFTSPGDRDLIRDRQQRLLDEQRK
                     RLEEL"
     assembly_gap    48144..51112
                     /estimated_length=2969
                     /gap_type="within scaffold"
                     /linkage_evidence="align genus"
     gene            <51113..>52023
                     /locus_tag="HWH41_00225"
     CDS             <51113..>52023
                     /locus_tag="HWH41_00225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45387.1"
                     /translation="GLLQSRDRAVVKTRGDLDNRGGQVIGLNDLEVGAATLDNGQQGL
                     LGSQQSTRVSAQALVNRGDGEVSGKRVEARVGSLDNRGGKLIGDDLLVVASGAIDNRL
                     GLFSAANRLDLRARSLDNSGKGTLSSRGGLEVSLGGLLDNRDEGNLLSQGAQRVTVGQ
                     LDNRAGGLLSSRSELNVHGASLDNRGGVLVADAGLSATGGAFDNRDGGSASGKAGVRV
                     EVASLRNDQGGKLLSDGRLDLAANAVGNAGGRIAAKGDLQATLGSLAQQGGELVSEKT
                     LKVAADTLDNSQSGLIAANGGIAIEAR"
     assembly_gap    52024..55602
                     /estimated_length=3579
                     /gap_type="within scaffold"
                     /linkage_evidence="align genus"
     gene            55603..59217
                     /locus_tag="HWH41_00230"
                     /pseudo
     CDS             55603..59217
                     /locus_tag="HWH41_00230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248731.1"
                     /note="frameshifted; too many ambiguous residues;
                     incomplete; partial in the middle of a contig; missing
                     N-terminus and C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DUF637 domain-containing protein"
     assembly_gap    57196..57206
                     /estimated_length=11
                     /gap_type="within scaffold"
                     /linkage_evidence="align genus"
     assembly_gap    58333..58343
                     /estimated_length=11
                     /gap_type="within scaffold"
                     /linkage_evidence="align genus"
     gene            59695..60300
                     /locus_tag="HWH41_00235"
     CDS             59695..60300
                     /locus_tag="HWH41_00235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001442996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA/RNA non-specific endonuclease"
                     /protein_id="QOD51080.1"
                     /translation="MLAKAKALYKEGKVSEAADLVEGLGKLPAPQGPKGTGTALREVE
                     VSSGSKGSWTKELNKPEPNTIYKVDGNKTYQTDSLGRVEKVESNLSLTKSDRNTYQQC
                     IAGKCGVSGDEGGHLIASIFNGPGEKLNLLPMNGNLNKGAWKSMENTWSSALKQGQMV
                     SVKIEPVYSGSSVRPDRFTVRYSIDGGRPVIVDFKNSPGGI"
     gene            60300..60629
                     /locus_tag="HWH41_00240"
     CDS             60300..60629
                     /locus_tag="HWH41_00240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019106673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45388.1"
                     /translation="MGDQELYQKIGQLLVDAGPADAREIIVRAELFSEGDGGKYEFDY
                     VDQSGELNWFDPDGRAVGDLTELLVQLRDYFSANNLTAGEGGWSGCVIKLHVDEMKFG
                     IAFNYGK"
     gene            61054..61296
                     /locus_tag="HWH41_00245"
     CDS             61054..61296
                     /locus_tag="HWH41_00245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003118488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="QOD45389.1"
                     /translation="MRYPCPCCGYLTFDEEPCGTYEICPVCYWEDDIAQNKDPDYDGG
                     ANGISLNNAKENFFKYGAIKRVFLKNVRKPLDDESL"
     assembly_gap    61466..61476
                     /estimated_length=11
                     /gap_type="within scaffold"
                     /linkage_evidence="align genus"
     gene            61477..61643
                     /locus_tag="HWH41_00250"
                     /pseudo
     CDS             61477..61643
                     /locus_tag="HWH41_00250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_008719729.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus and C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            61815..62348
                     /locus_tag="HWH41_00255"
     CDS             61815..62348
                     /locus_tag="HWH41_00255"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45390.1"
                     /translation="MNSSCQHVLCGLMDFSKKLPDNVVKVKKGMAFFVERSALYSLSI
                     LKLLFFVSVNCGAKKIFFCFLVAQKNKFEISSVYEVDLLEVNFTEIENRLFSLYEEHV
                     LVGEVGRIVAFSDMVSWVLYEEVLEEIGVLVMLDETRSVYSNFDFGEFVSREFMMEQA
                     DLGLYRKEYVDKLISNY"
     gene            62559..62816
                     /locus_tag="HWH41_00260"
     CDS             62559..62816
                     /locus_tag="HWH41_00260"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45391.1"
                     /translation="MHEFVGGCWFVFEGAHFSKRITNEYTDGREESAGNKVIQEFGSR
                     SCIDALSREYLLEGVLEVQPGPGWVLWYIYAKSFHIEIPDV"
     gene            62928..63369
                     /locus_tag="HWH41_00265"
                     /pseudo
     CDS             62928..63369
                     /locus_tag="HWH41_00265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_008719729.1"
                     /note="frameshifted; too many ambiguous residues; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     assembly_gap    63099..63109
                     /estimated_length=11
                     /gap_type="within scaffold"
                     /linkage_evidence="align genus"
     gene            63619..64131
                     /locus_tag="HWH41_00270"
     CDS             63619..64131
                     /locus_tag="HWH41_00270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005766397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45392.1"
                     /translation="MSYLPIRVWTDFQSAVRLLSAEASPKEVLDLILNWIKRNRKFFL
                     SGSFAVYGFEEFLGLSGEEMPVNFSNFSSSELENFKKFTFKYQAKDVDYIAQFLRDVI
                     EALITVEVDKKCPNCNSEGMHVFIGKYNNLVAYQCNVCGHSQYSDGSKVEVGGLEFIT
                     ERKLRDLKLI"
     assembly_gap    64214..64886
                     /estimated_length=673
                     /gap_type="within scaffold"
                     /linkage_evidence="align genus"
     gene            65093..65488
                     /locus_tag="HWH41_00275"
     CDS             65093..65488
                     /locus_tag="HWH41_00275"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45393.1"
                     /translation="MPVLALRLTALAALAISVSGCVMEAYGSRARSDAQSWIGLPIQD
                     VIKRFGEPERVTGDAARQKYVWKEYENYSHDYDYTYYEQGHGNTPNSSVLNQKTGTAN
                     QSGYYTCIYEFFADASGRVVDATARGECR"
     gene            complement(65753..67162)
                     /locus_tag="HWH41_00280"
     CDS             complement(65753..67162)
                     /locus_tag="HWH41_00280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019371294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MgtC/SapB family protein"
                     /protein_id="QOD45394.1"
                     /translation="MRLHRGGEPDGYRRQRRPHGGRRTAVRAPRGRLLLWCAQARRHP
                     LSRRMESSMTLSLDLLLSLCTALAIGLLIGAERGWQERDHEDARQIAGIRTFSLAGLL
                     GGFATLLAGELGSAVWVALLLALAALAVAGYVSDVRRGGDQGMTTEIALLMTFLLGSL
                     ALTEQRLLAAAGGIVLTLLLSLKDKLHALLKRLTAEELSGTLKLLFISVVLLPVLPNQ
                     GYGPWAFFNPYLTWWMVVLIAALGFSAYLAIRLIGSRKGLLLTAVLGGLVSSTVMTLT
                     LARLRERMPDALLACALLATSALMFPRILVEIGAIHPALLKELALPFAATTLVYLGGT
                     LFHALRGGRASQEAPDEPGLRNPFELLPAMRFAALLSAILLLVEVGRRLFGDAGIYAV
                     ALLSGLADVDAITLSLARAAQGELDPGVASRGIALAALSNSLVKAGLVVLVGGKRLAL
                     QTLPFSLAGLLVGALLILL"
     gene            67326..68699
                     /gene="exoT"
                     /locus_tag="HWH41_00285"
     CDS             67326..68699
                     /gene="exoT"
                     /locus_tag="HWH41_00285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T3SS effector bifunctional cytotoxin exoenzyme
                     T"
                     /protein_id="QOD45395.1"
                     /translation="MHIQSSQQNPSFVAELSQAVAGRLGQVEARQVATPREAQQLAQR
                     QEAPKGEGLLSRLGAALARPFVAIIEWLGKLLGSRAHAATQAPLSRQDAPPAASLSAA
                     EIKQMMLQKALPLTLGGLGKASELATLTAERLAKDHTRLASGDGALRSLATALVGIRD
                     GSRIEASRTQAARLLEQSVGGIALQQWGTAGGAASQHVLSASPEQLREIAVQLHAVMD
                     KVALLRHAVESEVKGEPVDKALADGLVEHFGLEAEQYLGEHPDGPYSDAEVMALGLYT
                     NGEYQHLNRSLRQGRELDAGQALIDRGMSAAFEKSGPAEQVVKTFRGTQGRDAFEAVK
                     EGQVGHDAGYLSTSRDPGVARSFAGQGTITTLFGRSGIDVSEISIEGDEQEILYDKGT
                     DMRVLLSAKDGQGVTRRVLEEATLGERSGHGEGLLDALDLATGTDRSGKPQEQDLRLR
                     MRGLDLA"
     gene            69195..69881
                     /locus_tag="HWH41_00290"
     CDS             69195..69881
                     /locus_tag="HWH41_00290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CsgG/HfaB family protein"
                     /protein_id="QOD45396.1"
                     /translation="MSHSANKALLPLLAVATLAGLAGCATETSTALPVQQVESVNRPY
                     SGVRSPIAVGKFDNRSSYMRGIFSDGVDRLGGQAKTILITHLQQTNRFNVLDRDNMSE
                     IQQEAAIKGQAQRLKGADYVVTGDVTEFGRKEVGDRQLFGILGRGKSQIAYAKVALNI
                     VNISTSEVVYSTQGAGEYALSNREVIGFGGTASYDSTLNGKVLDLAMREAVNKLVNAV
                     DSGAWKPQNQ"
     gene            69912..70265
                     /locus_tag="HWH41_00295"
     CDS             69912..70265
                     /locus_tag="HWH41_00295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4810 domain-containing protein"
                     /protein_id="QOD45397.1"
                     /translation="MSKTITWTAALLGSMALAGCSGPKTLYQWEGYQAQVHEYFKGES
                     KEAQAQALEADLEKIRAKNGAVPPGYHAQLGLLYSSIGKDDQMVREFETEKALFPESA
                     TYMDFLLNNARGGAR"
     gene            70262..70927
                     /locus_tag="HWH41_00300"
     CDS             70262..70927
                     /locus_tag="HWH41_00300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003083573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF799 domain-containing protein"
                     /protein_id="QOD45398.1"
                     /translation="MKLARLSGLVAGFTLLALLGGCAPTKSVDYSAFKQAKPRSILVL
                     PPLNESPDVKATYSMLSQVTFPLAEAGYYVVPVALADETFRQNGLTSAGDVHQVSPAK
                     LREIYGADAALYVTVSDYGTRYMVISSATIVTASAKLVDLRSGTTLWTGSATASSEEG
                     NGGNNGGLVGMLITAAVKQIINSSVEDAGYPIAGMTSARLLSAGQPGGLLYGPRSPRY
                     GSD"
     gene            complement(70942..71325)
                     /locus_tag="HWH41_00305"
     CDS             complement(70942..71325)
                     /locus_tag="HWH41_00305"
                     /inference="COORDINATES: protein motif:HMM:NF024949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QOD45399.1"
                     /translation="MSFAQNLLRLRQQNALTQRQMAERLGVTVSQLRHFETKGGHPSL
                     VVLQTIAGRFAVPLDWLVCERSERQALPEDLRLQFEAIGRLRLDERRAIRALLDDLIR
                     QYMAKRNAAAKPLPAACAEATETSP"
     gene            complement(71607..73115)
                     /locus_tag="HWH41_00310"
     CDS             complement(71607..73115)
                     /locus_tag="HWH41_00310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020750948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD51081.1"
                     /translation="MSYEERRLDTPLPFSGANVVTHDQTPLAERIVKGAGFDGFEPAF
                     AKRLCAADGRTPVSSYAKALKLVTEEGRALWRAAVDRAQGRRAIPAGALPASDDRMLY
                     WTRLYMTRTLRQWAPSFHLGKAQAQALQWRFERASRGQLDIDLPRRYAADGSRYRRMI
                     ISGFDVFTLGTPGTANTGLRNGNPSGATALALDGREFRLADGSLLRIEAYLLPVSYDP
                     FNRGMQEDTLGPWFRPGPRRVDASITISQGGANQFWLEAWNGRFHGSSAGNDGIVYCP
                     ADSALPNYVLPLGSVTNPGTAPISLRGSGCNINPPRRWLGYDSASRWRQNLPAQFSKA
                     SLPVRQLLAADTWRGIERPPGATSQAAEGFDVTWHTNYDFFPDCANPRTENVPTNGVM
                     NAMPDPSLVLPPNRRICARNGGGGDYLSNESAYRNTVLRDAFRLEIPAGHIHVPVMNN
                     YYTGVPASGGGARNDNAISDARYEAYRSAIVAQTRALLVGVGNALAQGAQAD"
     gene            73880..74020
                     /locus_tag="HWH41_00315"
     CDS             73880..74020
                     /locus_tag="HWH41_00315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45400.1"
                     /translation="MKRKMLAASLLLWMFSLTAQADCAVLGPGEDPCAGPVLGPTVCE
                     CP"
     gene            74082..74219
                     /locus_tag="HWH41_00320"
     CDS             74082..74219
                     /locus_tag="HWH41_00320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003083584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45401.1"
                     /translation="MKKVLLAVFLLCGFSLTAQAACPVFGPSEDPCSGPVFGPSTCEC
                     P"
     gene            74837..76669
                     /gene="asnB"
                     /locus_tag="HWH41_00325"
     CDS             74837..76669
                     /gene="asnB"
                     /locus_tag="HWH41_00325"
                     /EC_number="6.3.5.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthase (glutamine-hydrolyzing)"
                     /protein_id="QOD45402.1"
                     /translation="MCGLAGWVDYTRKLDDEFPAIFAMTDTLALRGPDAEGIWKHRNA
                     LLGHRRLAVIDLSGGVQPMSYRFPTGQEVTLVYTGEVYNHDALRERLRRAGHEFRTRS
                     DTEVVLHAYLQWGEHCCEHLTGMFAFAVFDGRDGHLLLVRDRLGIKPLYYARHREGLL
                     FGSEIKSILAHPEFAARLDAVGLVDLLTLSRGTSQTPFREVQELLPGHLLSWRPNSQA
                     KLRRYWEVRRQEHADDLQSTVQRTRELVTRALGSQLHADVPVCSLLSGGLDSTALTGI
                     AQRIAKAEHGGDINSFSVDFVGQAEQFRSDDLRPDQDQPFALLAAQYIGSRHRTVLIE
                     NAELVCERAREEVFRAKDVPFTFGDMDTSLHLMFGEIRRHSTVAISGEGADELFGGYG
                     WFRDPQAVAAARFPWASRVHLPAGFIDAGFNRRCDLLQYQQASYDDGLRQVEHLAGDS
                     PEERRMREFSHLHLKRWMVLLLERKDRLSMCNGLEVRVPYTDHELVEYVYNVPWSIKS
                     RDGEEKWLLKRACADYVPEAVLKRRKSPYPTSANLGYERFLRGSVRRLLEDAANPVFG
                     IVSREFLAAELEHPEGYFNTQVSRHNLETALALEGWLRLYGLSA"
     gene            complement(76722..77150)
                     /locus_tag="HWH41_00330"
     CDS             complement(76722..77150)
                     /locus_tag="HWH41_00330"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="QOD45403.1"
                     /translation="MDLRPSHVHVFPPSRDLPAATSPHRETLLRSGCAWNGSLYLGYP
                     LGQPQLTVQRLSLAAHERLDWQVHPMPSALYVLKGELRLETRDGAQSTRVLEGEAAGC
                     LMNIIHRLIAGAEPVEALLFHAGVEGMPVGLGERGEMPDA"
     gene            complement(77358..77906)
                     /locus_tag="HWH41_00335"
     CDS             complement(77358..77906)
                     /locus_tag="HWH41_00335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA 2'-phosphotransferase"
                     /protein_id="QOD45404.1"
                     /translation="MDRKTLDDTSKFLSYVLRHQPEAIGLTLDGEGWADIDALIAGAA
                     RDGRALDRVLLGAVVENNDKKRFALSADGQRIRAVQGHSHAAVAIAYAPAVPPAVLYH
                     GTASRFLDSIRERGLVPGSRHHVHLSARRATALEVGRRYGNPVLLEIDARDMHLAGHL
                     FHQAENGVWLTERVPVRFIREA"
     gene            complement(77945..78451)
                     /locus_tag="HWH41_00340"
     CDS             complement(77945..78451)
                     /locus_tag="HWH41_00340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1993 family protein"
                     /protein_id="QOD45405.1"
                     /translation="MSLSIYQASIPTFLRTLGNLSAILKKAAAHAEAKNIDPRIFIDA
                     RLAPDMFPLARQVQIASDAAKGAGARLAGLEVPSYADTETTFDELQARIARTVEFLEG
                     IREEQLDGAEERNVTLKVRGQEISFNGRDFLFGFALPNFFFHVTTAYAILRHNGVELG
                     KMDFLGGA"
     gene            complement(78517..79437)
                     /locus_tag="HWH41_00345"
     CDS             complement(78517..79437)
                     /locus_tag="HWH41_00345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014007183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="QOD45406.1"
                     /translation="MDRLTATRVFVEVIDSGSQTAAAERLDMSRAMVSRYLAELEEWV
                     GARLLHRSTRRLSLTDAGAELLPQCREMLAVADAMQATGQTRRDSPRGTLRITSSLSF
                     AQAWLTRAAAAFVERYPGTAIDLQVNSQVVNLVEERIDLALRIANQLDPNLIARRLGE
                     CRSVICAAPDYLRRHGTPRRPEDLALHNCLTYSYFGRSLWQFERDGEPTSVPVGGSLS
                     ANESTVLLEAAAAGAGISQQPLYSAAPLIRSGRLVALLPEWSPQVLGIHAVYASRRQM
                     PPALRALLDFLVERMAADPHWDEAGPLALA"
     gene            79545..80432
                     /locus_tag="HWH41_00350"
     CDS             79545..80432
                     /locus_tag="HWH41_00350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="QOD45407.1"
                     /translation="MSRHGLLRSLFAAAALLGAAGVFAASAEPLRLEVYNPGEKAIFA
                     VSSELLVGQREAMLIDAQFSRADAEQLVKRIQASGKTLSTIYISHGDPDFYFGLDVLK
                     AAFPEAKILATAQTVAHIQATKDAKLAYWGPILKDNAPTSLVVPEPLKGDQLKLEGHA
                     LKVVDLKGPSPDRTVLWIPSLKTVVGGVLVESGSHVWTADTQTKASRQAWVAMLDRIE
                     ALQPRRVVPGHFTGEEPKGLDGVRFTRDYLKALEAELPKARDSAALVEAMKRRYPNLP
                     GEEGLELSAKVLKGEMQWP"
     gene            80495..81199
                     /locus_tag="HWH41_00355"
     CDS             80495..81199
                     /locus_tag="HWH41_00355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DsbA family protein"
                     /protein_id="QOD45408.1"
                     /translation="MNDLTLHYLYDPLCGWCYGASPLLAAAREVTGLDVRLHGGGMMT
                     DANRQPVGAGLRHYVMPHDLRIAQLTGQPFGKDYFDGLLRDTSAVFDSAPPTAAVLAA
                     EALDGLGAAMLARIQRAHYVEGRRIAERPVLLELGAELGLGEGFAEAFDACSGEPLRA
                     HFADSRRLMNRLGAAGFPTFALERDGRLQVLDTGRYLGQPDDWRAFLETQLRLAGGSG
                     AVGGAAAPLCRIDGCA"
     gene            81283..81738
                     /locus_tag="HWH41_00360"
     CDS             81283..81738
                     /locus_tag="HWH41_00360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OsmC family protein"
                     /protein_id="QOD45409.1"
                     /translation="MSIHSSGGVDMKKTASAVWQGGLKDGKGTLSTESGALKDNPYGF
                     NTRFEGAPGTNPEELIGAAHAGCFSMALSMMLGEAGLTAERIETRAEVTLDKQSDGFA
                     ITAVHLVLRARVPGADAQTFEQIANKAKAGCPVSKVLNAKISLDASLDG"
     gene            81849..82082
                     /locus_tag="HWH41_00365"
     CDS             81849..82082
                     /locus_tag="HWH41_00365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1161 domain-containing protein"
                     /protein_id="QOD45410.1"
                     /translation="MKTIGLGIAALLFSATALAAPKPCEELKAEIETKIQSAGVTSYT
                     LEIVRNDEVSDPNMVVGSCENGTKKIIYQKNDD"
     gene            complement(82094..82531)
                     /locus_tag="HWH41_00370"
     CDS             complement(82094..82531)
                     /locus_tag="HWH41_00370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45411.1"
                     /translation="MRPLTRLVPLALLLLAGCAGPLPQPDPQMAWVELRSAPANTLLA
                     ERLDGERLSDGRYFQVTPGRHVLEVRFQYELYGGSGGGGGGFGEPVQINCYQQVVYDG
                     FEAGRRYRLEVRPQLRRALALLSDERGEVVARSNFQTSRCPPY"
     gene            complement(82588..83004)
                     /locus_tag="HWH41_00375"
     CDS             complement(82588..83004)
                     /locus_tag="HWH41_00375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45412.1"
                     /translation="MRTLLLAGGLLVLSGCSLLMPTPDPNRAWVDLDTQPDADLAAVE
                     VDDKSWDRTRYFEVDPGTRELTVRYQFTVDPTNIGPVDSPLWRDCQLNLKFKDFSAGQ
                     RYRLEAGHIGFRPWAKLYDQDNRELARGREGRCAKV"
     gene            83096..84223
                     /locus_tag="HWH41_00380"
     CDS             83096..84223
                     /locus_tag="HWH41_00380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="QOD51082.1"
                     /translation="MLVGRRAVRVLCYVPPMPRRLRHPLADLRLPRWVPCLALLALSG
                     CSTVSYYGQLASGQFALLRAREPAAAVIADPQRDARLRERLAKAEKARQFASERLGLP
                     DNRSYRLYADIGRPYVVWNVFATPELSLQPVTHCFPIAGCVAYRGYYSEAAARAEAAR
                     QRALGDDVYVGGVQAYSTLGWFDDPILSSMLRWDDERLATLIFHELAHQKFYLRDDTA
                     FNESFATFVEQEGTRQWREYRGLPPADGREEKRREQFTALVLASRARLEALYAGPLDD
                     AAKRAGKAAEFQRLRREYAALSQREWGGESPFKAWIDAPFNNAKLLPFGLYDQWVAAF
                     AALFRQVGGNWPAFYARVRALGQLPLAERQAALQRLAAAAP"
     gene            complement(84231..85214)
                     /locus_tag="HWH41_00385"
     CDS             complement(84231..85214)
                     /locus_tag="HWH41_00385"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45413.1"
                     /translation="MTDNPFATPTAPVQPPAREVPATTQPYAFIAVLALVTCLSFAVS
                     LGIQWYNDIGEIRQRFSEHLQLMAPHWFTGLVFYAAANLLVLHAYREKRRLVEFRPLA
                     LLLIGYGLLNLVCGMLAGIGLAPLTLPFYQWVTAQSSYGVWLMAFNEAMSWVYLLLGS
                     LLPLGLVLLGSRVNSPRLAEGEEARVAAWQVALGAALCFATLCFKLMQFLPYALLRYD
                     EPWLYGLYLSGVALPAALLFGAVCTRLPARLQRFAAGRALLLAVVAMLLWSVALLAVG
                     GGLALLMILGLAPAGIGYTLLVALLGVGLLALLWPIGRLATRWCYADQLAA"
     gene            complement(85247..85912)
                     /locus_tag="HWH41_00390"
     CDS             complement(85247..85912)
                     /locus_tag="HWH41_00390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="QOD45414.1"
                     /translation="MRDATLRYPNILFDLDGTLTDPREGITRSVQFALARLGIDEPDL
                     ARLEHFIGPPLLQCFMQTYGFDEARAWEAVNHYRERFRLTGLYENRVFDGIPELLEAL
                     VGRGHTLYVATSKPGEFAREIARHFAFDRHFKAIYGSELDGTRTHKDELIRHLLDSEG
                     LAAEHCLMIGDRMHDLLGASRNGVACIGVGYGFGSEDELRAHQPTHYCADLAALRQVL
                     ESH"
     gene            complement(85905..86447)
                     /locus_tag="HWH41_00395"
     CDS             complement(85905..86447)
                     /locus_tag="HWH41_00395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma carbonic anhydrase family protein"
                     /protein_id="QOD45415.1"
                     /translation="MTIRSYQGKTPLLGERVFVDPSAVLVGDIEIGTDSSVWPLVVIR
                     GDMHRIRIGQRSSIQDGSVLHITHAGPFNPDGFPLSIGDEVTVGHKVLLHGCSIGNRV
                     LVGMGSIVMDGAVIEDEVILGAGSLVPPGKVLESGFLYVGSPAKKARPLSDKERGFFT
                     YTAGNYVKLKDLHIAEDYHA"
     gene            86525..88570
                     /gene="prlC"
                     /locus_tag="HWH41_00400"
     CDS             86525..88570
                     /gene="prlC"
                     /locus_tag="HWH41_00400"
                     /EC_number="3.4.24.70"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptidase A"
                     /protein_id="QOD45416.1"
                     /translation="MSANPLLQAYDLPPFSSIRPEHVKPAIERILADNRAAIARLLET
                     QREQPTWKGLVLAMDELNDRLGAAWSPVSHLNAVCNSAELREAYEACLPELSAYSTEL
                     GQNRALFEAYEALAKSPEAAGFDVAQKTILEHALRDFRLSGIDLPADKQKRYAEVQSR
                     LSELGSRFSNQLLDATQAWTKHVTDEAALAGLTDSAKAQMKQAAEAKGLDGWLISLEF
                     PSYYAVMTYADDRALREEVYAAYCTRASDQGPNAGQNDNGPVMEEILDLRQELAGLLG
                     FANYAELSLATKMAESSDQVLSFLRDLAVRSKPFAARDLEQLRAYAAEQGCTELQSWD
                     AGYYAEKLREARYSVSQEALRAYFPVDKVLSGLFAIVERLYGIQIRELHDFERWHADV
                     RLFEILENGEHVGRFYFDLYARANKRGGAWMDGARDRRRDAQGRLIDPVAYLVCNFTP
                     AVNGKPALLTHDEVTTLFHEFGHGLHHLLTRVEHAAASGINGVAWDAVELPSQFMENW
                     CWEPEGLALISAHYETGEALPQDLLEKMLAAKNFQSGMMMVRQLEFSLFDFELHATHG
                     DGRSVLQVLEGIRDEVAVMRPPAYNRFANSFAHIFAGGYAAGYYSYKWAEVLSADAFS
                     RFEEEGVFNPDTGRAFREAILARGGSREPMLLFVDFRGREPSIDALLRHSGLVGEAA"
     gene            88567..88842
                     /locus_tag="HWH41_00405"
     CDS             88567..88842
                     /locus_tag="HWH41_00405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YheV family putative metal-binding protein"
                     /protein_id="QOD45417.1"
                     /translation="MSPAITRKRFIAGAVCPACSEQDKIQMWEEDGVPHRECVACGYA
                     DTLNAQGQSIPKELGTRVNQNAPKPANPKVQSVQFFPNPKLKKKPDA"
     gene            88931..89194
                     /locus_tag="HWH41_00410"
     CDS             88931..89194
                     /locus_tag="HWH41_00410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003152715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="QOD45418.1"
                     /translation="MSAPLPPRGRGTASNPLNRFAPTHSEAFDDGWEQEVPPIQLTEV
                     REEIARTVISRNQSPDLPFDRSINPYRGCEHVIVDKEMYGQSV"
     gene            89241..91595
                     /locus_tag="HWH41_00415"
     CDS             89241..91595
                     /locus_tag="HWH41_00415"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="QOD45419.1"
                     /translation="MPRKPFSKSALESRERPTLQRKLPENTPQAIQERSTARGQVDVS
                     AQGLLVRNKTTGTREYVRDFTDLVTEYPHHKLIVQQLLIGAQLHSAKRLITYQSHQDI
                     YYSIQEFVLFLNSAEPINKSVKGVADVDGQVCANFRSFLIRSYPGRTVNRKRYGALKN
                     IFLSLKNKYKGQGWVGKGFEWPTGPGMNEQITEGYSREIHNKLVEGCLIDIKFIMKWM
                     ESYNSVVEGEKPILAYDLSLENLMFDLVVKEQTKRSNGSIKATHIKGFEWVIRSTGDV
                     KEYIRANGISIERFLGIYRARAHELAAKGRPVVGTEVSERGMVYGCDREESGRIATAN
                     VGRLYPDWPMQVSFEEAGHLFSTEWSKNTAHGTNKKYSTLEKRLRSALMYMKVGPEHL
                     PYEVGQMAYFSRVAFTMGTIFPFFLFVMLQTGWNFEVVVSISDNLDDHIEEDLLDDDY
                     VIIYGYKGRSNKSQMHRSNKRDKFGTYQILRFVAAEVTKHFSSPHYLKGKLFQCVISK
                     NLWNKFGRLCTPVTTTNFGHASTEFLHRHRIKLDTDTKSPRIETKRLRTTYETRRREQ
                     GLDIDEVSTMMGHSDIDTTVNHYDSDWGSAEILNGRLRKIQRKHEEDFRRYSANLLTD
                     VSLVELREATLRCGSKEKLRSVVAPLVGRLNSSEDSVIQLLSPEGQTFIASCLNSRRP
                     DWPGAESFLRTDTPCNYFNRCPLCSQCVIFKEALPFIARRISDLDGLRERLNPLEWEK
                     SYRAEYLAWKGVLEGWGDPIEVAEAIDRSVHNDFALPLTMIGLS"
     gene            91592..93694
                     /locus_tag="HWH41_00420"
     CDS             91592..93694
                     /locus_tag="HWH41_00420"
                     /inference="COORDINATES: protein motif:HMM:NF012798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="QOD45420.1"
                     /translation="MTTPTRDQIKAVLEEIRNGLGCHEEESEPIATEEDDEILSGDSS
                     LGIICDSINLLNLSRIDKNEWSYIRVSPRSSFGDPVWDFGDYPSPNGFPIRINFDYVN
                     MYGVNVCGVGHEHWVNIARALLFYRVPHFGIHGRINAYTSLESDKTKVLRLVGLFQAE
                     GLYLGSENSPDFRTVNDLAKSSVEHYIESLPTSGIKWEFCYLMSFWQGVSSMGMLPSE
                     YSLYDSYVTKELVAKYRREYDESSRPFEPIPLDDYAEIFRYCVGFVENYSDDVLWLYK
                     NFAPTIVGAFENPGKLAAMNIGVSTASVEGVKRFRAYKPKLLDSGIPWWGIEIKERTH
                     ENDEGEYINQTAVISVVVSLIDACIVLLLCLTGMRRSEVIGLKVDCLSFKSEGYWLTY
                     TVFKTSISSQGDIKTIPIPKIAADAIEVIIEIGRDARAYGNHDYLFVKIPKLSFGNTP
                     QSTVVERACNRVANNLGIDYRVHPHRFRKSLALYIIHQDSRNLEIIKRLFSHRSLKMT
                     LRYILSLPGMNDEVKATLIEENTEILVEVLQGVISGQIGGIGGKRLAKTANSSPILRA
                     KLQNAGKESLSQYVASLLDEGVKLLHRTNLAICMRTPGLSSESPCDAKNDSPGSRLHP
                     NLFACDPYNCRYAAFVEANAPSLKNEIIFHDNMIKHRYCGATQKEYSQRRIAEAFKRL
                     HEVVGDEAHNFLKQVAHG"
     gene            93687..94631
                     /locus_tag="HWH41_00425"
     CDS             93687..94631
                     /locus_tag="HWH41_00425"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45421.1"
                     /translation="MAKQDLLNRVYATISALQSDGRKKLSVMEVSKLSGVGRATINQK
                     HDPDWVKVREVIKGTTHSGVYTKDSSEDVKKPLKNTQEIHHRLKELEEQLALLRERAS
                     TTYNQLIDRVQYYFALASEKPAKQVEKAKLLQELTHQKNQNAILRADLKAALAESLTP
                     AVSGFITSKIILEVPNAGSDSEAILSFLEKLDSLSSQNRSSLVTAVYIMCGLPMCGKS
                     SWIDNHKPPTPGVSLYVSGASDTVSTRNLLVSRVRKEFNAPVHCVRFSLGLDACISRA
                     EKQFNGAALELNISSIKVVAARFEEIQFSENFDSIILA"
     gene            94685..95014
                     /locus_tag="HWH41_00430"
     CDS             94685..95014
                     /locus_tag="HWH41_00430"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45422.1"
                     /translation="MGDWADFVSADMTRLSRVKLVEACGIQRSIIYQNSQVVTLLRDL
                     ESELRAHGVLYGRSADANCAHQNGLTHDEELEQRLGDLSASLCKFNDYLNEVSNSLVV
                     YPLSRPK"
     gene            95044..96324
                     /locus_tag="HWH41_00435"
     CDS             95044..96324
                     /locus_tag="HWH41_00435"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="QOD45423.1"
                     /translation="MASHSGYMRERVGIYFDDNHNVLEAPTMWAMAVSKIRSRSDETT
                     RNYANILRRFLQWLDDSPIEGAEVVFGAQNWQLVDEDVFDAFLVHIASPTDALPDGPS
                     HKTMYHIAARVWSFYQWAEKQGYKHYLDISRTDIRYMLKDQKLLAHINPVVKVTTLGF
                     NLPSGRPAMHQREMQKFVRQTDYEIALSVLNDPVYQIIAAIIRITGLRPIDLFQLPYR
                     GRNENYGFIPYDEGEYPEGLDNGAIYYYFRSKGKWRSIDFPGKLWRVICEYYLPLRRQ
                     RAKLYEAKHGIPPRNSDLFLSARGDVVTHGMLGYNFSKVVSAAKNSESATDFKAIRFN
                     ARMLRHTCATYFVYEALKAQNRLGRSFVYDAALDEDLRKMLGHTDVRTTLEYYVHLVN
                     RYVHDNLLTDLHRSRVDAGLSAILDRHNYSEIVV"
     gene            96552..98528
                     /locus_tag="HWH41_00440"
     CDS             96552..98528
                     /locus_tag="HWH41_00440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003152710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent DNA methyltransferase"
                     /protein_id="QOD45424.1"
                     /translation="MNTENHSQTAAFLWSIADLLRGDFKQSQYGRIILPFTLLRRMEC
                     VLEPTREAVIRESYAQEGRPDLVRERLLLRAAGQQFFNASKLTLGTLSDTQTAADLMS
                     YVQSFSKDAREIFEHFHFEDFVQQLSSANLLYQVVQRFAATDLSPERISNFGMGIIFE
                     ELIRKFAESSNETAGEHFTPRDIVHLTTSLVITGQDDKLKPNSIVTIYDPTAGTGGFL
                     SEGDEYIQSISQQVTVSLHGQELNPESYAICKADMLIKGQDVTSIKLGNTLSDDQLAD
                     SRFDFMLSNPPFGVEWKKVQKQITDEHSEKGFNGRFGPGLPRVSDGSLLFLLHLVSKM
                     RDPREGGSRIGIILNGSPLFTGGAGSGESEIRRYLLQNDLVEAIIALPTDMFYNTGIA
                     TYVWVLSNHKAAARKGKVQLIDGSQHYAKMRKSLGSKRQYITDEQIDELVRLYGRFEE
                     TAQSKIFPVEAFGYRRITVERPLRLNFQTSPERIAKVLEEKAIQKMGAAAQQQLVAAL
                     QTLDASVLHRNREQFSKLLKKTLSAHDVSPSTPELKAILNALSERDPEADICMVKGQP
                     EADAGLRDNENVPLGESVYDYFEREVKPHVPDAWIDESKRDEQDGEVGVVGFEIPFNR
                     HFYVFQPPRPLVEIDRDLKACTDRIKQMIEGLSA"
     gene            98525..99886
                     /locus_tag="HWH41_00445"
     CDS             98525..99886
                     /locus_tag="HWH41_00445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013347366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease subunit S"
                     /protein_id="QOD45425.1"
                     /translation="MSFPAYPEYKDSGVVWLGGIPAHWKIKKFRYVFEESPEKITDEV
                     VGDMLSVSGYRGIEVKQYDDEGRRRTDEELFGYRVVRPGQLVVNTMWLNYAGLGVSEH
                     EGHVSPAYRSYWIDPAMDKRFIHHLMRSGTYVQGYTRLLTGIRPNSLQMGRDDLMVFP
                     VLLPTKSEQTQIARFLDHETARIDALIEEQQRLIELLKEKRQAVISHAVTKGLDPTVP
                     MKDSGVEWLGEVPAHWEITQIKRRCDLITDGAHISPETENGVYCFVSTRDVSDEGIDF
                     EGCLRTSADSYEYLVRTGCQPEVGDVLFSKDGTIGRTIVVGEGSPEFVVASSLIIIRP
                     SREELLPSYLDFLCQSWVVSQQVDGFVKGAGLPRLSIQNLTKVVGVFPPLEEQVLIAD
                     FLQMQSVTARQLTSEALRTMELLKERRSALISAAVTGKIDVRGWQPSASTQAPQLDVA
                     EAH"
     gene            99887..103075
                     /locus_tag="HWH41_00450"
     CDS             99887..103075
                     /locus_tag="HWH41_00450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019396228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction endonuclease subunit R"
                     /protein_id="QOD45426.1"
                     /translation="MADSKEAQFQQDIITAMTAQGWLTGPASGYDRHTALYTEDFLGY
                     FKDAWPERWDKFAKANPNNPDAVLVQKLVRELEQDGTLDVLRHGFKLPGVKIETCSFK
                     PDHGMNPDTLKRYQCNRLRVVPEVSYSPHFREGEYNPRLDLVLFVNGIPTATLELKSE
                     FKQSVENAKRQYRYDRPVKDPLTRKPEPLLTFKRGALVHFAVSQDEVAMTTQLAGKDT
                     FFLPFNLGSLDGGAGNPPAPDDSQYATGYLWQRLFQPDAWLKVLGRFLHLQKSVKEDA
                     DGKRVTKETLIFPRYHQWEVVNTLIETTRNEGPGKRYLIQHSAGSGKSNSIAWTAHQL
                     ASLYDAEGQRLFNSVIVITDRTVLDKQLQDTIYQFEHAQGVVKCITRDIGNQSKSEQL
                     AEALAEQTRIIIVTIQTFPALFDALDKYPRLASGRYAVIADEAHSSQTGSSASKLKQI
                     LGSDAPDAEEISAEELLDAAVAARAPNERISYYAFTATPKAKTLELFGRPANPALPAS
                     ADNKPEAFHLYSMRQAIEEGFILDVLQNYTTYSTAWKIAHPDGDDDEVDSKKARMKLA
                     RWVRLHPYNISQKVEVIVEHFRSNIRHLLGGQAKAMVVTSSRQEAVRYQLAVQAYVKQ
                     MGYTDVHPLVAFSGSVLPDGVIPEEVTESSSLLNPGLNGRDLAEAFDTQDFNVMIAAN
                     KYQTGFDQPKLCAMYVDKKLQGVDCVQTLSRLNRTFGDSKPTFILDFFNDPQDILDAF
                     LPYYTKAELTDVTDPQLIYDLQKKLDAEGIYHWEEVTAFALAFFDPIAAASKLSYYCA
                     PAKERFAKRYKLAQESRQQALDFKRTAEKNGDSAGVKKAEAAVKEAGEQVDQLDLFKK
                     NLQSFVRLYEFLSQIIPYEDRELEQLCVYAKHLHPLLRVDRLDQTDVDVGELQLTHYR
                     LTKRAEHQLRLSEEQGDYGLDPATGLGSGKPHDPEKKRLSEIIEALNDIFGAEVSDED
                     QLQFLTGIANRISRQEDVMAQVNNHSVEQVMHGLFPKRVLDTVLDAMTDHEKLSLEVL
                     DNETKSRAFALVILKMLTGAGGLGQGNSGAAV"
     gene            complement(103106..103327)
                     /locus_tag="HWH41_00455"
     CDS             complement(103106..103327)
                     /locus_tag="HWH41_00455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003381724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QOD45427.1"
                     /translation="MDKLAKALGERIRMQRKTCRISQDALALACSLDRSYVGRIERGE
                     VNITVEKLYRIAGELACEPSSLLPKPSEI"
     gene            103430..104020
                     /locus_tag="HWH41_00460"
     CDS             103430..104020
                     /locus_tag="HWH41_00460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003127304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45428.1"
                     /translation="MKSASFIFDRRLYELLQEPGRTSFTTRELRDAYAARLSGTQFRI
                     ADVRRYVYEQIRRLVRAGWVSPDEDRRVRGQVYHQQPIPTHLQLELIDNGFENSLMAA
                     GVPEPGTAVRDVEALPLKSSANTDLQLEALHKEIRLDFLTSMGEAERFKLLLDEMPHL
                     RDKLEGDYLEARDRSSRLLGHLRAIEKTLKTLAAQR"
     gene            104017..105417
                     /locus_tag="HWH41_00465"
     CDS             104017..105417
                     /locus_tag="HWH41_00465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003127305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase family protein"
                     /protein_id="QOD45429.1"
                     /translation="MSSSLRSWQNSCITKALEHFIVTQHFFCQATPGAGKTRMAAELT
                     SRLLQHDRIDLVLCFAPSCQVVEGFRATFSEVLGRRFDGQMGAVGAAYTYQAMEYRDE
                     GFWQLLDDYRVLVVFDEIHHCAGHDPLLSNAWGQQILHRIQDRAAFTLALSGTPWRSD
                     DKAIALARYSSPEGHLICDYRYGLKDAIADDVCRSPRIVLLDNQKVKLTEELGADSSV
                     RLFPSIAKLLGESPVTYEELLRHDEVINPILDLGCSKLNELRQIKPDAAGLVVATDIE
                     HAQQVVLALEAMGEECRIVTNKTPDAQQVINAFRSSACRWIVAVGMISEGTDIPRLQV
                     CCYLSRIRTELHYRQVLGRVLRRTGESDDQAWLFMLAEPTLQSFAERIADDLPDDLAV
                     LNEVQMPASTSGSKAGLIGAAGNIDGLDDSMKIGVEQVIGADTANIVSLGGGAAGPSY
                     QVSFSQHYRQQLLACF"
     gene            105850..106452
                     /locus_tag="HWH41_00470"
     CDS             105850..106452
                     /locus_tag="HWH41_00470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003292750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV toxin-antitoxin system AbiEi family
                     antitoxin domain-containing protein"
                     /protein_id="QOD51083.1"
                     /translation="MSCTDSAQPVSTRIAQRVMRLPKGQPFSTRRFAALGTRSAVSKA
                     IARLVSRGELERVHRGVYMRPKSSRYVARVRPNAWEVVSLIARQSRQALQIHGANAVR
                     RFGLSTQMPLISIYYTSGSSRSLFIGKAEVRLVHAAPMVMQQAGTEVGMAISALFYLG
                     KDGSTPECIAAIKKVLRPEDLTTLMACKMPKWMRMALELT"
     gene            106637..106888
                     /locus_tag="HWH41_00475"
     CDS             106637..106888
                     /locus_tag="HWH41_00475"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45430.1"
                     /translation="MSFQAQTHGSRASSFMLLPVHFPSTCRNFIDPVSSTKRVVEFRF
                     QTAGLGQNSVGTWVKNALAVTFDVCGSTASCSGLAQQKT"
     gene            106907..107140
                     /locus_tag="HWH41_00480"
     CDS             106907..107140
                     /locus_tag="HWH41_00480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003298751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45431.1"
                     /translation="MGISYYLACLETRQYVWVGRLDPQGEVPVTDVEGSIAMFALVNR
                     NKPLIVVSESHPILEEGMEWSPPATQETCSGQP"
     gene            complement(108405..109583)
                     /gene="umuC"
                     /locus_tag="HWH41_00485"
     CDS             complement(108405..109583)
                     /gene="umuC"
                     /locus_tag="HWH41_00485"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019726859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translesion error-prone DNA polymerase V subunit
                     UmuC"
                     /protein_id="QOD51084.1"
                     /translation="MLASFRYNDGCVVSRSNEAKALGIGMGEPFFKIRDLVQAHGVLA
                     FSSNYALYGDVSARVVRVLRELAPRLEVYSIDESFLDLAGLGRPLAGYGRHIRAEVQR
                     LTGMPVGVGISTTKTLAKLANWAAKRRSQSGVVVATRPEQQAALLKDAPLGEVWGVGR
                     KLQAHLGALGVKTAWDLAQQDAWTMRKQFSVVLEKTIRELRGEACFALDEGPEPKQMI
                     TCSRSFSRRVTELAPLREAVASYACRAAEKLRAQGDVCQLLQVYIRTGVFNPDEPRYA
                     RTASVPLHTPSNDSRDLVQAALAGLEGIYRPGYRYQKAGVMLMNLASPGQVQADLFAP
                     APRPRSAALMATVDRINTNMGRGTVRLARVPALGGWSMKQELRSPGYTCRWDELPRVL
                     "
     gene            complement(109922..110338)
                     /locus_tag="HWH41_00490"
     CDS             complement(109922..110338)
                     /locus_tag="HWH41_00490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008567175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45432.1"
                     /translation="MNIKTNELGRGDSLRQTWQVISFWGLPAVVATLTILLADRHPTL
                     FLAASAALAVMGGACLVNAARCRRLHCYLTAPYFLLLALGGLLAYGFDPHGEQFSRLW
                     LLLALGAAPLLIWLPERLAGRKYLGAPGCGEGRECR"
     gene            complement(110357..112039)
                     /gene="merA"
                     /locus_tag="HWH41_00495"
     CDS             complement(110357..112039)
                     /gene="merA"
                     /locus_tag="HWH41_00495"
                     /EC_number="1.16.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020795287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury(II) reductase"
                     /protein_id="QOD45433.1"
                     /translation="MTELKIIGMTCASCVVHVKEALEKIPGVHRADVSYASGRAELKV
                     DEAVSREQMQAAVEALGYRAAFEDITLPTRPGLLDKARGWLSGGTDAGKEGDRLHVAV
                     IGSGGAAMAAALKAVERGARVTLIERGIIGGTCVNVGCVPSKIMIRAAHVAHLRRESP
                     FDGGLPATPPLVLRERLLAQQQGRVDELRHAKYEGILESTPAITVLRGSARFQDSHTL
                     SVELVEGGERIVTFDRCLIATGASAAVPPIPGLQDTPFWNSEKALASSSIPQRLAVIG
                     SSVVALELAQAFARLGSRVTILARNSLFFREDPAIGAALTAAFRLEGIEVLEQTQASQ
                     VAHANGEFVLTTKHGEVRVDQLLVATGRTPNTHGLNLEAAGVQLDERGAIQIDQGMRS
                     SKADIYAAGDCTNQPQFVYVAAAAGNRAAINMTGGEAMLNLDTMPAVVFTDPQVATVG
                     FSEAEAHQAGLETDSRTLTLDNVPRALANFDTRGFIKLVAETGSGRLLGVQAVTPEAG
                     ELIQTAALAIRARMTVQELADQLFPYLTMVEGLKLAAQTFSKDVKQLSCCAG"
     gene            complement(112072..112506)
                     /gene="merC"
                     /locus_tag="HWH41_00500"
     CDS             complement(112072..112506)
                     /gene="merC"
