LOCUS       CP024785             8363872 bp    DNA     circular BCT 07-DEC-2017
DEFINITION  Nostoc flagelliforme CCNUN1 chromosome, complete genome.
ACCESSION   CP024785
VERSION     CP024785.1
DBLINK      BioProject: PRJNA407846
            BioSample: SAMN07658063
KEYWORDS    .
SOURCE      Nostoc flagelliforme CCNUN1
  ORGANISM  Nostoc flagelliforme CCNUN1
            Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
REFERENCE   1  (bases 1 to 8363872)
  AUTHORS   Shang,J.
  TITLE     Complete genome of a free-living desiccation-tolerant
            cyanobacterium and its photosynthetic adaptation to extreme
            terrestrial habitat
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 8363872)
  AUTHORS   Shang,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-NOV-2017) College of Life Sciences, Central China
            Normal University, Central China Normal University, Wuhan, Hubei
            430079, China
COMMENT     Bacteria and source DNA available from the submitter.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: APR-2016
            Assembly Method        :: HGAP3 v. v2.2.0
            Expected Final Version :: yes
            Genome Coverage        :: 228.0x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..8363872
                     /organism="Nostoc flagelliforme CCNUN1"
                     /mol_type="genomic DNA"
                     /strain="CCNUN1"
                     /isolation_source="desert soil"
                     /db_xref="taxon:2038116"
                     /country="China: Sunitezuoqi"
                     /collection_date="2005-09"
     gene            complement(11..757)
                     /locus_tag="COO91_00001"
                     /note="Nfsy_R00001"
     CDS             complement(11..757)
                     /locus_tag="COO91_00001"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34191.1"
                     /translation="MKRLAAWIDKQFNLKCCRESIRKTLKNLGFSWKKARKLLNKANS
                     KKRREFLEKLKGLLDDALHNGHLLIFIDEAHIHLDSDEGYGWSVKGERFWVSSNSPGR
                     AKVSFYGIYVYNYAKVKIFPYLKADQFNTIDVLKHLRTEFPDQEVTLIWDGAPYHRAQ
                     LVNEALQVLQINLQPLPSYSPDFMPVEHLWQWLREDVTYHTCYQSAAELIERVHLFEQ
                     DIHSNPFEISDRLWVKNHLDPDEEKLRVST"
     gene            complement(856..1122)
                     /locus_tag="COO91_00002"
                     /note="Nfsy_R00002"
     CDS             complement(856..1122)
                     /locus_tag="COO91_00002"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34192.1"
                     /translation="MLRVECDRWNESASKLREEALKANHARTRERLMALYEICNGKSA
                     TKVGRETGRNPQTVMEWVHRYNLSGIKALLYQRTGGHPPFFPQK"
     gene            1677..2225
                     /locus_tag="COO91_00003"
                     /note="Nfsy_F00003"
     CDS             1677..2225
                     /locus_tag="COO91_00003"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34193.1"
                     /translation="MLIFIDEAHIHLDSDEGYGWSVKGERFWVSSNSPGRAKVSFYGI
                     YVYNYAKVKIFPYLKADQFNTIDVLKHLRTEFPDQEVTLIWDGAPYHRAQLVNEALQV
                     LQINLQPLPSYSPDFMPVEHLWQWLREDVTYHTCYQSAAELIERVHLFEQDIHSNPFE
                     ISDRLWVKNHLDPDEEKLRVST"
     gene            2318..2953
                     /locus_tag="COO91_00004"
                     /note="Nfsy_F00004"
     CDS             2318..2953
                     /locus_tag="COO91_00004"
                     /codon_start=1
                     /transl_table=11
                     /product="Site-specific DNA recombinase"
                     /protein_id="AUB34194.1"
                     /translation="MVIYAYLRVSSDRQDLHNQRHGILEYANIHALSPIQFIEDTVSG
                     REKWSERGVGQLLTQTALESDVVIFSEVSRMARSTLQVLEMLECCVRRGINVHIVKLG