                     /locus_tag="HWH41_00500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008567179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="organomercurial transporter MerC"
                     /protein_id="QOD45434.1"
                     /translation="MANSFNLFTRIGDKAGSVGVLVSAIGCASCFPALASLGATIGLG
                     FLSQWEGLFITTLLPLFAGVALLVNALGWFSHRQWRRAAPGLIGPALVLVAVFLMLAH
                     GWRSGWLLYIGLAVMFGVSIWDFVSPAHRRCSPASCPTPPNQ"
     gene            complement(112519..112794)
                     /gene="merP"
                     /locus_tag="HWH41_00505"
     CDS             complement(112519..112794)
                     /gene="merP"
                     /locus_tag="HWH41_00505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury resistance system periplasmic binding
                     protein MerP"
                     /protein_id="QOD45435.1"
                     /translation="MKKLLAALALIAVVSPVWAASQIITLSVPGMTCAACPITVKKAL
                     TKVEGVTKAEVSYEKREAIVTFDDAKTSAQALTKATEDAGYPSSVKQ"
     gene            complement(112808..113158)
                     /gene="merT"
                     /locus_tag="HWH41_00510"
     CDS             complement(112808..113158)
                     /gene="merT"
                     /locus_tag="HWH41_00510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric ion transporter MerT"
                     /protein_id="QOD45436.1"
                     /translation="MSESRNGRGALLTGGLAAILASTCCLGPLVLIALGFSGAWIGSL
                     TVLEPYRPFFIGAALVALFFAYRRIFRPAQVCIPGEVCADPQVSTIYKLVFWVVTALV
                     LVALAFPYILPLFY"
     gene            113230..113640
                     /gene="merR"
                     /locus_tag="HWH41_00515"
     CDS             113230..113640
                     /gene="merR"
                     /locus_tag="HWH41_00515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008567182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hg(II)-responsive transcriptional regulator"
                     /protein_id="QOD45437.1"
                     /translation="MHNAVESLTIGAFAKAAGVNVETIRFYQRKGLLPEPDKPYGSIR
                     RYGEADVARVRFVKSAQRLGFSLDEVAGLLRLDDGAHCDEARVLAEQKLEDVREKLAD
                     LQRIESVLAQLVDDCCASQGTVSCPLIVSLQASK"
     gene            113975..114163
                     /locus_tag="HWH41_00520"
     CDS             113975..114163
                     /locus_tag="HWH41_00520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017699103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4113 domain-containing protein"
                     /protein_id="QOD51085.1"
                     /translation="MLGRSRDIVIAAVQPVASEKVMQVMDRINSKWGRGTLRLGGVPV
                     TPDWGCVGKCSAQAIPHG"
     gene            complement(114204..114557)
                     /locus_tag="HWH41_00525"
     CDS             complement(114204..114557)
                     /locus_tag="HWH41_00525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008567186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="QOD45438.1"
                     /translation="MLDKVIDGILSTNGKLSISGVAKAAGVTPGLIHNTYPAVAERIR
                     GLMGKSVRAQRDSKHQALLKERELNRALRAENAQLSQDLARLASVNQTLILELAQLKG
                     VATGKVVLLSSKPAS"
     gene            complement(114629..115711)
                     /locus_tag="HWH41_00530"
     CDS             complement(114629..115711)
                     /locus_tag="HWH41_00530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017516609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="QOD51086.1"
                     /translation="MIRCRDAVLYIASITSGMRNEEVIGIEVGAWRKEVVDGVTYCWV
                     TTTEHKTGKGRVDYLVPELTLDALNLFAMCSTPMRRELEAELSDLELSCNSVDSADLL
                     LRLEKARKDSKRLFLCLNGYGNKAERVGHIEVLSAAGSNEAFKRVAKAAGSDWPLRTH
                     QCRRTYARCFVESRMGRTSLVFLKWQFKHSSMSMTQLYASNPLQDLTLFDEILQQMTE
                     FKIDLIESWLDDQPLAGGAGERIMELRAIPIKDRSALLAQTAPHANIRATGHGWCIAT
                     ERGCGGAGLYEATRCPGCKHSVIDETFATTWQGIYSHQLELMEIDDAGPAVRQRAKRD
                     MQVAFDVISSLGLSPLDARDSDPTRT"
     gene            complement(116463..118079)
                     /locus_tag="HWH41_00535"
     CDS             complement(116463..118079)
                     /locus_tag="HWH41_00535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011979104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45439.1"
                     /translation="MARKKNYKAEMQSVTKGFETVENELRIDLPKNPRNVTKIDHSQY
                     IGFGFDAWAIQSIHVIRALVNGGNFSLATLVGYSSNGLRYFMAFLKSGTIDSPPSTPN
                     SLTKRHLERYVSWLKLKYPNGSTAKNYYTSLKSLIISLIEYGFVEADKDDLLPAVPFP
                     HTAKSTNDAKPLSLSEMQGLITALKSDLVAIHKGLFSGNDAEAMTVLLLITAARSGIN
                     TTPLLEMSRDALQPHPFIPNLRLLNTVKRRGKGAQSKTIRQTELHDGYNPIPLDGVAV
                     VNKALAISEPLVGFAPEKLKSHVWLYRAGQNGHGHRVVALASSTLFQSTKSICARHAL
                     KDDQGQPLIVNLSRLRKTMESRLWKLSGGDLLEVSAVMGHSPSVADNHYLKINDEIKV
                     EGATFVGEAFTDQLRGINVTPTPPGGCKDSLYGSLAPKDGVTHCSEFIHCLTCPSYAI
                     VGTLGDLYRLFSYQQFLHAEMEYFLTDEWAAWRKRQGDFIRLIDEFTSRKFKIELIEA
                     AKAKAKASPHPFWGCKIEFMRKVRGDALVG"
     gene            complement(118090..119247)
                     /locus_tag="HWH41_00540"
     CDS             complement(118090..119247)
                     /locus_tag="HWH41_00540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010794485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="QOD45440.1"
                     /translation="MRLVFATKDLAVAGRSFEGFPLLVGADGWPVEPAQSFLWHTLVE
                     SGEALSALTWEAYGRRLFDYFAFLEANGLAWNEESQADGLSVLSRYRDWSSGELELDP
                     STLNKRLNLIVRFYQWAKQRDLIAALPFGERRVRATPHSGFLSHVARPNAESTKPSVM
                     VRERKRLTKFLTKDQAKVCLALDADPSHRILFHLMVRTGLRSCEARTFPFKYVFNPRL
                     KKGLRPGQMISVALEPSDMHLKYGRPRTIDVPWSLMEEMWSYTLHEREVRKAAGNGRA
                     TALVLTREGRQYTKDSIVDVMKAYERKCGFYVRAHMLRHTYGTYTLLALRKSRDFKGE
                     PLLYVRDRMGHSDVQTTMVYLHLINQLEAQSVLAHEDEIDMMFMAVSTPSI"
     gene            complement(119345..119473)
                     /locus_tag="HWH41_00545"
     CDS             complement(119345..119473)
                     /locus_tag="HWH41_00545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001883756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45441.1"
                     /translation="MPTYALVDCNNFYVSCERLFRPDLRAVPMVVLSNNDLRDCFR"
     gene            complement(119473..119673)
                     /locus_tag="HWH41_00550"
                     /pseudo
     CDS             complement(119473..119673)
                     /locus_tag="HWH41_00550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011979106.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="S24 family peptidase"
     gene            complement(119829..120667)
                     /locus_tag="HWH41_00555"
                     /pseudo
     CDS             complement(119829..120667)
                     /locus_tag="HWH41_00555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013957934.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
     gene            complement(120673..121455)
                     /locus_tag="HWH41_00560"
     CDS             complement(120673..121455)
                     /locus_tag="HWH41_00560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009684893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="QOD45442.1"
                     /translation="MQQISTRQHWIDTPHGQLFAQCWSPTEACAPPIVLLHDSLGCVA
                     LWRDFPERLAQASGRRVIAYDRLGFGRSATYPGRLPPSFVQDEACGSFQALRQQLGLS
                     QFVVFGHSVGGGMAVGCAAVHQEACQGLITESAQAFVDAATLDGIRVAERQFAEPGQL
                     ERLQKYHGDKAGWVLRAWIDTWLSDAFRPWSLDGQLSHVRCPLLCLHGDRDEYGSPPH
                     SERIAAQASGPASVHILADCGHVPHREYPDAVLAAVCAFLAQ"
     gene            complement(121526..121909)
                     /locus_tag="HWH41_00565"
     CDS             complement(121526..121909)
                     /locus_tag="HWH41_00565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000450273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PaaI family thioesterase"
                     /protein_id="QOD45443.1"
                     /translation="MQAASTGTSDRFAELLGIEPLHSSFERAACRLSVGDEHRNALGG
                     IHGGLIFSLADIAFAAACNAGDAAYIGLQAEVRYMNRAEGNELTATATLMGGTRKIAH
                     YQVLVTDSQEKPIALFSASAYRLSQ"
     gene            122027..122995
                     /locus_tag="HWH41_00570"
     CDS             122027..122995
                     /locus_tag="HWH41_00570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017517930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="QOD45444.1"
                     /translation="MKKVAILAYDGCWAMNLFAVTDFFRVVALLEQHLGLAPGYAVEV
                     LSGDGAEVRAASGHRVQADGAIDAAQCYELVVIPAIEGVRLGAGFSPDARLVAWLAAQ
                     HRAGARVLALTTGVCFVAAAGLAEGLLMATHWAYVRQLKKRYPGGQFVAHQSCLQASA
                     IWSTGSLNGAYDALLEMLAQDRSDQFSQLCATHLLVAAPERLNPILPGYRNHCDAAIL
                     KVQDWIESHYAEAITIERMGREAGLAERTLKRRFQQATRLSPNLYVQKVRIDKAKKLL
                     LASGLSVKAIAYEVGYENVSFFVRLFRTQVGQTPAQWRKCEDVIAS"
     gene            123096..123242
                     /locus_tag="HWH41_00575"
     CDS             123096..123242
                     /locus_tag="HWH41_00575"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45445.1"
                     /translation="MLLLGAEALGMTHNQCLDLLESAEDTLDFLKSSLTYLGSPQKTE
                     NKAR"
     gene            complement(123239..123856)
                     /locus_tag="HWH41_00580"
                     /pseudo
     CDS             complement(123239..123856)
                     /locus_tag="HWH41_00580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_021138877.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="Tn3 family transposase"
     gene            complement(123939..124901)
                     /locus_tag="HWH41_00585"
     CDS             complement(123939..124901)
                     /locus_tag="HWH41_00585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010794530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SdiA-regulated domain-containing protein"
                     /protein_id="QOD45446.1"
                     /translation="MYLMAKNWLGRTRKVSVWMWALVCLVLLTVFQVRTHHLDDRLYF
                     WIKTHWHTDDWQERSVWLPGYRVELDAKAVPGVDNNLSGLTFDPDLNLLWAVTNGPNE
                     LLALSRDGDVERRYSLDGFHDVEAVSYAGNGQLVIAEERRQSLVIVDIPIDEYGKLSP
                     DRPLSLDQYSALTLALGKEDNKGLEGLAYDLKGDRLFVTKERDPRQLLEVSGLRASLE
                     GGVSLHVRDMSNLVKDKVFATDLSSVVFDQQSGHLILLSDESKLLIEMTDEGKVVSFR
                     SLARGFAGLLKGIPQAEGVTIDDEGYLYVVSEPNLFYRFTRETD"
     gene            complement(124947..125306)
                     /locus_tag="HWH41_00590"
     CDS             complement(124947..125306)
                     /locus_tag="HWH41_00590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003090764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TraR/DksA family transcriptional regulator"
                     /protein_id="QOD45447.1"
                     /translation="MSLDDALDLAHFKTLLEQRAAELDRLLGDAESRSQSVELDQSKV
                     GRLSRMDALQQQAMNDAIRSRARHERVRLQLALKRWHEGDYGWCNQCGELIASGRLEF
                     DPATPLCITCASRAESG"
     gene            complement(125306..126157)
                     /locus_tag="HWH41_00595"
     CDS             complement(125306..126157)
                     /locus_tag="HWH41_00595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003090760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="QOD45448.1"
                     /translation="MTHVIACIDGSTSAPAVCDYAAWASLSLEAPLTFLHVLDQRQYP
                     VAADLSGNIGLGSREHLLDELASLDEQRGKLALEQGRIMLAAAKERAVNDGVRAPESK
                     QRHGDLLESLQELQSETRLLVIGRQGESSGGLSQHVGSQLESVIRIMHRPILVTPANF
                     QKPKSAMLAFDGGATTRKGVEMLAASPLLKGLPIHLVMVGPVNDEASAQLDWAQKVLI
                     NAGFTVRAETRSGEIERTLHAYQKEHGIDLLVMGAYGHSRIRQFLVGSTTTSMLRTTT
                     SPLLLLR"
     gene            complement(126172..127659)
                     /locus_tag="HWH41_00600"
     CDS             complement(126172..127659)
                     /locus_tag="HWH41_00600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_251253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SulP family inorganic anion transporter"
                     /protein_id="QOD45449.1"
                     /translation="MLHSLKQTWLSNIRGDILAGLVVALALIPEAIAFSIIAGVDPKV
                     GLYASFCIAVVIAFVGGRPGMISAATGAMALLMVTLVKNHGLEYLLAATLLCGVLQIA
                     AGYLKLGSLMRFVSRSVVTGFVNALAILIFMAQLPELTNVTWHVYAMTAAGLGIIYLF
                     PYVPKIGKLIPSPLVCIIVLTAVAMSVGLDIRTVGDMGELPDTLPIFLWPDVPLTFET
                     LAIIFPYSAALAVVGLLESMMTATIVDDLTDTPSDKNRECKGQGVANIASGLIGGMAG
                     CAMIGQSIINVKSGGRSRLSSLAAGVFLLLMVVFLGDWLKQIPMAALVAVMIMVSIGT
                     FSWDSLRNLKKHPLSTNIVMVVTVVVVVATHNLAFGVLAGVLLAAMFFANKVGHYMAI
                     SSSLDEAGEHRSYNVTGQVFFSSADKFVAAFDFKEALNKVTIDLNRAHFWDITAVAAL
                     DKVVIKFRREGTEVEVLGLNEASATIVDRFGVHDKPDAIDQLMGH"
     gene            complement(128003..128992)
                     /locus_tag="HWH41_00605"
     CDS             complement(128003..128992)
                     /locus_tag="HWH41_00605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003132006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3330 domain-containing protein"
                     /protein_id="QOD45450.1"
                     /translation="MSAFRPDGWTTPELAQAVERGQLELHYQPVVDLRSGGIVGAEAL
                     LRWRHPTLGLLPPGQFLPVVESSGLMPEIGAWVLGEACRQMRDWRMLAWRPFRLAVNV
                     SASQVGPDFDGWVKGVLADAELPAEYLEIELTESVAFGDPAIFPALDALRQIGVRFAA
                     DDFGTGYSCLQHLKCCPISTLKIDQSFVAGLANDRRDQTIVHTVIQLAHGLGMDVVAE
                     GVETSASLDLLRQADCDTGQGFLFAKPMPAAAFAVFVSQWRGATMNANDPTATSCCVC
                     CKEIPLDAAFTPEGAEYVEHFCGLECYQRFQARAKTGSETDADPNACDSSLSD"
     gene            complement(128989..129225)
                     /gene="merE"
                     /locus_tag="HWH41_00610"
     CDS             complement(128989..129225)
                     /gene="merE"
                     /locus_tag="HWH41_00610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003132004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="broad-spectrum mercury transporter MerE"
                     /protein_id="QOD45451.1"
                     /translation="MNNPERLPSETHKPITGYLWGGLAVLTCPCHLPILAVVLAGTTA
                     GAFLGEHWVIAALGLTGLFLLSLSRALRAFRERE"
     gene            complement(129222..129587)
                     /gene="merD"
                     /locus_tag="HWH41_00615"
     CDS             complement(129222..129587)
                     /gene="merD"
                     /locus_tag="HWH41_00615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001277466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury resistance co-regulator MerD"
                     /protein_id="QOD45452.1"
                     /translation="MNAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTPGGYGLFDD
                     AALQRLCFVRAAFEAGIGLDALARLCRALDAADGDEAAAQLALLRQFVERRREALADL
                     EVQLATLPTEPAQHAESLP"
     gene            complement(129605..131290)
                     /locus_tag="HWH41_00620"
     CDS             complement(129605..131290)
                     /locus_tag="HWH41_00620"
                     /EC_number="1.16.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013722692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury(II) reductase"
                     /protein_id="QOD45453.1"
                     /translation="MTHLKITGMTCDSCAAHVKEALEKVPGVQSALVSYPKGTAQLAI
                     VPGTSPDALTAAVAGLGYKATLADAPLADNRVGLLDKVRGWMAAAEKHSGNEPPVQVA
                     VIGSGGAAMAAALKAVEQGAQVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRES
                     PFDGGIAATVPTIDRSKLLAQQQARVDELRHAKYEGILGGNPAITVVHGEARFKDDQS
                     LTVRLNEGGERVVMFDRCLVATGASPAVPPIPGLKESPYWTSTEALASDTIPERLAVI
                     GSSVVALELAQAFARLGSKVTVLARNTLFFREDPAIGEAVTAAFRAEGIEVLEHTQAS
                     QVAHMDGEFVLTTTHGELRADKLLVATGRTPNTRSLALDAAGVTVNAQGAIVIDQGMR
                     TSNPNIYAAGDCTDQPQFVYVAAAAGTRAAINMTGGDAALDLTAMPAVVFTDPQVATV
                     GYSEAEAHHDGIETDSRTLTLDNVPRALANFDTRGFIKLVIEEGSHRLIGVQAVAPEA
                     GELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQLSCCAG"
     gene            complement(131362..131637)
                     /gene="merP"
                     /locus_tag="HWH41_00625"
     CDS             complement(131362..131637)
                     /gene="merP"
                     /locus_tag="HWH41_00625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury resistance system periplasmic binding
                     protein MerP"
                     /protein_id="QOD45454.1"
                     /translation="MKKLFASLAIAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAI
                     SKVEGVSKVDVTFETRQAVVTFDDAKTSVQKLTKATADAGYPSSVKQ"
     gene            complement(131653..132003)
                     /gene="merT"
                     /locus_tag="HWH41_00630"
     CDS             complement(131653..132003)
                     /gene="merT"
                     /locus_tag="HWH41_00630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric ion transporter MerT"
                     /protein_id="QOD45455.1"
                     /translation="MSEPQNGRGALFTGGLAAILAAACCLGPLVLIALGFSGAWIGNL
                     TVLEPYRPIFIGAALVALFFAWRRIYRPAQACKPGDVCAIPQVRATYKLIFWVVAALV
                     LVALGFPYVMPFFY"
     gene            132075..132509
                     /gene="merR"
                     /locus_tag="HWH41_00635"
     CDS             132075..132509
                     /gene="merR"
                     /locus_tag="HWH41_00635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hg(II)-responsive transcriptional regulator"
                     /protein_id="QOD45456.1"
                     /translation="MEKNLENLTIGVFAKAAGVNVETIRFYQRKGLLPEPDKPYGSIR
                     RYGEADVTRVRFVKSAQRLGFSLDEIAELLRLEDGTHCEEASSLAEHKLKDVREKMAD
                     LARMEAVLSELVCACHARRGNVSCPLIASLQGGASLAGSAMP"
     gene            132542..134833
                     /locus_tag="HWH41_00640"
                     /pseudo
     CDS             132542..134833
                     /locus_tag="HWH41_00640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001138014.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="Tn3 family transposase"
     gene            135729..135875
                     /locus_tag="HWH41_00645"
     CDS             135729..135875
                     /locus_tag="HWH41_00645"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45457.1"
                     /translation="MPGAAGADGHLQDVIEVDVPHHLLTGRAGRIRSTRCLAPPAPMA
                     TCRA"
     gene            136270..137130
                     /locus_tag="HWH41_00650"
     CDS             136270..137130
                     /locus_tag="HWH41_00650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003142911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA cytosine methyltransferase"
                     /protein_id="QOD51087.1"
                     /translation="MGEARSRVDSWRSHALAQHCTRANEGRIVLSLFDHTGQWSRPWE
                     EAGYQVVRFDIQDNPETGDVNAFGVNFFSDWFGDFDGLDIYAVLAACPCTEFAISGAK
                     HFAAKDADGRTVAAVELVHQTLRTIEYYRPSVWAIENPVGRIEKLAGLPPWRLAFDPH
                     HLGDPYTKKTLLWGRFNADLPIAPVAAIEGSKMHRKYGGRSVATKNARSETPEGFAYG
                     FFMANNAIDNPVLAVANRYDRLDPQLLRVALDAGICEKGIDALIADAYFFELDDVAAE
                     RALRQAINRQ"
     gene            137248..138303
                     /locus_tag="HWH41_00655"
     CDS             137248..138303
                     /locus_tag="HWH41_00655"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45458.1"
                     /translation="MQDPKDPGTLDLIEACKRPLTAAERQKRHREKLKRERQAGKRAV
                     LDLGQPELALLTVALREFGERWSRVPSKTEGAAALLSRLPAVSIAEAFPGDSAWIPDA
                     LQQGDDRALWPACTSAQRDIGGFHGPYAYRQTPHGQPEVDELVKPGDQVWTSYDSGPY
                     KVLEVKRYTVEGMRVYSLVMTALNQRKPSAWINELVAVDGRLLKLFANNMDEVFVVGA
                     GALASAEPLPEPVRQMEEERAEANAWYQTGRRLEGEVTHLREQRDAWIAENEKLLEKI
                     RGLQAEVKRLNDGALHAGQVAARLKGLQDENGRVIAERAGAFRAVEVLQARLKRHGID
                     ADFRETEDDRRALLGST"
     gene            138746..139159
                     /locus_tag="HWH41_00660"
     CDS             138746..139159
                     /locus_tag="HWH41_00660"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45459.1"
                     /translation="MKRLTLDDVICPVCCVLLPLDNDGCPECGHQDQLQGRIPPIRAY
                     SDRLHYPGMRALIGRLQEQAEAASQEVTEEVLRRECVDLVKAGNVVAAVRRYRHATGC
                     GLPHARRQLGLTWPSLLDVDPADPDFLVDRPGVIK"
     gene            139519..139905
                     /locus_tag="HWH41_00665"
     CDS             139519..139905
                     /locus_tag="HWH41_00665"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45460.1"
                     /translation="MSESNLVLSCRHLSTLLRYVYPSDRLTCALELQQIQQDGQLLRE
                     ENIRSVRFRSRGLDYDEGHCIPFVFDGQAESVSALELLKLADTYHRNSCDAPGYYKSR
                     AYELLSRIREAAIEDLPGFKEAPGWV"
     gene            139927..140154
                     /locus_tag="HWH41_00670"
     CDS             139927..140154
                     /locus_tag="HWH41_00670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004644386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45461.1"
                     /translation="MSWVEQAAPIVHEVIRRVGRSDLKALRREFRKAYPFGRRTNAPY
                     KAWLAEIRRQLGHPLNLPKCDPEDPQMEFEF"
     gene            140268..140558
                     /locus_tag="HWH41_00675"
     CDS             140268..140558
                     /locus_tag="HWH41_00675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015272403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45462.1"
                     /translation="MPERYTLEHWEKCLPAMKRLHPDTLAIARSVYVDGVKPVEVARQ
                     TGRSAQNVNSALKRVEPYLQKGAAGLVFVGVWLPPELAEQVKQMAAQYEQND"
     gene            140579..140920
                     /locus_tag="HWH41_00680"
     CDS             140579..140920
                     /locus_tag="HWH41_00680"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45463.1"
                     /translation="MDDSSSKPFFITLLAGGALLLAGIAIGVVGTTAAVKSEWLVLGR
                     SSASQPISAPKLEYEENQGVDSILCIDGRAYKVRLGTQELMHRLEELPRTQSIRQYQL
                     KPIPCAALHKS"
     gene            141154..141411
                     /locus_tag="HWH41_00685"
     CDS             141154..141411
                     /locus_tag="HWH41_00685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004666836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adhesion biosynthesis transcriptional regulator"
                     /protein_id="QOD45464.1"
                     /translation="MKPGTAKDSFLTPGEVDPRHFELLLEGTSIRAQPLIDALREHLV
                     NGVKASEAWTKYGVNMSQFSRRLAVLRKESQRAAELSKFYP"
     gene            141488..141709
                     /locus_tag="HWH41_00690"
     CDS             141488..141709
                     /locus_tag="HWH41_00690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004666908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45465.1"
                     /translation="MAAYTVTWTIDVEVDGDHKDAAQFVAESYFQARIAAGEQDSACS
                     FIVVDETDQHQVDIDLADSLSDLDGDDTE"
     gene            141777..141983
                     /locus_tag="HWH41_00695"
     CDS             141777..141983
                     /locus_tag="HWH41_00695"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45466.1"
                     /translation="MQTLMNRMNKESKPLAAEAETPPRKHPFQKMLPELAVWCLLAFG
                     VVGSLLLWMHIIWVHIIPRAVGAN"
     gene            141998..142477
                     /locus_tag="HWH41_00700"
     CDS             141998..142477
                     /locus_tag="HWH41_00700"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45467.1"
                     /translation="MPIEPRTLAAVFTKVARCLEGHDLALETLDDYRVDAAAGLLTVD
                     RLRGFLQGLSAAGALPYEDYCEVDAMLDVGPRTALLAMHVDLIRGLDTDLGVRRAASC
                     AMGYLQALLDIQSINSDSYRAHREEIQKLEQERLEELTSLRLLTAAHVGASTAKRSQ"
     gene            142557..142766
                     /locus_tag="HWH41_00705"
     CDS             142557..142766
                     /locus_tag="HWH41_00705"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45468.1"
                     /translation="MEKNDAVDTLIAAMTDSRLPVPVRIGAARGLAHIGSAQVRAELV
                     KVMTNQLSPMDLRAAAAEALGQASA"
     gene            142798..143037
                     /locus_tag="HWH41_00710"
     CDS             142798..143037
                     /locus_tag="HWH41_00710"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45469.1"
                     /translation="MTLITPRKLPPLTDEQVRAGARPGETWAEARRRLEALNVACPAP
                     QVDEHPGADYTLAGPVDECEGLDGRPIEWEPGELG"
     gene            143127..143315
                     /locus_tag="HWH41_00715"
     CDS             143127..143315
                     /locus_tag="HWH41_00715"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45470.1"
                     /translation="MEREQSFNEWLDTPEREEHLRDIYFDDQLGPGSEFYKWAESIYR
                     IRKATAEQTRCPRRWPYV"
     gene            143345..143623
                     /locus_tag="HWH41_00720"
     CDS             143345..143623
                     /locus_tag="HWH41_00720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004666841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45471.1"
                     /translation="MSQKIQCPECQGPLKVWLEIDATLSFAVSSSGKLNKRSIEDNME
                     SDGRCGLECQGCDWKVHGADVEDKAHSKLIEAAYEQWEELELAVRTRK"
     gene            143656..143883
                     /locus_tag="HWH41_00725"
     CDS             143656..143883
                     /locus_tag="HWH41_00725"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45472.1"
                     /translation="MMIDVEPLKRYLDAVEQATQAWMSVGAAYDAAPADEKGAYAGQF
                     KQAERAYNRACETLAIMVAEQVKAAESAAAG"
     gene            144009..144155
                     /locus_tag="HWH41_00730"
     CDS             144009..144155
                     /locus_tag="HWH41_00730"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45473.1"
                     /translation="MLKWDVYLNDEYRIQVQATTHGDAVMEAILALDLDDDAGLRVRR
                     EAGS"
     gene            144451..144693
                     /locus_tag="HWH41_00735"
     CDS             144451..144693
                     /locus_tag="HWH41_00735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003449746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45474.1"
                     /translation="MRESITEDALQALIAAGGARDTLVTRGPGGEGWQLLVRYAGGGH
                     HYPLRSRREPLRVFASLTQLERYATKIGLREFRVEL"
     gene            144726..145142
                     /locus_tag="HWH41_00740"
                     /pseudo
     CDS             144726..145142
                     /locus_tag="HWH41_00740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005746556.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     assembly_gap    145213..145223
                     /estimated_length=11
                     /gap_type="within scaffold"
                     /linkage_evidence="align genus"
     gene            complement(145296..145448)
                     /locus_tag="HWH41_00745"
                     /pseudo
     CDS             complement(145296..145448)
                     /locus_tag="HWH41_00745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003150544.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase family protein"
     gene            145650..145889
                     /locus_tag="HWH41_00750"
     CDS             145650..145889
                     /locus_tag="HWH41_00750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017335987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine repressor-like protein"
                     /protein_id="QOD45475.1"
                     /translation="MNTIRWNVAVSADTDQSLRMFLASQGGGRKGDLSRFIEEAVRAH
                     ILELSAEQAKAANAHLSEAELTNAVDEALDWARKR"
     gene            145889..146299
                     /locus_tag="HWH41_00755"
     CDS             145889..146299
                     /locus_tag="HWH41_00755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003150546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative toxin-antitoxin system toxin component,
                     PIN family"
                     /protein_id="QOD45476.1"
                     /translation="MRVVLDTNILFSALISPHGAPDAIYRAWRAARFEVVTSRMQLDE
                     IRRASRYPKLQAILQPAKVGAMINNLQRAVVLERLTIEVEADDPDDSFLLAMALAGDA
                     DYLVTGDRRAGLLQRGHIERTRIVTPAVFCVEVL"
     gene            146303..149296
                     /locus_tag="HWH41_00760"
     CDS             146303..149296
                     /locus_tag="HWH41_00760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003089110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tn3 family transposase"
                     /protein_id="QOD45477.1"
                     /translation="MPVGFLTQEQRDGFGRYVDSPSREELERYFHLSDEDREAIQVLR
                     GNHNRLGYAVLLTTVRFVGVLPDKPAAVPVEVLQVLCRQLAIPDPDCLQRYSDHRRWI
                     HATDIQNRFGYRHFTDPGIGFRLSRWLYALCWTGTDRPGVLFERATSWLFTQKVLLPG
                     VSQLERFIAQLRSRVEERLWFTLGRSVTEEQRLQLQDLLTVAEGNRSSRLDQLRSGPV
                     MVSGPALIRALRRLDDVRGIGITLPAAAHIPPSRIAALARFANTAKVTAINRLPASRR
                     MATLVAFALCLEATAHDDALEVLEALLRDLFSNAEKADKKARMRSLKDLDRSAATLAA
                     ACKVVLDSSISDDNVRARLFNDLPRTTLEKALEEVNALIRPVDDVYFLALEARYRSVR
                     RFLPDLLKHIRFGFSPAGKGVAASLEWLQLNLPRRKPEDDAPQEIVAKAWQKHITRED
                     GSLDMGAYVFCTLDALRTALRRRDVFVSPSWRYADPRLGLLDGAEWLAARPIICRSLG
                     LTIDAKTTLDALSVELDATWLAVAARLPDNPAIQLSENTEGKTELSLGALDKLDEPCS
                     LLQLRAAVSDLMPRVDLPEILLEIAARTGFSEAFTHVSERNARADNLVTSLCAVLLGG
                     ACNTGLEPLIRTDNPALRRDRLSWVSQNYIRDDTLSAANAILVGAQSQLELAQVWGGG
                     EVASADGMRFVVPVRTVHAGPNPKYFGTGRGVTWYNLISDQFSGLNAITVPGTLRDSL
                     VLLAVVLEQQTELQPTQIMTDTGAYSDVVFGLFRLLGYHFSPRLADVGGTRFWRTRPD
                     ADYGKLNGLARQSVKLDLIAEHWDDLLRLAGSLKLGRVPATGIMRTLQTGDRPTRLAQ
                     ALAEFGRIEKTLHTLTYIDDESKRRATLTQLNRGEGRHSLARAVFHGKRGELRQRYRE
                     GQEDQLGALGLVVNIIVLWNTLYMTAAVERLKQHGYPVLEEDLARLSPLIYEHINMLG
                     RYSFAVPEEVARGELRPLRNPDDDL"
     gene            complement(149309..149521)
                     /locus_tag="HWH41_00765"
     CDS             complement(149309..149521)
                     /locus_tag="HWH41_00765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003089113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45478.1"
                     /translation="MSAIVLESVLTCPRCGFAKPETMPTDACQFYYECSNCKALLRPN
                     PGDCCVFCSFGSVKCPPIQQQLGCCS"
     gene            complement(149529..149804)
                     /gene="merP"
                     /locus_tag="HWH41_00770"
     CDS             complement(149529..149804)
                     /gene="merP"
                     /locus_tag="HWH41_00770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003150552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury resistance system periplasmic binding
                     protein MerP"
                     /protein_id="QOD45479.1"
                     /translation="MRKLLIAVLFALPFVALAAPPKTVTLDVQNMTCGLCPITVKKSL
                     EKVSGVSDVQVNFDQKTATVTYDPDKAQPEALTEATANAGYPSTVQK"
     gene            complement(149817..150167)
                     /locus_tag="HWH41_00775"
     CDS             complement(149817..150167)
                     /locus_tag="HWH41_00775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009682418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury transporter MerT"
                     /protein_id="QOD45480.1"
                     /translation="MGMQLTGKGSLVASSLTAIGASVCCVGPLVLLALGVGGTWVGAL
                     TMMEPLRPLFIGLTLLFLGLAFRKLYLVPQVCTPGTPCADPRTLVRQRLVFWIVSVLL
                     LGLLAVPWLAPLFY"
     gene            150242..150640
                     /gene="merR"
                     /locus_tag="HWH41_00780"
     CDS             150242..150640
                     /gene="merR"
                     /locus_tag="HWH41_00780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003089120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hg(II)-responsive transcriptional regulator"
                     /protein_id="QOD45481.1"
                     /translation="MATELTIGKLADAAGVNVETIRYYQRRGLLDEPAKPLGGHRRYP
                     VDMVKRLRFIKRAQALGFTLSEVGGLLTLDESCACAETRARAARKLALIEQKMADLVV
                     MQQLLGELVQQCDAGDGGTICPIIEALIRE"
     gene            complement(151049..151969)
                     /locus_tag="HWH41_00785"
     CDS             complement(151049..151969)
                     /locus_tag="HWH41_00785"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003292671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="QOD45482.1"
                     /translation="MAHEHNHNTEAIGDKRLIAAIGVNAALTLAQVVGGILSGSLSLI
                     ADALHNLSDAASLVIALIARKIGRRPPDAFKTFGYRRSETIAALINLVSLIIIGLYLI
                     YEAIGRLYSPQPIEGWTVVVVAGIALIVDIATALLTYTMSKDSMNIKAAFLHNVSDAL
                     ASVGVVVAGTLILLYGWYWTDTVVTLMIAGYVLWQGFSMLPKTIHLLMEGAPEGVSIA
                     DIINVMEQVDDVESVHHVHVWEIAEHTIALEAHVVIKKASLPDIERVKTDLKRVLHEQ
                     FKVSHSTLEMELDGSVCIDTRQADNHRSEA"
     gene            complement(152040..152504)
                     /locus_tag="HWH41_00790"
                     /pseudo
     CDS             complement(152040..152504)
                     /locus_tag="HWH41_00790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011544423.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS30 family transposase"
     gene            complement(152927..154450)
                     /locus_tag="HWH41_00795"
     CDS             complement(152927..154450)
                     /locus_tag="HWH41_00795"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45483.1"
                     /translation="MTKKKKKSRSGKITTPLAGHKRVGKALVPPMLQLEGVSFSSWVN
                     DRLPEMLWASLVITVIPRDQALEAFRDIAALGLRYRKDEREQATGWTLRHTHLPAQPR
                     ELFEALVGRVLRCHAGAQALRPLLLLENLPGITWWKAALGSEPIEDDWQTLGQAVQKT
                     FDHQSQEATDVRWVSILFKIALGEMLFPAGFEEHLLEIVEYPNRGDMRSVRPSIRAME
                     MTFTHLGQSSWSESFWTDMLQQTGCTPAPLLPREKPSNDLQAVRLGLVEVRKALLEHW
                     FTTLSTSGIDPKQDGVFGFGFFALSCFAEMSSGPLNEGIAGRLLLRALTECRISLAFL
                     VRCGDDAMWKKFRSYGAGQAKLALLKHEEMTGERPRFVTLETLERLANEDYFQEYVEI
                     DLGHWCGKDLRKLAEESGTKEDYDRYYGWASGFVHGQWGAMRDSNFTHCLNPLHRFHR
                     VPLPFHRKLEPTLDDGLQLVNSILDDVSTAYPGFNARIKISSDSMERQEDAATVEPT"
     gene            complement(154553..156265)
                     /locus_tag="HWH41_00800"
     CDS             complement(154553..156265)
                     /locus_tag="HWH41_00800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003150565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45484.1"
                     /translation="MRRFEAKDLIALATAPMNPDDHWYVDAEQASQYLVANANADEIV
                     IYASAPAVLIVGALVPTVNVTPVDGGALQNTSLCTDAAWKIQKSWNAAEGYRVYLEPP
                     FPNDRVSALSGGETLVTRRYLSGVHKGPAPIEVSQKLVHCLDIHYIPERNAYCRLDGN
                     GDIEDVIRVLTLPIDEQLEGREVVTILRKDLDTYMAVADLALVIKFDFTRTVRGSFSG
                     WNDVSRYHRDGEDLFYHGGSAARASFMHGAMVVRSRTTLAEQEEAWRRDFEGAPDREY
                     AVFKIYDRKNDRNVETSASPLHIVSYFEQSDLPWQISPAFFRPEVLQRFKADPEKYTL
                     EDRSISCRGAWHIKSYDINEAGQVHVYIGDLAKLPIAEQNYWKAFNEWPKSSISARAH
                     RTDIEGQWCTTYDPLNSLRNKVRALDKACPEWWNRRGDALMDSVLAPATDSPKEWGDE
                     ILALDQLLVEGFLDKPLRKIAQEKGREIEPVWRSLKLLHEILLGSTLSEEAAKQLLAP
                     MKKLHELRNEIRGHATHEKKEVAIREARTTHGNFRAHFFHLAEGCDQALIGVLKALEF
                     EMED"
     gene            156530..156802
                     /locus_tag="HWH41_00805"
                     /pseudo
     CDS             156530..156802
                     /locus_tag="HWH41_00805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010952952.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            156832..157665
                     /locus_tag="HWH41_00810"
                     /pseudo
     CDS             156832..157665
                     /locus_tag="HWH41_00810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248759.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="PA0069 family radical SAM protein"
     gene            complement(157896..158810)
                     /locus_tag="HWH41_00815"
     CDS             complement(157896..158810)
                     /locus_tag="HWH41_00815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion-associated lipoprotein TagQ"
                     /protein_id="QOD45485.1"
                     /translation="MSQPSENRLITSARYALCLLTASGVLLSGCASSGVGSVAQTTRA
                     EYYPSCYEPVSHLRSTDNAVRNSAITGAITGGLLGGLAGGLASDENRGRNAALAAAGG
                     ALAGGAAGYYMEKQKQISDDRARIGSYATDVDRSTVEINRSVAYAKSAQSCYQSQFKA
                     LLDGRKNKSINEAEGRKRLAEIVSGLQETNALLVAANGRAGENINNYTQAYEKDLQQV
                     GVPRTEVTKVAEAENRASTTKGGSKPKTGSNPKVPKEAVATEQTIRKAQDAQSEGNKV
                     ASRGQGMIQEVCNSPDMGDWAPPSCAKA"
     gene            complement(158872..160584)
                     /locus_tag="HWH41_00820"
     CDS             complement(158872..160584)
                     /locus_tag="HWH41_00820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SUMF1/EgtB/PvdO family nonheme iron enzyme"
                     /protein_id="QOD45486.1"
                     /translation="MFEKAILPLTLGACLAFAAPAWAEGDSPDNPKPLADDVALPLPC
                     GGEMVFRHVYVLAEGALDDREVNLGYAFNEGEAGYQQSFISGYRRDYVNGQFSLADLA
                     PAWQQKLSASLPKPAAGTPLKPMLYFIGKYEVTARQYAAVMSQAAALSGQGEAPACDV
                     PDGMAARLPKVNLSRFDAERFGAVYSAWLMKNHPELLPVSGRGKNPEDGGIGFVRLPT
                     EVEWEFAARGGQAVSRQELEGRLFPRKVEGSDQEGPLGDWAVYNQVAGGTGQAARLLP
                     VGMKRPNPLGLFDVIGNAAEMVQESFQLVHAGRRQGTYGGFVVKGGNYLEGEMTLFTG
                     MRREYPLFAADGSEQRNETTGFRVAIGALSAPRSRYPELFAQWQKEGRLAALTDAIDD
                     AQDPTKQLDGIIAATRDPQMQAQLAQINEELKRNVSLIARQREEAAGNLIQSAALVAE
                     TINNYNIRLTNLKKDREKAVAARDQATAQLYAGAIANGRSALDGALAIYIDNLATGTR
                     YTDAVIQAQFQRIQEELNRNPVLGKSLVKRATLFVKHVGDYRQQHRAEPEAVLKELLA
                     SSGR"
     gene            complement(160577..161776)
                     /locus_tag="HWH41_00825"
     CDS             complement(160577..161776)
                     /locus_tag="HWH41_00825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QOD45487.1"
                     /translation="MRAGLLLSLAWADYRGEARLSLCAIFALAAVITPLLVLFGLKYG
                     LVSTLTERLERAPSVREIIPVGGARYRAEDIAALAARVDVAFAVPRTRQIAATADLSG
                     GGETALSVEMIPSAAGDPLLAGLPQPDRPTRVVLSHGAAEKLGAQPGERIVARIGRRM
                     DGQAQSQRLELEVLAVLPQERFARDALFAPLALLEAAEDYRDGRAVAAYGWPGKAGET
                     PRARIYPGFRLYARDLDAVEGLRRHFVASGVEVATQAEAIAQVRSLSRNLGLVFWIVA
                     ALAIGGAFAAIAASSLAAVERKRRALAVLRLLGFPTAALVGFVMLLALFSAVFGLFLA
                     GLLYAATAGALNHLFDNQSGEFVCRLLPSHYLTALLATLLCSVLAAASGGWRAARIEA
                     AEGLRDV"
     gene            complement(161776..162495)
                     /locus_tag="HWH41_00830"
     CDS             complement(161776..162495)
                     /locus_tag="HWH41_00830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="QOD45488.1"
                     /translation="MILRLHEVARSHGAGRQRYRLRVPALELRAGRQLAIVGPSGCGK
                     STLLDLLALALAPDPGGRFEFLAGERPQDIAALWRDGRQDRLAALRRQHCGYVLQSGG
                     LLEFLDVRRNIGLPCALLGAPSAERVQALAERLEIGDQLDKKPAALSVGQRQRVAIAR
                     ALAHAPRLLLADEPTAALDPLNAERVMRLLVEQARERGACTVVATHDERLARAAGLEV
                     LAIRWQREADDSVGACLEDVG"
     gene            complement(162492..165590)
                     /locus_tag="HWH41_00835"
     CDS             complement(162492..165590)
                     /locus_tag="HWH41_00835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase"
                     /protein_id="QOD45489.1"
                     /translation="MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALA
                     ADPSFAERFLREGRTLARLSHPNTVTIHDIGNVGSCYYMAMEYLPNGTLKERIQQGLD
                     PEQGLAYVRQVAAALGYAHSQGLVHRDVKPANILFRADGTAVLSDFGIAKSIEDNTQF
                     TQVGFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILTGKLPYNGKDSLSTALAH
                     LTEPLPELPIEQGRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLA
                     TPQGSPRASNPPPAEPAPLPPADLGGLQPVSIQLPPVTPSAGSATPPPPPPSQAAKPP
                     SPPPPPFPPGKPRAGASRTPLIVAAAAAVLLAIGGGAWWLLGSGDAPSAADPAPLGQT
                     PADKPQQQTPVADAEQDGGERPLLMPGKKTLFQRVLTKPGAAISAEAGGPPRAGAVPA
                     FSVLYVYARKQVGGSPWLRVGASSNGEGDGWLPASAVSDWKQSLVLKFTERSGRAPVM
                     FLNSAEQVERLLGDTRAARDTLTQAVDHKGDPQVVAVEPNDRAIPQDQFYLLPIFDSK
                     ESFDADGQPAQLLEVASIDPGGSATAPQAPGQAGRGGASGAASDTFRTGIVLVVDTSV
                     SMQPYIDRVREVIDGLQRQIGERGDLDKVSFGLVGFRNNTDKTPGLEYVSKTLVPLQP
                     GNDAQRFAELSSQVRATDVSSHSFNEDAFAGIMQAVDEMDWSPYAGRVVLLVTDAGAL
                     RKNDPLGRTQMNEAEVRQAALRKGVKIYALHLRTPAGKNNHGYAEQQYRSLTADANPK
                     IADLYIPVAGGEVNAFGNTVKEIGTVFADLVHDAGNRKPQAPRFDAAPSVASKSAAIG
                     YAMQMEFLGRRDPVRAPQVVTAWTADRDLTNPALPAFQVCVLLSKLQLNELQQSLKLI
                     VDAAKRTQTSPKDFFQEIASASAYMSRDPAQLVKGSNLAQSGVLGEYLEGLPYRSKSL
                     NMTQDLWLSLSVAEQQDFIDELESKIRLYETFHNDVANWVRFGDADAGDALYRVPLST
                     LP"
     gene            complement(165598..166326)
                     /locus_tag="HWH41_00840"
     CDS             complement(165598..166326)
                     /locus_tag="HWH41_00840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine-protein phosphatase"
                     /protein_id="QOD45490.1"
                     /translation="MVPNSVSYYRSASYSHVGMVRKVNEDASLDAPESGLWVVADGMG
                     GHAAGDFVSSLIVDTLRRIPAASSLPAYVGALRTGLAQVNERVRQEAGLRGVSVMGST
                     LVLLAARGNQASCLWAGDSRLYRLRGGVLEAISRDHSYVQELLDNALISEEEARHHPR
                     ANVVTRAVGVHEQLELSEAALHVLPGDSFLLCSDGLNKTADDSELRDVLSHSDPYAVV
                     RSLVHLGLTRGAPDNITALVVRAF"
     gene            complement(166336..167016)
                     /gene="tagF"
                     /locus_tag="HWH41_00845"
     CDS             complement(166336..167016)
                     /gene="tagF"
                     /locus_tag="HWH41_00845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system-associated protein
                     TagF"
                     /protein_id="QOD45491.1"
                     /translation="MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDEL
                     GAAWLDAYLTSPLWRFAIAPGLLGGEAVAGVVMPSIDRVGRYFPLTVACLLPANADLG
                     GLVGGDDGWFEQVESLLLSTLEPEAEVEAFEQAVAQLPAPPCGPRIEQSLISGNLLRS
                     EAVTPAQRLAALAQHACDGASHWWGRGSARISAGLMRYQGLPPAPAFGRFLTGEGEVI
                     PLFPGIPG"
     gene            complement(167013..170543)
                     /gene="tssM"
                     /locus_tag="HWH41_00850"
     CDS             complement(167013..170543)
                     /gene="tssM"
                     /locus_tag="HWH41_00850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003176940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system membrane subunit TssM"
                     /protein_id="QOD45492.1"
                     /translation="MKGFLNFFARWVVPVLGLLALSLIIWFLGPLLRLGNYEPLASAT
                     SRWVLIVLLFLVWIGFRVLRIVQARRNAAKVMQSLAEVSAPDAASVATAEELATLKQR
                     MDEALALLKRAKLGGSERRNLYELPWYVIIGPPGSGKTTALMNSGLDFPLAAQMGAGA
                     IRGVGGTRNCDWWFTDEAVLLDTAGRYTTQDSHAQVDKAAWLGFLDLLKTQRKRRPID
                     GAFIAISLSDLLLGSDAERAAHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFME
                     FFDSLNREERAQVWGMTFALDDGKSAEGPLAVFDSEFALLEQRLTARLVERLQQERDP
                     ARRDLVYGFPQQFAALRECLGEFLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLI
                     GSMAQSMNLDRQHLARQTGTGRSYFIERLFREVAFGERGLVGTNPKVERRRKWLTIGA
                     LSATALVVLAVTAVWIASYRANQSYIAAVDQRVDPLARGIESLSPAQRDVLAVLPQLN
                     AVQNLAGDAPSWAEGYGLYQGDMLGEESASVYRKLLIAVFAPRLVTRIEEQLRSGGSS
                     DFLYEGLKAYLMLGSPDHYDADFIKAWISLDWERNLPRDLSPEQRQALHAHLDALLER
                     RPPSARLDQDLVEDLRRQLQQLPVAQRVYDRVKRQRLPKDVPDFRISDAAGRDAPLVF
                     ARKSGKPLTDPLSGFFTYRGYREVFLTASLSQAGTIAEEQWVLGRDLNDAGDAANLAL
                     DVRRLYFQDYLRQWDDLLADLTVVPITNVTQAADVLRILSGPTSPFRKLLEAVARETD
                     LQKGDRLVAAQVKKAADGTVDKLKQRLGSLVGQEEEGAREQPRQVDSDPISAHFAELN
                     SLVSKGEGGNEPAPIDSLLEDMNALYVQVSAMAGASGDSLLGDAKNQVAAAASRVALS
                     AERQPPVVQGLVKNVVNSTTSSMMGSVRNQLNAAWISDVVSVYRQSLAGRYPIAAGSS
                     RDATLEDFGHFFGAGGVMDSYFRQYLQPYVDTSASTWRWQPGAAQKLGINPGVLHTFQ
                     RAAAIRDAFFRSGGMQPAVRFELKPVTMDAAISQFILDLDGQQLTYDHGPARPVAMQW
                     PSANGLGVVRLTVTPPPSSGRSGLTLEGPWAWFRLLDQSDLERGNSPDRFTLRLRIDG
                     SSIACELRASSAFNPFKSRVVSGFSLPERL"
     gene            complement(170540..171889)
                     /locus_tag="HWH41_00855"
     CDS             complement(170540..171889)
                     /locus_tag="HWH41_00855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DotU family type VI secretion system protein"
                     /protein_id="QOD45493.1"
                     /translation="MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGG
                     DPYTPPPMASLAPLSGRGDGLNPLEQAAGPLLAMLTRLRNTIAHPAPASLRAQLLGYL
                     RQFEEKARQAGVAPDEVMLARYVLCTALDEAVLSTPWGSTSDWGKQSLLITLHNEAWG
                     GEKVFQLLEHCLQNPHQRLHLLELLYLCTSLGFEGRYRVMHDGRSQLEALRERTAAVI
                     RSTRGEYEHELSPHWRGLSVMRDRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAE
                     PVFKRIHAIGEIPVQAIDRPAVQPRVIERPRLARFLADDIKAQRVAVEDAVDRSVVTI
                     RGDELFASASASVRDEFQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLS
                     QARAQEVADLLGATTGDAGRFTAEGRSDTEPVASNASAEGRARNRRVEITVFAEGAQ"
     gene            complement(171896..173230)
                     /gene="tssK"
                     /locus_tag="HWH41_00860"
     CDS             complement(171896..173230)
                     /gene="tssK"
                     /locus_tag="HWH41_00860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system baseplate subunit TssK"
                     /protein_id="QOD45494.1"
                     /translation="MSWNNRVVWSEGMFLRPQHFQQHDRYLETLVDGRCRSLLAGGWG
                     FSELKLDDALLTQGKLAIVSARGVLPDGTPFNIPADDPAPAPLNVEESLRDGIVYLGL
                     PLKRVGTRDTVEEGEALGGARYVSQVQEVRDDNAPFESRAPVALGSQAFRLLTERDGL
                     GEYAAVGVARVREKRADQALSLDEDYLPPVLDIAAAPPLASFAKELLGLLHQRGEALA
                     GRVVASSAGGASEIADFLLLQLVNRAEALTGHLSRVRPLHPQELYRELVALAGEFCTF
                     TASQRRPEEYPVYNHDDLAASFAPVMLALRQALATVIDAKAIAIPIVEKAYGVHVAML
                     SDRSLIDNASFVLVVRADVPGESLRGHFPQQAKVGSVEHIRDLVNLQLPGIGLLPMPV
                     APRQIPYHAGSTYFELDRGSAHWKQLTHSGGFAFHIAGQFPGLNLAFWAIRG"
     gene            complement(173246..173710)
                     /gene="tssJ"
                     /locus_tag="HWH41_00865"
     CDS             complement(173246..173710)
                     /gene="tssJ"
                     /locus_tag="HWH41_00865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system lipoprotein TssJ"
                     /protein_id="QOD45495.1"
                     /translation="MQKLIVALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAG
                     QAAPLRLRLYELKKDTAFGRADYFALTDNAQSTLGGDLVEQDEFLLRPGEERRIERTL
                     DEQTRQLGFVAAYRDLDRATWRQVLDVPGQRTSHLDITLGAQAIGIVARPAP"
     gene            complement(173755..175254)
                     /gene="tagH"
                     /locus_tag="HWH41_00870"
     CDS             complement(173755..175254)
                     /gene="tagH"
                     /locus_tag="HWH41_00870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system-associated FHA domain
                     protein TagH"
                     /protein_id="QOD45496.1"
                     /translation="MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPE
                     RLVSSRHCTILNRDGVYYLTDTSTNGVLLVNAGHRLRRGNSEPLQDGETVRLGEYDIL
                     VQLGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAFAEPAPTPHPAVTAHFQGGSP
                     LDTKPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPPPPATTPAPPPAGGAPLI
                     PADWDPFAELLGNTPAPSATPVAQPLPTAEPTPLAMPFADPGITQQPQPQPQPQPQPQ
                     PQPQPQPQPQPASVAAPTPPASAAATAGGDLLQAFLRGAGMTQLKVDPAGAEAQMEAI
                     GRSYRGLVEGLVDVLRARASLKGEFRMAQTMIQPVQNNPLKFAPNVDEAMLLLLRRDN
                     QAFMAPDRAVADSFEDLKAHQLAVMAGVQAAIRHLLARFEPAALEARFGKPAGLSGLL
                     PGARQAQNWDSFTELYAKILREAEDDFQELFGREFSRAYEEHSARLRRS"
     gene            175622..176656
                     /gene="tssA"
                     /locus_tag="HWH41_00875"
     CDS             175622..176656
                     /gene="tssA"
                     /locus_tag="HWH41_00875"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system protein TssA"
                     /protein_id="QOD45497.1"
                     /translation="MLDVPVLLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGD
                     AVLPAEPPEWPRVRALASELFGRSKDLRVANLLLQSNVALDGLGGLAEGLLLVRELLG
                     QYWDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVWAIPLVRSRAFGPVNLRAALN
                     AAGLQRFASETLSPEQIAGAFADADADALAATRRALDGAQEHALAIESGVAERVGSAQ
                     GLDLGPLRQLLRQALQVFDLYGPQGAGEPLAPGAEAATGEQGGAAPVAAVAAPAPRAS
                     GEIANREDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQ
                     FETLRGPESE"
     gene            176745..177263
                     /gene="tssB"
                     /locus_tag="HWH41_00880"
     CDS             176745..177263
                     /gene="tssB"
                     /locus_tag="HWH41_00880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system contractile sheath
                     small subunit"
                     /protein_id="QOD45498.1"
                     /translation="MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMA
                     DLAGKPAEPQAAVADRKFLEIDVDNFDARLKAMKPRVAFNVPNVLTGEGNLSLDITFE
                     SMDDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKTGAEEMIMKAIKDPALLQALA
                     SAPKPKDDEPQA"
     gene            177276..178772
                     /gene="tssC"
                     /locus_tag="HWH41_00885"
     CDS             177276..178772
                     /gene="tssC"
                     /locus_tag="HWH41_00885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system contractile sheath
                     large subunit"
                     /protein_id="QOD45499.1"
                     /translation="MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETA
                     VRTLAEHALEQTSLISNDAIKSIESIIAAIDAKLTAQVNLIMHHADFQQLESAWRGLH
                     YLVNNTETDEQLKIRVLNISKPELHKTLKKFKGTTWDQSPIFKKLYEEEYGQFGGEPY
                     GCLVGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQELSNPRDLTK
                     IFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSK
                     YAWANSAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTE
                     IAISDRREAELAKNGFMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLP
                     YLFATCRFAHYLKCIVRDKIGSFKEKDEMQRWLQDWILNYVDGDPAHSTETTKAQHPL
                     AAAEVVVEEVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVSKLPSAKEA"
     gene            178848..179336
                     /locus_tag="HWH41_00890"
     CDS             178848..179336
                     /locus_tag="HWH41_00890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system tube protein Hcp"
                     /protein_id="QOD45500.1"
                     /translation="MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGG
                     GGGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITL
                     KEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPVKYGWNIRQNV
                     QA"
     gene            179504..180349
                     /locus_tag="HWH41_00895"
     CDS             179504..180349
                     /locus_tag="HWH41_00895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="QOD45501.1"
                     /translation="MADPSFASGRLGSRLQGSIAMIAEELLRAGRLDDALKALQEQVR
                     SQPSNATLRIFLFQLLAVMGQWARAQNQLKVVGELDASALPMVQTYSTAIDCEALRRE
                     VFAGRLTPVILGQPAEWIAPLLQALSLDAEGHGEAAQALREQAFDAAPAVPGRIGEAP
                     FAWLADADTRLGPVLEVIVNGRYAWLPMSNLRSLKVEAPSDLRDLVWLPAELTLANGG
                     ATVALLPARYAETVEHGDDAARLGRKTEWLDSGLPVGQRLFVTDAGETALFDLRELDF
                     EPTDA"
     gene            180351..180860
                     /gene="tssE"
                     /locus_tag="HWH41_00900"
     CDS             180351..180860
                     /gene="tssE"
                     /locus_tag="HWH41_00900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system baseplate subunit TssE"
                     /protein_id="QOD45502.1"
                     /translation="MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLSQLKASV
                     LRDLAWLFNTTSLFDHGPAARMPAGNSVLNYGLPALAGHTASSVDVHAIEALLTETIA
                     TFEPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAEPAPLRLLLTTNLDLETGHVR
                     VAQGERRRT"
     gene            180857..182716
                     /gene="tssF"
                     /locus_tag="HWH41_00905"
     CDS             180857..182716
                     /gene="tssF"
                     /locus_tag="HWH41_00905"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system baseplate subunit TssF"
                     /protein_id="QOD45503.1"
                     /translation="MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADP
                     YVERLLEGFAYLTARVQLKLDAEYPTFTHNLLEIAYPHYLAPTPSMTVVQLRPDPNEG
                     ALSSGFSVERGASLRGQLGPDDQTACEYRTAHPVTLWPLEVAQADYFGNPAAVLGRLA
                     ASEPRAKAGLRIRLRSGAGIPFDSLSLDALPLYLHGADEQPYRLYEQLLGNACAVFVR
                     APDNAWVERLPTSSLRARGFDDEVALLPVVPRAFQGYRLLQEYFALPARFLFVEFSGL
                     NRALRRCHGEELELVVLFGKHDQRLEGTVDAEQLVPFCTPAINLFPRRCDRIHLSDRV
                     NEHHVIVDRTRPLDFEVHSLQQVSGHGSGPEQPFQPFYAVRDPARYGREQAYFSVRRE
                     PRVLSSKQRRKGPRSTYVGSETFVALVDANQAPYRHDLRQLGIAALCTNRDLPLFMPI
                     GAHKSDFTLEDSAPVMQVRCLAGPSRPRASRAHDASAWRLISQLSLNYLSLAERGQGA
                     AALRELLRLYGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEITLDFDEN
                     AFRGTGVFLLGAVFERFLARYVSINSFTETVLRTGERGEVMRWQAKPGSRPNL"
     gene            182680..183726
                     /gene="tssG"
                     /locus_tag="HWH41_00910"
     CDS             182680..183726
                     /gene="tssG"
                     /locus_tag="HWH41_00910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system baseplate subunit TssG"
                     /protein_id="QOD45504.1"
                     /translation="MAGEAGQPSEPLNLLAGMAAAPWDYDFFQALRRIECESPQLPRL
                     GHSVRLADDPLRLGQKPDCTFAPSTLASVSHTGTAATPRLDQFFFGLTGPNGPLPLHL
                     TEYARERQRNVNDATFKRFMDVFHHRLLTLFYRAWAEARPEISHDRIDDDYWSARLAA
                     LSGRGMPSLRGREPLADTARYYYTGHLAAQTRYPDGLRVILAEYFEVPVAVEEYVGQW
                     LELPERSRLGVDSTSLGMDVCLGTHVWDRQHKFRLRLGPLDLDQYQRFLPDGDHFVEL
                     AAWVAEYLGEELDWDVNLVLQRHEVPPLGLQGGGRLGFNTWLGDPGQDARDLLLARQY
                     ATARPHEHKEKEHE"
     gene            183719..186427
                     /gene="tssH"
                     /locus_tag="HWH41_00915"
     CDS             183719..186427
                     /gene="tssH"
                     /locus_tag="HWH41_00915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system ATPase TssH"
                     /protein_id="QOD45505.1"
                     /translation="MSEISRVALFGKLNSLAYKAIEAATVFCKLRGNPYVELVHWFHQ
                     ILQLPDSDLHQIVRQSGIDPARLAKDLTEALDRLPRGSTSITDLSSHVEEAVERGWVY
                     GSLMFGESQVRTGYLVIGILKTPSLRHALTGLSAEFAKLKVEALTERFDEYVGASPEN
                     GLSASDGFNAGAAPGEASGALAPSAMGKQEALKRFTVDLTEQARSGKLDPIVGRDEEI
                     RQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRALDVGLL
                     QAGASMKGEFEQRLRQVIEDVQSSEKPIILFIDEAHTLVGAGGAAGTGDAANLLKPAL
                     ARGTLRTVAATTWAEYKKHIEKDPALTRRFQVVQVDEPSEHKAILMMRGVASTMEKHH
                     QVQILDEALEAAVRLSHRYIPARQLPDKSVSLLDTACARTAISLHAVPAEVDDSRRRI
                     EALETELAIIRRESAIGVATAERQRNAETLLAEERERLAALEQRWAEEKRLVDELLET
                     RARLRAAAEAVDAGGAPLGEGEARLDEEQRQALHARLAELQAQLSALQGEEPLILPTV
                     DYQAVASVVADWTGIPVGRMARNEIDTVLNLDRHLKKRIIGQDHALEMIAKRIQTSRA
                     GLDNPSKPIGVFMLAGTSGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLK
                     GAPPGYIGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVHEIFFQVFDKGVMEDGEGR
                     VIDFKNTLILLTTNAGTEMIASLCADPELMPEPEAIAKSLREPLLKIFPPALLGRLVT
                     IPYYPLSDDMLKAISRLQLGRIKKRVEATHKVPFEFDEGVVELIVSRCTETESGGRMI
                     DAILTNTLLPDMSREFLTRMLEGKPLAGVRISSRDNQFHYDFAEAE"
     gene            186474..188405
                     /locus_tag="HWH41_00920"
     CDS             186474..188405
                     /locus_tag="HWH41_00920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system tip protein VgrG"
                     /protein_id="QOD51088.1"
                     /translation="MQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENP
                     NLPLEQLLGKPMSLSLELPGGSRRFFHGIVARCSQVAGHGQFAGYQAILRPWPWLLTR
                     TSDCRIFQNQSVPEIIKQVFRDLGFSDFEDALTRPYREWEYCVQYRETSFDFISRLME
                     QEGIYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRERDHFFDWQMARE
                     VQPGSLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRI
                     EAIQAQHERVRLRGVVRGIGAGHLFRLSGYPRDDQNREYLVVGAEYRVVQELYETGSG
                     GAGSQFESELDCIDASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHF
                     HWDRHDQSNENSSCWIRVSQAWAGKNWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVY
                     NAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRMEDKKGAEQLYIHAERNQDNLV
                     ENDASLSVGHDRNKSIGHDELARIGNNRTRAVKLNDTLLVGGAKSDSVTGTYLIEAGA
                     QIRLVCGKSVVEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAKGKG
                     VQGTIDGQVQAMFPPPAKG"
     gene            complement(188520..188804)
                     /locus_tag="HWH41_00925"
     CDS             complement(188520..188804)
                     /locus_tag="HWH41_00925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003111794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45506.1"
                     /translation="MSPVNYVERALALVAERLARHPQCGMLLSVEKQLLYLKAVLLDR
                     SLDRSALHRLSFGGIAGKEFEETDPELARALKDAFYVGIRTGRGLKVDLP"
     gene            complement(188817..189050)
                     /locus_tag="HWH41_00930"
     CDS             complement(188817..189050)
                     /locus_tag="HWH41_00930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003083689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45507.1"
                     /translation="MAIEKGEAFARRDIYIDYDFEDVTYRWDHRQGTIHVRFYGEAES
                     PEPVEHDNRLFNDALRFGREITREEYETGFPKG"
     gene            complement(189040..190422)
                     /gene="tis1"
                     /locus_tag="HWH41_00935"
     CDS             complement(189040..190422)
                     /gene="tis1"
                     /locus_tag="HWH41_00935"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003083691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T6SS immunity factor Tis1"
                     /protein_id="QOD45508.1"
                     /translation="MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATG
                     GLAAVILAGSIAAGGLSMFQIVKGLTTIFELPEPTTGVLIRGSFNVYVNSRNAMRAGD
                     DVSATCSGLPLNHPLWPFPVLIAEGSATVYINGKPAARLQSKMVCGAHIKTGSQDTFI
                     GGPTERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALVGVVAIGGLMMGGM
                     ALLGDLGDRFGPGYRDLFQGVAGMALLGFGPKMARLGNAPKGAPKTQVPKGFEKVYGK
                     APAAKAEIDAVADGLAAKHGGRVAKAPIKSRERAMQKINNDYKGDPTKIKDLARNTII
                     VEGDKVNTVAAELANRGAKVKVIDGNADPLGYSGVNSTMNTKAGIPGEIQVNSPEMIY
                     AKESEDMARILLGNDTYDAVAAKAGVPGGQGHKYYEDWRVLDPKSPEAQAIAEKSRAY
                     YDAVRKGNGN"
     gene            complement(190438..190872)
                     /locus_tag="HWH41_00940"
     CDS             complement(190438..190872)
                     /locus_tag="HWH41_00940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DcrB-related protein"
                     /protein_id="QOD45509.1"
                     /translation="MTLYRLHEADLEIPDAWQDQSINIFKLPASGPAREASFVISRDA
                     SQGDAPFADYVARQLENAEKQLPGFKLHKRWDINIHGHAAVLLDYQWQREGRDLMLRQ
                     VFIERRPAVLITTLTTTPADLPHHEPAWKQAMQTLVPRPTPS"
     gene            191126..>192312
                     /gene="vgrG"
                     /locus_tag="HWH41_00945"
     CDS             191126..>192312
                     /gene="vgrG"
                     /locus_tag="HWH41_00945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system tip protein VgrG"
                     /protein_id="QOD45510.1"
                     /translation="MALAQQTRLVRVDSPLGAEVLQLQRMEGREELGRPFAYELELIS
                     ENPDLPLDGLLGKPASLALELHDGSRRHFHGIVAACSQGSGNGQFASYQVTLRPWLWL
                     LTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSR
                     LMEQEGIYYWFRHEQSRHILVLSDAYGAHQSPPNYASVPYYPPTLEQRERDHFYDWHM
                     AREVQSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYAR
                     TRIEALQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGADYRVVQELYET
                     GGGGVGAQFESELDCIDAGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVK
                     VHF"
     assembly_gap    192313..192704
                     /estimated_length=392
                     /gap_type="within scaffold"
                     /linkage_evidence="align genus"
     gene            <192705..193351
                     /locus_tag="HWH41_00950"
     CDS             <192705..193351
                     /locus_tag="HWH41_00950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=3
                     /transl_table=11
                     /product="type VI secretion system tip protein VgrG"
                     /protein_id="QOD45511.1"
                     /translation="DHDETVHVKHDRTETVDNNETITIGVDRTEKVGNNEKISIGANR
                     TEDVGSNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVGNNETI
                     SIGADRSESVGANETIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKSFTLNA
                     GDSITLVTGAASIRMKKDGSIVISGKNITIDGSGAINVKADKNVVVKGRKILQN"
     gene            193379..193828
                     /locus_tag="HWH41_00955"
     CDS             193379..193828
                     /locus_tag="HWH41_00955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45512.1"
                     /translation="MSVEIHLPGATTALPARLDGVVIGVLLDVPDAAAPVVAYPGCPS
                     EHGLAAATTTQLSRADIGAQVALLFVAGDPRQPLVIGRIQRLPQEASARLDGERLEFS
                     AEREIVLRCGKASITLTRAGKVIIRGAYLSSRSTGVNRIKGGSVQIN"
     gene            193758..194957
                     /locus_tag="HWH41_00960"
     CDS             193758..194957
                     /locus_tag="HWH41_00960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2169 domain-containing protein"
                     /protein_id="QOD45513.1"
                     /translation="MAPIFPAAPPGSTGSRAVRCRSTERGGPDMELLNATPLAAAYNQ
                     GLDAEGRESLVVIAKGSFDLPLDGREARLLDEQQTLLMVDEFYGEPGLSAPRRECEFV
                     PFKPFCDVLVLGSARAPGGRPVQQLTAGIRVGRVSKALTVHGPRQWEPGLLGAGAGVA
                     QPFQRQDISYASAFGGSHASPDNPGFMDCYMANPAGCGWFPRSADTAEIVGTPMPATE
                     KLGEPVDSPHGRFTPMALGPLGRHWQARVGFAGRYDDAWLAERFPFLPADFDERYFQS
                     APADQWTDHLRGGEEVLLLNLTGEERAAFRVPRREVPVTFFLKKGGHETAQARIDTLL
                     VDCDARRVEVTWRIRRPLKRNLFEIAQVLVGSKSAAWWRARELGKDYYPSLAALVRSR
                     QAEEDEA"
     gene            194954..195991
                     /locus_tag="HWH41_00965"
     CDS             194954..195991
                     /locus_tag="HWH41_00965"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003161052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45514.1"
                     /translation="MSQALSIVASGMVSAVGLSAPASCAAIRCALDNFQETRFIDQGG
                     EWLVGAPVMLPEPSSGYAQLVGMAAMAIAECVAGLPAEDIREMPLLLGVAEVDRPGRL
                     AGLEQPLLQAIEERLGYRFHERSCVIPRGRVSAAVALLNARKLIEQGCSKVLIAGVDS
                     YLTAATLAAYQERDRLLGSHCQDGFIPGEGAAAVLVTAACASEEPQLLCLGLGFGVEK
                     ATVESEGLPLRADGLTQAVKAAFADCGFGYELVDYRLADLPGEQYYFKEAALALSRTL
                     RVRKERVELWSPADCIGECGAMTGPALLCIALAASRKGYAHGPQVLCHSGNDAGERAA
                     VVLGYQRVRAN"
     gene            195992..196939
                     /locus_tag="HWH41_00970"
     CDS             195992..196939
                     /locus_tag="HWH41_00970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003101201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4150 domain-containing protein"
                     /protein_id="QOD45515.1"
                     /translation="MANEVYANGRELSCKSASGKSIASFPDVCFTPPQAPPTPLGVPV
                     PYPNTGMSKDTTRGSRTVRITRKEVMLKNKSHFKKSYGDEAGRAPKKGIITSTNTGKV
                     YFTSWSMDVKIEGLNVVRHLDLTTHNHNPSPGNTATWPHTSKMKAAFKPGGKCAGMEH
                     LRLQPYSKACPSTAGGGAQTGHHLIPGRCMRGKAGYSHSKAPVICVSRGNQHQGSHKR
                     CHAKFDPVELDHFDKGKPFKYETARNTAAASAGGALSPPRELTKKEKECVAFQLDQYY
                     KAKPKKGPGCTTATNLRASGAAGKVIPPARSAPAPAGRP"
     gene            196950..197864
                     /locus_tag="HWH41_00975"
     CDS             196950..197864
                     /locus_tag="HWH41_00975"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45516.1"
                     /translation="MAKSETALYFTNIIAIGPQEALLAGHLYLEGAEPSVTRVMMIDQ
                     DDWFHVYDIPEVVYSALQRSPRRGQQKGDYCFLGRAGLLREHPSGQSSTDATLDIDNV
                     YLMDLCEVDGELYACGTQNQVLRQNKGVWQRIDQGLYVPLGDEVTACLNGIDGFSRDD
                     VYAVGDAGAIWHWDGKGWQASAAPTNLPLYCVHCAADGTVYIGGSGGILLRGSAQVGW
                     TDIGDRDLCSEVLENMVEFAGKLYVTATDQLLEYDGTRLSETKVPVQGKKAYYAIDAK
                     PEVMWVVGDECVLSYDGGTWQRHVCPEN"
     gene            197871..199103
                     /locus_tag="HWH41_00980"
     CDS             197871..199103
                     /locus_tag="HWH41_00980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003142384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR02270 family protein"
                     /protein_id="QOD45517.1"
                     /translation="MNVAAVIDQHVEEAGFLAGLRDHAVRAPHYDLAHLLDLDNRIEA
                     HLDALQIGGLRSLDLVLKALDTNAEGEVFVAAILVFRGTNGTALAQLCEHLRRFPEGA
                     RFFAAALGWLDWGQARPWVERLLASPEPLFRAIGLAACGMHRHDPGPALLSALGHADP
                     AVLARAARTAGELRRRDLMANIRAYRAHDDPSLRFWANWATAQMGDEEALGPLRAFAG
                     QPGPFQLPATMVLLAWQPRDTSMAWIRQLMQAADTRRIGIQATGLFGDPVAVPWLIQQ
                     MRDESLARVAGEAFSLITGADLALLDLELEALPDYDPGPNDDPDDEDVALDDDENLTW
                     PDAARVTAWWRDHGARFVAGRAYLLGEPLGEARCRQVLRDGQQRQRMAAACLLARFVP
                     NLPLFPTGAPVRRQLDLF"
     gene            199479..200207
                     /locus_tag="HWH41_00985"
     CDS             199479..200207
                     /locus_tag="HWH41_00985"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="QOD45518.1"
                     /translation="MPDRMRGVKSDSPEQESADDALKRIVDGFQHFRREVFPEQQALF
                     KKLANSQRPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSTAI
                     EYAVLALGVHHIIVCGHSDCGAMRAVLDPQTLERMPTVKAWLRHAEVARTVVADNCDC
                     GASHDTLGVLTEENVVAQLDHLRTHPSVASRLASGQLFIHGWVYDIESAQIRAYDAKQ
                     GRFLPLDGEHPVPMATPAPRYLNS"
     gene            200418..201989
                     /locus_tag="HWH41_00990"
     CDS             200418..201989
                     /locus_tag="HWH41_00990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SulP family inorganic anion transporter"
                     /protein_id="QOD45519.1"
                     /translation="MHVSKVFPSLRDTLPRDLMASVVVFLVALPLCMGIAIASGMPPA
                     KGLLTGIVGGLVVGFLAGSPLQVSGPAAGLAVLVFELVRTYGVAMLGPILLLAGAIQL
                     LAGRLRLGCWFRVTSPAVVYGMLAGIGILIVLSQLHVMLDLAPKASGLDNLLAFPQAA
                     FAALGSLGMDSGLDAALLGLGTIAVMWGWDKLRPQRLRFLPGALLGVSLATLASLWLA
                     LDVRRVEVPANLGEAIDWLRPADLLALADPSLLLAAVVVAFIASAETLLSAAAVDRLH
                     DGPRSDMDRELSAQGVGNMLCGLLGALPMTGVIVRSSANVNAGARTRASAIFHGLWLL
                     AFVLLLGSLLRQIPVASLAGVLVYTGVKLVDFKALGNLSRYGRMPMLVYAATALAIVF
                     TDLLTGVLVGFALTLLKLVLKAARLKIALRYTGEHEAELRLSGAATFLKVPALSRVLD
                     EVKPGTTLHVPMDNLSYVDHACMELLEDWGRMAPVQGSRLVIEPRALKRRLEGRLRGS
                     VGLGGARSGGAVSPG"
     gene            complement(201976..202614)
                     /locus_tag="HWH41_00995"
     CDS             complement(201976..202614)
                     /locus_tag="HWH41_00995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_008719730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45520.1"
                     /translation="MNTAALRELIQQAHLSEARHGHLADLIASCLPRLHRTIQPQGEN
                     TEDILTRFVHAYVEQVPDLLDAANSVAREAGIEERIKPVLKVAEQFFLTPPALLAGHD
                     GLDALLDEAYLAHRLVEEVNDRYIAHFGQALIPLDTTVANLVAHQLIGEPFANRLDEA
                     VHHAVENMLDATTFDADSARAYRENLKNPRVVAAWQQWPCLSKQLGVELSLG"
     gene            202986..204110
                     /gene="coxB"
                     /locus_tag="HWH41_01000"
     CDS             202986..204110
                     /gene="coxB"
                     /locus_tag="HWH41_01000"
                     /EC_number="1.9.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit II"
                     /protein_id="QOD45521.1"
                     /translation="MLRHPRVWMGFLLLSAISQANAAWTVNMAPGATEVSRSVFDLHM
                     TIFWICVVIGVLVFGAMFWSMIVHRRSTGQQPAHFHESTTVEILWTVVPFVILVVMAV
                     PATRTLIHIYDTSEPELDVQVTGYQWKWQYKYLGQDVEYFSNLATPQDQIHNRQAKDE
                     HYLLEVDEPLVLPVGTKVRFLITSSDVIHSWWVPAFAVKRDAIPGFVNEAWTKVDEPG
                     IYRGQCAELCGKDHGFMPIVVDVKPKAEFDQWLAKRKEEAAKVKELTSKEWTKEELVA
                     RGDKVYHTICAACHQAEGQGMPPMFPALKGSKIVTGPKEHHLEVVFNGVPGTAMAAFG
                     KQLNEVDLAAVITYERNAWGNDDGDMVTPKDVVAYKQKQQ"
     gene            204120..205712
                     /gene="ctaD"
                     /locus_tag="HWH41_01005"
     CDS             204120..205712
                     /gene="ctaD"
                     /locus_tag="HWH41_01005"
                     /EC_number="1.9.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit I"
                     /protein_id="QOD45522.1"
                     /translation="MSAVIDTPDHHAGDHHHGPAKGLMRWVLTTNHKDIGTLYLWFSF
                     MMFLLGGSMAMVIRAELFQPGLQIVEPAFFNQMTTMHGLIMVFGAVMPAFVGLANWMI
                     PLMIGAPDMALPRMNNFSFWLLPAAFGLLVSTLFMPGGGPNFGWTFYAPLSTTFAPHS
                     VTFFIFAIHLAGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMP
                     VLAGVVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSAII
                     PTFARKPLFGYTSMVYATASIAFLSFVVWAHHMFVVGIPVTGELFFMYATMLIAVPTG
                     VKVFNWVTTMWEGSLTFETPMLFAVAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVA
                     HFHYVLVPGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWMSFIGMNLAFFPMHFVGL
                     AGMPRRIPDYNLQFADFNMVSSIGAFMFGTTQLLFLFIVIKCIRGGKPAPAKPWDGAE
                     GLEWSIPSPAPYHTFSTPPEVK"
     gene            205723..206277
                     /locus_tag="HWH41_01010"
     CDS             205723..206277
                     /locus_tag="HWH41_01010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase assembly protein"
                     /protein_id="QOD45523.1"
                     /translation="MSDAKVDTRRLVGRLLLVTVLMFAFGFALVPLYDVMCRALGING
                     KTAGSAYNGEQQVDVGREVKVQFMTSNNIDMVWEFRSAGDQLVVHPGAVNQMVFYARN
                     PSDKPMTAQAIPSIAPAEAAAYFHKTECFCFTQQVLQPGESIEMPVRFIVDRDLPKDV
                     RHVTLAYTLFDITARKPPVPVAGR"
     gene            206288..207175
                     /locus_tag="HWH41_01015"
     CDS             206288..207175
                     /locus_tag="HWH41_01015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit 3"
                     /protein_id="QOD45524.1"
                     /translation="MASHEHYYVPAQSKWPIIASIGLLVTVFGLGTWFNDLTAGHKES
                     HGPWIFFVGGLIIAYMLFGWFGNVIRESRAGLYSAQMDRSFRWGMSWFIFSEVMFFAA
                     FFGALFYVRHFAGPWLGGEGAKGVAHMLWPNFQYSWPLLQTPDPKLFPPPSAVIEPWK
                     LPLINTILLVTSSFTVTFAHHALKKNKRGPLKAWLALTVLLGIAFLILQAEEYVHAYN
                     ELGLTLGAGIYGSTFFMLTGFHGAHVTLGALILGIMLIRILRGHFDAEHHFGFEAASW
                     YWHFVDVVWIGLFIFVYVI"
     gene            complement(207191..207400)
                     /locus_tag="HWH41_01020"
     CDS             complement(207191..207400)
                     /locus_tag="HWH41_01020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin transmembrane helix small protein"
                     /protein_id="QOD45525.1"
                     /translation="MLKVAIVLLLLATLVSLFSGLFFLVKDQGHGSRVVNSLTVRVVL
                     AAATLALVAWGFYSGELNSHAPWHF"
     gene            207416..208210
                     /locus_tag="HWH41_01025"
     CDS             207416..208210
                     /locus_tag="HWH41_01025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SURF1 family protein"
                     /protein_id="QOD45526.1"
                     /translation="MGGFMQYSQRLGEAGRNDRRSMRGAFRPGLLPTLVVLGLLPVLL
                     WLGTWQLQRADEKRALLASYEARRGAEPVSPGQLEGLRDPAYVRVRLHGRFDERHTLL
                     LDNRLRNGQAGVEVLQPFYDQASGLWLLVNRGWVAWTDRRSPPALETPDRVLLLDAWT
                     YLPPPGGLHLADAPAGGWPRLVTQLDIPALWQAFGRAGLPWEIRLEPGDASFDTDWPV
                     VSMPPERHTGYAVQWFALATALLALYLYLGVRRAREKNHESRDSDA"
     gene            208185..208763
                     /locus_tag="HWH41_01030"
     CDS             208185..208763
                     /locus_tag="HWH41_01030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45527.1"
                     /translation="MSLAIPMPERPRRARGRLQLLAIIGLVVGPMLLASAMYKWNFWV
                     PQGRSYSGALIGNGQTPADLGVQGRSQGEQWQLLVTAPGTCGEDCQQLVYLARQVNIA
                     LGREASRAGHALAASGELPAAFANLVRQDYPRLQRYGLDPALYDKAGGGERPLLWVVD
                     PHGNLVLRYDAKANGKKLLKDVQLLLKLSHIG"
     gene            208828..209901
                     /locus_tag="HWH41_01035"
     CDS             208828..209901
                     /locus_tag="HWH41_01035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="COX15/CtaA family protein"
                     /protein_id="QOD45528.1"
                     /translation="MSGATRKPGFTVAVLATLLAAVVVLLGAYTRLTHAGLGCPDWPG
                     CYGFVHVPLSEAQLAHAELHFPDAPVEAQKGWNEMIHRYFAGALGLLILGLALHALVR
                     RGRDGQPLKLPLLLLAVVIAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLALLFLLALR
                     LSGRFAARRYPAATRGLAGLALLLVIGQIALGGWVSSNYAAVACIDLPTCHGEWWPRM
                     DFANGFHLTQHIGPNYLGGQLDSDARTAIHMTHRIGALCVTLVLLLLAWRLQRSGLVW
                     PTALMLLGLSLQIGLGISNVLLHLPLPVAVAHNGGGALLLLSLVLVNYRLRAPASVRA
                     PAPSPQRVRRTLPPAQGSRLKAA"
     gene            209927..210841
                     /locus_tag="HWH41_01040"
     CDS             209927..210841
                     /locus_tag="HWH41_01040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="QOD45529.1"
                     /translation="MATVIDRHSQPTWRDFLELTKPKVVVLMLITSLIGMLLATKAPL
                     DGFVPWQVLIFGNLGIGLCAGAAAAVNHVVDRRIDSIMARTHKRPLAEGRVSPSMALG
                     FALLLALAGMAVLLAFTNPLTAWLTLASLLGYAALYTGFLKRATPQNIVIGGLAGAAP
                     PLLGWVAITGHLSAEPLLLVLIIFAWTPPHFWALCIHRKDEYAKADIPMLPVTHGERY
                     TKLHILLYTLVLFAVSLMPFVIHMSGLVYLLCALALGARFLDWAWALYCDSRPHAAIK
                     TFKYSIVYLFLLFMALLVDHYLPLKLLL"
     gene            210867..211502
                     /locus_tag="HWH41_01045"
     CDS             210867..211502
                     /locus_tag="HWH41_01045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SCO family protein"
                     /protein_id="QOD45530.1"
                     /translation="MTRVNKTVLVLVALVALVLGLTVHKVLTAQRQADPTVLLDAGIV
                     ILPQTRKVPALEFTNQDGQAVSTASLKGRWHLLFFGYTFCPDVCPTTLAQLRELQGKL
                     PQEVRDDLQVVFVSVDPNRDTPQQIKQYLGYFNAGFQGLTGTPENIQKLANAMSIPYI
                     PADTSKPNYTVDHSGNLVIIGPDGEQHGFIRAPLNNAKLEAQLPGVLKPQA"
     gene            complement(211542..211994)
                     /locus_tag="HWH41_01050"
     CDS             complement(211542..211994)
                     /locus_tag="HWH41_01050"
                     /EC_number="2.3.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="QOD45531.1"
                     /translation="MSLDWTCKHHADLTLKELYALLQLRTEVFVVEQKCPYQEVDGLD
                     LVGDTHHLMAWRDGQLLAYLRLLDPVRHEGQVVIGRVVSSSAARGQGLGHQLMERALQ
                     AAERLWLDTPVYLSAQAHLQGYYSRYGFVAVTEVYLEDDIPHIGMRRA"
     gene            212126..212599
                     /locus_tag="HWH41_01055"
     CDS             212126..212599
                     /locus_tag="HWH41_01055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QOD45532.1"
                     /translation="MRWEELSEQPCSLARVLAILGDRWTLLVLRDCFLGVRRFDDFER
                     SLGVTRHVLADRLKRLVEAEILAKVPYQERPLREEYRLTEKGMELYPAILSLVNWGDR
                     HLAGVEGPPLEHVHKHCGQHMHGVLVCSECGEPLHARDVTVREGLFWKGRLLRRG"
     gene            212856..213584
                     /locus_tag="HWH41_01060"
     CDS             212856..213584
                     /locus_tag="HWH41_01060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="QOD45533.1"
                     /translation="MTQRKAVLVMGAGDATGGAIARRFAREGYVACVARRNAEKLEPL
                     VQAIRDQGGEALACGCDARQEQQVIDLFARIEGEVGALEAVIFNVGANVWFPITETTE
                     QVYRKVWEMAAFGGFLTGREAARVMLPRQRGTIIFTGATASLRGRAHFAAFSGAKFAL
                     RALAQSMARELGPKGIHVAHPIIDGAIDTDFIRETLPELYKRKEQDGILDPEHIAETY
                     WQIHCQPRDCWVHELDLRPWMEIF"
     gene            213609..214196
                     /locus_tag="HWH41_01065"
     CDS             213609..214196
                     /locus_tag="HWH41_01065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxychromene-2-carboxylate isomerase"
                     /protein_id="QOD45534.1"
                     /translation="MSKQIEFFFDFGSPTTYLAWTQLPRIAAAHGASIAWRPMLLGGV
                     FKATGNHSPIEVPAKGRYTLHDLARYAKRYGVPLAFNPAFPINTLTLMRGAQGYLGGE
                     GFHPYLKAVFEALWVRQQNLGKPEVVAQVLAEAGFDPDEFLRLVGDEQVKEGLKATTE
                     EAVRRGVFGAPSFFVGDQLFFGQDRLDFVAEALAG"
     gene            214426..215775
                     /locus_tag="HWH41_01070"
     CDS             214426..215775