                     MVLDDSMQSRITATVLGLAAEIERELIVLRTTEALAKRKAEGKTLGRPKGRQSAHLKL
                     DTREAEIRSYLAKGMSKRSIAKLVDCSPSTLYDWLSRKHLHSRHDKLVEKS"
     gene            2955..4604
                     /locus_tag="COO91_00005"
                     /note="Nfsy_F00005"
     CDS             2955..4604
                     /locus_tag="COO91_00005"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase InsO"
                     /protein_id="AUB34195.1"
                     /translation="MPKKQIPIDTIVDLRRRLEQLPPRSPSRRVLVQEIAQLYGISED
                     TVYRTLREGNVVRPVRRVDCDVPRVIPKAGLERYCEIIAAIKIRTSNRKGRHLSTVQA
                     IRLLEEDGINTPDGHLRVPVGLLKPTTVNRYLNKWGYDRDTLLRQPPAVRFQAEYSNQ
                     CWHFDLSPSDLKHVKAPAFLEPGRGHPLLMLYSVVDDRSGFAYQEYHGVYGEDVEAAL
                     RFMFAAMSLKSETDFPFQGIPQMLYMDNGPIAKSLVFQKVMGYLGIEVRTHLPNGKDG
                     RRVTARSKGKVERPFRTVKEMHETLYHLHEPETEAEANAWLMKFLLHYNSRPHRSEPH
                     SRMEDWVSNLPSNGIRQMCNWERFCTFARSPERRKVGIDARVTVEGVAYEVEPDLAGE
                     TVVLWWGLFDNELYVEHGERRYGPFLPVDGPIPLHRYRSFKKTRTQKRADRIESLAKQ
                     LSLPNSVIGKGNPPEFGSSTTQLKVQPFVDPNPFQELTFSTVIAAKLAIADYLARPLA
                     KLTPEQMAYINAVLVSTLNKQEVMKQIRDFFNPLSGTSHVE"
     gene            4594..5583
                     /locus_tag="COO91_00006"
                     /note="Nfsy_F00006"
     CDS             4594..5583
                     /locus_tag="COO91_00006"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II secretory pathway, component ExeA"
                     /protein_id="AUB34196.1"
                     /translation="MLSDVMTYFGLKRTLDHVGYFETQEQTNLFKELKPQIRQGRLIA
                     LTGVVGCGKTTTLQRLQLELSSEKDIIISRCLAIDKDKVSVGVLMSALFCDLSTEKDA
                     KPPTQPELRERKFLALIQKCRKPVVLFVDEAHDIHHGTLVKIKRLIELVRQNGCTLSV
                     VLLGHPKLKNDLRRPSLEEIGARTNIFSLEGIRGHQVEYIKWLLSECIHDDYLPEDLI
                     TNEAIAFLAERLTTPLQIEHYLQRAFEDAYQAATKPVTLGMAEAVLTVGLNDLEPRLI
                     RHGYTKTVLAELLNIRVSEVNSFLHAQLPPGRTQDLRDQMLKIGIPLYASEGN"
     gene            5852..5971
                     /locus_tag="COO91_00007"
                     /note="Nfsy_F00007"
     CDS             5852..5971
                     /locus_tag="COO91_00007"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34197.1"
                     /translation="MVSKSPCLRFKAFMFAVRYNYPQFFAASILKIKFPNHLR"
     gene            6008..6736
                     /locus_tag="COO91_00008"
                     /note="Nfsy_F00008"
     CDS             6008..6736
                     /locus_tag="COO91_00008"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator, IclR
                     family"
                     /protein_id="AUB34198.1"
                     /translation="MIPKPERDSNTKVSGKFYPLQNTEWVKACKELTHTQLSVLYYLR
                     SADPYSNGMKIRASRIADELQISRQAVYKAIDALSEKEYIEKEDVEYSLKLRSRGCLC
                     DSLENRPQLSTDGDSCKLEATVVNAGRQLSTDGDSCKLEATVVNAGRQPEAETLVEEE
                     SQSSKINKTYSDFKKTLSEDERENFIEFAKKKAAQLPNPPYFHSAGLRRILMNCVVSG
                     TSPRVKCPRRNLQNGKLTPGVKSG"
     gene            complement(6910..7026)
                     /locus_tag="COO91_00009"
                     /note="Nfsy_R00009"
     CDS             complement(6910..7026)
                     /locus_tag="COO91_00009"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34199.1"
                     /translation="MRSRSELYVGITSLARCGSTMPKSLQQKHLQEGCQISF"
     gene            7094..7366
                     /locus_tag="COO91_00010"
                     /note="Nfsy_F00010"
     CDS             7094..7366
                     /locus_tag="COO91_00010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34200.1"