                     /locus_tag="HWH41_01070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate transporter DctA"
                     /protein_id="QOD45535.1"
                     /translation="METPAMFIKRCSRSIFLQVVIGLVIGVICGVGIPDLAVQMKPLG
                     DGFIKLIKMLIALIVFCVVVNGISGAGDLKKVGRIGLKSVIYFEILTTIALVLGLVVA
                     YSLGLGSGANIHLNELPAGDVALYTGRTQEIHGPVAFLMGLIPTSVFSAFAENDILQV
                     LLFSVLFGSALNLVGEQASGVARLINEFSHIVFRIMGMIVRLAPLGVFGAVAFTTARY
                     GVDSLSHLGALVLVFYATCLVFVMAVLGSVLRLSGVRMLPFLRYFREELMIVMGTASS
                     DAVLPQVMRKLEHMGIRSSTVGLVIPTGYSFNLDGFSIYLTLAVVFIAHVTGTPLAMT
                     DLVTILLVSLVTSKGAHGIPGSALVILAATLTAVPAIPVAGLVLVLSVDWFMGIGRAL
                     TNLIGNCVATVTIARWENDIDMPRAQAILDGRLEAPAKADGEPLKRSAVAGEGKLHG"
     gene            215824..216510
                     /locus_tag="HWH41_01075"
     CDS             215824..216510
                     /locus_tag="HWH41_01075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FadR family transcriptional regulator"
                     /protein_id="QOD45536.1"
                     /translation="MFSSSKLVNAVAQRLLDTIEQGRWVAGQMLPGQRELAEQMEISR
                     PSLREAIMVLETLGVVRSLPGKGVMVLERSEPLREVAAPGEATMEDVLQLRYALEPFI
                     VGIVAQSAGAAEISELRLLLLDLREAVEDGDPQALVEAYTAFHRRLVKLTSNPIFLSV
                     SEQIGSALERSDNLVRRQPEYAEEILQEHDAILRAIRQHDSERASQAMRQHILNEGAR
                     LNIDLRLPQV"
     gene            216611..217345
                     /locus_tag="HWH41_01080"
     CDS             216611..217345
                     /locus_tag="HWH41_01080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="QOD45537.1"
                     /translation="MVGFDARTQQGAALRPTSHFVYESIYTAILEKRLAPAAKLSKET
                     LGQIFRVSNGTIQRALTRLAEDGAVVMPPKEVASVARPDERQARQVLDARLLVESEVV
                     RQLPAGLDPAALAELRALVDEEQACLAARDSAGLIRLAGRFHLRLAELTENPLLQGFV
                     RGLVARASLDIALNKGAVYTAEACAAQRALLDALEDGDSATAAALMDAYLRGLFARMR
                     FLPPPTTDLREAFGMKAPRGEKRRRA"
     gene            217549..217935
                     /locus_tag="HWH41_01085"
     CDS             217549..217935
                     /locus_tag="HWH41_01085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014602345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin"
                     /protein_id="QOD51089.1"
                     /translation="MKVVVSKSIGTVGIRNATLQWGKFYRYTNKDDEISTEEVSSMNV
                     QAGSPQWIASCGRENASSGTQGSFDCYDGNTKMGTFSWDDPWKSGATNTWGFTPASAD
                     YAGITSGGNATGTDIGEVTLTLGRFS"
     gene            complement(217967..218875)
                     /locus_tag="HWH41_01090"
     CDS             complement(217967..218875)
                     /locus_tag="HWH41_01090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="QOD45538.1"
                     /translation="MDSLKGMAIFATVVDKGSMAAAAQSLGMTPSAVSQQIRKLESRA
                     QVTLLHRTTRRLTLTEAGEAFYRSCAQMLAIAEEAERRLGEWRDAPVGELRLAAPVGF
                     SGTLITQALKPLLENHRQLRLQLFFQDERIDLVAERIDLAIRVGNLADSSLVARHLGD
                     WSSVLCAAPAYLRQRAPINRPEQLSEVDWISLNTSNHLNHLTLSGPGGEVCKLRLEPR
                     VAANGMLAVRQFTLDGLGVSYQPLPEVRDALNDGRLQQLLPEWRIPGLGIYAVTPRRE
                     AQPAKVKVAIEALRRAFATDGDERWS"
     gene            complement(219175..219456)
                     /locus_tag="HWH41_01095"
     CDS             complement(219175..219456)
                     /locus_tag="HWH41_01095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system RelE/ParE family
                     toxin"
                     /protein_id="QOD45539.1"
                     /translation="MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQ
                     QVANQGAGRPSEVPGVRTLNLERWPFSAPFRVKGKEIQILRIDRVEITP"
     gene            complement(219453..219680)
                     /locus_tag="HWH41_01100"
     CDS             complement(219453..219680)
                     /locus_tag="HWH41_01100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribbon-helix-helix protein, CopG family"
                     /protein_id="QOD45540.1"
                     /translation="MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQ
                     WQVAAIDEGLADANAGRLLEHTEIEKRWGLQ"
     gene            complement(219856..220476)
                     /locus_tag="HWH41_01105"
     CDS             complement(219856..220476)
                     /locus_tag="HWH41_01105"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45541.1"
                     /translation="MPTRVLRGLVAALPLFLAACSDSAPSSEEIARLLAERGFDKPAC
                     ASSTLFKTFPVTLSDSFSGPGPAKGNAAVYDALVGVGLLRRDGDSYDLTPAGREDYKP
                     ESKAFCYSSGFDVSVRSVDPAKPDDYGPAVEKGWLVTVEVKPREVKDWAKNPEVLKQA
                     SLTTLQQITQPQVGQVSLVKPRGEEGYKLVNTRFSPRQGFHFNQAW"
     gene            220577..221077
                     /locus_tag="HWH41_01110"
     CDS             220577..221077
                     /locus_tag="HWH41_01110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LEA type 2 family protein"
                     /protein_id="QOD45542.1"
                     /translation="MRLPANLGRLLPALCLGVLLSACSTFGQRDPLRIDLVGLEPLPG
                     QGMEMRFMVKLRVQNPNDEPIEYNGIALDLDVNGQPLASGVSDQTGEVPRFGERVVSV
                     PLTVSAFSAFRQAWGLSNNAPTRGMPYVVKGKLAGGLFGTVRFSEKGTLDFSGPAVGA
                     PKTKGL"
     gene            221149..221490
                     /locus_tag="HWH41_01115"
     CDS             221149..221490
                     /locus_tag="HWH41_01115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkylphosphonate utilization protein"
                     /protein_id="QOD45543.1"
                     /translation="MSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDDGK
                     VIKDSVGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGA
                     MKLKSEFVRKV"
     gene            complement(221572..222999)
                     /gene="gabP"
                     /locus_tag="HWH41_01120"
     CDS             complement(221572..222999)
                     /gene="gabP"
                     /locus_tag="HWH41_01120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GABA permease"
                     /protein_id="QOD45544.1"
                     /translation="MSKVVLASQLPNKRNASLAPGLKQRHVTMLSIAGVIGAGLFVGS
                     GHAIAAAGPAALLAYLIAGTLVVLVMRMLGEMAVASPDTGSFSTYADRSIGRWAGFTI
                     GWLYWWFWVLVIPLEAIAAAAILNAWFPAIDTWIFALAVTFLLTVTNLFSVARYGEFE
                     FWFALLKVIAIIAFIVLGAVAIVGGLPEREVSGLSSLMASHGGFVPNGYGAVLGALLT
                     TMFSFMGTEIVTIAAAESKDPAKQITRATNSVIWRIGLFYLVSIFIVISIVPWNDPLL
                     IQVGSYQRALELLDIPHAKLIVDLVVLVAVASCLNSAIYTSSRMVFSLAKRGDAPSVL
                     KLTNTAHVPRPAVLASTAVGFLTTIVNYFAPEKVFTFLLASSGAVALLVYLVIAVAQL
                     RMRKQLQASGQPIEFRMWLYPWLTWAVILFIVAALSIMLIMPEHRHEVFATALLTIFT
                     VCLGLLNARRKPRLGEDYAGKTARV"
     gene            complement(223168..224661)
                     /locus_tag="HWH41_01125"
     CDS             complement(223168..224661)
                     /locus_tag="HWH41_01125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA-acylating methylmalonate-semialdehyde
                     dehydrogenase"
                     /protein_id="QOD45545.1"
                     /translation="MGTLHHLINGEMVADNGRSADVFNPSTGEAIHKVPLADGKTLQK
                     AIDAARAAFPAWRNTPPAKRAQVLYRFKQLLEQNEARISKLISEEHGKTLEDAAGELK
                     RGIENVEYACAAPEILKGEYSRNVGPNIDAWSDFQPIGVVAGITPFNFPAMVPLWMYP
                     LAIACGNTFILKPSERDPSSTLLIAELFHEAGLPKGVLNVVHGDKEAVDGLLQAPEVK
                     AISFVGSTPIAEYIYAEGTKRGKRVQALGGAKNHAVLMPDADLDNAVSALMGAAYGSC
                     GERCMAISVAVCVGDQVADALIAKLVPQIKALKIGAGTSCGLDMGPLVTAAAQAKVTG
                     YIDSGVAQGAELVVDGRGYQVAGHENGFFLGGSLFDRVTPEMTIYKEEIFGPVLCVVR
                     VNSLEEAMQLINDHEYGNGTCIFTRDGEAARLFCDEIEVGMVGVNVPLPVPVAYHSFG
                     GWKRSLFGDLHAYGPDGVRFYTRRKAITQRWPQRASHEASQFAFPSL"
     gene            complement(224745..225032)
                     /locus_tag="HWH41_01130"
     CDS             complement(224745..225032)
                     /locus_tag="HWH41_01130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="QOD45546.1"
                     /translation="MSGRPQAVPTVQVDNAEVIVTEWRFAPGAETGRHRHGHDYVVVP
                     LTDGTLLLETPEGDRHAPLVAGQAYFRKAGVEHNVINASAHEVVFVETEIK"
     gene            complement(225032..226378)
                     /locus_tag="HWH41_01135"
     CDS             complement(225032..226378)
                     /locus_tag="HWH41_01135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase family protein"
                     /protein_id="QOD45547.1"
                     /translation="MNQPLNVAPPVSSELNLRAHWMPFSANRNFQKDPRIIVAAEGSW
                     LTDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTLDYSPGFQYGHPLSFQLAEK
                     IAGLLPGELNHVFFTGSGSECADTSIKMARAYWRLKGQPQKTKLIGRARGYHGVNVAG
                     TSLGGIGGNRKMFGQLMDVDHLPHTLQPGMAFTRGMAQTGGVELANELLKLIELHDAS
                     NIAAVIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTYSGAEY
                     FGVTPDLMNVAKQVTNGAVPMGAVIASSEIYDTFMNQALPEHAVEFSHGYTYSAHPVA
                     CAAGLAALDILARDNLVQQSAELAPHFEKVLHGLQGAKNVIDIRNCGLAGAIQIAPRD
                     GDPTVRPFEAGMKLWQQGFYVRFGGDTLQFGPTFNARPEELDRLFDAVGEALNGIA"
     gene            226514..227431
                     /locus_tag="HWH41_01140"
     CDS             226514..227431
                     /locus_tag="HWH41_01140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="QOD45548.1"
                     /translation="MAKSRNPSLGQVSDFDIRLLRIFKTIVECGSFSAAESTLGLSRS
                     AISLHMGDLEKRLGMRLCQRGRAGFALTDEGREVYRATQTLLAALEGFRAEVNDLHQH
                     LRGELNIGIINNLVTLPQMRITHALSALKGQGPQVRINIGMTTPNEIELGVLDGHLHV
                     GVVPLISPLSGLEYLPLYDEHAQLYCSRGHALFERADGDIAVDEVLAADAVAPSYRLP
                     AEAQARHQELNNSASASDREGMAFLILTGNFIGYLPSHYAADWVAAGMLRPLLPERFH
                     YAIALTIVTRKGRRPNLVLERFLEAVAVS"
     gene            complement(227544..228914)
                     /gene="guaD"
                     /locus_tag="HWH41_01145"
     CDS             complement(227544..228914)
                     /gene="guaD"
                     /locus_tag="HWH41_01145"
                     /EC_number="3.5.4.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanine deaminase"
                     /protein_id="QOD45549.1"
                     /translation="MNDAVPAGNFVPPLVLRSDHGGSAMSSSAHRGRILHFLGDPAKL
                     GDKAWEYFEDGLLWIEHGHVRALDHAAYLLPQLPANLPLEEHPQRLLLPGFVDCHVHY
                     PQLGVIASYGTQLLDWLETHTFPAEQRFADAGYAAAQAELFLDELLRHGTTTALVFGT
                     VHAVSAEAFFQAAQKRRLRMIAGKVLMDRNAPPALCDTAASGYAESRALIERWHGNGR
                     LQYAVTPRFAPTSSPEQLAAAARLLDEYPGVYLHTHLSENLKEVAWVGELFPQAQDYL
                     DVYHRAGLVGERSVFAHGIHLSERECRCLAHKNAALAHCPSSNLFIGSGLFDLGRAQQ
                     YGIRVGIGSDVGGGTSLSLLANLADAYKIQQLRGTSLDPFQALYLATLGGARALDLDG
                     LVGNFLPGREADFVALDLAATPMIAQRMEHARGLADTLFVLNTLGDDRAVAETWVMGE
                     RRHAKG"
     gene            230025..231596
                     /locus_tag="HWH41_01150"
     CDS             230025..231596
                     /locus_tag="HWH41_01150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="QOD45550.1"
                     /translation="MSAPSSFAPPRLELRGISKRYPGCLANDRIDLCIDAGEIHALLG
                     ENGAGKSTLMKIIYGVTRPDAGEIRWQGEPVQVRDPARARALGIGMVFQHFSLFETLS
                     VAENIALALGAEAGSPRRLEARIREVSQRYGMPLEPRRLVHGLSIGERQRVEIVRCLM
                     QDIRLLILDEPTSVLTPREAEDLFVTLRRLAEEGCSVLFISHKLAEVRALCQRATVLR
                     GGRVAGQCVPAQCSDLELARLMVGDAEGLAAEYPKVTGGAPFLQVRDLHWRNPDPFGV
                     SFAGLDLEVRSGEILGIAGVAGNGQDELLALLSGEVRLPRAQAERIRLGGCAGAHLAP
                     DARRRAGQAFVPAERLGHGAVPEMSLADNALLTAFQQGLVRRGLVRRRKVLALAEEII
                     RRFAVKAPGAGAPARSLSGGNLQKFILGREILQAPRLLVAAHPTWGVDVGAAALIHRA
                     LIALRDAGTAILMVSEDLDELFLLSDRIAALCSGRLCPAIATASASPQQVGGWMAGQF
                     EAPAAVAGAVAQGSL"
     gene            231596..232693
                     /locus_tag="HWH41_01155"
     CDS             231596..232693
                     /locus_tag="HWH41_01155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QOD45551.1"
                     /translation="MLLSLEPRGRQSRWMLLASPLLAGLLTLVCGALLFACLGHDPWQ
                     TLHTVLVQPVSDLYGLGELLVKAMPILLCALGLALAYQARVWNIGAEGQLLVGALAGS
                     AVAIQLLDWQSRWALAWVLLAGTAAGALWAGFAAWLRTRFNANEILTTIMLNYIALNL
                     LLYGVHGPLKDPDGFNFPQSALFGEASRLPALFEDSRVHLGALFGLLALAAVWVLAQR
                     SFLGFQVRVLGLDRRAAGFVGFREKRLVWFVLLFSGALAGLAGVCEVAGPIGQLVPQV
                     SPGYGYAAITVAFLGRLNPFGILCASLLMALLYLGGEAAQMSLNLPLALTGLFQGMML
                     FFLLACDVLILYRPRLHGRWRKRPALRDALA"
     gene            232716..233642
                     /locus_tag="HWH41_01160"
     CDS             232716..233642
                     /locus_tag="HWH41_01160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QOD45552.1"
                     /translation="MDIDLLDNLLFAMVRTGTPLLLVALGELVCERSGVLNLGQEGMM
                     LFGAVIGFMVAFSSGSLWLGVLLAVLAGMLLAALFAGVALYLNANQVACGLALTIFGV
                     GLSSFVGAAWVGKPLQGFAPLALPVLGELPLLGRMLFAQDALVYLSLALFAAVAWMLL
                     RSRAGLVLQAVGENPDAASAMGLPVLRVRTLAVLFGGAMAGLAGAYLSLAYTPMWAEN
                     MTAGRGWIALALVVFASWRVFRVLLGAWLFGLASILHLVAQGIGLSIPANLLAMLPYA
                     ATILVLVLLSRDALRTRLYAPVSLGQPWKAGH"
     gene            233807..234370
                     /gene="ahpC"
                     /locus_tag="HWH41_01165"
     CDS             233807..234370
                     /gene="ahpC"
                     /locus_tag="HWH41_01165"
                     /EC_number="1.11.1.15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="QOD45553.1"
                     /translation="MSLINTQVQPFKVNAFHNGKFIEVTEESLKGKWSVLIFMPAAFT
                     FNCPTEIEDAANNYGEFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLIGDPTH
                     QLTNAFGVHIPEEGLALRGTFVINPEGVIKTVEIHSNEIARDVGETVRKLKAAQYTAA
                     HPGEVCPAKWKEGEKTLAPSLDLVGKI"
     gene            234515..236080
                     /gene="ahpF"
                     /locus_tag="HWH41_01170"
     CDS             234515..236080
                     /gene="ahpF"
                     /locus_tag="HWH41_01170"
                     /EC_number="1.8.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase subunit F"
                     /protein_id="QOD45554.1"
                     /translation="MLDANLKTQLKAYLEKVSQPFEIVASLDDSDKSRELLGLLQDIV
                     GLTDKITLKTDGSDARKPSFSLNRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSK
                     LDADVIEQVKGIEGTFEFETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQD
                     EVETRQIMSVPSIYLNGEVFGQGRMGVEEILAKIDTGAAARDAEKLTARDAFDVLVVG
                     GGPAGAAAAIYAARKGIRTGVAAERFGGQVLDTMAIENFISVQETEGPKLARALEEHV
                     RHYEVDIMNLQRASKLVPAKNTGELHEVQFESGGSLKAKTLILATGARWREMGVPGEQ
                     EYKAKGVCFCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDSKLRAD
                     AVLQRKLYSLPNVEVITSALTSEVKGDGQKVTGLVYKDRNSEEFKSIELEGIFVQIGL
                     LPNTEWLKGSVELSPRGEIIVDARGETSLPGIFAAGDVTTVPYKQIVIAVGEGAKASL
                     SAFDHLIRTSAPE"
     gene            complement(236160..237056)
                     /gene="ppk2"
                     /locus_tag="HWH41_01175"
     CDS             complement(236160..237056)
                     /gene="ppk2"
                     /locus_tag="HWH41_01175"
                     /EC_number="2.7.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase 2"
                     /protein_id="QOD51090.1"
                     /translation="MALQVASAPHGSSEDSTSASLPANYPYHTRMRRNEYEKAKHDLQ
                     IELLKVQSWVKETGQRVVVLFEGRDAAGKGGTIKRFMEHLNPRGARIVALEKPSSQEQ
                     GQWYFQRYIQHLPTAGEMVFFDRSWYNRAGVERVMGFCSPLQYLEFMRQAPELERMLS
                     NSGILLFKYWFSVSREEQLRRFISRRDDPLKHWKLSPIDIKSLDKWDDYTAAKQAMFF
                     HTDTADAPWTVIKSDDKKRARLNCIRHFLHALDYPDKDRRIAHEPDPLLVGPASRVIE
                     EDEKVYAEAAAAPGHANLDIPA"
     gene            237511..238860
                     /locus_tag="HWH41_01180"
     CDS             237511..238860
                     /locus_tag="HWH41_01180"
                     /EC_number="3.5.4.32"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="8-oxoguanine deaminase"
                     /protein_id="QOD45555.1"
                     /translation="MSRTWIRNPLAIFTANGLDAAGGLVVEDGRIVELLGAGQQPAQP
                     CASQFDASRHVVLPGLINTHHHFYQTLTRAWAPVVNQPLFPWLKTLYPVWARLTPEKL
                     ELATKVALAELLLSGCTTAADHHYLFPGGLEQAIDVQAGVVEELGMRAMLTRGSMSLG
                     EKDGGLPPQQTVQEAETILADSERLIARYHQRGEGARVQIALAPCSPFSVTPEIMRAS
                     AELAALHDVRLHTHLAETLDEEDFCLQRFGLRTVDYLDSVGWLGPRTWLAHGIHFNAE
                     EIRRLGEAGTGICHCPSSNMRLASGICPTVELEAAGAPIGLGVDGSASNDASNMILEA
                     RQALYLQRLRYGAERITPELALGWATRGSARLLGRSDIGELAPGKQADLALFKLDELR
                     FSGSHDPLSALLLCAADRADRVMVGGAWRVVDGAVEGLDLAALIARHREAASALIAG"
     gene            238967..240019
                     /locus_tag="HWH41_01185"
     CDS             238967..240019
                     /locus_tag="HWH41_01185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248833.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside hydrolase"
                     /protein_id="QOD45556.1"
                     /translation="MSRAARPRNRFCSLLLGLSLLMPASLPLSAAETAAVQSPRTLII
                     DTDPGADDVIALLFAMASPKELKIQALTTVAGNVPLEKTARNARLAREWGKRPDIPVY
                     AGAPRPLLRTPIYAADVHGSEGITGVEVHEPKQPLAEGNAVDYLIRTLRAAPEKSVTL
                     AMLGPETNLALALTQAPDIVKGIREIVIMGGAHFNGGNITPAAEFNIFADPHAAEIVL
                     KSGAPITMLPLDVTHKILTSPERIAKLRNLGNRAGKTVADILDAYVQYDIKYYGLKGG
                     PVHDATVVAYLLKPSLFKGKRINVQVDSHEGITFGQTVADWYGGLKQPANVEWINEGD
                     AQGFFDLLTERIARLP"
     gene            complement(240056..240904)
                     /locus_tag="HWH41_01190"
     CDS             complement(240056..240904)
                     /locus_tag="HWH41_01190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003111661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein OmpK"
                     /protein_id="QOD45557.1"
                     /translation="MRKALLCCAAPLCAAAAFGAENNDENAAREGLWNNLHVYRAFNQ
                     RGGPYLTDDSYLEWEFGGRKGVLDLYGYIDYKNLFDDASSDVPDGENWFVDIEPRLSI
                     DRLLGRDFSIGPIREWFVAFDYYYADARQGPGLNVLWSGIGTNTELPWLGTVGLNLYA
                     RYIDKNYGASNENAWDGYVAHMNWFKPLAQFGGKRFIAFQGFFDYEFGSKLPDKDDAF
                     EHEYRTDNGFQAYLGLWYHTEHWKFGYGAKVYRNMTQWRDGEQLDGRRTDSSGIGHYF
                     NVGYAF"
     gene            complement(240939..241565)
                     /locus_tag="HWH41_01195"
     CDS             complement(240939..241565)
                     /locus_tag="HWH41_01195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside 2-deoxyribosyltransferase"
                     /protein_id="QOD45558.1"
                     /translation="MSRSNGSSSRRTFLRLAALLLPAGALLGSLPGVRAAARPRKLYL
                     AGPDVFRADAVAHGEALKAQCARYGFEGLYPLDNALPKQLAEPREQAAWIYRANIGLI
                     ERADAVLANLNFFRGAEPDSGTAFEVGYATALGKPVYGYVDDAGSYAERIRRHAPELV
                     GEDPTRDRDGMALEEFGLPLNLMLAVPGRIVVGDAEQALRQLAGQSRG"
     gene            complement(241715..242233)
                     /locus_tag="HWH41_01200"
     CDS             complement(241715..242233)
                     /locus_tag="HWH41_01200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside 2-deoxyribosyltransferase"
                     /protein_id="QOD45559.1"
                     /translation="MTAIYLAGPDVFRPDAEAHGEMLKALCAEFGFLGLYPLDHALPA
                     DIREPAAQAAWIYRANVGLIERADCVLANLEPFRGSEPDSGTAFEVGYALALGKLVYA
                     YLSDAGAYAERLARLAPEWLGERPGEDRDGWQLEGFGLPLNLMLAVPSRLVAGGPREA
                     LRRLAEELGGNA"
     gene            242471..243568
                     /locus_tag="HWH41_01205"
     CDS             242471..243568
                     /locus_tag="HWH41_01205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BMP family ABC transporter substrate-binding
                     protein"
                     /protein_id="QOD45560.1"
                     /translation="MKHRRTQSHMSVLRRLAAVLGLGACALAAEAAEPLKIGFVYVGP
                     VGDHGWTYQHELGRRELVEHFGDKVKTSFVENVAEGADAERVIRNLAKDGYGLVFTTS
                     FGYMNPTAKVARQFPKVTFEHATGYKRDRNLGTYLSRSYEGRYVGGFLAAKMTRSHKI
                     GYIASFPIPEVIRDINAIQLALDKYDPRAELKVMWVSTWFDPGKEADAANALIDQGVD
                     VVFQHTDSPAPIQAAERRGVYAVGYASDMQHFGPKTVLTSIVNDWGPHYIRSAQAVMD
                     GTWKSEDFWGGLAESTVVLPLNQEVLPAPVREEAGRLIESIRSGAFHPFTGPIRDQSG
                     KERFAAGVSATNADLASMNYYVEGIKADLPK"
     gene            243641..244603
                     /locus_tag="HWH41_01210"
     CDS             243641..244603
                     /locus_tag="HWH41_01210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2OG-Fe(II) oxygenase"
                     /protein_id="QOD45561.1"
                     /translation="MDRLPIIDIAPLYGADRGAWNDVARRIDQACREWGFFYIAGHPL
                     PAARFEALLAAAREFFALPVEEKLKIDITRSRNHRGYGAIATEQLDPALPSDFKETFD
                     MALHLPAEHPDVRAGKSFYGPNRHPDLPGWEALLEGHYVDMLALARTVLRALAIALGI
                     EEDFFDRRFEQPVSVFRLIHYPPAAARQSADQPGAGAHTDYGCVTLLYQDAAGGLQVQ
                     NRQGEWIDAPPIDGTFVVNIGDMMARWSNDRYRSTPHRVISPRGVHRYSMPFFAEPHM
                     DTEIRCLPGCFDADNPPKYPPTTCGEWLTSRFAQTYAYRRGETA"
     gene            244708..245658
                     /locus_tag="HWH41_01215"
     CDS             244708..245658
                     /locus_tag="HWH41_01215"
                     /EC_number="3.5.4.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="QOD45562.1"
                     /translation="MYEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVET
                     LRKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTH
                     TDRGIPFEVVLAGIRAALQDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAF
                     IAVGLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDH
                     GVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDD
                     PAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARLVK"
     gene            245856..246401
                     /locus_tag="HWH41_01220"
     CDS             245856..246401
                     /locus_tag="HWH41_01220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="QOD51091.1"
                     /translation="MPADGEAARRADLLKAFLAQRQRMESLVSRWVGCRATAADLVQE
                     LFLRFWRRPAAPVEELGSYLLRSARNLAIDHLRGEGSRQRQLDDWLPEQRQGEPVGPE
                     QALEAGDQWRRVEAALRGLPERTRRIFLLNRIHGRTYAEIAQAMQLSQSAVEKHMMRA
                     LDACKASLAGPAGEQARSAQP"
     gene            246398..247393
                     /locus_tag="HWH41_01225"
     CDS             246398..247393
                     /locus_tag="HWH41_01225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FecR family protein"
                     /protein_id="QOD45563.1"
                     /translation="MTRPDSDAAPYDPVLEQTAQAWLVRLRGTPDAATRRAFEDWLAQ
                     RPAHAEAYARAEALWRLTEIPASRLAIEEADALEAYLRPRRASRNPRRWAYPLASVAC
                     LLAMLWLGGWWQPGDWLQDWRADYVAAPGQVAEWKLADGSYLSLDAGSAVRVRIDGGQ
                     RRVELLRGAAALRVKRDTLPFVVEAGEGRARVLGTEFEVRRGAGETRVTVLQGRVAVS
                     AGTGAGAAEEVLGAGQQVGFADGKLGRPVAIDAAAALAWRQGWLSFYRRPLAEVLDEL
                     ARYYPGRILLLDDALGRQPVSGSFRSDDPEAALKSLQAVLGYRQQILFGRLVVIR"
     gene            247541..249928
                     /locus_tag="HWH41_01230"
     CDS             247541..249928
                     /locus_tag="HWH41_01230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="QOD45564.1"
                     /translation="MTPFPRFALRTLPALFLSLGCLAATAQAAEAVRYRFSQAAAPLA
                     QALNAFSRASGQTLLYTAELPPQATAPALHGSLDAEEALQRLLQGSGLRARRIDERTL
                     TLEPIPASGALNLDATTVSAAAPAQGYRPAANASISRGDAPLLEIPQAISVVPAQALQ
                     DQRPRNLDDALGNISGITQANTLGGTQDAVMKRGFGDNRDGSIMRDGMPSVQGRNFTA
                     TADHVEVLKGPASLLYGIQDPGGVVNVVSKKPQLQQANALTLRGSAYAHGRNGSGGQL
                     DSTGPLGDSGLAYRMILDHEDEDYWRDFGKSRETLVAPSLAWYGEDTTVNLSYEHREF
                     TTPFDRGTAIDPRTNRPLDIPRSRRLDEPFNITEGRSELTRLDLERQLDDTWKAHFGY
                     GYSRETYDDNQARVMAVNADGTLTRRMDGTHGAVSSDSFATLGLSGTLQLAGMQHDLQ
                     FGMDHEKRKIFRADLLRDSKTSRFDYLDPVYGQVVPSTRVVAGDSDQTDKLRSDSLYF
                     QDSIHLDERWILVGGARYQIYDQLAGRGRPFNANTDINGQKWVPRGGLVYRLSDEVSL
                     YGSYTRSFKPNSTIAPLSTGETIDSAILPEEATSWELGAKLDVPGRLSGTLALFDIRK
                     KNVLVNELDGAGNSSVRAAGRVRSRGLELDLTGQLSERWSLIGSYAWLAAEVTEDPTL
                     EGKRLQNVARNTASLSAVYELGQLFGGDRLRLGGGARYVGKRPGDPANSFDLPSYTVA
                     DAFASYDTRFGGHGVKFQLNVKNLFDRTYYPSSANRLYVAMGEPRQFQLSTTVEF"
     gene            250216..251133
                     /gene="pcaQ"
                     /locus_tag="HWH41_01235"
     CDS             250216..251133
                     /gene="pcaQ"
                     /locus_tag="HWH41_01235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016254344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pca operon transcription factor PcaQ"
                     /protein_id="QOD45565.1"
                     /translation="MNLDNRIKFRHLACFLEVARQRSFAKAADAVAVSQPAISKTLKE
                     LEEILGARLFERSKAGAELTEAGVTFLRYAGPCVQALRDGVNTLRGHEAQVETVRVGV
                     LSTVESLVVPEVIRRLHRRHGALVVSVATGPSAYLLAQLKVGELDLVVGRMTDSPDIQ
                     GLTFEHLYSESMMLVVRPGHPLLAAPLGDLQRLAEFPLVLPLAGTTIRRHADSLFVQW
                     GIPLAGQRLETLSPTLSRSYVLRSEAIWVAPRDAVRLDVGNGELAELDLGIREPGGSV
                     GLCHNAALPLPLGAQWFSAVLREVAAELH"
     gene            251268..251987
                     /gene="pcaH"
                     /locus_tag="HWH41_01240"
     CDS             251268..251987
                     /gene="pcaH"
                     /locus_tag="HWH41_01240"
                     /EC_number="1.13.11.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 3,4-dioxygenase subunit beta"
                     /protein_id="QOD45566.1"
                     /translation="MHDAESRRFVIRDRNWHPKALTPDYKTSVPRSPSQALVSIPQSL
                     SETSGPDFSHLRLGRHDNDLLLNFDHGGLPQGERIIMFGRVFDQYGKPVPHTLVEMWQ
                     ANAGGRYRHKNDRYLAPLDPNFGGVGRTLTDSEGHYYFRTIKPGPYPWRNGPNDWRPA
                     HIHVSVSGPAIAARLVTQMYFEGDPLIPKCPIIRTLADPEAAQSLIGRLDMSMANPMD
                     CLAYRFDIVLRGQRKTFFENA"
     gene            251998..252603
                     /gene="pcaG"
                     /locus_tag="HWH41_01245"
     CDS             251998..252603
                     /gene="pcaG"
                     /locus_tag="HWH41_01245"
                     /EC_number="1.13.11.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 3,4-dioxygenase subunit alpha"
                     /protein_id="QOD45567.1"
                     /translation="MSHELLRETPSQTAGPYVHIGLALAAAGNPTRDLEIWNRMAREG
                     APGQHILLLGHVYDGNGHLVRDSFLEFWQADSEGRYQERYDPERPFNSFGRTATTFDA
                     GEWTLHTVKPGVVRNAQGVPMAPHINVSLFARGINIHLQTRLYFDDETEANAACPVLN
                     LIEQAPRRDTLLARRCEVDGQLAYRFDIRIQGDNETVFFDF"
     gene            252810..253649
                     /locus_tag="HWH41_01250"
     CDS             252810..253649
                     /locus_tag="HWH41_01250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="QOD45568.1"
                     /translation="MSELPEHPATLAPPTVLSPAKRIEAFTGDPNFMTSLARGLAVIH
                     AFQERKRHLTIAQISHRTEIPRAAVRRCLHTLMQLGYATTDGRTYSLLPKVLTLGHAY
                     LSSTPLAITAQPILDRLSEQLHEACSMATLEGDDVLYIARSATPQRLISVDLNVGSRL
                     PAYCTSMGRILLAALDDDALHAYFGGVEMQAKTSRTLYTPETLLPCLVEIRRQGWCIV
                     DQELEVGLRSLAVPVRDSAGHVLAALNVGTHAGRVSRAELESRFLPLLLEASRELSAR
                     LFT"
     gene            253802..254953
                     /gene="triA"
                     /locus_tag="HWH41_01255"
     CDS             253802..254953
                     /gene="triA"
                     /locus_tag="HWH41_01255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triclosan efflux RND transporter adaptor protein
                     TriA"
                     /protein_id="QOD45569.1"
                     /translation="MSDARGAFHSKGRWSRMALPAILCASLLVGCGAEPPAEEHVRVL
                     AQTVKMAEFASATSITGDIQARVQADQSFRVGGKIVERLVDVGDHVAAGQVLARLDPQ
                     DQRSNVENAQAAVAAQQAQSKLADLNYQRQKALLPKGYTSQSEYDQALASVRSAQSSL
                     KAAQAQLANARDLLSYTELRASDAGVITARQAEVGQVVQATVPIFTLARDGERDAVFN
                     VYESLFSHDVDGQRITVSLLGKPEVTASGKVREITPTVDERSGTLKVKVGLDSVPAEM
                     SLGSVVNASVAAPAEHSVVLPWSALSKVGEQPAVWLLDQQGKARLQPVRVARYASEKV
                     VIDGGLEAGQTVVTVGGQLLHPGQVVEVAQPPQPTQSTASRDAVGGGQP"
     gene            254950..256020
                     /gene="triB"
                     /locus_tag="HWH41_01260"
     CDS             254950..256020
                     /gene="triB"
                     /locus_tag="HWH41_01260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triclosan efflux RND transporter adaptor protein
                     TriB"
                     /protein_id="QOD45570.1"
                     /translation="MKPFSLAGLFGFALLLSGCGDEPPPAPPRPVLTVTVKTLKNDDL
                     GRFAGSIQARYESVLGFRTNGRIASRLFDVGDFVGKGALLATLDPTDQQNQLRASQGD
                     LASAEAQLIDAQANARRQEELFARSVTAQARLDDARTRLKTSQASFDQAKAAVQQARD
                     QLSYTRLVTDFDGVITTWHAEAGQVVSAGQAVVTLARPEVREAVFDLPTEVAESLPAD
                     ARFLVSAQLDPQARTTGSIRELGPQADASTRTRRVRLSLAQTPEAFRLGSTIQVQLSS
                     AGSVRSVLPASVLLERDGKTQVWVVDGKQSSVALREVQVLSRDERQVVIGQGLADGDR
                     VVRAGVNSLKPGQKIKLDEDAR"
     gene            256017..259064
                     /gene="triC"
                     /locus_tag="HWH41_01265"
     CDS             256017..259064
                     /gene="triC"
                     /locus_tag="HWH41_01265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triclosan efflux RND transporter permease
                     subunit TriC"
                     /protein_id="QOD45571.1"
                     /translation="MKGGFNLSDWALRHQSLVWYLMAVSLVMGVFSYLNLGREEDPSF
                     AIKTMVIQTRWPGATVDDTLEQVTDRIEKKLEELDSLDYVKSYTRPGESTVFVYLKDT
                     TKAGDIPDIWYQVRKKISDIQGEFPQGIQGPGFNDEFGDVFGSVYAFTADGLDFRQLR
                     DYVEKVRLDIRSVKDLGKVQMIGAQNEVIYLNFSTRKLAALGLDQRQVVQSLQAQNAV
                     TPSGVVEAGPERISVRTSGNFRSEKDLQAVNLRVNDRFYRLSDLASISRDFVDPPTSL
                     FRYKGEPAIGLAVAMKEGGNILEFGEALNARMQEITGELPVGVGVHQVSNQAQVVKKA
                     VGGFTQALFEAVVIVLIVSFVSLGLRAGLVVACSIPLVLAMVFVFMEYTDITMQRVSL
                     GALIIALGLLVDDAMITVEMMITRLELGDSLHDSATYAYTSTAFPMLTGTLVTVAGFV
                     PIGLNASSAGEYTFTLFAVIAVALLLSWIVAVLFAPVIAVHILPKTLKHKSEQKKGRI
                     AERFDSLLHLAMRRRWTTIFLTALLFGVSLFLMKFVQHQFFPSSDRPELLVDLNLPQN
                     SSIHETRAVMDRLEATLKDDEDIDHWSAYVGEGAIRFYLPLDQQLQNNFYGQLVIVTK
                     DLEARERVAARLRDRLRKDYVGISTYVQPLEMGPPVGRPIQYRVSGPQIDKVREYAMG
                     LAGVLDGNPNIGDIVYDWNEPGKMLKIDIAQDKARQLGLSSEDVAQIMNSVVTGSAVT
                     QVRDDIYLVNVIGRAEDSERGSLETLESLQIVTPSGTSIPLKAFAKVSYELEQPLVWR
                     RDRKPTITVKASLRGEIQPTDLVARLAPEVKRFADGLPANYRIEVGGTVEESGKAEGP
                     IAKVVPLMLFLMATFLMIQLQSVQKLFLVASVAPLGLIGVVAALLPTGTPMGFVAILG
                     ILALIGIIIRNSVILVTQIDAFEKDGKTPWEAVLEATHHRTRPILLTAAAASLGMIPI
                     AREVFWGPMAYAMIGGIVAATLLTLIFLPALYVAWYRIPEPGR"
     gene            259263..260201
                     /locus_tag="HWH41_01270"
     CDS             259263..260201
                     /locus_tag="HWH41_01270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="QOD45572.1"
                     /translation="MDTLQGMRVFARVVDSGSFTSAAQALDLSTAQVSRLISDLEAHL
                     QTRLLHRTTRRLALTEAGERYLERCRGILEDIEVAEAEAAGAHIRPCGRLRVQSLMGM
                     GQHHLVPMIARYGALFPDVVIELTLSQRNPDMLEEGQDVLITGERQLPDSEFVAQRLG
                     SIHSVLCASPGYLQQHGVPRSVDDLERHVCLRLQDPAYPEGWIFADEQGERTVSPQNT
                     FMVNVAEVMAQAAKADLGIALLPSYVAAAALRNGELLRVLPGHAMHERTIYALYPSRR
                     YLDAKIRTWVDLLQQELPQAFARDETTMQSSSYWAQ"
     gene            260317..260502
                     /locus_tag="HWH41_01275"
     CDS             260317..260502
                     /locus_tag="HWH41_01275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45573.1"
                     /translation="MNRQILAAAILSLFSLAFSQAGFAEESSLMTNRMVDANQQAIEH
                     QQELSASAAQAGARSDS"
     gene            261089..262423
                     /locus_tag="HWH41_01280"
     CDS             261089..262423
                     /locus_tag="HWH41_01280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OprD family porin"
                     /protein_id="QOD45574.1"
                     /translation="MRNLFALTPMALALCTASAAWADEGEAKEGFIEGSSLQLLTRNY
                     YFNHDRRHASGHDSKEWAQGFIATFQSGYTPGVVGFGVDAYGMLGLKLDGGGGTGGTS
                     ILPITAPSKEGYESGKAPDEFSSGGAALKIRAFDTELKLGDQFLSNPVVAGGESRMLP
                     QTFRGVSLTNNSFEDLTLTAGQVSFTKYYNQSGHRRLGSYYGELPGDRDSHHLSWLGG
                     TWGGIEGFTSSLYAAELQNVWKQYYADVDYTYEIDDNWSLNPGAHYYKTVDSGDSLLG
                     RIDNNTYSLHFAVGYRQHTVTAVLQKVNGNTPFDYINQGDSIFLDNSQQYSDFNGPNE
                     KSWKLQYDYDFVALGLPGLSASASYSRGKLDLTRVDPDSPGYGGWYSADGKNAKHWER
                     DLDLQYVVQGGPAKDLSLRLRWATHRGTGGYSAVDNDIDEYRVIVDYPIDVF"
     gene            complement(262452..263249)
                     /locus_tag="HWH41_01285"
     CDS             complement(262452..263249)
                     /locus_tag="HWH41_01285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QOD45575.1"
                     /translation="MTMNGQPAELHRPIPTLARLPRPVYARAESLRAGSWTSRHRHAW
                     VQLSYAISGVLGVHTAEGSFFAPPQRAIWIPAQLEHEVVTSTRAEMRSLYIRGDACAW
                     APTRCRVLEVTPLARELIKSFCELPVDYPEGDSAESRLVQVLLDQLRLLPEVAFSLPM
                     PREPRLLRLCQALIDEPTQSLTMGDWAQRLGTSEKTLSRLFQRETGMNYRLWRQRQRL
                     LASLNALEAGDSVTGAALDSGYDSTSAYIAAFKGLFGFTPGELFRQR"
     gene            263327..264943
                     /locus_tag="HWH41_01290"
     CDS             263327..264943
                     /locus_tag="HWH41_01290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyltransferase family protein"
                     /protein_id="QOD45576.1"
                     /translation="MLDFSAHALPYASQRSPVHARRGMVATSQPQAAQVGLEILRRGG
                     NAIDAAIATAAALTVVEPTGCGIGGDAFALVWTRGRLHGLDASGRAPGLLDRERVRAA
                     GHERMPLYGWTPVTVPGCPAAWGELSRRFGKLPFEQLLRPAIELARDGFPVSPVIARL
                     WQSGLDKFRAALPQRPELRAWFDEFLIDGRAPRAGEVFRQPGQADTLDELARSQCESF
                     YRGELARAIVGHAERSGGYLRAEDLAGYQAKWVEPISLNYRGYDVWEIPPSGQGLIAL
                     MTLNILKGFEFGERDCARTWHRQLEAMKLAYVDGLHYISQPQSMRVSVEELLHEDYAA
                     SRRALIGERALDPSPGQPRPGGTVYLACGDEEGNLVSFIQSNYHGFGSGVVVPGTGIA
                     LQNRGAEFSLDPDHVNCLEPGKQTFHTIIPGFLSKDGVPLGPFGVMGAYMQPQGHVQM
                     VMNLVDFGLNPQAALDAPRWQWLGGLRVGIEHAAPRALAAELAQRGHQVEIAYDSTSY
                     GRGQIVLRDPASGVLCGGTEPRTDSQIAVW"
     gene            265615..266451
                     /locus_tag="HWH41_01295"
     CDS             265615..266451
                     /locus_tag="HWH41_01295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45577.1"
                     /translation="MSRTLATVMLAGGLLAAGQAVAEDHDMTPTHETDSGPLLWHNES
                     LTYLYGKNFKINPPIQQTFTLEHASGWTWGDLFIFFDQINYNGKEDASNGKNTYYGEI
                     TPRLSFGKLTGADLSFGPVKDVLLAGTYEFGEGDTEAYLLGPGFDLAIPGFDYFQLNF
                     YYRKPDGNRVRAGAWQITPVWSYTIPVGNSDILIDGYMDWVINNKSASTSRRNQSDYH
                     ANLHFNPQVKYDLGKALGYEPKHLYVGLEYDYWSDKYGVKDSQYFTTDQNTASFLVKY
                     HF"
     gene            266693..268099
                     /locus_tag="HWH41_01300"
     CDS             266693..268099
                     /locus_tag="HWH41_01300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine permease"
                     /protein_id="QOD45578.1"
                     /translation="MHSEDQRPNDLIYGLDDRPRPLPAFLAALQHVLASFVGIVTPPL
                     VIGSLLGLGEHLPYLISMALMVSGAGTLIQARRPFGIGAGMICLQGTSFAFLGAVLAA
                     GMLVKQRGGGPEEILAMIFGVCFFGAFVQIVLSRFLGHLRRVITPLVTGIVITLIGVS
                     LIKVGITDLGGGAGATDFGAPANLALGALVLLSIVLLNRSRLPWLRLAAIVIGLALGT
                     LAAWATGLFVPRALPELPLVSLPQPFRFGFAFDWMAFLPVALIYLISSIETVGDLTAN
                     CMLSRQPLEGPAYLQRLRGGVLGDGVSCLLAATFSAFPNTTFAQNNGVIQLTGVASRH
                     VGIYIGGVLLALGLFPWIGAILQQIPKPVLGGATLVMFGSVAAAGIRILGQTAMDRRS
                     VLIIAASFGVGLGVAAQPTLLDQMPAVVKTLFDSAITSGGITAILLNLLLPEERVAEA
                     AQASAKGGALARWRKPLG"
     gene            268192..268857
                     /locus_tag="HWH41_01305"
     CDS             268192..268857
                     /locus_tag="HWH41_01305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator C-terminal
                     domain-containing protein"
                     /protein_id="QOD45579.1"
                     /translation="MTLTVPAHDPAARDKPAGRIRQKNEEAILAAAEEEFARHGFKGT
                     SMNTIAQNVGLPKANLHYYFGNKLGLYTAVLSNILELWDSTFNTLGVDDDPAEALARY
                     IRAKMEFSRRYPLASRIFAMEIISGGECLTAHFNQDYRSWFRGRAAVFEAWIAAGRMD
                     PVDPVHLIFLLWGSTQHYADFASQIGLVTGRKRMSRQDFAAAADNLVRIILKGCGLTP
                     PAA"
     gene            268863..269453
                     /locus_tag="HWH41_01310"
     CDS             268863..269453
                     /locus_tag="HWH41_01310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YigZ family protein"
                     /protein_id="QOD45580.1"
                     /translation="MPSTLQGLAEYREEIRKSRFHTIAAPVADEDEAQAFIAAHRDAS
                     AGHNCWAWKCGAQYRFSDDGEPGGSAGRPILAAIEGQDMDCVAVLVSRWFGGIKLGTG
                     GLARAYGGGAAKCLQQAPRSELVERCRVRFACAFADHALLKARSLALGASVAAEDYGA
                     DGVVLTLELPVARFEALQALLVDLSRGQVRPQRLDA"
     gene            complement(269460..270167)
                     /locus_tag="HWH41_01315"
     CDS             complement(269460..270167)
                     /locus_tag="HWH41_01315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="QOD51092.1"
                     /translation="MRLERIARISDGFQSMAREQNLSLSERYHKQLRRLEKVARISDR
                     YQQMMRDLNLALKEASIRDPLTGLPNRRMLLERLREENERSQRHGQSYVLAMLDVDFF
                     KQVNDTWGHDSGDRVLVEIARAMESELREYDLCGRWGGEEFLLLLPQTRLQDAGPVLE
                     RVRDSVRTLAVRVGTEALSVTASVGVTEHRIGETYSQTVNRADAALLDAKRSGRDKCV
                     FAALPPLPAPSRPAPAR"
     gene            complement(270294..270674)
                     /locus_tag="HWH41_01320"
     CDS             complement(270294..270674)
                     /locus_tag="HWH41_01320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1987 domain-containing protein"
                     /protein_id="QOD45581.1"
                     /translation="MSDLHIPGTQSTPAIQGDWQAGRLSMQGDSYPENSYELFGQVID
                     WVERFLADGQRPLELDLRLLYLNTSSIKAMMDILDLLEEAHQGGRPVSLRWHYDRRNE
                     RVAELAEEFREDCSFPFAIQAHDE"
     gene            complement(270701..271243)
                     /locus_tag="HWH41_01325"
     CDS             complement(270701..271243)
                     /locus_tag="HWH41_01325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45582.1"
                     /translation="METLDLLAMRESYTRQRILLCFNGPISRSLIEEIGHALRNYLHA
                     EQAKPSEAMDVFAVYIEMTQNIRHYANLKGYGEHEAAATVAIARNEDGHYVVSAGNLV
                     ERDDGQSLVRSIQAIANLDKAALKAAYKEQLRRPRDSGCASGAGLGLLDIARKSSEPL
                     AASLKEQPDGRAFFSLRAVI"
     gene            complement(271252..273243)
                     /locus_tag="HWH41_01330"
     CDS             complement(271252..273243)
                     /locus_tag="HWH41_01330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SpoIIE family protein phosphatase"
                     /protein_id="QOD45583.1"
                     /translation="MAANWGLRGKSVVALLLACALALVPAVLLGWRAMDDIRTHFGLA
                     YAKNFTLLHRQKILAPVSRELALSRRFAESVVTRDWLLKEDDPARRALFFREAEGYRG
                     DFRDHAYFIIASGSQHYYFNDGSQPYSERPRYTLEAGDPEDAWYFNTLRNSAAYNINV
                     NVDSKLNLTKVWFNLVIRDQGRPIGLAGSGLDLSGFLDDFIIAREPGVTPMIVGDDGA
                     IQAHPDRRLIAYSSAAGGASERHRVFDLLDQPEQRDALREAMRLARAKAGSVHCLWAG
                     LDGRQQLFAVAYIPQLRWYVLTAVDLHAAQVLDNRWLWPLAGTFLLLLVALLLGFAYA
                     VERLLLRPLRSLKRSAKAIAAGRYDTPLPLARQDEIGSLSKAFASMADQVRRHTAELE
                     DKVQERTQALEEANREMAAAQKKIGDSLDYASLIQRAILPDRQLSATLGEHHFILWKP
                     RDVVGGDFYVYREQADGYLIGVVDCAGHGVPGALMTMLARAAIDHAIEAVGSRDPAAI
                     LGETDQAMRSMLSQEQIPQALATNMDAGLVWVDRRRRQLAFAGAKISLYASDGEEVQE
                     LKGARRAIGDKRRGDYRNIEVPLAPGWTFYLSTDGFLDQAGGEHGFGFGSRRFADMLR
                     DHARQPLPEQAEAFVATLAEYQGEHPQRDDITILSFRFD"
     gene            complement(273506..274555)
                     /locus_tag="HWH41_01335"
     CDS             complement(273506..274555)
                     /locus_tag="HWH41_01335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis response regulator protein-glutamate
                     methylesterase"
                     /protein_id="QOD45584.1"
                     /translation="MPISVLVVDDSALIRSLLKEIIQADPELRLVGCAPDAFVARDLI
                     KQHAPDVISLDVEMPRMDGLTFLDKLMKARPTPVLMISSLTERGSEATLRALELGAVD
                     FIAKPRLGIAEGMQAYAEEIRAKLKTVARARLRRRAADAPAPPESAAPLLSTEKIIAL
                     GASTGGTEALKEVLLGLPAHSPGVVITQHMPPGFTRSFAERLDRLTRLSVSEARDGDR
                     ILPGHALVAPGDHHMEVQRSGANYVVRLNRQAQVNGHRPAVDVMFESLARCAGRNLLA
                     GLLTGMGKDGARGLLAIRQAGGYTLAQDEATCVVYGMPREAVELGAAEDVLPLERIAA
                     ALLQQAARRGSGNRL"
     gene            complement(274575..275177)
                     /gene="cheD"
                     /locus_tag="HWH41_01340"
     CDS             complement(274575..275177)
                     /gene="cheD"
                     /locus_tag="HWH41_01340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemoreceptor glutamine deamidase CheD"
                     /protein_id="QOD45585.1"
                     /translation="MNLQAREGAPLNRYYDPYFACDAVKLLPGEYFASGEDLVIVTVL
                     GSCVSVCLRDPLNGIAGMNHFMLPERGLGGDPASPSARYGSHAMELLINRMLTLGASR
                     ERLQAKVFGGGSVLRQISAAIGQRNVEFTLDYLATERIPLLASDVLEAFPRKIYFFPR
                     NGRVLVKSLVELKNDTVLQRERDYRRRIDRNADGGPIDLF"
     gene            complement(275183..276025)
                     /locus_tag="HWH41_01345"
     CDS             complement(275183..276025)
                     /locus_tag="HWH41_01345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheR"
                     /protein_id="QOD45586.1"
                     /translation="MPTSTPSPVFGNQEFHYTREDFQQVRERLYRLTGISLAESKAQL
                     VYSRLSRRLRLLRLGSFAEYFTHLDREPGEQQLFVNALTTNLTAFFRERHHFPLLADL
                     ARRQLQRHRPLRIWSAAASTGEEPYSIAITLVEALGSFDPPVKIVASDIDTGVLDCAR
                     LGVYPLERLEQMPAPLKKRFFLRGTGPNAGKARVVEELRQLVEFRQINLLEADWSIAG
                     ELDAIFCRNVMIYFDKPTQTRLLERMVALLRPEGLFFAGHSENFVHASHLVRSVGQTV
                     YSPA"
     gene            complement(276095..278134)
                     /locus_tag="HWH41_01350"
     CDS             complement(276095..278134)
                     /locus_tag="HWH41_01350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain-containing protein"
                     /protein_id="QOD45587.1"
                     /translation="MGLFNAHAVAQQRADRIATLLQSFADGQLDTAVGEAPAPGYERL
                     YDSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDQTIPAERLEGRAARIAK
                     GVNELVAAHIAVKMKVVSVVTAYGQGNFEPLMDRLPGKKAQITEAIDGVRERLRGAAE
                     ATSAQLATAAYNARIKSALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLP
                     NFDAGRLMGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFSLDVVPVFNDANER
                     LGSAVQWTDRTEEHRAEQEVSQLVQAAAAGDFSKRVEEAGKEGFFLRLAKDLNSLVDT
                     ADRGLRDVSRMLGALAQGDLTQRIEADYQGTFGQLKDFSNETALSLSRMLGQIREAAD
                     TINTAASEIASGNAELSARTEQQASSLEETASSMEELTSTVKLNAENARQANSLAANA
                     SEVATQGGTVVQKVVSTMSSINESARKIADIIGVIDGIAFQTNILALNAAVEAARAGE
                     QGRGFAVVAGEVRTLAQRSAAAAKEIKTLISDSVDKVENGNTLVAQAGQTMSDIVVAI
                     RRVTDIMSEIAAASAEQSTGIEEVNSAVSQMDDMTQQNAALVEEAAAAAEAMQEQAGL
                     LNQSVAVFRLDTPPSVVQLASARPSAPRPSAPAPLARSGMARASKARKEDGWEEF"
     gene            complement(278170..278655)
                     /locus_tag="HWH41_01355"
     CDS             complement(278170..278655)
                     /locus_tag="HWH41_01355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheW"
                     /protein_id="QOD45588.1"
                     /translation="MNGTEASQANGPAQEYLTFTLGREEYAIDILRVQEIRGYDQVTA
                     IANAPPFIKGVINLRGAIVPIVDLRIKFHLAEVTYDPFTVVIILNIGRRIVGVVVDSV
                     SDVIALGGDAIRPPPEFGASFDTEYLLGLATAGERMLILVDIERLMTSREMALVDEAA
                     A"
     gene            complement(278642..280570)
                     /locus_tag="HWH41_01360"
     CDS             complement(278642..280570)
                     /locus_tag="HWH41_01360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheA"
                     /protein_id="QOD45589.1"
                     /translation="MPQDMSQFLQVFFEETEEHLATLELLLIGLDLDRPDSETLHGIF
                     RAAHSIKGSSGMFGFDDITAVTHELETLLDRIRCGQMGLRPDMISSFLEARDVLQRLL
                     DAHRSGRPDPGVPLLETVERLRGWLRAPEQEAAEEGFGLFDDAPTSPARETAGDDAFG
                     FFDEGPGAPERAAAPEAFGLFDEAPGAPAASEAFGLFDDAPGSPPTEERAFGLFDGAP
                     GSPAAPSAPAQAVAVPARGAVAPARGDGESGSIRVSVEKIDSLINLVGELVITQAMLG
                     QLGEQLDPSHHERLQHALAQLEHNTRDLQESVMSIRMLPINFIFSRFPRLVRDTATRL
                     GKQVELHLHGEHTELDKSVIEKLSDPLTHIVRNSIDHGIETPAERLAAGKPASGTVKL
                     AASHQGGSVVVEVSDDGRGLSRPRILAKARERNLPVHDRMSDAEVWQLVFMPGFSTAE
                     TVTELSGRGVGMDVVKRNIGAMGGRIDIDSAPGMGTRIGIRLPLTLAILDGLIVAVEA
                     VNYVIPLTYIVESLQARSDDVRGLGGEDNAMIRVRGEYLPLFSLHELLRIGGEAPAPE
                     QGIVVILESEGRSFALQVDELVGQQQVVIKSLEQNFRRVEGIAGATIMGDGSVALILD
                     VDALPRLAAREDTADERH"
     gene            complement(280598..280963)
                     /locus_tag="HWH41_01365"
     CDS             complement(280598..280963)
                     /locus_tag="HWH41_01365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="QOD45590.1"
                     /translation="MGKPILIVDDSASIRQMLSFTLKSAGYEVDEAADGKEGLGKAQS
                     KSYSLVFTDQNMPNMDGLSLIRSLRNLAGYRSVPILMLTTESSDAMKQQGRSAGATGW
                     LVKPFDPPKLLEVTRKVLP"
     gene            complement(281161..282333)
                     /locus_tag="HWH41_01370"
     CDS             complement(281161..282333)
                     /locus_tag="HWH41_01370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="QOD45591.1"
                     /translation="MRESLGVSLPSRPLLLKLGLLSLPWALCAGLHAVGLGVWLALAL
                     GWFASLAMLFLLLRDPRQAVANASPQADAASPAWSAAQRALADETAQLDGHARQIDEL
                     LHSAIRQLSDSFHGLAERIDTQRGLSHSLIERYDGRGQVDEGINFQDFVRTTQQTLSL
                     FVEATLETSRTSQQLVERMDQVRLKITEILQSTQDMDAIAKQTNLLALNAAIEAARAG
                     ESGRGFAVVADEVRALSTRSTEFSAAIRKHIDVVHHEIQDAESAISQLADKDMSFALD
                     SKQKIQGMLDDLEAMNRHTLKVIHELDRLSLEVGQGVDAAVTALQFQDMGSQLLGQMR
                     KHHARLGAFAFGLGALEARPRQEWPERVAREVEELRRPLPSPVSQNSVNVGEVELF"
     gene            complement(282524..283456)
                     /locus_tag="HWH41_01375"
     CDS             complement(282524..283456)
                     /locus_tag="HWH41_01375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="QOD45592.1"
                     /translation="METLSNIQCFVRSAEAGSFAEAARRLGLTPAGVGKNVARLESNL
                     GVRLFQRSTRRLTLTEAGERFLQEVGGSLEGIQTALANVSSVGNQPSGTLKVSMGLAF
                     GRDYILPLLGEFLERYPDIVPDWHFDNRQVDLIGEGFDAAIGGGFELPPGVVARNLTP
                     GHLILLASPAYLRDKPPIRHPGDLGGFDGIRIRSPQTGRVRSWPLRQRNGEEAPIELR
                     ERMTMSDPEATCEVAAMGLGITLVCMQHAYAYLESGALVRVLPDWYVDAGNTSLYYAA
                     NKLLPAKTRVFVDFVVDYFRRQDLARRFSAFPTG"
     gene            283573..284325
                     /locus_tag="HWH41_01380"
     CDS             283573..284325
                     /locus_tag="HWH41_01380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase FabG"
                     /protein_id="QOD45593.1"
                     /translation="MSVSSASLAGKVAFVQGGSRGIGAAIVRRLAAEGASVAFTYVSS
                     ADKSRALAAELEGAGASILALHADSADAAALVAAVDEAAARFGRIDILVNNAAVLALG
                     SVEELPLADFERTLAINVRSVFVATQAAVKHMGDGGRVISIGSTNAERMPFAGGATYA
                     MSKSALVGLTKGLARDLGPRGITVNNVQPGPVDTDMNPDDGDFAETLKGLMALPRYAR
                     SEEIASFVAYLAGPEAAYITGASLTIDGGFSA"
     gene            complement(284425..286035)
                     /locus_tag="HWH41_01385"
     CDS             complement(284425..286035)
                     /locus_tag="HWH41_01385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfatase"
                     /protein_id="QOD45594.1"
                     /translation="MSKRPNFLVIVADDLGFSDIGAFGGEIATPNLDALAIAGLRLTD
                     FHTASTCSPTRSMLLTGTDHHIAGIGTMAEALTPELAGKPGYEGHLNERVVALPELLR
                     EAGYQTLMAGKWHLGLKPEQTPHARGFERSFSLLPGAANHYGFEPPYDESTPRILKGT
                     PALYVEDERYLDTLPEGFYSSDAFGDKLLHYLKERDQSRPFFAYLPFSAPHWPLQAPQ
                     EIVEKYRGRYDAGPEALRQERLARLKELGLVEADVEAHPVLALSREWEALNDEERAKS
                     ARAMEVYAAMVERMDWNIGRVVDYLRRQGELDNTFVLFMSDNGAEGALLEAFPKFGPD
                     LLGFLDRHYDNSLENIGRANSYVWYGPRWAQAATAPSRLYKAFTTQGGIRVPALVRYP
                     RLSRQGAISHAFATVMDVTPTLLDLAGVRHPGKRWRGREIAEPRGRSWLGWLSGETEA
                     AHDENTVTGWELFGMRAIRQGDWKAVYLPAPVGPATWQLYDLARDPGEIHDLADSQPG
                     KLAELIEHWKRYVSETGVVEGALPFLVR"
     gene            complement(286123..286962)
                     /locus_tag="HWH41_01390"
     CDS             complement(286123..286962)
                     /locus_tag="HWH41_01390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="QOD45595.1"
                     /translation="MNAFTAPATGTPLVSFRQVRKHFAVDGRRLEAIQQFDLEIGEGE
                     FIAIVGASGCGKSTLLRLLIGLDRDYDGEIRVDGRPIAGIGGERGIVFQEHRLFPWLT
                     VQQNVALGLVNEALGETDKAARIDEYIRLVGLHGFERAYPHQLSGGMAQRVAIARGLV
                     ASPRLLLLDEPFSALDALTRQQLQEELLAIRRRTRITTLLVTHDVEEALYLADRVVVM
                     EPRPGRIRRVVEVDLAHPRERGGFDFLRQREALLHELTADGEYVAPPPRRVENLPFEF
                     LAC"
     gene            complement(286959..288575)
                     /locus_tag="HWH41_01395"
     CDS             complement(286959..288575)
                     /locus_tag="HWH41_01395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QOD45596.1"
                     /translation="MKNIDKTLSPAWSRPLPRLAPPPSAAFARRLGDSLLPWLLPLGL
                     ALLWWVASHRHWMSAQVLPTPELVWQSARELLAGELWSELAISLRRLAWGLLAGVASG
                     AALGAWLGFSPRAERLVFPTFSALAQIPTLAWIPLFMLFFGIGELLKLVVLVKAVVVP
                     VTIHTLVGVRDAQPKLREAAAVLRLPPRLLVWRLILPAALPAFLTGLRLALAQGWTSL
                     LAVELLASSEGIGYLMVQGRQLFMLDIVFVCILVIGLVGVSMDRAIQWLDHRLLHWPQ
                     AATGEFRRRPPGRGWQRLQVWLPPLALLLLWQSASSAEWVDPAILASPLEVARATWSG
                     ALDGSLPGALFDSLKRTLGGLLLGGGLGFLGGLLLGLWRPAERFFGPTFAALRQVAIF
                     AWVPLLTAWFGLGEPAKLTFVAIAAFFPLLLATQRGIASLPPSLGEAARVLRLGPWRR
                     LLRLVLPGAAPSVFAGLRLALIYAWLGTIGAEYFMPSDGGIGSLMIGAQQLFRMDLIG
                     AGMLLVGLTGALLNALGQRIEARATRWRHA"
     gene            288842..289909
                     /locus_tag="HWH41_01400"
     CDS             288842..289909
                     /locus_tag="HWH41_01400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="QOD45597.1"
                     /translation="MKALTSSLLGLFAVPVLAGLLGAYVPLASAAPPKEIRIAVPDVS
                     AGSSHSGGGVVDVLYTRQLLEKEFANDGIAVKWSFFKGAGPVVNEAFANGQVDFAYLG
                     DLAAIIGKSGGLDSRLLAATARGVNHYLGVQPGSGIKTLEDLKGKRVGIFRGTASQLS
                     FDNALASVGLSEKDLKVINLDFSAALSALAARQIDATWGLAGLFALRDRGLAEIPLST
                     RDLNGAGTLQALLVGSGAFVDAHPDITERLLKVQLQAQDWLAREENRDAYIELVSKQA
                     SYPVVILQSEYRGRKLGDALSPRLDADFLGRLDASIQAAKRFGLIRREFSAEQWAAPE
                     LLEAAGKLAKAKAKAVAQAAE"
     gene            complement(289932..291290)
                     /locus_tag="HWH41_01405"
     CDS             complement(289932..291290)
                     /locus_tag="HWH41_01405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OprD family porin"
                     /protein_id="QOD45598.1"
                     /translation="MQNLRRAVFAGLVAGTLSEGAAATAGDGGFVEDSELQFLARTYY
                     FNRDYRDSPNNAGRNRFKPRSERNGYREETTQGLRLQFASGYTPGSLGFGLDAHAMLG
                     LQLDSGGGRTGTGNLPVGADGHPDHRYGKVGGALRLRHGETRLKYGQTTTSAPVFAAS
                     SNRTLAGMAYGLLLEDRSFDGLLLEGGRFTAASGPGESKVRGDISTVYGRLGAYPVRL
                     DAVGFLGGQWQATERLQLSLYASRFDDIWQQAYFGASHRQPLGGERALRVDLDAYRTR
                     DSGQSRFGRIDTLASSLALGYEQGPQRITLAYQRVHGEQPFDYMAFGDGRSSASMVLA
                     NSVGYSDFNGPGERSWQLRYDLDLGALGLPGLSLHALHARGRAGASASSAAESIYAGL
                     YGRDGRHRESDLGFAYRVKAGPLAGLALRASQAWHRGNASYLDGDIDETRLVVDYSRS
                     IW"
     gene            291538..292262
                     /locus_tag="HWH41_01410"
                     /pseudo
     CDS             291538..292262
                     /locus_tag="HWH41_01410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248880.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase PAP2 family protein"
     gene            complement(292286..293203)
                     /locus_tag="HWH41_01415"
     CDS             complement(292286..293203)
                     /locus_tag="HWH41_01415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="QOD45599.1"
                     /translation="MDLRQLRYFIALAEHRSFVRAADAMGITQPAFSRSIQGLEQELG
                     CQLVDRGSKDLRPTPEGQVVLQHALSLVQGSANLIHEIAQLNKLDAGELRFGSGPAPA
                     QQLVPDAVADFINRHPRVQISLDVDNWEKLSRSLLREEIEFFVADIRDFEADPNFQTR
                     PLTPRRGQFFCRPQHPLLGKDSLSTNDLFNYPLASTLIPPGIRKLLANLSGKIDFAAN
                     IRCENMHALIRIVRQTDAIGIASDETLRPYLQRGELQPLQWRNLPQNLDSLSARCGII
                     SRSGYRLSAAAKAMIETLVELDQAQHAAA"
     gene            293554..295926
                     /locus_tag="HWH41_01420"
     CDS             293554..295926
                     /locus_tag="HWH41_01420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="QOD45600.1"
                     /translation="MKYHYRLPLRRTPPGGSDYALALLLALGGALPASAADAPAPAEE
                     APPLAGSAPAKADTALGKVTVTARRREEDSQKVPTPITVLGGETLEAQRISRVQDLQQ
                     VLPSVNVAYIHARQSSVAVRGIGNNPASDGLEGSAGIYLDNVYLGRPGMAVFDLLDIE
                     QLELLRGPQGTLFGKNTTAGVLNISTRAPTFTTERTVEVSGGQDGYFQGRGTVSGPLG
                     ETLAGRLSAYRTRDDGYIKNIHDDNYLNGGERQGARGQLLFEPNEDFSLRWIADYNEE
                     DSSNGSMVVYGAAERFWQRAALVGASPLRDPQRRKVNINGRQHVSVHQGGSSLEANWN
                     LAGGYRLTSISAYRYWHFTPANDEQLNVSAINDTGVEVHDRQFSQEIRLASPTGGAFD
                     YVVGAYAFRQNLGNKTFTSYGPLADLYLLGANLGALNDTYSKANGKIETDSFALFAQG
                     TWHLSERLDFTAGLRGTYEEKNAKVERFAPLGGAAVGGVGAAVRNGQLGAYDSGDLSQ
                     YNFAPSALLSLSYQFSDDLLGYASLSHGEKSGGVNLAVGSAPSAGADSLLVGPERAND
                     AELGLKSTLFDRRLLLNANLFWTGIHGYQATTLYQAPGSTQLVQVLANAGSVRSRGLE
                     FEATALPLRGLTLNFNGSYNDVTYLSFKDAPCPAEVSTRPGAPSSCDLSGQRVVGASK
                     WIANLNGEYQWRLDDRFQPYVSASYAYRSAAEGTLDNSDLSKIDGYALVNLAAGLRSD
                     LGDGQLDTSVWLKNAFDKDYYLSAFASINGSYTASVGQPRTLGVSLRYDF"
     gene            295967..296869
                     /locus_tag="HWH41_01425"
     CDS             295967..296869
                     /locus_tag="HWH41_01425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TauD/TfdA family dioxygenase"
                     /protein_id="QOD45601.1"
                     /translation="MSNAAQALATPVRLDIQPVAGRIGAEIRGVTLSGELDAATVEAI
                     QAALVRHKVIFFRDQSHLDDQTQEAFAHLLGEPVAHPTVPSREGTRFLLELDGAEGRR
                     ANSWHTDVTFVEAYPKASILRSVVAPESGGDTVWANTASAYADLPAELRELADRLWAV
                     HSNEYDYAGVKPSASLEQLENYRKVFTSTVYETEHPVVRVHPQSGERTLLLGHFVKRL
                     KGLSQHDSAHLFAVLQGHVTRLENTVRWRWEAGDVAIWDNRATQHYAIDDYGDQPRVV
                     RRVTLGGDVPVGIDGQRSRTIRKA"
     gene            296937..297836
                     /locus_tag="HWH41_01430"
     CDS             296937..297836
                     /locus_tag="HWH41_01430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TauD/TfdA family dioxygenase"
                     /protein_id="QOD45602.1"
                     /translation="MSQSATARQPEPEVAEAFRITPLEAPLGAEVRGLDARRPLAPEQ
                     VLALKQALREHHILVFRQQHLDDEQYLRFATLFGSVFQPPADIPVLSSGGDGKVPEIV
                     KVANTGDGELGNFALPAHIDHQWTPVPSSGSLLYALEVPSSGGETRFTNLARAYESLD
                     EATRREIDGLRLINYNPFIRLREGGYGGGFATYRTPDIEPIQGSEHPLVRTHPESGRR
                     VLFLSAHTEVEIPGYDPARGQALIGRLREHLARPELSYSHAWSVGDIVWWDNQAVLHA
                     RNAFPASERRRLKRISLAGSRPF"
     gene            298483..299601
                     /locus_tag="HWH41_01435"
     CDS             298483..299601
                     /locus_tag="HWH41_01435"
                     /EC_number="1.6.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Re/Si-specific NAD(P)(+) transhydrogenase
                     subunit alpha"
                     /protein_id="QOD45603.1"
                     /translation="MQIGVPLETHAGETRVSATPETVKKLIGQGHQVIVQSGAGVNAS
                     QPDSAYEAAGATIGSAAEAFGADLVLKVVAPSAAELAQMKSGAVLVGMLNPFDNENIA
                     RMAERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVMLAANHYPRFMPMLMTAAG
                     TVKAARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFVDVPYETD
                     EERECAEGVGGYARPMPASWMERQAKAVHERAKQSDIVITTALIPGRKAPTLLHEATV
                     AEMKPGSVVIDLAAAQGGNCPLTEADQVVVRHGVTIVGHSNLAALVPADASALYARNI
                     LDFLKLTLNAEGFSVNLEDDIVAACLMCRDGQAVRKNG"
     gene            299677..299985
                     /locus_tag="HWH41_01440"
     CDS             299677..299985
                     /locus_tag="HWH41_01440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248886.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="QOD45604.1"
                     /translation="MDIISDGIYNLIIFVLAVYVGYHVVWNVTPALHTPLMAVTNAIS
                     AIVIVGAMLAAALTVTPLGKAMGTLAVALAAVNVFGGFLVTRRMLEMFKKKAPKAGGH
                     "
     gene            299985..301421
                     /locus_tag="HWH41_01445"
     CDS             299985..301421
                     /locus_tag="HWH41_01445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)(+) transhydrogenase (Re/Si-specific)
                     subunit beta"
                     /protein_id="QOD45605.1"
                     /translation="MSMNLVTLLYLIASVCFIQALKGLSHPTTSRRGNLFGMVGMAIA
                     VATTVGLVFKLGAEIATTGVGYIVVGLLVGGTAGSIMAKRVEMTKMPELVAFMHSMIG
                     LAAVFIAIAAVVEPQSLGIVAHLGDTIPTGNRLELFLGAAIGAITFSGSVIAFGKLSG
                     KYKFRLFQGTPVQFSGQHLLNLVLGLATLGLGLVFMFTGNLTAFAVMLALAFVLGVLI
                     IIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAM
                     NRSFFNVILGGFGAGGDAGGPAGPKEQRPVKSGSADDASFLLTNADSVIIVPGYGLAV
                     ARAQHALMELAEKLTHRGVTVKFAIHPVAGRMPGHMNVLLAEAEVPYEQVFEMEDINS
                     EFGQTDVVLVLGANDVVNPAAKNDPKSPIAGMPILEAYKAKTVIVNKRSMASGYAGLD
                     NELFYLDKTMMVFGDAKKVIEDMVKAVE"
     gene            301765..302577
                     /locus_tag="HWH41_01450"
     CDS             301765..302577
                     /locus_tag="HWH41_01450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="energy transducer TonB"
                     /protein_id="QOD45606.1"
                     /translation="MATPQPVDARTQPWRETPGGDLVALGRPVRQALHLVRHNPTQGR
                     VLSRRETILLVLFALTLHGAVIHWLSQQRTPALPEVPPQVPPMTIEFTAPAPPVVEPP
                     PPEPLPPVVEEPPPPVVDENAVKPPPPKPVPKPKPKPKPQPRPKPAPKAVEPAPPAPP
                     QPAAPPAPPVPVAAPAPLTPPSANAGYLHNPAPEYPALAMRRGWEGTVLLRVHVLASG
                     SPSEIQVQKSSGREALDQAAVKAVKRWSFVPAKRGDKAEDGWVSVPIDFKLN"
     gene            302606..303325
                     /locus_tag="HWH41_01455"
     CDS             302606..303325
                     /locus_tag="HWH41_01455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MotA/TolQ/ExbB proton channel family protein"
                     /protein_id="QOD45607.1"
                     /translation="MSLLTTPLESVEGAVIWLLVGFSVVTWGLALVKGVQFARQKRQD
                     RQFQKQFWSATSLDSAGEQAQDKQGAGARVAQAGFAAIQVQDNGQPDLAQSINHQDRL
                     ERALRQQIQRERRSLESGLAVLASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLET
                     VAGPIGSALIATGVGIAVAVPAVLVYNYFLRRLKLTAADLDDFAHDFYSLAQKSAFRV
                     IVHPSAARQAGNPSRNVKEAS"
     gene            303327..303728
                     /locus_tag="HWH41_01460"
     CDS             303327..303728
                     /locus_tag="HWH41_01460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbD"
                     /protein_id="QOD45608.1"
                     /translation="MAFSTQDSDEVLSEINVTPLVDVMLVLLVVFIVTAPLLTNSIPI
                     NLPKTESVAPPEQKDPLVVSIDGAGKLFVNKDEIQPELLESNLAAAKAKDAEVRVQLQ
                     ADEGVNYGQVAKAMASIERAGITRLAVITAR"
     gene            complement(303909..304121)
                     /locus_tag="HWH41_01465"
     CDS             complement(303909..304121)
                     /locus_tag="HWH41_01465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3079 domain-containing protein"
                     /protein_id="QOD45609.1"
                     /translation="MAKKFPLHPSHPERICWGCDRYCSAESMGCGNGASRTQHPSELF
                     GEDWAGEWEVEGTEDAKEQEAPARQA"
     gene            304337..304918
                     /locus_tag="HWH41_01470"
     CDS             304337..304918
                     /locus_tag="HWH41_01470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="QOD45610.1"
                     /translation="MHSERVRYVLVPGWYGSEDAHWQSHWQRALPNASRVEQQDWITP
                     LRADWIAELDAEIRRQPGPVVLIAHSLGCVTVALWAAQAERRVRDQVRGALLVAPADV
                     ERESCAEALRNFAPISREPLPFPSVLVGSDNDQACSPQRAMHLARAWGAETVILPEAG
                     HINVKSGHGAWEAGYRHLFRLQYLIDSQARRRA"
     gene            305029..306693
                     /gene="mdcA"
                     /locus_tag="HWH41_01475"
     CDS             305029..306693
                     /gene="mdcA"
                     /locus_tag="HWH41_01475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit alpha"
                     /protein_id="QOD45611.1"
                     /translation="MTTPISPPPQWSRRRQEKQRRLERVRGLADGAVLPRERLVAALE
                     ALIAPGDRVVLEGNNQKQADFLSRSLARVDPGKLHDLHMIMPSVGRPEHLDLFELGIA
                     RKLDFSFSGPQSLRIGQLLEDGLLEIGAIHTYIELYARLVVDLIPNVALVAGFVADRE
                     GNVYTGPSTEDTPALVEPTAFSDGIVIVQVNRIVDDPRDLPRVDIPASWVDFVVEADQ
                     PFYIEPLFTRDPRHIKPVHVLMAMMAIRGIYQRHNVQSLNHGIGFNTAAIELILPTYG
                     ESLGLKGKICRHWTLNPHPTLIPAIESGWVESVHCFGTELGMEGYIAQRPDVFFTGRD
                     GSLRSNRMFCQLAGQYAVDLFIGATLQVDGDGHSSTVTRGRLAGFGGAPNMGHDPRGR
                     RHSTPAWLDMRGEPEALLERGRKLVVQMVETFQDGGKPTFVERLDALEVARQTGMPLA
                     PVMIYGDDVTHVLTEEGIAYLYKARSLEERQAMIAAVAGISPIGLRHDPRETQRMRRE
                     GLIALPEDLGIRRTDASRELLAAKSIAELVEWSGGLYQPPARFRSW"
     gene            306693..307574
                     /locus_tag="HWH41_01480"
     CDS             306693..307574
                     /locus_tag="HWH41_01480"
                     /EC_number="2.4.2.52"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triphosphoribosyl-dephospho-CoA synthase"
                     /protein_id="QOD45612.1"
                     /translation="MNAIANLAATPCADLGECLADLAVDALIDEAELSPKPALVDRRG
                     NGAHADLHLGLMQASALSLWPCFKEMADAAQRHGRIDARLRGVLGQLGRDGEAAMLRT
                     TEGVNTHRGAIWALGLLVAAAALEPRRTQAGEVAARAGRIALLDDPAAAIGDSHGERV
                     RRRYGVGGAREEARLGFPRAVRHGLPQLWRSREGGAGEQNARLDALLAIMSVLDDTCV
                     LHRAGRVGLAVMQDGARAVLAAGGSASLAGRRRLCELDRRLLALNASPGGAADLLAAC
                     LFLDRLPAVSGGWAGSL"
     gene            307576..307875
                     /locus_tag="HWH41_01485"
                     /pseudo
     CDS             307576..307875
                     /locus_tag="HWH41_01485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248901.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit delta"
     gene            307868..308731
                     /locus_tag="HWH41_01490"
     CDS             307868..308731
                     /locus_tag="HWH41_01490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin-independent malonate decarboxylase
                     subunit beta"
                     /protein_id="QOD45613.1"
                     /translation="MTDVARLLALRSFTELGARQRARALLDAGSFRELLDPFAGVQSP
                     WLERQGIVPQADDGVVVARGLLDGQPAVLAAIEGAFQGGSLGEVSGAKIAGALELAAE
                     DNRNGVPTRALLLLETGGVRLQEANLGLAAIAEIQAAIVDLQRYQPVVAVIAGPVGCF
                     GGMSIAAGLCSYVLVTREARLGLNGPQVIEQEAGIAEYDSRDRPFIWSLTGGEQRFAS
                     GLADAYLADDLDEVRTSVLAYFAKGLPARPRCRRAEDYLRRLGDLDTAEQPDAAGVRR
                     LYQGLGQGDAT"
     gene            308728..309534
                     /gene="mdcE"
                     /locus_tag="HWH41_01495"
     CDS             308728..309534
                     /gene="mdcE"
                     /locus_tag="HWH41_01495"
                     /EC_number="4.1.1.88"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin-independent malonate decarboxylase
                     subunit gamma"
                     /protein_id="QOD45614.1"
                     /translation="MSQPFASRGLAWFQALAGSLAPRPGDPASLRVADAELDGYPVRF
                     LAVVPDPDNPFPRARQGEVGLLEGWGLAAAVDEALEADREAPRKRALLAIVDVPSQAY
                     GRREEALGIHQALAGAVDAYARARLAGHPLIGLLVGKAMSGAFLAHGYQANRLIALHD
                     PGVMVHAMGKAAAARITLRSVEELEALAAKVPPMAYDIDSYASLGLLWRTLPVETVEV
                     PSTADLVRVRTCLGEALADILGGPRDLGGRLGAANREASARVRRLLREQW"
     gene            309550..310242
                     /locus_tag="HWH41_01500"
     CDS             309550..310242
                     /locus_tag="HWH41_01500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase holo-ACP synthase"
                     /protein_id="QOD45615.1"
                     /translation="MVIANSSQLGSSRRRLAPDPMRRRAGPEPHDLLLGMAPAHLPEN
                     APAWVCAALKAGWPVVVRRAPADPARVAIGVRGLAREQRWAGWMPLATITRRLRPEAL
                     GQREPAMLRDLPAWRALRDLRAPLNALGLAWGVTGGAGFELASGVAVLHPDSDLDLLL
                     RTPRPFPRDDALRLLQRFEQCPCRIDLQLQTPAGGVALREWAEGRPRVLAKGSEAPLL
                     LEDPWRVAEVEA"
     gene            310239..311171
                     /gene="mdcH"
                     /locus_tag="HWH41_01505"
     CDS             310239..311171
                     /gene="mdcH"
                     /locus_tag="HWH41_01505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003281891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit epsilon"
                     /protein_id="QOD45616.1"
                     /translation="MSVLFAYPGQGAQRPGMLAALPDEPPVRACLEQAADCLGQAPAE
                     LESAEALRGTRAVQLCLLIAGVAASRLLETRGHRPGLVAGLSIGAYPAAVVAGALDFD
                     DALRLVALRGELMQAAWPEGYGMSAILGLDQAQLDALILMVRREHPPLYLANVNAERQ
                     LVVAGSEAALAALAERARAAGASAAKRLAVSVPSHCALLDEPAARLAEAFAGIRLRRP
                     RVPYLSSSRARLVAEPAALADDLAGNMARRVEWLATLRSAYERGARLHLELPPGRILS
                     GLARPLFGCATPAFEGSRADTLDALLREEEKRTR"
     gene            311228..311632
                     /gene="madL"
                     /locus_tag="HWH41_01510"
     CDS             311228..311632
                     /gene="madL"
                     /locus_tag="HWH41_01510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate transporter subunit MadL"
                     /protein_id="QOD45617.1"
                     /translation="MIIYGVALLSLCTLAGLFIGEILGVLLGVPANVGGVGIAMLLLI
                     FVGSYLGKRGLLSAKTEQGVEFWSAVYIPIVVAMAAQQNVLGALSGGPAAILAGIAAV
                     AVAFALVPLLDRFGRKKAEGAPPLKPRTSVQG"
     gene            311638..312402
                     /gene="madM"
                     /locus_tag="HWH41_01515"
     CDS             311638..312402
                     /gene="madM"
                     /locus_tag="HWH41_01515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate transporter subunit MadM"
                     /protein_id="QOD45618.1"
                     /translation="MFESLNKVINGYGLISGFAIIGVTMAVSYWLSARLTRGRLHGSA
                     IAIFLGLVLSYVGGVATGGQKGLVDVPLMSGIGLLGGAMLRDFAIVATAFGVNVEELR
                     RAGVSGVVSLFLGVGSSFVAGVAVAMAFGYTDAVSLTTIGAGAVTYIVGPVTGAALGA
                     SSEVMALSIAAGLVKAILVMVLTPFVAPYIGLNNPRTAVIFGGLMGTSSGVAGGLAAT
                     DPKLVPYGCLTAAFYTAIGCLLGPSLLYFSVRGLVG"
     gene            complement(312487..313416)
                     /locus_tag="HWH41_01520"
     CDS             complement(312487..313416)
                     /locus_tag="HWH41_01520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="QOD45619.1"
                     /translation="MLIDEEITLKKLETFLAFMRTGNLARAAAELGTSNVSVHRAIHS
                     LESALRCPLFKHEGRNLTPLESAYVLEERAQKLVQEVLDTVRLTREAAGFSAERFKLG
                     ALYSLTVKTVPQLIMGLKLRRSALNIDLILGSNVDLFYQLKNMELDAILVSLNDSVSD
                     PDCEHLPLFSDDIFLAVPVDSPYARLAEIDLSTLRDTPFVTLTQGFATHQDGTRVFQQ
                     AGFEPQIAMQVNDIFTLLSMVSSGVGHALLPKRIEAVYENRVRLIPLQPRYRLQQHIG
                     VVFLKAKERDPNLLALLAECRMYSLRLEQEAAG"
     gene            complement(313763..314683)
                     /locus_tag="HWH41_01525"
     CDS             complement(313763..314683)
                     /locus_tag="HWH41_01525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="QOD45620.1"
                     /translation="MASYTLRQLKYFVTTVECGSVAEASRKLYIAQPSISTAVKGLEE
                     SFGVQLFIRHHAQGVSLTPAGARFYRKAQELLRMAHEFEQNALADNDVIAGQIDIGCF
                     ETVAPLYLPGLIAGFRQAYPGVEIRIRDGEQQELVQGLTSGRFDLAFLYEHDLDSTIE
                     TEPLMPPQRPHALLPEGHRFAGQAQVSLRDLCLEPMILLDVQPSRTYFVSLFEELGLT
                     PNIAFSSPSIEMVRGMVGQGFGFSLLVTRPHSECTYDGKKVVMVDLAEPVSTSGLAAA
                     WLKRAQLTKPARLFVDYCREQLGKLAERRH"
     gene            315034..316524
                     /locus_tag="HWH41_01530"
     CDS             315034..316524
                     /locus_tag="HWH41_01530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="QOD45621.1"
                     /translation="MFELSDWQRRAATQRFIDQALIGGRQRPAASGATFDAIDPASNR
                     LLARVAACDAADVDAAVAAARRAFDEGPWARLAPVERKRVLLRLAELMLAHREELALL
                     DSLNMGKPVMDAWNIDVPGAAHVFAWYAESLDKLYDQVAPTAQQALATITRVPLGVIG
                     AVVPWNFPLDMAAWKLAPALAAGNSVVLKPAEQSPFSALRLAELALEAGVPEGVLNVV
                     PGLGEQAGKALGLHPEVDALVFTGSTEVGKYFMQYSAQSNLKQVWLECGGKSPNLVFA
                     DCRDLDLAAEKAAFGIFFNQGEVCSANSRLLVERSIHDEFVERLLAKARDWQPGDPLD
                     PASRAGAIVDRRQTAGILAAIERAQGEGATLLGGGRQLTINGSDNFIEPTLFGDVRPD
                     MQLAREEIFGPVLAISAFDSEDEAIRLANDSRYGLAASLWSDDLHRAHRVARRLNAGT
                     VSVNTVDALDVAVPFGGGKQSGFGRDLSLHSFDKYTQLKTTWFQLR"
     gene            316582..318015
                     /locus_tag="HWH41_01535"
     CDS             316582..318015
                     /locus_tag="HWH41_01535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="APC family permease"
                     /protein_id="QOD45622.1"
                     /translation="MNDTPNVREPALRRVLGLGPLLAVAIGLVVSQGVMVLMLQGAGT
                     AGLGFIVPLGVAYLLALSYAFSFSELALMIPRAGSLSSYTEVAIGHFPAILATFSGYV
                     VVAMFALSAELLLLDLIIGKVYPGALPPMLVAYGVLGLFTLLNLLGIDIFARLQSALA
                     LLMMIVLLVLGLGAVSSDHASAQTALASGWNPLGVSALALTAMAVWGFVGAEFVCPLV
                     EETRRPERNIPRSMILGLSIIFLTIALYCFGALLCIPQAELAGDPLPHFLFANRVFGE
                     YGQLFLVIAAITATCSTLNSSLAAIPRMLYGMAQNGQAFPQFKQLSRRARTPWVAVLF
                     VAAITGLPILILGQDPDSINLLLLAAALAWLLAYIIAHVDVLALRRRYPHIARPFRTP
                     FYPLPQLFGIAGMIYAVVHVSPTPEMTGRIFASAGVVLGVVSLVAVVWIKGVMRKPLF
                     VPEPLETAGETAQGKSVALDPLQSPSA"
     gene            318046..319428
                     /locus_tag="HWH41_01540"
     CDS             318046..319428
                     /locus_tag="HWH41_01540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase family protein"
                     /protein_id="QOD45623.1"
                     /translation="MTAQLNPQRDTRDYQQLDAAHHIHAFLDQKALNREGPRVMVRGD
                     GLQLWDNDGKRYLDGMSGLWCTNLGYGRQDLAAAASRQLEQLPYYNMFFHTTHPAVVE
                     LSEMLFSLLPDHYSHAIYTNSGSEANEVLIRTVRRYWQILGKPQKKIMIGRWNGYHGS
                     TLGSTALGGMKFMHEMGGMLPDFAHIDEPYWYANGGELSPAEFGRRAALQLEEKILEL
                     GAENVAAFVAEPFQGAGGMIFPPQSYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFA
                     HEHFGFQPDTLSIAKGLTSGYIPMGGLVLGKRIAEVLVEQGGVFAHGLTYSGHPVAAA
                     VAIANLKALRDEGVVTRVREETGPYLQRCLREVFGDHPLVGEVQGAGFVAALQFAEDK
                     ATRKRFANENDLAWRCRTIGFEEGVIIRSTLGRMIMAPALVAGRAEIDELIDKTRIAV
                     DRTAREIGVL"
     gene            319592..320650
                     /locus_tag="HWH41_01545"
     CDS             319592..320650
                     /locus_tag="HWH41_01545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="QOD45624.1"
                     /translation="MYKSLHQYAHVFSRLSLFGLAFAAAAQAQSQSLTVISFGGATKA
                     AQEQAYFKPFERSGGGQVVAGEYNGEMAKVKAMVDVGKVSWDVVEVESPELLRGCDEG
                     LFERLDPARFGDPAQFVPGTFSECGVATYVWSMVMAYDSTKLARAPQSWADFWNVREF
                     PGKRGLRKGAKYTLEVALLADGVKAEDLYKVLATPEGVSRAFAKLDQLKPNIQWWEAG
                     AQPPQWLAAGDVVMSAAYNGRIAAAQKEGVKLAIVWPGSLYDPEYWAVVKGTPNKALA
                     EKFIAFASQPQTQKVFSEQIPYGPVHKGTLALLPKTVQEALPTAPANLEGARAVDAEF
                     WVDHGEELEQRFNAWAAR"
     gene            complement(320728..321609)
                     /locus_tag="HWH41_01550"
     CDS             complement(320728..321609)
                     /locus_tag="HWH41_01550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase family protein"
                     /protein_id="QOD45625.1"
                     /translation="MSASIHGIIGYTITPFAADGGLDLPALGRSIERLIDGGVHAIAP
                     LGSTGEGAYLSDPEWDEVVDFTLKTVAHRVPTIVSVSDLTTAKTVRRAQFAESLGAEA
                     VMVLPISYWKLNEAEVFQHYRAVGEAIGVPVMLYNNPGTSGIDMSVELILRIVREVDN
                     VTMVKESTGDIQRMHKLRLLGEGRVPFYNGCNPLALEAFVAGAKGWCSAAPNLIPTLN
                     GQLYQAVLDGDLEKARTLFYRQLPLLDFILRRGLPTTIKAGLGLSGLEVGAPRLPVQA
                     LDTEGCRYLQGLLEELR"
     gene            complement(321669..322451)
                     /locus_tag="HWH41_01555"
     CDS             complement(321669..322451)
                     /locus_tag="HWH41_01555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldolase"
                     /protein_id="QOD45626.1"
                     /translation="MATTLELPKDQLIQHALKQMKSSLGDNTWTDRQKLALTCRILFE
                     AGHDSGLAGQITSRGPEAGTYYTQQLGLGFDEISAGNLLLVDEDLNVLHGHGMANPAN
                     RFHSWVYRARPDVNCIIHTHPLHIAALSTLEVPLQVSHMDLCPLYDDCAFLKDWPGVP
                     VGNEEGEIISAALGDKRAILLSHHGLLATGASIEEACVIAVLLERAAKMQLLAMAAGE
                     IKPIPPALAREAHDWISTPKRHGAAFNYYARRCLPRNSDCLS"
     gene            322606..323145
                     /locus_tag="HWH41_01560"
     CDS             322606..323145
                     /locus_tag="HWH41_01560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QOD45627.1"
                     /translation="MSMRLKLLRKKLGVTLETLADKTGLTKSYLSKVERGLNTPSIAA
                     ALKLAKALNVQVEELFSEESDGVDGYSIVRRDQRKSLSSGDDGPAYASLAQQIGARAL
                     LPFIVHPPRDFSHSTFKEHLGEEFIFVHEGQVEVDFMNQRIILERGDALHFNAQKPHR
                     IRSLGETQAELLVVIHSDE"
     gene            323296..324147
                     /locus_tag="HWH41_01565"
     CDS             323296..324147
                     /locus_tag="HWH41_01565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA transferase subunit A"
                     /protein_id="QOD45628.1"
                     /translation="MAEILSLREAVRRFVHDGDSVALEGFTHLIPTAAGHELIRQGRK
                     DLTLIRMTPDLVYDLLIGAGCAKKLVFSWGGNPGVGSLHRLRDAVEKGWPQPLEIEEH
                     SHADLANAYVAGASGLPFAVLRAYAGSDLPKVNPLIRSVTCPFTGEVLAAVPSVRPDV
                     SVIHAQKADRKGNVLLWGILGVQKEAALAAKRCIVTVEEIVDELDAPMNACVLPSWAL
                     SAVCLVPGGAHPSYAHGYYERDNRFYQDWDPIARDRESFTAWIDEYIRGTEDFGAFQA
                     KLAEGKR"
     gene            324144..324926
                     /locus_tag="HWH41_01570"
     CDS             324144..324926
                     /locus_tag="HWH41_01570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA-transferase subunit beta"
                     /protein_id="QOD45629.1"
                     /translation="MSSYSTNEMMTVAAARRLHNGAVCFVGIGLPSKAANLARLTSSP
                     DVVLIYESGPIGAKPSVLPLSIGDGELAETADTVVPTGEIFRYWLQGGRIDVGFLGAA
                     QVDRFGNINTTVIGDYRQPKVRLPGAGGAPEIAGSAKEVLIILKQSHRTFVDKLAFVT
                     SVGHGEGGDSRQRLGLPGKGPVAIITDLCIMEPEAGSNEFVVTSLHPGVTREQVVEAT
                     GWAIRFAERVAETPAPSEVELAALRDLEARTAAAHGQKGSDE"
     gene            324923..326128
                     /gene="pcaF"
                     /locus_tag="HWH41_01575"
     CDS             324923..326128
                     /gene="pcaF"
                     /locus_tag="HWH41_01575"
                     /EC_number="2.3.1.174"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipyl-CoA thiolase"
                     /protein_id="QOD45630.1"
                     /translation="MSREVFICDAVRTPIGRFGGSLSAVRADDLAAVPLKALVERNPG
                     VDWSALDEVFLGCANQAGEDNRNVARMALLLAGLPESVPGVTLNRLCASGMDAIGTAF
                     RAIACGEMELAIAGGVESMSRAPYVMGKADSAFGRGQKIEDTTIGWRFVNPLMKEQYG
                     IDPMPQTADNVADDYRVSRADQDAFALRSQQRAGRAQEAGFFAEEIVPVTIRGRKGDT
                     LVEHDEHPRPDTTLEALARLKPVNGPEKTVTAGNASGVNDGAAALVLASAEAVEKHGL
                     TPRARVLGMASAGVAPRIMGIGPVPAVRKLLRRLDLAIDAFDVIELNEAFASQGLACL
                     RELGVADDSEKVNPNGGAIALGHPLGMSGARLVLTALHQLEKSGGRRGLATMCVGVGQ
                     GLALAIERV"
     gene            326278..327576
                     /locus_tag="HWH41_01580"
     CDS             326278..327576
                     /locus_tag="HWH41_01580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="QOD45631.1"
                     /translation="MTAPVHQYSNEERRKRIFAIVGASSGNLVEWFDFYVYAFCAIYF
                     APAFFPSDNPTVQLLNTAGVFAAGFLMRPIGGWMFGRIADKHGRKTAMLISVVMMCAG
                     SLAIACMPTYASIGTLAPALLLLARMFQGLSVGGEYGTSATYMSEVALKGQRGFFASF
                     QYVTLIGGQLLAVLVVVILQQLLSEDELRAWGWRIPFVIGAITAVIALWLRRSLNETA
                     SKSTLERKESGTFAELFKHKRAFFTVLGFTAGGSLIFYTFTTYMQKYLVNTAGMSAKT
                     ASAVMTFALLAYMLMQPLFGMLSDRIGRKTSMLWFGTLGTLCTLPILLALKTVSSPYV
                     AFFLIILALAIVSLYTSISGLIKAEMFPPEVRALGVGVSYAVGNAIFGGSAEYVALGL
                     KSVGMENVFYWYVSAMCLLALLVCVSLPDLRKVSYLNDEP"
     gene            327599..328978
                     /locus_tag="HWH41_01585"
     CDS             327599..328978
                     /locus_tag="HWH41_01585"
                     /EC_number="5.5.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-carboxy-cis,cis-muconate cycloisomerase"