                     /translation="MRFTAAICQELDRINRENWRQATQQQFERYKNQVDIATGAIAQS
                     HSLAVTNRTSNDDREVAQRKAEIEAISPEQWEAMNKAYLVGSNKDE"
     gene            7359..8057
                     /locus_tag="COO91_00011"
                     /note="Nfsy_F00011"
     CDS             7359..8057
                     /locus_tag="COO91_00011"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34201.1"
                     /translation="MSKYSIGDFKVGDRIIASGNRLGMVSSVHSKKITITWENGLSAE
                     YTPKQMQAWNYKKLSEEKEAIASCQDSHNLTSAQELEPIFAMQDSSTDLNLSEPQRLT
                     ITAQASSNCDIPAYTTTATCEISQDLLNADSDTICTPIESIYLQLPHPAPHSPQKANG
                     LEAQTSVIASPQSSKPLENYSQGLQPLKMSQDSSPAPITQDNPQAHISYHVRIIAYDK
                     SNEYKYDLCRNESI"
     gene            8036..8527
                     /locus_tag="COO91_00012"
                     /note="Nfsy_F00012"
     CDS             8036..8527
                     /locus_tag="COO91_00012"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34202.1"
                     /translation="MPKRINIAEHSNISELEQLYKHAKDAIESRQYQIIWLLAQGKKT
                     EEVEEITGYSRTWIYALVKRYNELGICGIGDRRSENQGVKALGDDIHQALLWQALQDN
                     APDGGFWNGRKVADWLSEVTGITISRQRGWEILRQMTFRLRVPRPSHTESDPVEQEAW
                     KKN"
     gene            8664..9098
                     /locus_tag="COO91_00013"
                     /note="Nfsy_F00013"
     CDS             8664..9098
                     /locus_tag="COO91_00013"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34203.1"
                     /translation="MSIGDLSGYGCMHSYILKQEKQKAWILPYVNTELFNQVLADFAR
                     EFELGAKKHILLAVDRAGWHISHDLKIPVGLHLTLLPSHSPELQPAERLWTLVDEPIA
                     NQSFKTLDDLEEVLFQRCQSLLQMKDFIQGLTGFHWWIKIGV"
     gene            complement(9082..9195)
                     /locus_tag="COO91_00014"
                     /note="Nfsy_R00014"
     CDS             complement(9082..9195)
                     /locus_tag="COO91_00014"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34204.1"
                     /translation="MAATDSKPFRIVPEKVKGVDHASDIMSGKSLTIKLRF"
     gene            9164..10057
                     /locus_tag="COO91_00015"
                     /note="Nfsy_F00015"
     CDS             9164..10057
                     /locus_tag="COO91_00015"
                     /codon_start=1
                     /transl_table=11
                     /product="PUA-like domain"
                     /protein_id="AUB34205.1"
                     /translation="MRNGLLSVAAILPAPTLESEYCWLRSPGALSSTGKGRPPGLTKQ
                     EAGLKNLGAIKSGQVVNPEFLESSYALPLGWTDPQENRSALELLAKMELSELAAPPLE
                     TPLIGELRVSDFAALPTLIPYVENQQLQKLKAITLHQPWAYLVGRYKWFETRSWSTNY
                     RGKIAIHAAKKQHDTDEWCSLLEDLLPPVEELVFGAVVAIADLTDCILMTEEFISQQS
                     ETELKCGLWEPGRYAWKLENIQILPEPIPARGKQGLWNIELPFALAQPAAGIAPQSLI
                     DRFLEENRDYECTQQSEAEWH"
     gene            10048..10218
                     /locus_tag="COO91_00016"
                     /note="Nfsy_F00016"
     CDS             10048..10218
                     /locus_tag="COO91_00016"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34206.1"
                     /translation="MALRKGKIVEAALVQRSKGAGEKEEILGIRTEKIEIPLCPPAPL
                     PLEHPYAAYLSA"
     gene            10568..11608
                     /locus_tag="COO91_00017"
                     /note="Nfsy_F00017"
     CDS             10568..11608
                     /locus_tag="COO91_00017"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34207.1"
                     /translation="MHMQNLGGMRDSNESNVFDTTDFDEGYLGPYVWDLRRMAVSILL
                     AAKENALSSSDAQDIVRNFLDAYLNKMSDFKGTNDELSYRLSESNTNGVVKDLIQEAA
                     