                     /protein_id="QOD45632.1"
                     /translation="MSDVPANQLFDAYFTAAPMRAVFSDRGRLQGMLDFEAALARAEA
                     RTGVVPATAVAPIESACRAELYDPLSLAEAVATAGNSAIPLVKALGRQVAAGDAEAER
                     YVHLGATSQDAMDSGLVLQLRRALALLEQDLQRLAEVLADQAERHADTPLAGRTWLQH
                     ATPVTLGMKLAGLLGALTRHRQRLRELRPRLLVLQFGGASGTLAALGEQALPVAAALA
                     EELGLALPEQPWHTQRDRLVEFASVLGLVAGSLGKFGRDVSLLMQTEAGEVFEPGGAG
                     RGGSSTMPHKRNPVSSAVLIAAATRAPGLVSTLFAAMPQEHERSLGLWHAEWETLPEL
                     CCLVSGALQQAIGLLEGLEVDAQRMRRNLGLTHGLVLAEAVSIALARRIGREAAHHLV
                     EQCCRRAVEQRRELRAVLGEEARVSAELSGDELDRLLDPAHYLGQARAWVERALAEHH
                     ALGFEPHPA"
     gene            328993..329784
                     /gene="pcaD"
                     /locus_tag="HWH41_01590"
     CDS             328993..329784
                     /gene="pcaD"
                     /locus_tag="HWH41_01590"
                     /EC_number="3.1.1.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate enol-lactonase"
                     /protein_id="QOD45633.1"
                     /translation="MPTVRLADGDLNYSLEGPAGAPVLLLSNSLGTDLGMWDTQIPAL
                     TAHFRVLRYDTRGHGASLVTPGPYAIGQLGADVLALLDALDLPRVHFCGLSMGGLIGQ
                     WLGIHAGERLGRLVLCNTAAKIASDEVWNTRIDTVLKGGEQAMRDLRDASVARWFTAG
                     FAEREPAQVERIVAMLAATSPQGYAANCAAVRDADFREQLGLVQAPTLIVAGSHDAVT
                     TPDNARFMQARIADAQLVEFAAAHLSNVEAGDAFSRRLVDFLLSA"
     gene            329795..330196
                     /gene="pcaC"
                     /locus_tag="HWH41_01595"
     CDS             329795..330196
                     /gene="pcaC"
                     /locus_tag="HWH41_01595"
                     /EC_number="4.1.1.44"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-carboxymuconolactone decarboxylase"
                     /protein_id="QOD45634.1"
                     /translation="MDEKQRYEAGMQVRRAVLGDAHVERSLANLTPFNEEFQEMITRH
                     AWGDIWTRPGLPRHTRSLVTIAMLIGMNRNEELKLHLRAAKNNGVSRDEIKEVIMQSA
                     IYCGIPAANATFHLAESVWDELGVESQQASR"
     gene            330324..331265
                     /locus_tag="HWH41_01600"
     CDS             330324..331265
                     /locus_tag="HWH41_01600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="QOD45635.1"
                     /translation="MSRKLHIHAPAIHYFDMVRRCHSIREAARRLNVASSAVNRQILK
                     LEDEIGAPLFDRLPGGLRLTGAGEIFARHVTVVLQDMERVRSELDALQGLRTGHVEIA
                     TIEAVTSDLLPCVLKAMRERYPDITVGVTLLGSQAIPEAVSSGAVDLGLAFALPRSAD
                     LQQVSVGHFRLGAIVSPQHPLARHQAIAFADCVEHGLIMAKSELSIHHLLAPLQRRLR
                     EPRRAVLESSSLELSRQLARRGLGVAFQTRLGIEADIAQGELRFLPLKDNGGIHSDLG
                     LYVRTGRYLPVAVDALARQIAEEVRLREREEARLNEA"
     gene            331456..332289
                     /locus_tag="HWH41_01605"
     CDS             331456..332289
                     /locus_tag="HWH41_01605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-binding protein"
                     /protein_id="QOD45636.1"
                     /translation="MKKMMQGAAALIALVGAGESMALEWMSNSVGFRYGQQFTNPNNP
                     DKFAKRIYSFTHADGYRYGSNFFNLDVFLSDNRDPRKGTDHGGSEVYAVYRHQLYASR
                     VFDRPLGTGLVKDYAFTLGFDASRNNNLASAKKRALVFGPTLKFNGPGVLDLSLLYYR
                     EKNHFGVPGARHPDHTFDTTYMLNLTWMRPFKVGNRAAKFQGFVNYVGEKGEDYNDKD
                     TAAETLVRTALMVAALPGDKRQPNLWLGVGYEYWHNKFGVDGGTGSRTSTPTLNMEFT
                     F"
     gene            complement(332428..333774)
                     /locus_tag="HWH41_01610"
     CDS             complement(332428..333774)
                     /locus_tag="HWH41_01610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="QOD45637.1"
                     /translation="MNSPSLPAVERLDVQAFINAQPLSPYQWRIVLLCFLIVFLDGLD
                     TAAMGFIAPALTQDWGIDRASLGPVMSAALIGMVFGALGSGPLADRYGRKLVLVAAVF
                     LFGLFSLASAYSTNVEQLLALRFLTGLGLGAAMPNATTLLSEYTPERLKSLLVTSMFC
                     GFNLGMACGGFVSAKLIPLFGWHSLLLLGGLLPLVLAVVLLFRLPESARYLVVRNRGS
                     ERVRQVLVPIAPAQVALARSFHVPEQQTVQARNVFAVIFSGTYSAGTLLLWLTYFMGL
                     VIVYLLTSWLPTLMRDSGASLEHAAFIGALFQFGGVLSAVAVGWAMDRFNPHKVIGLF
                     YLLAGVFAWCVGQSLGQVTLLATLVLLAGMCINGAQSAMPSLAARFYPTQGRATGVSW
                     MLGIGRFGAILGAWIGATLLGLGWNFEQVLTALVLPAALATAAVLLKGLVSHADAG"
     gene            334080..334859
                     /locus_tag="HWH41_01615"
     CDS             334080..334859
                     /locus_tag="HWH41_01615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="QOD45638.1"
                     /translation="MAGSLIERALGLLELLASDARGLPLQQLADRLDIPKSAAHRMLA
                     ELIRLGYVRQDDDTSRYRLSTRLAALGFRFLASSGVVDLVQPVLDGLARETGELVRLG
                     VIEGDRQTWIAKSQGATSGLRYDPDMGREAPLFYTASGHAWLASLSDKAALALVERQG
                     VGTARDFGPNAPRSRSELLRYLKRAREHGYAWQIECSAPGMAAMAALVRHPEDGRALG
                     VLSVAGPSARFGEARMHELAPLLLAAAQDLSHASQASELFR"
     gene            335103..336146
                     /locus_tag="HWH41_01620"
     CDS             335103..336146
                     /locus_tag="HWH41_01620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="QOD45639.1"
                     /translation="MDAPLRIALIGAGNMGRQHYHRLQRIAGARLCAVADPQGQAFAA
                     DAGVPWFGDHRRLLEEARPQAAIVANPNNLHVATALDCLAAGVPLLLEKPVGVQLDEV
                     SELVAVARRSGVPLLVGHHRRHNPLVVRARQLIAEGALGRLLSVTALWQLKKPDSYFE
                     VAWRREPGAGMLLTNLIHDLDLLRYLCGEVREVQALAGNAIRGLPNEDNVALLLRFAN
                     GALGSLTGCDAAAAPWSWELAAGENPVYPRQAEQPCYLLAGTEGALSLPQLRRWRYAE
                     ARQGWHDPLAASVEAVAAGDPLQRQLEHFVRVARGEEAPLMDATDAARTLALVEAVRE
                     AARSGRACAPASF"
     gene            336169..336984
                     /locus_tag="HWH41_01625"
     CDS             336169..336984
                     /locus_tag="HWH41_01625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphate isomerase/epimerase"
                     /protein_id="QOD45640.1"
                     /translation="MESRILSLAALTVLELSPPDMVEAAARAGYSHVGLRLVPATVEE
                     HHYPLLADAGLRRRTLARLRDSGVRTLDVEILRLRPDTRVGEFAAVLEVGAEFGARYV
                     LVAGNDDDERRSADNFAALCDLARPLGLDPHLEFMPWTGIRDLRQAARVVEAAARDNA
                     GLLLDAFHFDRSASSLEDLRAIPPARLGYAQLCDVVGPRPTSMDEILRQAREERRFPG
                     DGGLDLLALLRALPENLPLSLEVPALDLLARGVDGTERARLAIERTRALLARL"
     gene            337134..338012
                     /locus_tag="HWH41_01630"
     CDS             337134..338012
                     /locus_tag="HWH41_01630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="QOD45641.1"
                     /translation="MNASTSPLPASDQTLRGILLICAAVFLFASHDGLSKFLSGFYPI
                     VMVVWARYLVHTLLMVAVFVPRNGLAVIRTRRPLMQLARALCLIGTSLFFTTGLRYLP
                     LAEATAVNFLAPLLVTALSVPLLKEKVSLGQWLAVLTGFIGVLFIVRPGGALFTPAAL
                     FPLGSALCFGLYQLLTRMLANSDSPTTSNFLAGIFNTLIMSLLVPFFWQTPSLLHGLM
                     MIALGGCGMGGHLLLTQAFRHAPPATLAPFSYGQIIFAGLLGLLVFGHVPDAWALLGI
                     LVICASGLVVAWRRGR"
     gene            complement(338038..339303)
                     /locus_tag="HWH41_01635"
     CDS             complement(338038..339303)
                     /locus_tag="HWH41_01635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OprD family porin"
                     /protein_id="QOD45642.1"
                     /translation="MSHPSHVRALCASLCLGAGLPVHAGHVHAGQGFLEDAKASLTAR
                     NFHLHRNFVGDASQGKAEEWTQSFILDARSGFTQGSVGFGLDVLGLYSLKLDGGKGTA
                     GTQLLPTHDDGRPADDFGRLAVAGKLRVSNSELKIGEWMPVLPILRSDDGRSLPQTFR
                     GGQLSANQIAGLTLYAGQFRGNSPRNDASMQDMSLFGRPAATSDRFDFAGGEYRFNGE
                     RSLLGLWNAELKDIYRQQYLQLQHSQPLGDWLLGANLGGFRGRDAGSARAGKLDNRTV
                     SALFSAGYGLHTLYLGLQKVSGDDGWMRVNGTSGGTLANDSYNASYDNPGERSWQLRY
                     DFDFVGLGLPGLTFMTRYLHGDHVRLAGVTDDGSEWGRESELGYTLQSGAFKRLNVRW
                     RNSSQRRDWGSNTRFDENRLIVSYPLSLL"
     gene            complement(339369..340694)
                     /locus_tag="HWH41_01640"
     CDS             complement(339369..340694)
                     /locus_tag="HWH41_01640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="QOD45643.1"
                     /translation="MIHSSSSRLLAADAPRESRGGRIRNAFAVGRTRWGMLALVFFAT
                     TLNYIDRAALGVMQPILAEKMSWTAMDYANINFWFQVGYAIGFILQGRFIDKVGVKRA
                     FFLAVLLWSLATGAHGLATSAAGFMVCRFILGLTEAANYPACVKTTRLWFPAGERAVA
                     TGIFNAGTNVGAMVTPALLPLILGVWGWQAAFLCMSALGLVWLVFWWRNYYNPEEHPR
                     VKQSELEYIQQQEEPPATRVPFSQILRRRGTWAFALAYSITAPVFWFYLYWLPPFLNQ
                     QYGLGISVTQMGIPLILIWLTADFGSVGGGILSSWLIGRGMPAIRARLLSMLLFACTI
                     VGVVFAANASGLWIAVLAIALAVGAHQAWTANIWSLVMDYTPKHLMSTVFGFGGMCAA
                     LGGMFMTQIVGGVLTATNNNYALLFTMIPAMYFIALTWLYFMAPRRIEA"
     gene            341241..343145
                     /locus_tag="HWH41_01645"
     CDS             341241..343145
                     /locus_tag="HWH41_01645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional sugar phosphate
                     isomerase/epimerase/4-hydroxyphenylpyruvate dioxygenase
                     family protein"
                     /protein_id="QOD45644.1"
                     /translation="MQRSIATVSLSGTLPEKLEAIAAAGFDGVEIFENDLLHYDGSPR
                     DVRRLCADLGLEILLFQPFRDFEGCRRGRLGRNLERAERKFDLMQELGTDLMLVCSNV
                     AADALGEPALLADDLRQLAERAAVRGLRIGYEALAWGRQVNTWEQAWDLVRRADQANL
                     GLILDSFHTLSLDGDPRGIADLPGEKIFFVQMADAPLLAMDVLEWSRHFRCFPGQGGF
                     DLAGFLAPVVASGYRGPLSLEVFNDGFRAAPTRANAVDGLRSLLYLEEKTRERLQRQT
                     LHVAVDELFAPPPASLCDGIEFLEFAVDETLGARLGQWLQRLGFARAGEHRSKNVSLL
                     RQGDINLVLNAEPYSFAHGFFEAHGPSLCATALRVRDAGQALERARAYGGQPYRGLLG
                     PNEREIPAVRALDGSLLYLVERHTEGRSIYDSDFVTNDADTSGLGLRRVDHVALALPA
                     EGLDSWVLFYKSLFDFGADDEVVLPDPYGLVTSRAVRSPCGSVRLPLNISEDRNTAIA
                     RSLSSYRGSGVHHIAFDCADIFAAVAQAKEAGVALLEIPLNYYDDLAARFDFDDEFLS
                     ELAYYNVLYDRDAQGGELFHVFTEPFEERFFFEILQRRHGYAGYGAANVPVRLAAMAQ
                     ARRGVRRAKL"
     gene            343238..343906
                     /locus_tag="HWH41_01650"
     CDS             343238..343906
                     /locus_tag="HWH41_01650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="QOD45645.1"
                     /translation="MSKPDPALVEESAPRGKGRKNNPEKTRQDILRAAIDEFVAQGLS
                     GARVDAIAERTHTSKRMIYYYFGSKEQLYQAVLEKLYSDIRGIEGTLRLGALPPAKAM
                     EKLVEFSFDYHDRHVDFVRIISIENIHKGEHIASSELVQSVNSSIVQSIAEILRRGEA
                     EGVFRAGLEALDVHMLISSFCFYRVSNRYTVSRIFRTDLHDAEVRQRHRQMIGEAVLR
                     YIRA"
     gene            complement(343946..344800)
                     /locus_tag="HWH41_01655"
     CDS             complement(343946..344800)
                     /locus_tag="HWH41_01655"
                     /EC_number="1.1.1.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate dehydrogenase"
                     /protein_id="QOD45646.1"
                     /translation="MSAPRSVLAGLIGAGIQASRTPALHEREGDAQGIRYLYRLIDLD
                     PLGKSADDLEFLLAAASDLGFTGLNVTFPCKQAIIPLLDELSAEARGIGAVNTVVLRD
                     GRRIGHNTDCLGFAEGFRRGLADAPRQRVVQMGAGGAGAAVAHALLAEGVERLALFDV
                     DPARAQALADNLNQHFGAPRALAGSDLAGALGDAQGLVNTTPVGMAKLPGMPVPAELL
                     RADLWVAEVIYFPLETELLRQARALGCRTLDGGTMAVFQAVKAFELLSGVEADAARMQ
                     AHFASLGD"
     gene            complement(344797..345243)
                     /gene="aroQ"
                     /locus_tag="HWH41_01660"
     CDS             complement(344797..345243)
                     /gene="aroQ"
                     /locus_tag="HWH41_01660"
                     /EC_number="4.2.1.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II 3-dehydroquinate dehydratase"
                     /protein_id="QOD45647.1"
                     /translation="MTRTVLVLNGPNLNLLGTREPQTYGRRTLGEIADECAAFAETRG
                     FAVDFRQTNQEGQLLDWIHQARGRVAGIVINPAAWTHTSVALRDALAAVELPVVEVHL
                     SNVHQREAFRHHSYVSPVALGVICGFGSLGYRLALEHFAERFEAAA"
     gene            complement(345360..346865)
                     /locus_tag="HWH41_01665"
     CDS             complement(345360..346865)
                     /locus_tag="HWH41_01665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="QOD45648.1"
                     /translation="MSDLAQNPPAVRTVLAGLMLSIFLSALDQTIVAVSLPAISADFA
                     DLDLLAWVISAYMVAMTVSMPIYGKLGDLYGRRRLMLFAIVVFTAASLLCGLAQSMGQ
                     LVLARVLQGVGAGGLMAVSQAIIGDIVPPRERGRYQGYFSSMYAIASVAGPVLGGLLT
                     EYLSWRWVFWINLPIGLLALAISRRTLVGLPVPRRQPVIDYLGIVLMVVGLTALLLAI
                     TQIGQGAAWSDPALLGLFALAALALLLFVAQERRFREPLVPMQLFAVRAATLSWLVAF
                     FASFQAISLTVLVPLRYQSVTGAGADSAALHLLPLVMGLPLGAYCCGRLTASLGRYKP
                     LILLGAVLLPCGIAGLALVPVGDHWLSGLCMLLTGIAIGTQFPTSLVAAQNAVEQRHI
                     GVATSNATLFRSLGGAVGVALMSAILLALLKHLRIGGGLDQGFSESALLSSLDAASGP
                     ARVILQHVLADAFKVLFLVNAAVALLGLAVASALPDMTLRGRGATQPAAGE"
     gene            complement(347040..348224)
                     /gene="pobA"
                     /locus_tag="HWH41_01670"
     CDS             complement(347040..348224)
                     /gene="pobA"
                     /locus_tag="HWH41_01670"
                     /EC_number="1.14.13.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate 3-monooxygenase"
                     /protein_id="QOD45649.1"
                     /translation="MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIR
                     AGVLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQ
                     TEVTRDLMEAREACGATTVYQAAEVRLHDLQGKRPYVTFERDGERLRLDCDYIAGCDG
                     FHGISRQSIPAERLKVFERVYPFGWLGLLADTPPVSHELIYANHPRGFALCSQRSATR
                     SRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEKLVTGPSLEKGIAPLRSFVVEPM
                     QHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGELLERYSAICLR
                     RIWKAERFSWWMTSVLHRFPDTDAFSQRIQQTELEYYLGSEAGLATIAENYVGLPYEE
                     IE"
     gene            348402..349268
                     /locus_tag="HWH41_01675"
     CDS             348402..349268
                     /locus_tag="HWH41_01675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="QOD45650.1"
                     /translation="MTDSTRDVPVFKLYGAPLEWPTPDLLHCESIPARSRLHDWEIKP
                     HRHADLAQLLYVRKGWAQLQVEGEPTRVEQPSIQFVPPLCIHGFQFSERIDGYVLTLA
                     APLLARLQAHLGAQRQALEAPGLYPVGADRRYIDTLFDAIDGEYAGTAPARELLLQSL
                     IGVLAVWLGRQVMVRRAEARPGRGQEYLSAFSQLVERHFREHLGIDEYARRLGISPAH
                     LNGVARRLSGQTALGIVHQRLLLEAKRDLVYTAMTVNEIADRLGFSEPAYFTRFFKRL
                     SGVSPSVFRKGD"
     gene            complement(349265..349711)
                     /locus_tag="HWH41_01680"
     CDS             complement(349265..349711)
                     /locus_tag="HWH41_01680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="QOD45651.1"
                     /translation="MSSPPKIRRYIPADRDATLAIWLEASRVGHGFLGEAELQKQKAL
                     VRDHYLDASETWLALDGDTPLGFIGLLDAFIGGLFVAPTAHGRGIGRQLVEHAATLKG
                     ALEVEVYAANREALGFYARCGFVESGRRPRDDEGRALEIVQLRREH"
     gene            complement(349789..350223)
                     /locus_tag="HWH41_01685"
     CDS             complement(349789..350223)
                     /locus_tag="HWH41_01685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CBS domain-containing protein"
                     /protein_id="QOD45652.1"
                     /translation="MKTVAQLLNAKQNQQVYTIGPDEMVLDALRLMAEKNIGALLVVN
                     HGEVVGVVSERDYARKMVLKGRSSIGTPISAIMSAPVVSVDSKQSVDTCMNLMTDRHL
                     RHLPVVEDGQLLGLLSIGDLVKAAIAEQAELIQQLEQYIRGD"
     gene            complement(350388..351029)
                     /locus_tag="HWH41_01690"
     CDS             complement(350388..351029)
                     /locus_tag="HWH41_01690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="suppressor of fused domain protein"
                     /protein_id="QOD45653.1"
                     /translation="MNDYIARLREKYDDHFGCAPSIVLDCRDFWRHCVTAPEMAVFGY
                     RLESSRRPHHVVITAGMSQARMHFAPYMGSARWSSELICYLDVLGGEDLRHLQWLAGL
                     PFHERLALGHGHSVAFGFPLYEHSLLRHFLLLPTPLGEDAALFDGFDLSAHPVDLLWV
                     VPLTEQEYQVKVNKHLEGIAEVLNDAGHPLSLDRHRHCYVTGQRPEGFERILH"
     gene            complement(351297..351563)
                     /locus_tag="HWH41_01695"
     CDS             complement(351297..351563)
                     /locus_tag="HWH41_01695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45654.1"
                     /translation="MGGLRKSIRPAMPRPPHTTLLLCLCLTLPGCESGRSYSFSEDAP
                     VTGIRIQRDDRSPLQRLRDCERQGCSERQKIDPFTPDPDFPLPW"
     gene            complement(351655..352131)
                     /locus_tag="HWH41_01700"
     CDS             complement(351655..352131)
                     /locus_tag="HWH41_01700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="QOD45655.1"
                     /translation="MTGPMTETNALGLPQGPLYLMTEIVRQRERQLTALLAPLELGLH
                     EWRALRIIHAFDGDVPMSVLIEHSQTDRTALGRTIERLVRRGWVSRLPDPNDGRAVLV
                     RRSPAAQAVFEQALAQVAGLDERLLAALGAGPEEEALTLALGKLLRAFDGLSRVTQ"
     gene            complement(352172..353662)
                     /locus_tag="HWH41_01705"
     CDS             complement(352172..353662)
                     /locus_tag="HWH41_01705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UbiD family decarboxylase"
                     /protein_id="QOD45656.1"
                     /translation="MNRSALDFRHFVDHLRRQGDLVDVHTEVDANLEIGAITRRVYER
                     RAPAPLFHNIRDSLPGARILGAPAGLRADRARAHSRLALHFGLPEHSGPRDIVATLRA
                     AMRAEPIAPRRLERGPVQENVWLGEQVDLTRFPVPLLHEQDGGRYFGTYGFHVVQTPD
                     GSWDSWSVGRLMLVDRNTLAGPTIPTQHIGIIREQWRRQGKPTPWAMALGAPPAALAA
                     AGMPLPEGVGEAGYVGALVGEPVEVVRTQTNGLWVPANAEIVLEGEISLDETALEGPM
                     GEYHGYSFPTGKPQPLFHVHALSFRDQPILPICVAGTPPEENHTIWGTMISAQLLDVA
                     QNAGLPVDMVWCSYEAATCWAVLSIDVQRLAALGTDAAAFAARVTETVFGSHAGHLVP
                     KLILVGNDIDVTEIDQVVWALATRAHPLHDHFAFPQIRDFPMVPYLDAEDKARGSGGR
                     LVINCLYPEQFAGQMRAATASFRHAYPTALRRRVEERWSDYGFADA"
     gene            353859..354281
                     /locus_tag="HWH41_01710"
     CDS             353859..354281
                     /locus_tag="HWH41_01710"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45657.1"
                     /translation="MEACDTAGIMDAITAVTGVLTLLVAWAALFSWRRQERQKAILAW
                     KADLVDYAYGFPNLPVIWGYQTHKDEIDQAAERFYRCVKSYMVMRELVSRKRMKAYER
                     IWRQAHFVHEKCTFEGQMTCAIARDLLSQAYLNDFLKS"
     gene            complement(354301..354987)
                     /locus_tag="HWH41_01715"
     CDS             complement(354301..354987)
                     /locus_tag="HWH41_01715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1275 domain-containing protein"
                     /protein_id="QOD51093.1"
                     /translation="MVGSSARRLRLRRTRGRVGLGLVAGLSVLAGMTDAIGFLATGDF
                     VSFMSGNTTRLAVSLGEGDFGGLVRLSVALASFVVGNALGVILARFSGRRAAPILVCC
                     AMLLAVSAVWPFDWNVPALVAAILAMGMLNAVVEQVNGLPIGLTYVTGALSRFGRGLG
                     RWLLGERRNGWRVQLVPWSGMCVGAVLGALLEQQLGLAAMAASAALAALLALLALVIP
                     RPWQMDYMVR"
     gene            complement(355151..356083)
                     /locus_tag="HWH41_01720"
     CDS             complement(355151..356083)
                     /locus_tag="HWH41_01720"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45658.1"
                     /translation="MRSWHGVVTKIAKQGKGAVVKNRLGPEELLVPFTVSTLVEVDLD
                     ARIYGTDVDDTPWAEGDERKEVLVGTEVELLTDTDTFPTHASQVLSANFRFALDIVKG
                     GLSGPVRKGAVLVIYHDFQQEIRRGDSGSAFAEAVVAYARNKLYKPAFAIKADTNYAQ
                     LVRDLGKVAAESGEQYFIDTILIATHGTAGQLWLGNPHGDSTADVMARRVQGKQFVEP
                     QAFGATLLELFGKELAIALYGCDFAGDEDGEAAALELRIAANARAVYAGKGTVYLNAS
                     KEGRSTVTCSKAMVVYRTDKIEVLGGNQVPVFDI"
     assembly_gap    356384..356393
                     /estimated_length=10
                     /gap_type="within scaffold"
                     /linkage_evidence="align genus"
     gene            complement(356405..357549)
                     /locus_tag="HWH41_01725"
                     /pseudo
     CDS             complement(356405..357549)
                     /locus_tag="HWH41_01725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013790629.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            complement(357591..359027)
                     /locus_tag="HWH41_01730"
     CDS             complement(357591..359027)
                     /locus_tag="HWH41_01730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248950.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2875 family protein"
                     /protein_id="QOD45659.1"
                     /translation="MSADAYHAPKTSPRLETLDVLSVGMSLDVFRQGQVWKALQEQNA
                     MQAEALHVGSILPMDPRKYPVTADDKDIASEKREADALELGLKNFLEKWPIPTVTVVR
                     GWNPNTPNLRFTPEETQGSLSAMVNDMRIPAGLHWHRIVNLQDGIICNDTPEGVLEAL
                     FRLFERNPDLPAVLIYANEGFNMALSLMAKGEKPIGVGTGPRQPGELTDTMVALIVGR
                     PERVDWLRQFAPYTKVNENRIDPEFRGWGWRKPPVEFRPTPFIPQPWTERALEQWDAL
                     PVLARLHRPVSVPLTRPDTGERLKREALTAQLAAAWKTASAGLRPAPARLFYDGGLNA
                     TPLAELTPALGAAQSSLDLLDSRESYDLTQRLGDTGAASPFVGIALATIASYLNGDSS
                     MVMPLRRKDQATLIGISSPTPGKKPAHDPFGVDLLPQTASGDGPPPSADPVAPASRLT
                     TRLPPGEDYALEEFLSSLKPSTDWQDDL"
     gene            complement(359177..361334)
                     /locus_tag="HWH41_01735"
                     /pseudo
     CDS             complement(359177..361334)
                     /locus_tag="HWH41_01735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248951.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3274 domain-containing protein"
     gene            complement(361331..361828)
                     /locus_tag="HWH41_01740"
     CDS             complement(361331..361828)
                     /locus_tag="HWH41_01740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45660.1"
                     /translation="MKCKTLLIACLFGLGSVQALAVSKLPPQIPVHAGSGRVTLDLRP
                     LLAETNDVEITRVSVCRRAGSHCQETLWRIELPPGWRAGEIEVFGDYPGSSVLLRRPE
                     RLQPDGSYNAFIHFNERSRRHRQTVSSIAVEFCLAGEPGNWMLLDEATCLARRNAEER
                     QGEKP"
     gene            complement(361832..362338)
                     /locus_tag="HWH41_01745"
                     /pseudo
     CDS             complement(361832..362338)
                     /locus_tag="HWH41_01745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248953.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system tip protein VgrG"
     gene            complement(362694..363977)
                     /locus_tag="HWH41_01750"
     CDS             complement(362694..363977)
                     /locus_tag="HWH41_01750"
                     /inference="COORDINATES: protein
                     motif:HMM:NF037349.1,HMM:NF037813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45661.1"
                     /translation="MKWRKYIPHAILLGIAIAVSFYALRYWGDSKLHRNYPMTELTKK
                     MQTHCVGRLLIDLPEGTEWEPTASGAHLDGYLALSVTTGVSEADYAILMEKRWAEIEA
                     EEKKSTRLAPRSANKRSPLKNSSVFIYNYVWVEGPDLNGVMRKEVFHEAEGYLWRDNT
                     LFTFGRTLNAAEDILRWLPRLYTRKNNEIPDRPGLCLNGAFVESYYDLNAPFESVSWG
                     FRLPKELGLVVRHAKVWEPEQPMLERYREGEDEFTGLLAKDLAKPGVVAGRKEYRARK
                     RNVGDLEGDERVVGGTEGRGNWKYFKTNIGGEWSFPGAGSPYPMPSVGIDLETTFKTA
                     TKPAELGDFPTHDEAPAYPTEAEFFELWDTILNSVRYRPGALTPPPPNSGPMASSVGS
                     PPVRPAPLMTYDRDDYVLEEFLTSLTPKENWLDDL"
     gene            complement(363974..365770)
                     /locus_tag="HWH41_01755"
     CDS             complement(363974..365770)
                     /locus_tag="HWH41_01755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003126179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="QOD45662.1"
                     /translation="MGPHGEEIEMSEPTRLVSTHIGTNGHTTARVTMSPTSNKVRAEI
                     TAPPDQAIPVVFVPGIMGSPLLTSNAEAGRLLGENNRWAWFPDDGVGWVAGFTAKRGY
                     RHLSPTERKLLLDPDTTRPVSSPEDADREVVSEHITTLPLQEALSRGWGSVMISSYGG
                     ILNFLEAQLRFIITSKGEVYPGVQGAVPHNPEVWGQLNGYQVLTKEMLREAAEFRYPV
                     YAVGYNWLQTNGKAADYLAGKIEAIIDRCRKELRVKCDHGVILVTHSMGGLVGRMCAK
                     RYPALIQGVVHGVQPAVGAGTAYRRVRAGWEDFAGSIGLGGTGKKIMPVFANAAGPLE
                     LLPNHRYGAGWLRITCEGRVVAQLPEARVGQADPYMQIYMEPRAWWRLVDPLWIDPAV
                     NKIKGPAALQALQKAWGRYGMRLGEAKHFHTELGSSYHPNTYSHYGADEGEMAFHRVT
                     WNLQPQMIAAYRKDLPATRGPVPSTVHAIGLRMWRDDHEGTAYLVNDADGQDMVMQHG
                     VGVMRSTKGNSYVGKIQGQDQVGDATVPAHSSEDSAKAAVFSARMTGFDHQASYDNRM
                     VQNVTLYSVLCIGALAIRKEAGKSTTTTEIPA"
     assembly_gap    366096..366106
                     /estimated_length=11
                     /gap_type="within scaffold"
                     /linkage_evidence="align genus"
     gene            complement(367466..367711)
                     /locus_tag="HWH41_01760"
     CDS             complement(367466..367711)
                     /locus_tag="HWH41_01760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003288364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB/MazE/SpoVT family DNA-binding
                     domain-containing protein"
                     /protein_id="QOD45663.1"
                     /translation="MKHHVVIEDWEGDGAIRLPHDVLQEMGVDVGSTLYLLEEYVGTT
                     RCLVLSKTPRIPDRVDELVGHWESFGKIASDLGSKDG"
     gene            368049..368519
                     /locus_tag="HWH41_01765"
     CDS             368049..368519
                     /locus_tag="HWH41_01765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005887764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2384 domain-containing protein"
                     /protein_id="QOD45664.1"
                     /translation="MVSADTRTRKAAPAARRPTEYLFQSDSDQLSPVMVYRLTVKGFN
                     LKDVQDMLAISDLYSTKKIMSRIVGKSIRTIQRQGSKQPAHLNSQQSAVAFQYAKVLE
                     HAINVFGTQKLAEEWLGRPCKYLDGDVPLDVIDNPVGFQAVEDYLERIEYGVYQ"
     gene            368516..369007
                     /locus_tag="HWH41_01770"
     CDS             368516..369007
                     /locus_tag="HWH41_01770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017676524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RES domain-containing protein"
                     /protein_id="QOD45665.1"
                     /translation="MNPLPWSGSWYAWRLDRELYKDTWDSGIGAHKLGGRWNVPGRNV
                     VYASADPSTAILEVAAHVGFDALDTVAHVLTCFEVLDQSLIKVVQPEDVPNPIWLTSA
                     SASPNQQKFADALLAEHPFVLIPSAVTRHSWNLLVSRELAEGRYRMISQERFGLDTRL
                     VKV"
     gene            369603..371096
                     /locus_tag="HWH41_01775"
                     /pseudo
     CDS             369603..371096
                     /locus_tag="HWH41_01775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003288360.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
     assembly_gap    371167..371177
                     /estimated_length=11
                     /gap_type="within scaffold"
                     /linkage_evidence="align genus"
     gene            complement(371260..371848)
                     /locus_tag="HWH41_01780"
                     /pseudo
     CDS             complement(371260..371848)
                     /locus_tag="HWH41_01780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011005941.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus and C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(371977..372498)
                     /locus_tag="HWH41_01785"
     CDS             complement(371977..372498)
                     /locus_tag="HWH41_01785"
                     /EC_number="3.4.23.36"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008930575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein signal peptidase"
                     /protein_id="QOD45666.1"
                     /translation="MSTYGSRLAEKAHEPGKAMRWLWLSLLLLFVDQASKYLASTMLA
                     HGESVPAAPFFNWVHRHNTGAAFSFLADVGGWQQPLFIGLALVISILLVYWLWRSPRV
                     LSYRLALSAILGGALGNVADRLRLGYVEDFLDFHYAQWHWPSFNLADVWIFLGVALFI
                     WAEIRHQPGSRRR"
     gene            complement(372552..373991)
                     /gene="lnt"
                     /locus_tag="HWH41_01790"
     CDS             complement(372552..373991)
                     /gene="lnt"
                     /locus_tag="HWH41_01790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009686176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="QOD45667.1"
                     /translation="MPLAFAPVGWAWLAVIALATFFVLTAQSSRRQALWSAYLFGLGY
                     FGAGVSWVFISISQYGNGPVVAVLVTAAFVSLLALFPWGVAYLVRCLRPEMDAMALWL
                     GLPAAWVLSEWMRTWFLTGFPWLFIGYSQTDTTLATIAPVFGVLGVSLLVALLAGGLA
                     WVVQGPSLRRAAVVGAVLVATLAGLQLLDREWTQPAADPIDVVLLQGNIAQDKKWDPR
                     YRDITLERYQALTAQHLGADIVIWPEAAIPMWHDQAKAYLAELEALADQAGTSLMIGV
                     PVREAEGRTYNAVVSLSDPSGFYYKRHLVPFGEYVPFRDLLGSALDVLGAPMSDFTPG
                     REAHVLNAAGVPVGALICYEAVFGAEVTELLPEAQLLVNVSNDAWFGSSLGPLQHFQM
                     ARMRAIETGRDLLRATNTGITAAINHEGKVLKRAPQFEVATLSAEVTPRTGAPPYVRW
                     RDWPVLGLTALGLGLLLLRRIRRHHRLGT"
     gene            complement(374286..375044)
                     /locus_tag="HWH41_01795"
     CDS             complement(374286..375044)
                     /locus_tag="HWH41_01795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008928738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ZIP family metal transporter"
                     /protein_id="QOD51094.1"
                     /translation="MDSIWLVLGLALLPALGNFSGGLAAEASRTTGRRLNYALHGAAG
                     LVIAVVAVEIMPRVLENLSAWVIALAFALGGIAYVGIEKLVESLQKRQGQQGEGGQTS
                     VWMIYIAVSIDLFSDGLLIGAGSAVSPSVAIILAAGQVLADVPEGFATIATMKDKGIP
                     RSKRILLSASFAIPVLSAAVFAYFVLRNQPEAFKLAALTFTAGLLTVAAIEDMVSEAH
                     ESGDDTHISPLAFIGGFVLFVLVSAGLEGVVSQS"
     gene            complement(375190..376086)
                     /locus_tag="HWH41_01800"
     CDS             complement(375190..376086)
                     /locus_tag="HWH41_01800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014702287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="QOD45668.1"
                     /translation="MSKACGGPCSCDATPAADTDMPVSSKASGEWVSVYAVPKMDCPS
                     EERMIRLALNGFDEIRTLSFDLSNRRLEVVHDGEAEPITAKLATLGLGASLQETVIAD
                     PETIKAAESSAVSATQESGTLRVLLGINAIMFVVEMTAGLIAQSTGLIADSLDMFADA
                     AVYGLALYAVGRSAKMQVRAAHLAGVLQLILAIGVLVEVVRRFVFGSEPESLMMMAIA
                     FVALIANTGCLLLISKHREGGAHMKASWIFSANDVVINMGVIAAGALVAWTGSSYPDL
                     IIGTIVGLIVLNGARRILALKG"
     gene            376185..376619
                     /gene="cadR"
                     /locus_tag="HWH41_01805"
     CDS             376185..376619
                     /gene="cadR"
                     /locus_tag="HWH41_01805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014595526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cd(II)/Pb(II)-responsive transcriptional
                     regulator"
                     /protein_id="QOD45669.1"
                     /translation="MRIGQLAQIAGIDTQTIRFYEQQGLLPPPERQENGYRVYTEKHG
                     EWLAFIRRCRILDLSLTEIRELQSYQDDPRQPCTAVNAMLDDHISHVRSQITALQALE
                     QQLVSLRASCNEGREINACGILTGISEESKQQLYRASSGRKD"
     gene            complement(376949..377707)
                     /locus_tag="HWH41_01810"
     CDS             complement(376949..377707)
                     /locus_tag="HWH41_01810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008606280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M48 family metallopeptidase"
                     /protein_id="QOD51095.1"
                     /translation="MSAPPAPAVLSWLSFHYADELIQVERARRARDVSRILIKVDPDC
                     RVRVSAPDGASDEQVLAALKRRSRWIYEQLREFRAQLTHVRPRQYISGESHYYLGKQY
                     VLKVIEAPDELQQVRLLRGKLEVSVRVKSADKIRELLYAWYKARAREVFDRRLDAVLQ
                     QALWVAAKPPLRILSMQTQWGSCSPAGRITLNPHLVKASRECIDYVILHELCHIAEHN
                     HSERFYRLMQQVMPQWEKTKKRLDGMAAALLNGG"
     gene            complement(377722..380997)
                     /locus_tag="HWH41_01815"
     CDS             complement(377722..380997)
                     /locus_tag="HWH41_01815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003291342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction endonuclease subunit R"
                     /protein_id="QOD45670.1"
                     /translation="MTPTPKFQEEYSAKLPALALLCNLGWEFMSPEHALAARAGKSDE
                     VVLRDVLREQLSKRRFLFGGGEYPLSAKAIDNLISEVCSPALNEGLMAANERLYNHLL
                     YGISVTEFVDGKKASPTVALIDWHNPANNSFIFTEEFRVLRSGGVEARRPDIVCFVNG
                     IPLVVIEAKRPDGNAQKGPTIDEGVSQSLRNQRHDEIPKLFAYSQLLLSINGSDGRYA
                     TCGTPAKFWAAWREEDISTSELYTLKNRQLTGVQKAAIFSHRPAADLHWYENLIAGGE
                     LALTGQDQLLISLLSPARLLEMTRFFTLFDKKAGKIVARYQQVFGIKRLIERINQKRK
                     DGGREGGVIWHTTGSGKSFTMVFLSKALILHDSLKQCRIVVVTDRVDLESQLSKTFAS
                     GGELAGKKDREAAMATSGTRLAEQIGKGNERIIFSLIQKFNSATKLPQCVNTSADIIV
                     LIDEGHRSQGGENHIRMKQALPNAAFVAFTGTPLLKDDKTTNKFGPIVHAYTMQRAVE
                     DQAVTPLLYEERIPDLDVNARAIDSWFERITEGLNEQQKADLKRKFAKKGQIYSADDR
                     IRLIALDIANHFVKNIDEGLKGQLACDSKASAIKYKQYLDEAGLFESAVVMSPPDSRE
                     GNTDVDEAASPEVTQWWKKNVGSTDEQTYTKQLIERFDKDDSLKLLIVVDKLLTGFDE
                     PKNTVLYIDKPLKEHNLIQAIARVNRLHPLKKFGLLIDYRGILSELDTTIQKYQDLAS
                     RTQGGYDINDIAGLYNQMSSEYKRLPQLHKNLWAIFSDVKNKGDIEQLRQVLVPRMQE
                     RDGELVDVNLKVRDDFYEALTEFATCLKVALQSASFFEDTSFSDADRAHYKETLKQFS
                     SLRQLAKQDAGETVNYDQYAEQVRKLLDKHVVGVEVKDPVGVYEVGKMGQQKPEQWSE
                     EKTRNETDIIKTRVSKMIEQELRDDPYAQEAFSKLLRQAIEEAAKLFDHPLKQYLLFH
                     EFEQKVQARKLDELPDAFAGNRHAQAYFGIFKKSLPEALISADEHAQEHWVKLAFSLD
                     EMVTTSVAEHSINPQNIESDIRKKLLPLLFKECKAVGAGMDQAKAMVEWVVQITRVGL
                     SGL"
     gene            complement(380994..382493)
                     /locus_tag="HWH41_01820"
     CDS             complement(380994..382493)
                     /locus_tag="HWH41_01820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003291343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VWA domain-containing protein"
                     /protein_id="QOD45671.1"
                     /translation="MPLDLLASAAKDVSDNAQRIFASLLRDSDSIAGHIAERIRLWQL
                     ASAEELKAEFPFALYEQQLSNWQTRNQSPPISSAELAAAVAEYVALCRVAKLPDNQSF
                     WQRELAAVTASPTVNKKRKADSTVSARLLRDEWQKALDKARVEWELERISMLRRQFME
                     ELEVFLQLLQQLQQQLEILGLDPGILLDLSKGNFSAQEIERFKRWANYLANDPGVRSL
                     CDLLGKLRQLELSERIERAQVRYSQDIELPDINSREEIIGIRLGRDIEHMLPSELALL
                     ADPETSILFDLKYVESRLMCFDMQGIQRVQQHHQKEELRSVEEAAKQGPMVICVDTSG
                     SMSGMPETVAKAVALFIAGKARQQKRACYLINFSTGIETLDLGDDFGMEALIKFLGMS
                     FHGGTDAIPALDHALGVMKSEAYERADLLMISDFIMASLPEHLRQQIEQQRTHGNRFY
                     SLVVGDCFMTQRLTSLFDHEWVYDPHSSQIHELIGFQRKLDGRPENHSA"
     gene            complement(382484..384019)
                     /locus_tag="HWH41_01825"
     CDS             complement(382484..384019)
                     /locus_tag="HWH41_01825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003084152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="QOD45672.1"
                     /translation="MGLQKRIGDLVASVSAGMFEREEIIAVSLLGALCGQNTFLYGPP
                     GTAKSLISRRIACAFEQPTYFEYLMNRFSTPEEVFGPVSIKALKEDRYIRKTDSYLPK
                     ADFAFLDEIWKSSPAILNTLLTLINEHVFRNGEAIEKAPLKALIAASNETPDANQGLE
                     ALYDRFIVRLMVEPIREAQHFDQLLNSKPTEAKIDIPSAQQVKSSEWDEWMTQLHQVK
                     LSAETLTIIHLIREQLGQQYETLKVYVSDRRWQRAAMLMKAAAFFNDRKETNHSDALL
                     LQHCLWTHEENRQAVWDIVAEAVKACGFDSGIDLAALDKEKDALDKEIKKELFHSADI
                     YKTVKLSNKDFFQCKGTFKPKNSYYSNYEKAFEIFIAKDRLKTKDEFHPLDNKGNEQK
                     SVKCKFDGQGTCQIILSNGHVDYLSIKFTPEVLFHKGDRKEDINIRLITSLSSSVSEI
                     REKLSFTLKKVEKKFKAYETKLSSPFVPADKISLAISGIALQIEGLQLRIKDCERLEE
                     LCR"
     gene            complement(384102..385196)
                     /locus_tag="HWH41_01830"
     CDS             complement(384102..385196)
                     /locus_tag="HWH41_01830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003291345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PD-(D/E)XK nuclease family protein"
                     /protein_id="QOD45673.1"
                     /translation="MDLEQLRALLAKAERFYQPEREPSIFALGGRGYYENPTTDLLAF
                     FLNPAQVHGLEECFLTALLNCLPNTSMLTPSLRAAPQREVVTHNSNRIDLVLPGDGWD
                     LLLENKIFHGQVNPFADYEAFAQRKLNDGERPLVYAVLSPSGKSVRVAWHGLSYAKFI
                     DAARQQLAQRMLTHPVDKWQVFARDFLLHLENITVEKAMDAKAVNFVIEHLHQINKLT
                     RLKDQVIDALDAKVLDKLDAEVPGYARYTRRHNWKNGPALRYASDNWKTWSDVVLYLS
                     GANSTMKPSVRVYLCDVDETLQEQGRKLFTGNETKVWSEGKNNSILGFSWVLDHFDEE
                     EVLGLIVEKMKLLMTFENGIRAQVGQHTEA"
     gene            complement(385233..386246)
                     /locus_tag="HWH41_01835"
     CDS             complement(385233..386246)
                     /locus_tag="HWH41_01835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003084155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virulence RhuM family protein"
                     /protein_id="QOD45674.1"
                     /translation="MDANDLILYTSDDGEAQLVLRVLDGQVWLTQLEMAELYQTSKQN
                     ISLHVQNVLAEGELTEEATVKENLTVQAEGSRQVRRNLAYYALPMIIAVGYRVRSTRG
                     TQFRQWATRTLGEYLQKGFVMDDARLKEPRWDYFDELLKRIRDIRASEKRFYQKVRDL
                     FTLAEDYRANEQDTARLFAEVQNKLFFAVTGHTAAELIVQRADASAPNMNLLSFKGDR
                     VRKADVVVAKNYLNAEELDQLNRLVGMFLDFAELRAEQRKHLMLADWRQYIDSFMAFN
                     EQPLLRTAGSISHEQMKQVAHERYETFDQHRRSAEALAADAQELAELERLEKRLSAKK
                     KSK"
     gene            complement(386248..387480)
                     /locus_tag="HWH41_01840"
     CDS             complement(386248..387480)
                     /locus_tag="HWH41_01840"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45675.1"
                     /translation="MKDRTINFRLTDCAGHVTNFLSLRSFLTFCEAEASFWKERKQIV
                     QTDRNSANHTHLNAGDVFTRAADTIQGWKDNIEVWSDDDLSRQLQQLQQSYFQRLQRD
                     WLWRGHPFVEPFVQCLKEHGDNTANAFLDFSIRKSVQNISNIEHFKGYMYAYEFANQD
                     SQIVKRRHGEKLSLGHLRTQFADAQDKLFTEFGELKSEITDWDTQNRASSSRLAKVQK
                     ALGRRKIKSQSNAFERQLAEWTEKVTTLESTYEEKLKLKKPAEYWAKSARKYGIQGGL
                     WTLAIVALVIVAAINFQEIFVTWLQGRETPVQLNTIQGVILFGSLAGVYAFLLRVLSR
                     LAFSSFHLMRDAEEREQLTYLYLSLTNEAEIDKESRDIVLQALFSRSETGLLAQEHGP
                     TMPGASEMLRSTLRGRGQ"
     gene            complement(387477..388718)
                     /locus_tag="HWH41_01845"
     CDS             complement(387477..388718)
                     /locus_tag="HWH41_01845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001752617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease subunit S"
                     /protein_id="QOD45676.1"
                     /translation="MVRSAQESNIPTDWKYDLLDNFTVRGSGHTPNKEKSNYWNGGIK
                     WVSLADSFNLDKGLIFNTDKEISEEGIQNSSAVLHPAGTVILSRDAGVGKSAILASPM
                     AVSQHFIAWRCDNSQKMNSWFLYNWLQMMKPEFERQAVGSTIKTIGLPYFKKLKIAVP
                     PHHEQEKIAKILSTWDQAIATAEQLLENSLQQKKALMQQLLGSHESAEEDGEQDFKRI
                     SEIAERIQRKSDGGDHPVLTISSLSGFVRQDEKYNRFMAGKSVESYILLKRGEFAYNK
                     GNSKTYEFGCIFDLDSFDAGLVPHVYVCFKLKPGLSHRYFKYLFEADYLKPQLGQLVN
                     TGVRNNGLLNIKPSEFMNTKVPVPSLEEQERIADILHVASKQVIALEQKLACLKQEKK
                     ALMQQLLTGKRRVTVDAKGAM"
     gene            complement(388708..390231)
                     /locus_tag="HWH41_01850"
     CDS             complement(388708..390231)
                     /locus_tag="HWH41_01850"
                     /EC_number="2.1.1.72"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005330990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system subunit
                     M"
                     /protein_id="QOD45677.1"
                     /translation="MSDKVNQDDINKALWAACDTFRGTISADTYKDFILTMLFLKYIS
                     DVWQDHYDSYRMEYGDEPELIEEMLKNERFVLPRNANFYALYDRRYEPGNGERIDQAL
                     HAIEEANGTKLKDAGKSVFQDISFNTDKLGEEKQKNTILRHLLEDFAREELDLKPSRV
                     GSLDVIGNAYEYLIKNFAASGGQKAGEFYTPPEVSELIAELLDPQPGDSICDPACGSA
                     SLLMKCGRKVREHHNSKQYALYGQEAIGSTWSLAKMNMFLHGEDNHKIEWGDTLRNPK
                     LLDTNGQLLKFDIVTANPPFSLDKWGHDEAEHDQFGRFKRGIPPKTKGDFAFILHMVE
                     TLKAKTGRMAVIVPHGVLFRGSSEGKIRQQLIEENLLDAVIGLPEKLFYGTGIPAAIL
                     VFSKAKTDETVLFIDASRDFKSGKNQNVLGDEQIKNILVTYRHRINSDKYSHRASLQE
                     IRDNDYNLNIPRYVDTFEEEETVDLLLVRKEREKLKAKLAELEVQMDVYLKELGYGA"
     gene            complement(390235..390807)
                     /locus_tag="HWH41_01855"
     CDS             complement(390235..390807)
                     /locus_tag="HWH41_01855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003291351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease subunit S"
                     /protein_id="QOD51096.1"
                     /translation="MPNPSFKLSDVADVRSGYTFRGALEHDPAGDIRVLQIKDLRQSS
                     AIEPDTLTAISWDARTSPPLLQSGDIAVIARGDNNKAALFTGQQPVVATSQFFIVSTK
                     KQDVLPEYLCWLINLPQSQRSLERSGSAIQAISKASLLDMRIPLPPLATQQKLIALQA
                     LWDEEDELIARLQTNREQMLQGIYQHLIKD"
     gene            complement(390851..391132)
                     /locus_tag="HWH41_01860"
     CDS             complement(390851..391132)
                     /locus_tag="HWH41_01860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003084165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45678.1"
                     /translation="MKLYQIAYDLRKQRNYQALYDRIKAYGTWCRPLESTWIVATSQS
                     ATQVRDNLKAAMDADDGLLVTRLQGDAAWFGLDAEKTQWLQNQYQRCEA"
     gene            391555..391737
                     /locus_tag="HWH41_01865"
     CDS             391555..391737
                     /locus_tag="HWH41_01865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003291353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45679.1"
                     /translation="MRWFFVVMLCGGAGLLLSTQYQVPQWLLWLLLALGTTIWGLAKW
                     MERQEAKTERSHDRAH"
     gene            391896..392159
                     /locus_tag="HWH41_01870"
     CDS             391896..392159
                     /locus_tag="HWH41_01870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003084177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45680.1"
                     /translation="MTLPYERTRAIVKTEEFLRELSRHTGLPQDIRSYAKSLLRHYPS
                     AAQVFSLGRLEECLVNEALEVEYRQRVIAFHQPLLCSSLDSTE"
     gene            392162..392764
                     /locus_tag="HWH41_01875"
     CDS             392162..392764
                     /locus_tag="HWH41_01875"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003291354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV toxin-antitoxin system AbiEi family
                     antitoxin domain-containing protein"
                     /protein_id="QOD45681.1"
                     /translation="MPRSHSEQSVSHLVTQRVKRLRRGRPFSIRCLAELGSSSAISKA
                     VAQLVLRGELVRVYRGIYMRPKTSQYTGRVSRPGPWDLLSVIARQSRWKLQIHGADAV
                     RRFGLSTQMPVMPIFYTSGPSRSLSIEKAEIRLVHAAPMVMQCSGTRVGMAISALYYL
                     GKDGATQECIDAIKAALHPGELATLLDCNMPKWMRVALAE"
     gene            complement(392886..393434)
                     /locus_tag="HWH41_01880"
     CDS             complement(392886..393434)
                     /locus_tag="HWH41_01880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003291355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45682.1"
                     /translation="MGDWKACIGKMSDREIARRFGLGASSVRRYRHSIGIPEFHPEDI
                     ELPAELIEQLATRTNYQLAKEFGVSIKHIKRKRDELRIQEPKTARTRFKPLEDIWTNE
                     AIAMLGQMPDTEVADRLDISNFPVKKKRHELGIQAYKRPLPEITPEIASAFGVVSDAE
                     LARQLGVSVNYIRKARIKASQQ"
     gene            393841..394308
                     /locus_tag="HWH41_01885"
     CDS             393841..394308
                     /locus_tag="HWH41_01885"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45683.1"
                     /translation="MLTIKLRDIQGVHPEFSRIERDLDLAPVGVPDQALIPRAMALRI
                     NMLYPLVISRPDALCIGQTTLYRWLKTYMDPETPVQCIEWSRGRIKDCAYQLVLIERL
                     VAPALAQITPQQVRDLYAHIESAAEQWPHEYRSHAHLSRLVGVKPLKGCGGEK"
     gene            395760..396752
                     /locus_tag="HWH41_01890"
     CDS             395760..396752
                     /locus_tag="HWH41_01890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012703421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="QOD51098.1"
                     /translation="MGGGDRRYTRAKLRSYLFHQIVADTQDVAAASMLSGVEIPSAQT
                     PRYYLQLDACHLRKIYTTSLVRVLTQVYACAGLAYEYVDLNPDQQGGVGATHCLLPAT
                     IASNISAMARVLRRKANGRLSEMVAWHNCFTLWTVQMFMLVTSCRAIRNPLMLIDEFD
                     SVLGMGALSDKDSDDRHMSRLICMPPMLRRQITSYFAHCASISRQLIGYLPQDEEDHQ
                     WSRGFFLQISQAGVRRAEITPGNIYDQMGLVSGYTTHRVNAHRKFIRTELTERGCPSE
                     ALAAFMGHWLRGEEPQDAYSTFCPAVYAKVLDEWITPLLRELGWSALSSQWVTE"
     gene            396821..399880
                     /locus_tag="HWH41_01895"
     CDS             396821..399880
                     /locus_tag="HWH41_01895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003292746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD51097.1"
                     /translation="MPEMRALLKSIAEKSGTAFGKWLLGECAISGISTTHVRELEAQL
                     GTNHTLRNVLRSITQRVRDQIPGFPLARIAIAVRRAANPINPDVYTAERIQRSCQLIH
                     ALQQGLKLDIDALSTDERIGLLLMSAAYNGGLLDVAQLNAMLSTTPDSIDWVAGIPEI
                     RLPLSIRGNAVAEFRQWFPDPATLALLIRCVDDVQKSTGKLKRRNWHMRCVCAFLKKV
                     EVPEQYHPENPSDLFDFLRMQMQLRLPQVLVNFACRKGFVSQSLRPSSWGNILGLDDL
                     EDPAGTYDDESVSDVTEDNPDPPAWLEELRDRIRDNLPIESPLQAESHGELPGLIQGW
                     LAYMLGGASAYGHSIGRSTIKRYTQVLGAALSSRLDGISIFELEIDALELVYESALDA
                     QATDSKRRTLANAVQEFHTFLQRRYNYPTISPYSILGIGKGVTRVDARIISEEQYKLV
                     MQALGTCGLELRTPRLVTAARLLLILGFRLGLRRNEALKLRLRDLHLPEFSAAECAHI
                     QARQSHMRRLSKDEQARIELPVDLLIRPHAQRGLKTQNAVRSLPLRELLEPDELTLLI
                     DWYRERQQEESQNSTSEFLFCIPQLRTQWVSESCLFPALHDCMRAVTGSEFLHYHHLR
                     HSCATWFLLKLMGAQNALSPELIFKDLPLTTRWLRGDLRLRKAMLPVEGPTRRIVHIV
                     SAILGHGSPKTTLLHYVHSLPQIMAMMWQWNPQNWIFNAANVATIAEVSQPTMSTEPR
                     EGISAECGVLLNIIGRIRPLKERKRARKKASRGQAEQVAQNWAIGRILAIESMLAYAS
                     YAEQTGRAVNLDWVEFSAEAREMMLERARCIRDMQQRPGASSASPKHRLQPALYAEGS
                     SYLSLLPSPPKHGGREAVAEYAQRLYDLLEGPDSERAQRVIDDFVERCWTTETTLRFQ
                     RDRDEEHAQDYLWLLTAIGIHARSIELIVYDISKPKAAKSYWRQQFGNTRRPFSQHAP
                     ENSDVANPHLGIRAKLELKGEAKQNHHSGAALRYLMLMASIDWHFRA"
     gene            complement(399898..400110)
                     /locus_tag="HWH41_01900"
     CDS             complement(399898..400110)
                     /locus_tag="HWH41_01900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005366791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QOD45684.1"
                     /translation="MVKCHLSRLLGERKLKISDVVRDTGINRGTLTRLYHETAQRVEL
                     KDLETICQYLNCEVGELLELQDDPEG"
     gene            400259..400492
                     /locus_tag="HWH41_01905"
     CDS             400259..400492
                     /locus_tag="HWH41_01905"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003302571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45685.1"
                     /translation="MSHTYLTTEELATRMKYDVRTIRNRLKDSVLLEGIHYFRPFGGR
                     KILFIWEAIEKDMQKHSRTSSLIPMAGGGICHG"
     gene            400485..401645
                     /locus_tag="HWH41_01910"
     CDS             400485..401645
                     /locus_tag="HWH41_01910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003282465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="QOD45686.1"
                     /translation="MGKIRARADNEKLFFDFTYLDKRCREQTTLPDTPANRKKLEKIL
                     ERIEAEITLGSFDYATYFPQSSKVQEFARLRAGCAILKTPPFRDFAERWFDEKRVEWR
                     DTHTTTVRQTLDKYLLPTFGRQEVSAITKAEILSFRSALGKVPGLKGQALSATRINHI
                     MTPLRMILSEAADRFEFTSPYLNIKSLKVPKTDVEPFTLDEVLQILGAVREDFRNYYT
                     VRFFTGMRTGEVDGLQWKFVDFQRRQILIRETWVGGRLDYTKNDGSQREIDMSGPVYK
                     ALLDQQKKTGSGQFVFCSREGTPFSYRNINNRVWFPLLRHLGLRQRRPYQTRHTAATL
                     WLAAGENPEWIARQMGHTTTEMLFRVYSRYVPNLTRRDGSAFDNLIQANLKD"
     gene            401657..401941
                     /locus_tag="HWH41_01915"
     CDS             401657..401941
                     /locus_tag="HWH41_01915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003294188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45687.1"
                     /translation="MKLINRSNVTYLHPAMEAREHQYLKHLASAMSHYLESPNGNELV
                     CILGSGYEKNNRQALDTWVAYHRNEVFEKRLEGRSPLDFLIEKLESMLNN"
     gene            complement(402234..402310)
                     /locus_tag="HWH41_01920"
     tRNA            complement(402234..402310)
                     /locus_tag="HWH41_01920"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(402274..402276),aa:Arg,seq:ccg)
     gene            403043..404494
                     /gene="gabD"
                     /locus_tag="HWH41_01925"
     CDS             403043..404494
                     /gene="gabD"
                     /locus_tag="HWH41_01925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent succinate-semialdehyde
                     dehydrogenase"
                     /protein_id="QOD45688.1"
                     /translation="MQLKDAKLFRQQAYVDGAWVDADNGQTIKVNNPATGEIIGSVPK
                     MGAAETRRAIEAADKALPAWRALTAKERANKLRRWFDLMIENQDDLARLMTIEQGKPL
                     AEAKGEIAYAASFLEWFGEEAKRIYGDTIPGHQPDKRIIVIKQPIGVTAAITPWNFPS
                     AMITRKAGPALAAGCTMVLKPASQTPYSALALAELAERAGIPKGVFSVVTGSAGEVGG
                     ELTSNPIVRKLTFTGSTEIGRQLMAECAQDIKKVSLELGGNAPFIVFDDADLDAAVEG
                     ALISKYRNNGQTCVCANRLYVQDGVYDAFVDKLKAAVAKLNIGNGLEAGVTTGPLIDA
                     KAVAKVEEHIADAVSKGAKVVSGGKPHALGGTFFEPTILVDVPKNALVSKDETFGPLA
                     PVFRFKDEAEVIAMSNDTEFGLASYFYARDLARVFRVAEQLEYGMVGINTGLISNEVA
                     PFGGIKASGLGREGSKYGIEDYLEIKYLCLGGI"
     gene            404739..406019
                     /gene="gabT"
                     /locus_tag="HWH41_01930"
     CDS             404739..406019
                     /gene="gabT"
                     /locus_tag="HWH41_01930"
                     /EC_number="2.6.1.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-aminobutyrate--2-oxoglutarate transaminase"
                     /protein_id="QOD45689.1"
                     /translation="MSKTNESLLKRRQAAVPRGVGQIHPVVAERAENSTVWDVEGREY
                     IDFAGGIAVLNTGHLHPKVIAAVQEQLGKLSHTCFQVLAYEPYIELAEEIAKRVPGDF
                     PKKTLLVTSGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGM
                     GLMPGGIFRALAPCELHGVSEDDSIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVN
                     SKSFMQRLRALCDQHGILLIADEVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGFP
                     ISGVAGKAEIMDAIAPGGLGGTYAGSPIACAAALAVLKVFEEEKLLERSQALGERLKA
                     GLREIQAKHKVIGDVRGLGSMVAIELFEGGDTHKPAAELVSKIVVRAREKGLILLSCG
                     TYYNVIRFLMPVTIPDAQLEKGLAILAECFDELA"
     gene            406345..407544
                     /locus_tag="HWH41_01935"
     CDS             406345..407544
                     /locus_tag="HWH41_01935"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HDOD domain-containing protein"
                     /protein_id="QOD45690.1"
                     /translation="MSAAKKAPVILIADPDPWSRDLLGQLVLGVRCDARLVLCGDGGE
                     ALAHCRRRRFALILAELNLPQVDGFELLREARLRRSVAEQPFILISDRADQASVRAAV
                     ALAPTAYLVKPFQAENLMQRLRGLLLKGDEVVACPLPERDAGENLEAFLERARDSAEG
                     APLLADVRAASDRCLSAEEHPLRVLEDEFGRDPQITAGLIAAANSAARHVGPACQTLG
                     QALRRLGLGHSLNLVLGFSLQRAIQLGEPLLAERAMHFWDLSQRCADIAWELADALGA
                     DVERCYTAGLLHRLGDLALLRTLQDWCDGGGALDEARLDELLGRFGASFGSALRARWR
                     LPLELRRLIAAAYQFGGVLSREELILSLATQAASLPEDDAEQLAESKAARMLGLDGER
                     LAKLLQP"
     gene            complement(407715..409136)
                     /locus_tag="HWH41_01940"
     CDS             complement(407715..409136)
                     /locus_tag="HWH41_01940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PLP-dependent aminotransferase family protein"
                     /protein_id="QOD45691.1"
                     /translation="MELQLILDGRHDLVGQLYRQLRDAILHGRLATGDRLPATRYLAE
                     RLEVSRKTVSEAYERLTSEGFLEGRVGSGTFVARGPAGEAPPQRADGPLRPAARWARI
                     EPQSGLMDQRAPLRYSFAGGTTDKRRFPFDTWRTCVLQALRLQQRSPAFYKETEGDPE
                     LRLAISRYLAINRAVQCDWNALMVTQGAQQGLDLLARVMLDPGDLAVVEEPGYPPARA
                     SLLATGAEVRGVPVDAEGLRVDLLPDNAKLVYVTPSHQFPLGMPMSLERRLQLLDWAQ
                     RHRALIIEDDYDSEYRFDGRSLESLRSLDRNGQVAYLGTFSKTLFPELRLGYLLPPAS
                     LREAVLAARKLVDRHSETLQQRALALFIQRGDFARHTRRLQREYAQRRGRLLERLHGD
                     LSPWLEALPAVAGIHFAARCREPLDVLRIARHLRQQGLEVGTLPPFYAETPAQAGFLF
                     GFGCIERDDIDPALDLLRAELRR"
     gene            409263..409700
                     /locus_tag="HWH41_01945"
     CDS             409263..409700
                     /locus_tag="HWH41_01945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxymuconolactone decarboxylase family
                     protein"
                     /protein_id="QOD45692.1"
                     /translation="MTTRLEWAKASPDAYNAMLGLEKALAKAGLERPLIELVYLRTSQ
                     INGCAYCVNMHANDARKAGETEQRLQALCVWQETPYFTPRERVALAWTEQLARLSQGA
                     LPHGLLDELREHFDDKEIAELTLAVSAINAWNRFGVGMGMQPE"
     gene            409712..410119
                     /locus_tag="HWH41_01950"
     CDS             409712..410119
                     /locus_tag="HWH41_01950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="QOD45693.1"
                     /translation="MKANRSIACLLLAALPTLASAHAAEKVETLRDQALAEIPGHRGL
                     MLTVSFKPGQVSAPHVHPGSVFVYVLEGTVQTQLEGGPVETYTVGQSWYEPANVPHLL
                     ARNPDPMKPAKLLVWELLKEGDPILKPLERGAH"
     gene            410153..410437
                     /locus_tag="HWH41_01955"
     CDS             410153..410437
                     /locus_tag="HWH41_01955"
                     /inference="COORDINATES: protein motif:HMM:NF015925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="QOD45694.1"
                     /translation="MSASQVIRIRARNGQSERLGLRLQQLVEPGLEAPGCLEYQVRRD
                     ALEPDLWLVCSQWREAQQMFDYLAGGIQQVFAEVLWRSLAASLEVQDDAG"
     gene            complement(410434..411366)
                     /locus_tag="HWH41_01960"
     CDS             complement(410434..411366)
                     /locus_tag="HWH41_01960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="QOD45695.1"
                     /translation="MLIANGLRKVDMQDLLVFLQVHQRQNLVEVAEQLNLSPSTVSYC
                     LKKLRQAFDDELFIATRGGMQPTHKSRAMLPHVEEMLARINACHAAQGSFDPRGEPRT
                     FTLCAPEYVELLILPALLRRLAANGPRIGLDIRRLGPELPTEALLDGQVDLVFDFGPE
                     YHRPAPELQALALFSDELLCVQDRAQPRHERLELDEFCRRRFVFPTPLDASNANLVDT
                     WLRRQGRSREVAARANSYVAALQLLSGSDFVLMLPRRIHALLDDGRHRACLAPSGLPP
                     FALHLSWSRAADQDPANLWLREQVLIVCAELGLL"
     gene            complement(411416..412630)
                     /locus_tag="HWH41_01965"
     CDS             complement(411416..412630)
                     /locus_tag="HWH41_01965"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyanate transporter"
                     /protein_id="QOD45696.1"
                     /translation="MPTANPPCRTLWLMAAIVLVGLNLRPSMAAVGPLLNAMRGEIAL
                     SFGDVSLLTALPVLTLGLGMFFGLGIARRVGEWRSVALALLLIGAASALRLGSRGLPD
                     LLGSAMLAGLGIALIQALMPALIKARFGARTPLCMGLYVTAIMAGAALSASAAPTLAE
                     HAGWRLGLGAWAALAALALLAWWLQPGTRLRLPAAQPGRSLLRYPRTWLLVLFFGLGT
                     ACYTCVLAWLAPYYLEQGWSAQESGLLLGFLTAMEVLSGLLAPALASRSRDRRPVLVG
                     LTALMLAGFLGLAWAPASLPLLWALCLGLGIGGLFPMGLIVCLDHFDAPQRAGQLAAL
                     VQGAGYLIAGVSPWIAGLLRDSLGSFTGAWLGLAAVAALLLGLGLRFDPRRYAALFAE
                     RQARGVGAESLR"
     gene            complement(412793..413563)
                     /locus_tag="HWH41_01970"
     CDS             complement(412793..413563)
                     /locus_tag="HWH41_01970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45697.1"
                     /translation="MLRPALPAVLCLCCLLLALPARAALDDQQRALQQLQVQACRAVG
                     SLLLLRGEGFQEQHAAQLEKDLASLDRALAAAPEGVLLRQGERALVARIREGAAYGPR
                     EEDLPWRYPQQLSRALRDFLNLVERQVPPPPPGQPLPLWQLPVRVEYLSLQYLARAYL
                     GGLEIAREQPRDYLGQDESVLVPLIDRRIALLVEQSANPAGLKKLENRWEYLSQALRD
                     LNSKSSALVSASGRPWAPIIVDRHARALSESLMRLSAE"
     gene            complement(413672..414358)
                     /locus_tag="HWH41_01975"
     CDS             complement(413672..414358)
                     /locus_tag="HWH41_01975"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="QOD45698.1"
                     /translation="MNERTDYRSQLQAGRWFQGLPEALQTHLLALAQPRQLPPGQRLF
                     ARGDAPCGLYCVVEGAIRISAVSENGKEALLILVEAPHWFGEIALFDGQARTHDAYAE
                     GHTQLLQVPQAALLELLRREPHYWRDMALLMSHKLRLAFIALEEMALLPAAQRLARRL
                     LMLAEGYDNSRSRQVLHLPQEQLALMLSLSRQTTNQILKDLEAQGILQLSYGGIEILD
                     LAGLRAATHG"
     gene            414434..414949
                     /locus_tag="HWH41_01980"
     CDS             414434..414949
                     /locus_tag="HWH41_01980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF962 domain-containing protein"
                     /protein_id="QOD45699.1"
                     /translation="MKTLVDHLAQYAAYHRDRRNIFSHFIGIPMIVLSIAVLLARPAL
                     GFGLSPALLLALAAALFYLRLDLRFGAAMTALLALTVWGAAQLAAGTTAAWLGWGVGL
                     FVVGWIIQFVGHYYEGRKPAFVDDLSGLIVGPLFVLAELAFLLGLRGDVQREVEERAG
                     PTCIREHKRAA"
     gene            complement(414989..415747)
                     /locus_tag="HWH41_01985"
     CDS             complement(414989..415747)
                     /locus_tag="HWH41_01985"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M48 family metallopeptidase"
                     /protein_id="QOD45700.1"
                     /translation="MKTRLSLSALALACATLAGCQNLPQGDLMQHGMMAVKAATLSDA
                     EVRQVADQACAESDQQNRIAPANSKYGQRLDKIAKALGDQIDGVPVNYKVYLTEEVNA
                     WAMANGCIRVYSGLMELMSDNEIEGVLGHEMGHVALGHTRKAAQTAYAAAAVRGAAGA
                     SKSGALAALSGSQLGELTESLVNAQFSQSQESDADDFSYELLKKRGVNTQGLVTAFEK
                     LAKLGGGDSSMFDSHPGSQARADHIRQRIAADRK"
     gene            complement(415919..416671)
                     /locus_tag="HWH41_01990"
     CDS             complement(415919..416671)
                     /locus_tag="HWH41_01990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009614023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite exporter TauE/SafE family protein"
                     /protein_id="QOD45701.1"
                     /translation="MSVDLHALIPLIALTFLLAGFVKGVVGLGLPTVSVGLLGLAMPP
                     MQAAALLIVPSMVTNLWQLACGPRFLGLMKRLAGLLLGVVVGTLLVGAWLGGDAPRQA
                     TGVLGLALAAYALLGLAAIPLHLPARHEPWAGPLVGLATGALTAVTGVFVIPAVPYLG
                     ALGLQRDELVQALGLSFSASTLALAVTLGVHGDLLEPQMLGASLLTLVPALGGMLLGQ
                     WLRQRISATLFRRCFFVGLLLLGADLAWRGFH"
     gene            416765..417463
                     /locus_tag="HWH41_01995"
     CDS             416765..417463
                     /locus_tag="HWH41_01995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QOD45702.1"
                     /translation="MQFNPGFSSLAALLADPGRAQMIWALMDGSARPASELALLAGVS
                     PSSASGHLGRLVEGGVLSLEARGRNRFYRLAGPEVGQAVEALASASLALQPQRRSLPP
                     SHGTPSALREARTCYDHLAGELAVGVFARMLDAGWIEQEGRTLRLSATGEAGLAGLGI
                     DLAEVRRRRRQFACACPDWSERKPHLGGALGTALLEACLRQGWLRPQDGSRALQVSSK
                     GRAGLRGLAERTAG"
     gene            complement(417476..418465)
                     /locus_tag="HWH41_02000"
     CDS             complement(417476..418465)
                     /locus_tag="HWH41_02000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter ATP-binding protein"
                     /protein_id="QOD45703.1"
                     /translation="MSIEIRNVSKNFNAFKALDDINLDIQSGELVALLGPSGCGKTTL
                     LRIIAGLETPDAGNIVFHGEDVSQHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMK
                     PKGERPGESAIKAKVHELLNMVQLDWLADRYPEQLSGGQRQRIALARALAVEPKILLL
                     DEPFGALDAKVRKELRRWLARLHEEINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQI
                     GSPGEVYENPASDFVYHFLGDSNRLQLGNDQHLLFRPHEVSLSRSAVAEHRAAEVRDI
                     RPLGAITRVTLKVDGQDELIEAEVVKDHDSLAGLARGETLYFKPKAFQPVANL"
     gene            complement(418469..419338)
                     /gene="cysW"
                     /locus_tag="HWH41_02005"
     CDS             complement(418469..419338)
                     /gene="cysW"
                     /locus_tag="HWH41_02005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter permease subunit CysW"
                     /protein_id="QOD45704.1"
                     /translation="MSSASISAATASASRRGNAGGRLALIVLAWLVFALFLLLPLYVV
                     LSEALKQGFGTFFEAILEPDALAALKLTLIAVAISVPLNLLFGVAAAWCVSKFEFRGK
                     SILVTLIDLPFSVSPVIAGLIYVLLFGAQGYFGEWLSDHDIQIVFAVPGIVLATLFVT
                     VPFVARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTLPNIKWGLIYGVVLCTARAM
                     GEFGAVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFSVASLLLLMALVILLLKQWSE
                     SRMSRLKSNADEE"
     gene            complement(419349..420167)
                     /gene="cysT"
                     /locus_tag="HWH41_02010"
     CDS             complement(419349..420167)
                     /gene="cysT"
                     /locus_tag="HWH41_02010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter permease subunit CysT"
                     /protein_id="QOD45705.1"
                     /translation="MSRRISPVIPGFGLTLGYTLVYLSLLVLIPLGAMFLKTTQLSWE
                     QFWAIISAPRVLAALKLSFGTALAAAVLNGLIGTLLAWVLVRYEFPGRKIIDAMIDLP
                     FALPTAVAGIALTALYAPAGLVGQFASDLGFKIAYTPLGITLALTFVTLPFVVRTVQP
                     VLADIPKEVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIA
                     GNMPMKTEILPLLIMVKLDQYDYTGATAIGVLMLVVSFILLLLINLLQRRIETP"
     gene            complement(420329..421327)
                     /locus_tag="HWH41_02015"
     CDS             complement(420329..421327)
                     /locus_tag="HWH41_02015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter substrate-binding
                     protein"
                     /protein_id="QOD45706.1"
                     /translation="MSLRRFALAALASALVSGPVAAATQLLNVSYDPTRELYQAYNAA
                     FIKHWKAQGGEDLTVQQSHGGSGKQARAVIDGLKADVVTLALAGDIDELHKLGKLLPA
                     DWQARLPDNSTPYTSTIVFLVRKGNPKGIKDWGDLTKEGVEVITPNPKTSGGARWNFL
                     AAWAWAKKQYGSDEKAKDYVQALYKHVPVLDTGARGSTITFVNNQIGDVLLAWENEAF
                     LAKKEQGGENFEIVVPSISILAEPPVAVVDKVVEKKGTRKVAEAYLQYLYSEEGQRIA
                     AQNFYRPRNQKVAAEFATQFPKLNLVTVDSDFGGWKTAQPKFFNDGGIFDQIYQAQ"
     gene            complement(421504..421686)
                     /gene="oscA"
                     /locus_tag="HWH41_02020"
     CDS             complement(421504..421686)
                     /gene="oscA"
                     /locus_tag="HWH41_02020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur starvation response protein OscA"
                     /protein_id="QOD45707.1"
                     /translation="MSATLRSLDGQDEATILREIQSALRGLRFGAVEITVHNGQVVQI
                     ERKEKFRLQQPAVKQA"
     gene            complement(421850..424132)
                     /locus_tag="HWH41_02025"
     CDS             complement(421850..424132)
                     /locus_tag="HWH41_02025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="QOD45708.1"
                     /translation="MSPRLSALRLSLAYLAIAIAWAFLSDHLLQNQVQDHDQLVFWMT
                     AKRLFFFAATGLLLYLYLVRQFRRKAQAYDELHGSEQRLNRALEAVRDGLWDWDLVTD
                     RMFVSPGYAALIGLAPEELGDPIETWKKRLHPEEYATVLEAHRNHLQGLTDNLDHIYR
                     LRHKDGDYRWIHSRGRVLRDALGKPLHYTGVARDITLQRLKEDHLRQAAAVFDSTREG
                     VLVTDAQAVIVHVNPSFERITGYRSEDVLGKTPAILRSGRQDQAFYQRLWLALREQDV
                     WSGEIWNRRKSGEIYPQWLHIRAVRNDQGQLTHYVGVFSDLSSIKRSENELDFLAHHD
                     SLTGLPNRVLLRERIEQALENGKDRTVAGALLLIDLDHFKHINDSLGHTTGDMLLKEV
                     SKRLQHQLDERCLLSRLGGDEFAILVENDDPEAVARLSQRILDGFNAPFDIHCQPIYI
                     SASLGVSLYPEDASDVDHLMQHADAALFQAKDSGRNAYAFYTRVLTARARAHVQVESA
                     LRHALEHDELRVHYQPVHDLASGRIVGVESLVRWQHPERGLVPPGEFVPVAEECGLIA
                     ALDNWVLKRACRQMREWQQRGVELEFVAVNVSSRLFNRGGLEERIANALEESGLEPRY
                     LELEVTESAVMEDFEQSLNLLCRLRILGVNLAIDDFGTGYSSLMRLKWLPVHKLKIDQ
                     GFVAGLPGAVDDAAIARAIVALAQSMGLRVVAEGIEHQDQALFLREHGCDFGQGYWYG
                     RPQPAEALRFDLPPVALPED"
     gene            424304..425482
                     /locus_tag="HWH41_02030"
     CDS             424304..425482
                     /locus_tag="HWH41_02030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="delta-9 fatty acid desaturase DesA"
                     /protein_id="QOD45709.1"
                     /translation="MWFNGFLDLSPWQLVAVTLVLTHITIVSVTVYLHRYSAHRALDL
                     HPALQHFFRFWLWLTTGMNTREWTAIHRKHHAKCETVEDPHSPVHKGLFTVLRAGAEL
                     YKAEAKNQDTLRIYGKNCPDDWIERNLYSRFPIGGVVLMALIDLALFGALGLTVWAVQ
                     MVWIPFWAAGVVNGLGHAVGYRNFECRDAATNLVPWGILIGGEELHNNHHTYPNSAKL
                     SVKKWEFDLGWAWIKLFSFLRLARVARVAPIAHRVEGKHSLDMDTAMAILNNRFQIMA
                     QYRKLVIAPLVKQEVAKADESVRHLFRRAKRLLSRETSLLQDRHHVRIDSMLAHSQAL
                     KVIYEKRLALQQIWAKTSANGHDMLAAIKDWVHEAEASGIQSLKEFAAQLKTYSLRPA
                     "
     gene            425711..427096
                     /locus_tag="HWH41_02035"
     CDS             425711..427096
                     /locus_tag="HWH41_02035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:solute symporter"
                     /protein_id="QOD45710.1"
                     /translation="MLLDYLIMLVYALAMLGLGWYGMRKAKSQSDFLVAGRRLGPGLY
                     LGTMAAVVLGGASTIGTVKLGYQFGLSGLWLVFMLGLGIIVLSLVFSRQIARLRVFTV
                     TQVLEQRYQASSRLIGGVVMVAYDLMVAVTATIAIGSVTEVVFGIPRIPAILCGGGIV
                     IVYSVIGGMWSLTLTDIIQFVIKTVGIFLVLLPLSIDGAGGLARMQEVLPAGFFDLGH
                     IGLDTILTYFLLYFFGALIGQDIWQRVFTARSETVVRYAGLGAGVYCMLYGAACALIG
                     AAARVLLPDLAVPENAYAEITREVLAPGLRGLVVAAALSAIMSTASGCLLAAATVLQE
                     DIYARFLRPGTTSDIRLSRCITLLMGVAMLVLACLVNDVIAALSIAYNLLVGGLLVPI
                     VGALLWRRASPQGAIASIVAGCLAVIACMARDGLLANSPIVYGLLASLATFVAVSLAT
                     RPAASLRAQPE"
     gene            427152..428108
                     /gene="speB"
                     /locus_tag="HWH41_02040"
     CDS             427152..428108
                     /gene="speB"
                     /locus_tag="HWH41_02040"
                     /EC_number="3.5.3.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agmatinase"
                     /protein_id="QOD45711.1"
                     /translation="MSNDHPQPLDAAEIPRFAGIPTFMRLPAFTDPAALQVGLIGVPW
                     DGGTTNRAGARHGPREVRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSL
                     RRIEGFYRQVHAAGTLPLSVGGDHLVTLPIFRALGRERPLGMVHFDAHSDTNDRYFGD
                     NPYTHGTPFRRAIEEGLLDPLRTVQIGIRGSVYSPDDDAFARECGIRVIHMEEFVELG
                     VEATLAEARRVVGDGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLD
                     LVGADVVEVSPPFDVGGATALVGATIMFELLCLLAESAARSA"
     gene            428161..429123
                     /locus_tag="HWH41_02045"
     CDS             428161..429123
                     /locus_tag="HWH41_02045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="QOD45712.1"
                     /translation="MGAGMLGNLNDIDLRMLRTFCAIVEAGGFTAAQARLNTSLSRLS
                     VLVRDLEVRLGYSLCRRGNGGFQLTEEGQELYDAALGLFSDIARFREQVRGLGGRDRE
                     ALHLGCVDGVIGQHCLPLPLAIRLFRQRAPEVLLKLHTRRPDELEHAVLEERLQLAVG
                     AFHHRLSGLYYQPLFREEQNLYCGSAHPFFARADDEPTLGEICAADYVGRGYMAENHR
                     PHDLRFNQGTDAYTMEAIATLVFSGTYIGYLPTHYAATWVAEGRMRAIRPRQLAYDSE
                     FHCITRQGHEERPTLTLFLRSLFEAQKQLGVQAPANTNGIARQL"
     gene            429236..430207
                     /locus_tag="HWH41_02050"
     CDS             429236..430207
                     /locus_tag="HWH41_02050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor domain-containing diguanylate cyclase"
                     /protein_id="QOD45713.1"
                     /translation="MDDLTGIPEDPQEAALALLHSRAEVARLKEREQLFSALLASVNS
                     VLWAYDWQNRRMVYVSPAYEKIFGRSAALLLADYEEWRNSIYPDDLDYADSSLLQVLE
                     RGAVEQREYRIVRGDGEVRWLNDKCFVSRQGEAGLPLMVVGIAEDITDKKHMESELQR
                     LATTDVLTQSSNRRYFFDSAEAAFKECRREGIPLAFLLLDVDDFKKINDRFGHQVGDQ
                     VLQRIAQSGSAALRRGDLFGRIGGEEFAVLLPGCDEQTARQIGERLQREVQRLRFQEG
                     EQSFGITVSQGLTVLQADDEGLGALYSRADAAMYSAKRQGKDCIVVG"
     gene            430821..432203
                     /locus_tag="HWH41_02055"
     CDS             430821..432203
                     /locus_tag="HWH41_02055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OprD family porin"
                     /protein_id="QOD45714.1"
                     /translation="MKSRKINKSRLALAITAGTLGALAQQAVAAGFIEDSKASLTLRN
                     FYINTDNRNGTASPSKQEEWGQGFILNYQSGFTQGTVGFGVDALGLLGVRLDGGGRAG
                     KSGLDRQPGTVFPLESNGEPVHDFASLGLTAKAKVSNTEFRYGTLQPKLPVVTYNDGR
                     LLPVTFEGGQVTSTDLKDFTLVAGQLEHSKGRNSTDNRSLSIAGANGSSASSRDSNKF
                     YYAGGDYKVNKDLTLQYYYGNLDDFYKQHFLGLIHNWQIGPGVLKTDLRAFDSSSDGK
                     NGSRSGRADGYVSSGYYGSGVTKGEVDNRAFSGLFTYTVSGHSIGAGYQILNGDSDFP
                     FLNRGDGEGSTAYLITDVQIGKFQRAGERTWQVRYGYDFATVGVPGLTFNTIYLSGDK
                     IKTARGDQSEWERDISLAYVIPDGTFKGLGFTWKNASFRSGLPAAGSSNNQRDQDENR
                     LIVSYTLPLL"
     gene            complement(432338..433444)
                     /gene="aguA"
                     /locus_tag="HWH41_02060"
     CDS             complement(432338..433444)
                     /gene="aguA"
                     /locus_tag="HWH41_02060"
                     /EC_number="3.5.3.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agmatine deiminase"
                     /protein_id="QOD45715.1"
                     /translation="MSNPTSTPRADGFRMPAEWEPHEQTWMVWPERPDNWRNGGKPAQ
                     AAFAAVAKAIARFEPVTVCASAGQYENARARLDDGNIRVVEISSDDAWVRDTGPTFVI
                     DDKGNVRGVDWGFNAWGGFEGGLYFPWQRDDQVARKILEIERRARYRTDDFVLEGGSI
                     HVDGEGTLITTEECLLNHNRNPHLSQAEIERTLRDYLAVDSIIWLPNGLYNDETDGHV
                     DNFCCYVRPGEVLLAWTDDQDDPNYLRCQAALRVLEESRDAKGRKLVVHKMPIPGPLY
                     ATQEECDGVDIVEGSQPRDPSIRLAGSYVNFLIVNGGIVAPSFDDPKDAEARAILQRV
                     FPEHEVVMVPGREILLGGGNIHCITQQQPAPRKA"
     gene            complement(433530..434408)
                     /gene="aguB"
                     /locus_tag="HWH41_02065"
     CDS             complement(433530..434408)
                     /gene="aguB"
                     /locus_tag="HWH41_02065"
                     /EC_number="3.5.1.53"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-carbamoylputrescine amidase"
                     /protein_id="QOD45716.1"
                     /translation="MTRNVTVAATQMACSWDRPANIARAEKLVRQAAARGAQIILIQE
                     LFETPYFCQKPNPDYLQLATTVEENAAIAHFQALARELQVVLPISFFERAGRARFNSI
                     AVIDADGGNLGVYRKSHIPDGPGYHEKYYFNPGDTGFKVWQTRYARIGVGICWDQWFP
                     ESARSMALLGAELLFYPTAIGSEPHDASISSRDHWQRVQQGHAGANLMPLVASNRIGR
                     EEQDGYDITFYGSSFIADPFGEKVEELNRTEEGILVHTFDLDALERTRSAWGVFRDRR
                     PNLYGPLKTLDGSLES"
     gene            complement(434571..435236)
                     /locus_tag="HWH41_02070"
     CDS             complement(434571..435236)
                     /locus_tag="HWH41_02070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="QOD45717.1"
                     /translation="MQPTSPTRKPRASSQARIAAILDAARGLLADEGIGGLTIYSVAE
                     RAEMPPSSVYHFFPSVPALLQGLTGEVHAAFRACLEQPVDHAGLRCWRDLSRIVEERM
                     LAVYARDAAARQLILASHGLAEVTQADRQHDVQLGQAMRALFERHFLLPPLPTDIEIF
                     SLAMELGDRVYALSVQRHGIIDARLAEEGMRVFDAYLGLYLPPILEKRSEPLTGFISD
                     LNR"
     gene            complement(435299..436360)
                     /locus_tag="HWH41_02075"
     CDS             complement(435299..436360)
                     /locus_tag="HWH41_02075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter substrate-binding
                     protein"
                     /protein_id="QOD45718.1"
                     /translation="MPRLSALLFLALAPWLAQAEETLRVYNWNDYIDPQVLESFQKDT
                     GIRVEYHTFATAEELDKALRSGEAIDVAVPSHDTLPALLKDNLLRPLDFTQLPNRSHL
                     DRQLLSKLAAVDPDNRHAVPYLWGAVGLAINTPQAEAAYGGPLPNSWSLLFDASQSQR
                     LKSCGISLLDAPDETLAILLNYQGRNLGRTAPSQVRRAAEALHGLRPNLRYVDSERYI
                     ADLEGGRLCLAMAWVGDALRAAKAGQPVSFEVPQEGSVLFIDNLVIPAGAQHPREAHR
                     FIDYLMQPKIAAQITAATLYPSGNADAAGFLDPALRQQPGLYPDRDTSRRLFALETPP
                     EKLRPVVDEIWKAFRGASH"
     gene            complement(436616..>436996)
                     /locus_tag="HWH41_02080"
     CDS             complement(436616..>436996)
                     /locus_tag="HWH41_02080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="QOD45719.1"
                     /translation="WGLDNRTVALRVPTGSPDAVRLEHRVAGADANPYLLLAAVLAGV
                     HHGLTNKVEPGAPIEGNSYEQMEPSLPNNLRDALRELDESEIMAKYIDPKYIDIFVAC
                     KESELEEFEHSISDLEYNWYLHTV"
     assembly_gap    436997..437749
                     /estimated_length=753
                     /gap_type="within scaffold"
                     /linkage_evidence="align genus"
     gene            complement(<437750..437991)
                     /locus_tag="HWH41_02085"
     CDS             complement(<437750..437991)
                     /locus_tag="HWH41_02085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="QOD51099.1"
                     /translation="MSVPQRAVQLTEPSEFLKEHPEVQFVDLLIADMNGVVRGKRIER
                     NSLNKVFEKGINLPASLFALDITGSTVESTGLGLDIG"
     gene            438270..439022
                     /locus_tag="HWH41_02090"
     CDS             438270..439022
                     /locus_tag="HWH41_02090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyl-gamma-aminobutyrate hydrolase
                     family protein"
                     /protein_id="QOD45720.1"
                     /translation="MSRLPLIGVTACTKQIGLHPYHIAGDKYLRAVVNGAGGLPLIIP
                     ALGESIDQAALLDSVDGLLFTGSPSNVEPRHYSGPASEPGTLHDSDRDATTLPLVRAA
                     IDAGIPVLGICRGFQEMNVAFGGSLHQKVHEVGTFMDHREPADQPLEVQYAPRHAMHV
                     QPGGVLAGIGLPSEFQVNSIHGQGVDRLAPGLRVEALAPDGLVEAISVEGAKAFALGV
                     QWHPEWQVLTNPNYLAIFQAFGKACSKRAGQR"
     gene            439063..440421
                     /locus_tag="HWH41_02095"
     CDS             439063..440421
                     /locus_tag="HWH41_02095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="QOD45721.1"
                     /translation="MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFIAE
                     KGMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMVCRPDENAVFLVPWAIEPTAMVI
                     HDTFDKLGNPIELSPRNILKRVLKMYADKGWRPIVAPEMEFYLTKRSDDPDYPLQAPV
                     GRSGRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHG
                     DALDLADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSIVDVKTGKNIF
                     SNADGTMSELFLHHIGGLQKFIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTV
                     GLRVPDSSPENRRVENRLAGADANPYLALAASLLCGYIGMVEGIKPSAQVKGRGYERR
                     NLRLPLTIEAALERMENCKPLEQYLGSKFISGYVAVKRAEHENFKRVISSWEREFLLL
                     SV"
     gene            440487..441857
                     /locus_tag="HWH41_02100"
     CDS             440487..441857
                     /locus_tag="HWH41_02100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase family protein"
                     /protein_id="QOD45722.1"
                     /translation="MNSQITNAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEG
                     VYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPVVEL
                     AKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGST
                     VAGVSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEV
                     GEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWFG
                     SQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGEFYHGFTYSGHPVAAAV
                     ALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKT
                     RERFTDKGVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQIDELITLARKCLDQT
                     AAAVLA"
     gene            441973..443076
                     /locus_tag="HWH41_02105"
     CDS             441973..443076
                     /locus_tag="HWH41_02105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter substrate-binding
                     protein"
                     /protein_id="QOD45723.1"
                     /translation="MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTL
                     EKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKS
                     KLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDL
                     VFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYV
                     TYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDM
                     VAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYP
                     SEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSGK"
     gene            443495..444592
                     /locus_tag="HWH41_02110"
     CDS             443495..444592
                     /locus_tag="HWH41_02110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter substrate-binding
                     protein"
                     /protein_id="QOD45724.1"
                     /translation="MQHSIGKTLLVAALATAIAGPVQAEKKSLHIYNWTDYIAPTTLK
                     DFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSK
                     LPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILF
                     EPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSY
                     FHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMA
                     IPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQ
                     AVLDKLYVSAVLPAKVLRLQTRTWTRIKTGK"
     gene            444647..445801
                     /gene="potA"
                     /locus_tag="HWH41_02115"
     CDS             444647..445801
                     /gene="potA"
                     /locus_tag="HWH41_02115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter ATP-binding protein"
                     /protein_id="QOD45725.1"
                     /translation="MAIASGAYKKALEGNQQPKEVLVKIDRVTKQFDETLAVDTVSLT
                     INKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQS
                     YALFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQR
                     VALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMT
                     MAQRIAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACP
                     QLENPIYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHAGHNWAQGTVYDIAYL
                     GGHSVYYIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS"
     gene            445828..446709
                     /locus_tag="HWH41_02120"
     CDS             445828..446709
                     /locus_tag="HWH41_02120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease subunit"
                     /protein_id="QOD51100.1"
                     /translation="MPTGRHAVIGVPFLWLFLFFLLPFAIVLKISLAEADVAIPPYTE
                     IFAYADQQLQVLLNLGNYLMLTDDPLYIDAYLGSLKMAFISTLICLLVGYPMAYAIAR
                     SSQSSQTVLLLLIMMPTWTAILIRVYAWMGILSNNGLLNSVLMGLGLISEPLTILNTN
                     IAVYIGIVYSYLPFMILPLYANLVKHDPSLLEAASDLGARNFTSFWKITVPLSKNGII
                     AGCMLVFIPAVGEFVIPELLGGPETLMIGKVLWQEFFNNRDWPVASALAVVMLAILII
                     PIILFNKNQAKELEGKV"
     gene            446792..447661
                     /locus_tag="HWH41_02125"
     CDS             446792..447661
                     /locus_tag="HWH41_02125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease subunit"
                     /protein_id="QOD45726.1"
                     /translation="MKRWNFSNVMLIVGLLFIYLPMLILVIYSFNASKLVTVWGGWSV
                     KWYVGLLDNTQLVSSVGRSLEIAFYTAFSSVLLGTLAAFVLTRIPRFRGRTLFGGMVT
                     APLVMPEVITGLSLLLLFVAMAQLIGWPQERGIVTIWIAHTSFCSSYVAVVVSARLRE
                     LDLSIEEAAMDLGAKPWKVFLLITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGS
                     TTLPMEVFSAVRLGVKPEINAVASLILLSVSLFTFFAWYFTRQAEERRRRAIQQAMEE
                     TATDWQKGSPTPA"
     gene            complement(447859..450246)
                     /locus_tag="HWH41_02130"
     CDS             complement(447859..450246)
                     /locus_tag="HWH41_02130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin acylase family protein"
                     /protein_id="QOD45727.1"
                     /translation="MKRTLTVIAVAVAAAAAGGAWYLHAKQPLRNGSLALAHLQAPVD
                     VRYDERGVPHLYAQNQTDLYRALGYVHAQDRLFQMEMLRRLARGELAEVLGAKLVDTD
                     RLFRTLRIRDHAAEYSARQDKQSQPWKVLEAYLDGVNQFQENNPAPLEFDLLGIPRRP
                     FTPEDTLSIAGYMAYSFAAAFRTEPVLTYIRDELGSDYLRIFDLDWHPQGVLTPSGAL
                     GAGDWKDLGALARLSQQVLEDAGLPQFEGSNAWVVAGSRTASGKPLLAGDPHIRFAAP
                     AVWYEAQLSAPGFELYGHYQALNPFASLGHNRAFGWSLTMFQNDDLDLVAEKVNPDNP
                     NQVWYQGKWVDLQSEEQEIAVKGAAPVKLTLRRSPHGPIVNDALGASSGKTPIAMWWA
                     FLETENPVLDAFYQLNRADTLAKARAAASKIHSPGLNLVWANAAGDIGWWASAALPKR
                     PEGVNPSFILDGSKGEADKSGFYPFADNPQEENPARGYIVSANFQPVPANGRPIPGYY
                     NLADRGQWLDTQLADRGTKWNLDNSRALQLGNRTGYAPRLLAPLLPVLREVVDDAEGK
                     RLVEQLAAWNGDYPVDSTAATLFNQLLFQIAESALHDELGDAFFDSLIATRAIDSALP
                     RLAADADSPWWDDRRTERRETRADIVRAAWNASLAHLRGTLGNDPSGWLWGKAHTLTH
                     EHALGQQALLKRLLNVGPFAAPGTHEVPNNLSAKIGPAPWAVTYGPSTRRLVDFADPT
                     HSLGINPVGQSGVPFDGHYDDQAEAYIEGHYLPQHYEENEVKANSKGVLVLEPKR"
     gene            450357..451409
                     /locus_tag="HWH41_02135"
     CDS             450357..451409
                     /locus_tag="HWH41_02135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="QOD45728.1"
                     /translation="MQDDPSTSPLTHSATLRRLLYEALDALGLDPTRVYRSVYRRIPL
                     PPPTLGGRLVHDNAPLFWTELAAVTGDADIGLHLGEAMKPRLLDVVGYLLLSARDLEE
                     ALRSFVRFQHILSGGFAARLEVEGETARLILDINYLGYASLRQQIECLMLLFLKLLAL
                     ISDDEFVAERIEFRHRAPSRLGEHRRLFGRLPLFSRPHDALVFSAALLRRPSRNANPD
                     MHDVLTRHAEEQSRELSENRLLNRVRYLIELRLGEGYGLRQCAAELGLGSGALQRALA
                     AGGASFRQVRDEVRRQRASEMLLAGRAIREVAKACGFAELSPFYRAFRRWHAAPPEQY
                     RARLAKREEGYSTSGT"
     gene            complement(451388..451891)
                     /locus_tag="HWH41_02140"
     CDS             complement(451388..451891)
                     /locus_tag="HWH41_02140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_008719731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="QOD45729.1"
                     /translation="MSLRPTLALLALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDLA
                     DVDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLRLLLDYAQAYNSGNV
                     SDDQASKLIERVDDLQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEIG
                     RQVPLVE"
     gene            complement(451996..452607)
                     /locus_tag="HWH41_02145"
     CDS             complement(451996..452607)
                     /locus_tag="HWH41_02145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol-disulfide isomerase"
                     /protein_id="QOD45730.1"
                     /translation="MASLAPVFRVNAMTPRRKTLLVSLVGLLWAGGLLAAYWWFEIRY
                     IRPFSEQTTLFSGDSLRLPAELAGPGPIRLVHFWDPACPCNVGNQQHLGELIERFAGK
                     GVEFHVLQKPGSQGRLPDNLAALRPLAGLPGSEQLPASPAVAIWNRDGRLAYFGPYSE
                     GAVCTSSNSFIEPILEALLQGRPVDATHTLAVGCYCPWTPEKG"
     gene            452606..453625
                     /locus_tag="HWH41_02150"
     CDS             452606..453625
                     /locus_tag="HWH41_02150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="QOD45731.1"
                     /translation="MCSRAAEYPWVSPVARPRIDCSPEPPMSEAFNPDYLRQHLRPLA
                     AAEADAAVLAYQAYYGLDLRSHHPRLQARLGSMAVDGRRLAVQAWLLPEARGSLLLMH
                     GYYDHMGLYRHVVDWALGMGFSVLACDLPGHGLSEGERASIRDFAEYQAVFKGLLGQA
                     AELDLAAPWHLCGQSTGGAILLDYLLHGGERPELGETILLAPLVRPRAWGWSKLSYRL
                     LSPFVDSIPRRFSENSSDPQFLDFLREHDPLQPRTLPTAWVGALTRWVPRIERAPRRA
                     LSPLVVQGESDETVDWRHGLKVLREKFDEPRILLLEEARHHLANESEGLRRRYFDFLS
                     DALGA"
     gene            complement(453645..454397)
                     /locus_tag="HWH41_02155"
     CDS             complement(453645..454397)
                     /locus_tag="HWH41_02155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45732.1"
                     /translation="MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAA
                     QKRYQDKLPPALYQTLVDNSNRRFAPAEVDQRALNGLRENLPDSASPLNFFESPLGRK
                     VVAAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVA
                     ADSLSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRDLSDAELTQY
                     VNFAESPAGRSYYQAALAALKAGLAVDQAVAP"
     gene            454446..455144
                     /locus_tag="HWH41_02160"
     CDS             454446..455144
                     /locus_tag="HWH41_02160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2OG-Fe(II) oxygenase"
                     /protein_id="QOD45733.1"
                     /translation="MGRYCRHAADRLSRHRGGTLQWTMHINVNHPLLHRIVDELVDQG
                     WSHQSIFMPERLTTRLAEECRTRAVAGDLTPAAIGRGDGQVIREGIRGDLTQWLEPGE
                     SVACDEYLGVMDSLRQALNASLFLGLEDFECHFALYPPGAYYQKHVDRFRDDDARTVS
                     AVLYLNDAWLPEHGGALRLHLPQRQVDIQPTGGSLVVFMSAGTEHEVLPASRDRLSLT
                     GWFRRRNESLLQLS"
     gene            complement(455166..455720)
                     /locus_tag="HWH41_02165"
     CDS             complement(455166..455720)
                     /locus_tag="HWH41_02165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45734.1"
                     /translation="MLPTRSLLPFFLAPALLASAASQAAMEALDNDSLSQVTGQAGIS
                     LRLDLRAGAARVAWVDDGGSLSLRNLVIDNGCVKAGDCPDGRGGNIPLGAAQLGLSLP
                     IFGVEQPTLALDVTTGSGGGQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLYIG
                     DNSIGRIELRDITDLRGTIKVWGH"
     gene            455986..456480
                     /locus_tag="HWH41_02170"
     CDS             455986..456480
                     /locus_tag="HWH41_02170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF523 domain-containing protein"
                     /protein_id="QOD45735.1"
                     /translation="MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWHAQGRIVALCPEV
                     AGGLPTPRPPAEIPGGQGGEVLDRLNRVFTVDGEDVSEAFLLGAEAAVELVRRHDIRM
                     AVLKARSPSCGNLENYDGRFNGSRVAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGL
                     DAGG"
     gene            complement(456485..457177)
                     /locus_tag="HWH41_02175"
     CDS             complement(456485..457177)
                     /locus_tag="HWH41_02175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="QOD45736.1"
                     /translation="MNSLQKLLEWLANLVELLGMAWPFLLQGAMYTVLFAAVSMVLGL
                     ILGFSVAVVRVTKVPVVSQIAAVYVSAFRGTPLLVQIFVLYYGLPSVGIEFTPVTAGI
                     LALTLNVAAYLSESMRGAILGIDKGQWEAGLSVGLTWGQTLWNIITPQALRLAVPSLS
                     NSLISLIKDTSLISVITVTELMLATKEVIAETFQPLPLYLAAAGIYWLLSALFERVQK
                     ALENRLTAPLRR"
     gene            complement(457279..458049)
                     /locus_tag="HWH41_02180"
     CDS             complement(457279..458049)
                     /locus_tag="HWH41_02180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystine ABC transporter substrate-binding
                     protein"
                     /protein_id="QOD45737.1"
                     /translation="MRFLPRLLMLVSLAAPLAHAELLDDVHQRGALRIALEGTYPPFN
                     FKQGGKLTGFETELGELLAAELEVKPEFVTTEWSGILAGLQSGKYDIALNQVSVNEQR
                     RKVFDFSEPYTISSAQLIVRADDTRQFRSLEDLKGLKLGVGQGTNYADLAKSVAGVNV
                     RTYPGAPEYLQDLASKRIDAALNDRLLIPFAIREAKLPVKPGAAVGPVANMAIPYRKN
                     NPKFGEALNAALEKIKADGRFAKLSEKWFGLDVSQPPK"
     gene            458342..458779
                     /locus_tag="HWH41_02185"
     CDS             458342..458779
                     /locus_tag="HWH41_02185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4399 domain-containing protein"
                     /protein_id="QOD45738.1"
                     /translation="MRVTLPCLGLAALMFGASASLMAADLPRTKAPEGAKVYFITPAD
                     GATVDKTFTVKFGLKGMGVAPAGVDMPDTGHHHLLVDLKEQPAMNLPLPMTDNIRHFG
                     KGQTETEITLPPGKHTLQLLVGDKNHVPLEPTVESEKITVTVK"
     gene            complement(458837..460066)
                     /gene="serA"
                     /locus_tag="HWH41_02190"
     CDS             complement(458837..460066)
                     /gene="serA"
                     /locus_tag="HWH41_02190"
                     /EC_number="1.1.1.95"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate dehydrogenase"
                     /protein_id="QOD45739.1"
                     /translation="MSKTSLDKSKIKFLLLEGVHQNAVDTLKAAGYTNIEYLKTALSG
                     DELKERIADAHFIGIRSRTQLTEEVFDCAKKLIAVGCFCIGTNQVDLNAARERGIAVF
                     NAPYSNTRSVAELVLAEAILLLRGIPEKNASCHRGGWIKSAANSFEIRGKKLGIVGYG
                     SIGTQLSVLAEALGMQVFFYDTVTKLPLGNAVQIGSLHELLGMSDIVSLHVPELPSTQ
                     WMIGEKEIRAMKKGGILINAARGTVVELDHLAAAIKDEHLIGAAIDVFPVEPKSNDEE
                     FASPLRGLDRVILTPHIGGSTAEAQANIGLEVAEKLVKYSDNGTSVSSVNFPEVALPS
                     HPGKHRLLHIHANIPGVMSEINKVFADNGINVSGQYLQTNDKVGYVVIDVDAEYSDLA
                     LEKLQQVNGTIRSRVLF"
     gene            460270..461664
                     /locus_tag="HWH41_02195"
     CDS             460270..461664
                     /locus_tag="HWH41_02195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding oxidoreductase"
                     /protein_id="QOD45740.1"
                     /translation="MTREALIESLKPLVEPGKLLDDAASLDAYGKDWTKHFAPAPLAI
                     VFPKSVEQVQAIVRWANQHKVGLVPSGGRTGLSAAAVAANGEVVVAFDYMNRILDFNA
                     FDRTVVCQPGVVTKQLQTFAEENGLYYPVDFASSGSSQIGGNIGTNAGGIKVIRYGMT
                     RNWVAGMKVVTGKGDLLELNKDLIKNATGYDMRQLFIGAEGTLGFVVEATMRLERTPK
                     NLTAMVLGTPDFDSIMPVLHAFQSKLDLTAFEFFSDKALAKVLARGDVPRAFETDCPF
                     YALLEFEATTEEVANEALATFEHCVEQGWVLDGVMSQSEQQLQNLWKLREYISETISH
                     WTPYKNDISVTVSRVPAFLKDIDAIVEANYPDFEVVWFGHIGDGNLHLNILKPENLGK
                     DEFFARCATVNKWVFETVEKYNGSISAEHGVGMTKRDYLTYTRSETEIAYMKALKAVF
                     DPNGIMNPGKIFAE"
     gene            461756..462421
                     /locus_tag="HWH41_02200"
     CDS             461756..462421
                     /locus_tag="HWH41_02200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetate hydrolase family protein"
                     /protein_id="QOD45741.1"
                     /translation="MSYQHQYIDGTPIHFPLGKLVCVGRNYAEHAKELNNPVPTEPLL
                     FIKPGSCVVPVSGGLSLPQERGSVHYEAEIAVLIGKPLSRKPNREEVLDAISGYAPAL
                     DLTLREVQAKLKEKGLPWELAKSFDGAGVLSPFVNADQFPDPTDIGIRLTINGEVRQD
                     GNSRDMLNPIVPLIQHIAGHFSLQAGDVVLTGTPSGVGPLNSGDELLLELPGASRFET
                     RVL"
     gene            462520..463509
                     /locus_tag="HWH41_02205"
     CDS             462520..463509
                     /locus_tag="HWH41_02205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YjiK family protein"
                     /protein_id="QOD45742.1"
                     /translation="MPFHGDAQENTWPNSRASPMSLASKLPRFRWLLPAFVVLVGVVL
                     TIVMHWDDRAGLWWKESQASQQQRDDSIWLPGYRVVIDAKPLQGLEEEETSDLAYNPA
                     TRTLFTVTGKRPLLVELSLTGDVLRTIPLLGLSNPEGVAVLENGNVAVTDERRNTLTI
                     FHVDPQTAELSTKSLAEFPLGNIGKKNKGFEGIAWDPRQQRLLLSKERDPMTLFSWKS
                     DGGPSLSGAMTALPSDDLYMRNVSALSVDPRTGHTLVLSAESHLLLELDEKGEPVSFI
                     SLLGGFNGLDSKIPRAEGVAIDDEGTIYMVSEPNLFYVFRKKSGERLATSDAD"
     gene            463593..463943
                     /locus_tag="HWH41_02210"
     CDS             463593..463943
                     /locus_tag="HWH41_02210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YgiW/YdeI family stress tolerance OB fold
                     protein"
                     /protein_id="QOD45743.1"
                     /translation="MKLRHLPLIAAIGLFSTVTLAAGYTGPGATPTTTTVKAALEAAD
                     DTPVVLQGTIVKRIKGDIYEFRDATGSMKVEIDDEDFPPMEINDKTRVKLTGEVDRDL
                     VGREIDVEFVEVIK"
     gene            complement(464024..465058)
                     /locus_tag="HWH41_02215"
     CDS             complement(464024..465058)
                     /locus_tag="HWH41_02215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histone deacetylase family protein"
                     /protein_id="QOD45744.1"
                     /translation="MLTIYSDDHRLHHGRHELIGGQFTPCFEKPSRADMVLDRVKAVG
                     LGEVRAPRDFGLEPIRRVHSEGFVRFLQNAWQDWLATGRSHDMLPIAWPTRRLRQTEP
                     DNIDGRLGYYSFDAGAPITAGTWQAITSSANVALSGQSELANGARSVFSLCRPPGHHA
                     AADYMGGYCFFNNAAIAAQAFLDRGAGRVAILDVDYHHGNGTQDIFYDRADVLFTSIH
                     GDPRFEYPYFLGYADEKGNGVGTGYNFNYPLAAGSDWATWSQALQAAIRQIQAYAADV
                     LIVSLGVDTFKEDPISQFRLDSPDYLRMGEAIGKLGLATLFMMEGGYAVEEIGINAVN
                     VLQGFEGVHR"
     gene            complement(465074..466468)
                     /locus_tag="HWH41_02220"
     CDS             complement(465074..466468)
                     /locus_tag="HWH41_02220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="APC family permease"
                     /protein_id="QOD45745.1"
                     /translation="MASQRNNGILIGGKRPEYVHSAQGTGLRRILGLPALVFFGLVYM
                     VPLTMFTTYGVVTEITGGRTASAYLITLAAMLFTAFSYSFMVKKYPIAGSAYSYTSLS
                     FGPCVGFLAGWSLLLDYLFLPMINYLLIGLFLNIAFPMVPAWVFVLAAIGLVTVLNVI
                     GISSVAGMSNVIVGAQFVFAVVFVAMAVKHLAGIPSLDLSLPFVGDGSQPGFAPLMAG
                     AAVLCLSFLGFDAVSTLAEETRDPQRDIPRAIVITTVGAGLLFTVLAVFSQLVFPGSV
                     FQDAESAANEVMLAAGGKFLASFFTAAYVAGAAGSALASQASVSRILYSMGRDGILPR
                     RVFGSLSERFKTPVIAILVVSVISLLAVVIDLTTLASMISFGALVAFSAVNLAVIRSY
                     LLLDGRRAPRDLLRYGLVPAIGLGLTLWLWTSLSALTLVIGLTWFAAGLAYLALHTGG
                     FRRKAPTVTFSEQN"
     gene            complement(466889..467932)
                     /locus_tag="HWH41_02225"
     CDS             complement(466889..467932)
                     /locus_tag="HWH41_02225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="QOD45746.1"
                     /translation="MTYRTPLTLLFAAGLALGGQARAEGTLHFANWSDYYPPELLKKF
                     EKDTGIKATLDAYDSNETLLAKLKAGGGAYDVVVPSDSFIEIFVKEGLLQKLDKSQLP
                     SLGNLKENFRTLGFDPGHDYSIPYLWGTTGYSYDTAKVPGGRLEESWKPFFEPPAELK
                     GKVVALNSIEELFIPATYYLGIDECTEDAREAQKVLDLLLRQKPALAMYNSDGTIERM
                     AAGEVAMHQQWNGAFHRAHAQRASLEYVYPKEGIRLFIDNFAIPRDASNVKEAHVFID
                     WMMRPENIAAASNFAKYNNAIVGSEKFMEKALFDDPAINTPKDKLDRLKPFKLCSPKA
                     LALRSKVWTKLKK"
     gene            complement(467980..468768)
                     /locus_tag="HWH41_02230"
     CDS             complement(467980..468768)
                     /locus_tag="HWH41_02230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QOD45747.1"
                     /translation="MNGRNPLWTFSGVRQAAWLFFAFLYIPILVLVALSFNSGQSATL
                     WESFSLKWYAVVANDPEILRAAKNSLIVATLATLASTVLATLAALGMRGRAFRGQTLM
                     NGVLGLPLLVPEIVTAVATLMFFSFIGLKLSLFTILIAHIVFCIPFAYLPIRARLEGL
                     DPRLAEAAADLYASPWKAFWKITLPLLMPGVLSGAMLAFIISMDDFVITYFVAGAGAT
                     TLPVYIFSSIRMGISPKINAISSIILMISIAFVALSYYLGQRRR"
     gene            complement(468765..469694)
                     /locus_tag="HWH41_02235"
     CDS             complement(468765..469694)
                     /locus_tag="HWH41_02235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QOD45748.1"
                     /translation="MSTAGRPTAQQSAERRQLRRRLLLSSPAMLMLVLFLVIPLGIMF
                     AVSIQQSGDYGGVKWGQHSLEAYLNFLWERDLDDSLVFNADYLGIFQRSFWLSLLTTL
                     GCLALGFPTALYLALQPERRRNLLLFLVTVPFWTNLLVRVYAWILLLRNGGLVDASLQ
                     GIGLTDTGLGLLYTDNAVIIGLLYTYLPFMVLPIYTSLEKMDWRLVEAAFDLGANRWK
                     ALRRVIVPLAMPGIVAGCILVFIPALGSYIIPELLGGGKALMIGNLIQLQFGTAHNWP
                     FGAALSFALLAFVLLAMLIHNLRFRANAGGGQP"
     gene            complement(469691..470740)
                     /locus_tag="HWH41_02240"
     CDS             complement(469691..470740)
                     /locus_tag="HWH41_02240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="QOD45749.1"
                     /translation="MTSAIAIERICMEFGTPGQGLKALDDVSLDIHANEFFTLLGPSG
                     CGKTTLLRLIAGFEQPSSGSIRLYGERMEGLPPFRRPVNTVFQSYALFPHMSVADNIG
                     FGLEMQGRPRSEIDATVSRMLELVKLPEVGKRRADQLSGGQQQRIALARALASRPKVL
                     LLDESLSALDLKLRKEMQIELKRLQHETGITFIFVTHDQEEALTMSDRIAVMSKGKVL
                     QVGTPSDIYEAPLNRAVADFIGETNFLEGQADADGVRLADGQRLAATTPGSGAVTLAI
                     RPERTELAADGQLEGVLENIVYVGTDTVYHLNVAGQPGFRVRQQNRDGARCPHSPGAK
                     VRVRIPAAAIRVLAE"
     gene            471068..472033
                     /locus_tag="HWH41_02245"
     CDS             471068..472033
                     /locus_tag="HWH41_02245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YjiK family protein"
                     /protein_id="QOD45750.1"
                     /translation="MTIHAQTPEPFSMSRAFTPRRLLLAVLLVALAALVLLGQSFRVF
                     DRAWFAVQEWRHADAWKERSIWLPDYRVRIEAQPIEGLNDDVSALTFDPDRRTLFTVT
                     NQPAQIIELSLQGKVLRTIPLTGFGDAEAIEYISRGVYVITDERQQRLVKVRLEDDTR
                     FIDAADAQQLSLGIGLNGNKGFEGLAYDAEGKRLFVAKERDPVRIYEIHGFPHTQADK
                     PFAVHVVDDPGRDKRLFVRDLSSLQFDEGTGHLLALSDESRLVVELDTDGEPVSTLSL
                     LRGMHGLKRSVPQAEGVAMDDRGVLYLVSEPNLFYVFSKDEPAQP"
     gene            complement(472072..474015)
                     /locus_tag="HWH41_02250"
     CDS             complement(472072..474015)
                     /locus_tag="HWH41_02250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter domain-containing protein"
                     /protein_id="QOD45751.1"
                     /translation="MFKPLAVAVGLGCAALSLGANAYQYGEYAGETLERLITDYPGRY
                     RGTASFAGASELMQSRLGFGYQTSRQDFTWAGNRSSQNVIASAPGSSGKFLVLGAHYD
                     TYYGRPTLQGLDDNASGAAVLTEIARNLGGIALENGLEVVGFGAEEEGLRGSRAYVES
                     LDASQRANLLGMINLDSLVTGDKMYAHAGSNSVSNPALGAYREQILRIARELDIPLFT
                     NPGLNAEYPAGTGCCSDGESFNGMDIPVLFIEATNWELGDLDGYEQTDDPAIPGGSTW
                     HDPAEDNKEVLTNALGQERIEQRMRDFSRLLTRLVLELTNADLLASTASGGALARQME
                     DQLQRQHQALTRLHDRRWLTLLGSNRPVGSFDGEVGAEGEVSPDSGFDMPGDPESRRA
                     GVHLLGDYRYSEALTLGGSLAFQRSRDKLDHGGRIEGDTWQLGLFGLYNDGGPEWLAG
                     ELNLGHTRYDSKRSVYLQAAGGPVLLDQRLSGDTSAWSWGARLEGGYDFSFGELRSGP
                     LAGLDYMRYRIDDFREDEALRTALGYEKQDYDSLEASLGWRLRGELALGARMRLQPYA
                     SLRWVRELADGRLEDMDLTSRGDGRVRVADMGGVDKDFGRAQLGAQLAITEQLGVFAE
                     ANSRFAHSEGNQAGYSLGVSWQF"
     gene            474305..475030
                     /locus_tag="HWH41_02255"
     CDS             474305..475030
                     /locus_tag="HWH41_02255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003084381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CatB-related O-acetyltransferase"
                     /protein_id="QOD45752.1"
                     /translation="MNIFREALLNRRLKKALARHGCRMASGVETLRDGTQVTLEPNVK
                     LGKAKIHSPALEVGAYTDVVSGCEFLEVASIGRFCSIATGVVIGQPRRSHPMHWLSTH
                     AFTANPKLLRKPLQPEREATPARIGHDVWIGRDALILDGVEIGTGAVIGAQTLVNRDV
                     PPYAVVAGSPARVLRYRFAPELIERLLASRWWELPLDVLGELPLDDPQACVEALERRP
                     PQARQEARRLRIRHKPFAIEWLS"
     gene            complement(475072..475404)
                     /locus_tag="HWH41_02260"
     CDS             complement(475072..475404)
                     /locus_tag="HWH41_02260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YegP family protein"
                     /protein_id="QOD45753.1"
                     /translation="MAAKFHLKKAKDGQFHFNLHAANGEIILTSELYKAKDSALGGIE
                     SVRKNSQRDGAFEVKPANNGKFHFVLKATNGQVVGQSQLYASQANAEAGVQSVKRAAP
                     EAGLSDES"
     gene            complement(475527..476198)
                     /gene="rpiA"
                     /locus_tag="HWH41_02265"
     CDS             complement(475527..476198)
                     /gene="rpiA"
                     /locus_tag="HWH41_02265"
                     /EC_number="5.3.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-5-phosphate isomerase RpiA"
                     /protein_id="QOD45754.1"
                     /translation="MNQDQLKQAVAQAAVDHILPHLDSKSIVGVGTGSTANFFIDALA
                     RHKAEFDGAVASSEATAKRLKEHGIPVYELNTVSELEFYVDGADESNERLELIKGGGA
                     ALTREKIVAAVAKTFICIADASKLVPILGQFPLPVEVIPMARSHVARQLVKLGGDPVY
                     REGVLTDNGNIILDVHNLRIDSPVELEEKINAIVGVVTNGLFAARPADLLLLGTADGV
                     KTLKA"
     gene            476433..477971
                     /gene="ilvA"
                     /locus_tag="HWH41_02270"
     CDS             476433..477971
                     /gene="ilvA"
                     /locus_tag="HWH41_02270"
                     /EC_number="4.3.1.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017001827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine ammonia-lyase, biosynthetic"
                     /protein_id="QOD45755.1"
                     /translation="MKSAEPPPMLEQYVKKILTSRVYDVAVETPLQPARQLSERLGNQ
                     VLLKREDLQPVFSFKIRGAYNKVAQLTEEEKARGVIAASAGNHAQGLALAAKRQGIRA
                     VIVMPKTTPEIKVQAVRAHGAKAVLHGDAFPEALAHALKLVDEKGYTFVHPYDDPDTI
                     AGQGTVAMEILRQQPGRLDAIFVPVGGGGLVAGIAAYVKYLRPEIKVIGVEPDESNCL
                     QAAMAAGERVVLGQVGLFADGVAVAQIGQHTFDICKDHVDEVITVSTDEICAAIKDIY
                     DDTRSITEPAGALAVAGIKKYVERERAEGQTLVAIDSGANVNFDRLRHVAERAELGER
                     REAIIAVTIPERPGSFKAFCEAVGKRQITEFNYRYHSGSEAHIFVGVQTHPENDPREA
                     LVAYLREKGFPVLDLTDNELAKLHIRHMVGGHAVKVSDEMVFRFEFPERPGALFNFLT
                     KLGGRWNISMFHYRNHGAADGRVVAGLQVPEDERHLIPQTLEAIGYPYWDETANPAYQ
                     LFLG"
     gene            478091..478558
                     /locus_tag="HWH41_02275"
     CDS             478091..478558
                     /locus_tag="HWH41_02275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2269 family protein"
                     /protein_id="QOD45756.1"
                     /translation="MEHFLQIKILHGVATVLLFGGLLGLAFYAWRSWRTGDAARIARG
                     FKRVRLIGWPLLGLSLLALPVSGWWLVHLAGWPLGQSWLLFGACLYLLGCIFWLVLAG
                     RLARVQHQAGAAETAGAALGEQTLREIKVGLVMALLGAASFIAVAVLMVSKPL"
     gene            478609..479880
                     /locus_tag="HWH41_02280"
     CDS             478609..479880
                     /locus_tag="HWH41_02280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="QOD45757.1"
                     /translation="MRILLVGAGGFVGRHLLPALLAAGHELLLTARRPPVDAPAGVRW
                     LALDLERLAERPDSFAWPAGVDLLINAAGTMSLDEASMARVQDSGARALFDLAAAHGA
                     KVLQISALGAGAHPDVAFLASKAAADRHLLELGIPALVLRPSLLLGPGGASSAWLERL
                     SPLPLIPLLDNRARLQPLHVEDLVGAVLALLRCWPERAQVIPLVGPQALSQGELLDEL
                     RRAQGWPRGRYVVPPAALLDALGGLGRRAGWRTLSPSMLKLVRHDNLADPALLDEACG
                     YRCAPLASRLLGWPQAARSLAALMRPLMLAALVLIWLGTLVACLGPGYGWGLRILGEA
                     GIHGWPASLAVIAGALLDGALGVGLLLRRWRRRALLAQFWLMLGYSLAISLILPHYWY
                     DPYMAVGKNIVLMVATLWLLGDEPRAREARG"
     gene            479877..480344
                     /locus_tag="HWH41_02285"
     CDS             479877..480344
                     /locus_tag="HWH41_02285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003084393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2269 domain-containing protein"
                     /protein_id="QOD45758.1"
                     /translation="MNLYLLLKTLHILSSTILFGTGLGSAYYALRAWRSGQLPVIAVT
                     FRHLVTADWLFIATTAVFQPLSGLAMVHVAGWSLAQGWLLWSLGLYVFAGLCWLPVVW
                     LQIRVRDMAEAALREARPIEPLAYRYMNAWFILGWPAFIAFMVIFYLMVNKPV"
     gene            complement(480317..481558)
                     /locus_tag="HWH41_02290"
     CDS             complement(480317..481558)
                     /locus_tag="HWH41_02290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="QOD45759.1"
                     /translation="MPHTAPAPGSLRPVVIVALVTALCLAGDSMLYIALPIYWHEVGL
                     EALWQVGVLLSINRLIRLPFNPLIGRLYKHLALKTGLLLAVVIGVLSTAGYGLASGFL
                     AWVLLRGLWGIGWSFFRIGGLSAVVYCAADHQRGRAMGLYNGLYRLGSLVGMLLGGLL
                     VPVLGLPALALSFAFLALLGLPLLAKGFDLPESPAGHARTSAATASTSVARRPPPRGL
                     VILSGFATALLIQGVLAATLSALIARSFGTEVSLLGLALSAAGLSGIIQALRWSWEPW
                     LAGRFGAWSDGPRGRRRFYVAALLVGAMGFGLLSSRLPILAWLAIALLVMLVATALTT
                     LTDALAADVARAGDVVGFMTRYSIVQDLGAALGPALAFLLLERPGGFAWLYWGGSLAF
                     LVLALLWLRRADSQTGLLTIR"
     gene            complement(481608..482261)
                     /locus_tag="HWH41_02295"
     CDS             complement(481608..482261)
                     /locus_tag="HWH41_02295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="QOD45760.1"
                     /translation="MRLALFDLDNTLLAGDSDHSWGEWLCQRGLVDAAEYQARNDAFY
                     ADYVAGKLDVLAYQAFTQAILGRTEMAQLETWHRQFMQEVIEPIVLAKGEALLAEHRA
                     AGDRLVIITATNRFVTGPIAERLGVETLIATECEMRDGRYTGQTFDVPCFQGGKVVRL
                     QRWLDENGLDLEGASFYSDSLNDLPLLEKVSRPVAVDPDSRLRAEAEKRGWPIISLR"
     gene            482465..482944
                     /locus_tag="HWH41_02300"
     CDS             482465..482944
                     /locus_tag="HWH41_02300"
                     /EC_number="3.6.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA pyrophosphohydrolase"
                     /protein_id="QOD45761.1"
                     /translation="MIDSDGFRPNVGIILANEAGQVLWARRINQEAWQFPQGGINDRE
                     TPEEALYRELNEEVGLEAGDVRILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWFLL
                     RLMSDEARVRMDITSKPEFDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLLARD"
     gene            482967..485246
                     /gene="ptsP"
                     /locus_tag="HWH41_02305"
     CDS             482967..485246
                     /gene="ptsP"
                     /locus_tag="HWH41_02305"
                     /EC_number="2.7.3.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate--protein phosphotransferase"
                     /protein_id="QOD45762.1"
                     /translation="MLNTLRKIVQEVNSAKDLKAALGIIVQRVKEAMGTQVCSVYLLD
                     TETQRFVLMATEGLNKRSIGKVSMAPSEGLVGLVGTREEPLNLENAAAHPRYRYFAET
                     GEERYASFLGAPIIHHRRVMGVLVVQQKERRQFDEGEEAFLVTMSAQLAGVIAHAEAT
                     GSIRGLGKLGKGIQEAKFVGVPGAPGVGVGKAVVVLPPADLEVVPDKQVDDIDAEIAL
                     FKQALEGVRADMRALSSKLASQLRKEERALFDVYLMMLDDASIGNEVKRIIRTGQWAQ
                     GALRQVVMEHVQRFELMDDAYLRERASDVKDIGRRLLAYLQEERKQNLTYPEQTIIVS
                     EELSPAMLGEVPEGRLVGLVSVLGSGNSHVAILARAMGIPTVMGAVDLPYSKVDGIDL
                     IVDGYHGEVYTNPSAELVRQYSDVVAEERELSKGLAALRELPCETLDGHRMPLWVNTG
                     LLADVARAQERGAEGVGLYRTEVPFMINDRFPSEKEQLAIYREQLSAFHPLPVTMRTL
                     DIGGDKALSYFPIKEDNPFLGWRGIRVTLDHPEIFLVQTRAMLKASEGLDNLRILLPM
                     ISGTHELEEALHLIHRAWGEVRDEGVDIAMPPIGMMVEIPAAVYQTRELARQVDFLSV
                     GSNDLTQYLLAVDRNNPRVADLYDYLHPAVLHALKKVVDDAHLEGKPVSICGEMAGDP
                     AAAVLLMAMGFDSLSMNATNLPKVKWLLRQITLDKARDLLGQLLTFDNPQVIHSSLHL
                     ALRNLGLGRVINPAATVQP"
     gene            485272..486402
                     /locus_tag="HWH41_02310"
     CDS             485272..486402
                     /locus_tag="HWH41_02310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="QOD45763.1"
                     /translation="MRRLRFPRKRIDCLPFGRGHWPVERARDCRKMDERASKPPGLLP
                     LSREDLEKTLRYALEIVSDGIWDWNIATNQVSRSAGWYLMLGYPPHSLPESVETWKNI
                     IHPEDYPRVMASFQAYLDGESPEYCEEYRCRTYSGDYLWISDRGRFVEFDERGEPRRM
                     IGAHHEIHQRKLVELELQQRNEELFDWNRRLEDLVAERTEALHRVNQALASKMAEAQR
                     LSEIDPLTELYNRRKFEQCLHHEWMRRQRHGRATALMMIDVDHFKRINDLFGHSTGDR
                     VLVAFGRLVASELREVDVLARWGGEEFILLLPETGLEAAAALAERLRQRVRSQSFEMG
                     ERLTASFGVGVLNDGETLDLLLCRVDDALYRAKQRRDCVACC"
     gene            complement(486406..487161)
                     /locus_tag="HWH41_02315"
     CDS             complement(486406..487161)
                     /locus_tag="HWH41_02315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NRDE family protein"
                     /protein_id="QOD45764.1"
                     /translation="MCLIVFAWQPGHALPLLVAANRDEFYARPSLPLAAWEDAEGVFA
                     GRDLEAGGTWLGLGPAGRFAALTNVRDPSQALGKRSRGELVADFLRGGGNPADYLAQV
                     AGRAADYSGFNLLIGDRHQLWHYNPRVGPPRLLPAGVYGLSNAALDTPWPKLLKARAA
                     LAERLAEPHPQALLELLADAAPAADSQLPDTGVGLATERLLSSVFIASPSYGTRASSV
                     VRVHADGTREMIERSFGPSGARLGEVSLVLPPG"
     gene            487283..488086
                     /locus_tag="HWH41_02320"
     CDS             487283..488086
                     /locus_tag="HWH41_02320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite exporter TauE/SafE family protein"
                     /protein_id="QOD45765.1"
                     /translation="MEFLLYIVLGACAGVLAGLFGVGGGLIIVPALVFSFTAHGFGGD
                     VLTQMAVGTSLATIVFTSINSILEHHRRGAVRWPVFAWMTLGILIGSALGALTAAQIK
                     GLLLQKIIGVFAILVALQMVLDLKPKGSREVPGKGGLTLAGAVIGWASAIFGIGGGSL
                     TVPFLSWRSVPMQQAVATSSACGLPIAISGALSFIAVGWHNPQLPEWSLGYVYLPALV
                     GIAATSMLFARFGARLAHRLSPRVLKRLFALLLFSVGISFLTPDLAFLS"
     gene            488096..488896
                     /locus_tag="HWH41_02325"
     CDS             488096..488896
                     /locus_tag="HWH41_02325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="QOD45766.1"
                     /translation="MLTYPQIDPVALAIGPLKIHWYGLMYLIGIGGAWLLASRRMKRF
                     DPTWTKERLSDLVFWVACGVILGGRLGYVLFYNLDEYIANPTLIFEVWKGGMSFHGGL
                     LGVMLAVWWFGKRHGKSFFQLMDFIAPLVPIGLGAGRIGNFINSELWGKVSDVPWAMV
                     FPNGGPLPRHPSQLYQFALEGVALFVILWLFTRKPRPTASVSGLFVLCYGIFRFVVEF
                     VRVPDAQLGYLAWGWLTMGQVLCVPMVLAGIALMVWAYRRDAAQPKTA"
     gene            489102..489896
                     /locus_tag="HWH41_02330"
     CDS             489102..489896
                     /locus_tag="HWH41_02330"
                     /EC_number="2.1.1.45"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003110588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="QOD45767.1"
                     /translation="MKQYLDLMRHVREHGTFKSDRTGTGTYSVFGHQMRFDLAAGFPL
                     VTTKKCHLKSIVHELLWFLKGSTNIAYLKEHGVSIWDEWADENGDLGPVYGYQWRSWP
                     APDGRHIDQIANLMAMLKKSPDSRRLIVSAWNPALIDEMALPPCHALFQFYVADGKLS
                     CQLYQRSADIFLGVPFNIASYALLTLMVAQVAGLQPGEFIWTGGDCHLYANHLEQADL
                     QLTREPLPLPSMKLNPEVKDLFDFRFEDFELVGYEAHPHIKAPVAV"
     gene            complement(489923..490720)
                     /locus_tag="HWH41_02335"
     CDS             complement(489923..490720)
                     /locus_tag="HWH41_02335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FkbM family methyltransferase"
                     /protein_id="QOD45768.1"
                     /translation="MPFVSYAQNLEDVRLWRALKLFPRGFYIDVGANHPRIDSVTLAF
                     YERGWRGINIEPLPHLHRELERERPEDLNLNLAIGEREGRATLYEMAASGLSTLDPEL
                     ARQRQAEGCTATPREVKVSTLDAICAAHVEGPIHFLKIDVEGLEGAVLRGLDLNRWRP
                     WLILAETPFDHDPEWKAPLLAAGYRFVHFDGLNGYYLAEEQARLEGAFALPPNLLDDF
                     QLCHGHAMSHPVAPLEQALEQALQRAEDAERALRDWRALPWYRRLFG"
     gene            complement(490755..492134)
                     /locus_tag="HWH41_02340"
     CDS             complement(490755..492134)
                     /locus_tag="HWH41_02340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase/DUF3482 domain-containing protein"
                     /protein_id="QOD45769.1"
                     /translation="MTEPLILAVVGHTNTGKTSLLRTLTRDRGFGEVSHRPSTTRHVE
                     GARLSVDGEALLELYDTPGLEDAIALLDYLDALERPGERLDGPERMARLLDSNEARGR
                     FEQEAKVVRQLLASDAGLYVIDAREPVLAKYRDELAVLAGCGRPLLPVLNFVASPQHR
                     EEEWRAALARLGLHALVRFDSVAPPLDGERRLYESLALLLERARPQLDRLIADHETQA
                     AARLRAGQRLIAELLVDVAACRRLVPGGESAVQEATRDLHQQVRKREQACVEALLRLY
                     AFARDDARAADLPLLDGRWGDDLFNPETLRQLGIRLGGGVAAGAAAGAGIDLLVGGVT
                     LGAAAALGALAGGAWQTVGHYGSRLLGKLKGARELTVNDAVLRLLALRQRQLLAALQT
                     RGHAAIEAIRLETPEDKQWREGKLPEALRKARAHPEWSSLNGRRVSGSDRQEQIDALA
                     ELLESGRGE"
     gene            complement(492127..493512)
                     /locus_tag="HWH41_02345"
     CDS             complement(492127..493512)
                     /locus_tag="HWH41_02345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2868 domain-containing protein"
                     /protein_id="QOD45770.1"
                     /translation="MSHTTHPGLDALWLTEAVRLREEQAGPLEDSEALRQALAQGGSL
                     PRRILTRAHWLGRREGLLDAQRTWRQGSRLALALLLVLALASGAGLAFAALGDGQRPV
                     NVFWALASLLGLHLLTLLGWALGLLAGGEAAGALGRLWLWLSGKLARDARAAHLAPAL
                     LVLLGRRRLARWGLGALVHGLWLLGLLTALAMLLGLLATRRYGFVWETTILGSDTFIA
                     LTQALGALPALLGFPLPDAELIRASGDAALASEAARHAWAGWLVGVLLVYGVLPRALL
                     GLFCLWRWKRGLADLDLDLDDPGYSLLRERLMPASERLGVSDAAPDWLPEPQGGQSGQ
                     EAAGAVLVAVELDDRRPWPPKLAEGVADAGILDDGQQRRRLLDQLTRYPPARLAIACD
                     PRRSPDRGTLALLGELARCAASTRIWLLQAPPGEALDSDRLGDWHTALERLQLPHGET
                     SPLAWLETGHD"
     gene            493704..494066
                     /locus_tag="HWH41_02350"
     CDS             493704..494066
                     /locus_tag="HWH41_02350"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45771.1"
                     /translation="MKVVRRYPLALLLGMAGALADELPDGSLLQRYGVQADQLPTLAA
                     DPPSRKEEKETPSRFRVEPEQPLVTFGVKDHKGVEPTGNLSIDAMHERDRRICRNIRR
                     QALEKGKAQPFDGYIECP"
     gene            complement(494103..495254)
                     /locus_tag="HWH41_02355"
     CDS             complement(494103..495254)
                     /locus_tag="HWH41_02355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphodiester phosphodiesterase"
                     /protein_id="QOD45772.1"
                     /translation="MQPAFLRRHLGAACLMLAAGLASAAHADTGNVQRAIDWAQGQAS
                     VRHPAGHERSPLVIAHRGASGYVPEHTLGAYALAVMMGADYVEPDLVMTRDGKLVARH
                     DNELGLTTDVAQHPEFADRKRTQKVDGVELTGWFSEDFTLAELKTLRAIERIPTIRPG
                     NARLDGTFEIPTLQEIIDLVKSLQISQQRTIGLYPEIKHGTHFQRLGLAMERPLVKTL
                     HRNGYLGPRAPVFIQSFEVNNLKELKRLTGIRLVQLYGSGQPYDQQASGGSLTYAEMA
                     TAKGLRQVARYAYGVGPDKSYVIPRDANGNLGQPTRFVGDAHAAGLKVHPYTFRAENS
                     FLPAEFRSADGNPQSRGDLAGEIRAYLDAGIDGLFSDQPDVAVRLREQR"
     gene            495464..496558
                     /locus_tag="HWH41_02360"
     CDS             495464..496558
                     /locus_tag="HWH41_02360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45773.1"
                     /translation="MASAQPASAFPCLSLQLACLLLGAWLAFDAHGGGQAVAPPARVE
                     ARVPTAATDDWGRQPDSLMSAVPPRTLEASVGARGSGSASSRLWIADTDFRLHDDIGF
                     FIQRMLIRMEPTRPGAPLSLDDPTAMVARIQAGEIFVSDATLATLLNQDLAASRAAVR
                     NLRMSTRKDGQEVRGELLRKGRWRPLRMLTEIELSGPLEVTLVPRRIFVDGVEVTSSL
                     AAASIEMSEVLKLKTRHMELVGNRIRVDLDGLFPPPRLDFRVSRLALADGGMQLALGD
                     SLADLQWPALRAPDSYMFIEGGDIKMARTVLVKAYALFTSLSPGQPLLFNLYDYRRQL
                     QNGVIRLREDGMVQIAVSPVKAPAPLEARL"
     gene            496555..497595
                     /locus_tag="HWH41_02365"
     CDS             496555..497595
                     /locus_tag="HWH41_02365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QOD45774.1"
                     /translation="MSRRPWGVLLGWCLLAASAVQAESAIDRQQRELALLREGWYRQV
                     PPAPVPLPMRTAGPADSGQDGVGILLRNVDMYLRGNIGFHVPEVKGWLVPNRAGQPVD
                     FDRPQDMHFQVMEGEVLLSPRQLANLFNEHILAYDGTMLKDFRMSSAAGRLEVEGRVR
                     PLGVGPWLPLRLGGGVEVDAASGALVYRPDQLKVIGLPLYGAMSLVGLPMSALVSLDR
                     PGASLVGSAMRLDYRKVFPLLGIDGHVQEAWLDDQGLHLRFSQAPGQPSPVFSPPAAA
                     GPSFLWLQSGDLKIFEILITYAQVLLKTETPDQVLTFNLQDYRKVLATGTTQVNEDGT
                     FFMQVPPYANPL"
     gene            497666..498172
                     /locus_tag="HWH41_02370"
     CDS             497666..498172
                     /locus_tag="HWH41_02370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="QOD45775.1"
                     /translation="MARPLAMIAALGENRAIGIDNRLPWRLPADLKHFKAMTLGKPVI
                     MGRKTWDSLGRPLPGRLNLVVSRQAGLALEGAEVFASLDAALARAEAWAQAEDADELM
                     LIGGAQLYAEALPRAARLYLTRVGLAPEGDAFFPEIDGAAWRLASSIEHAAADDAPAY
                     AFEVWERR"
     gene            complement(498188..498661)
                     /locus_tag="HWH41_02375"
     CDS             complement(498188..498661)
                     /locus_tag="HWH41_02375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /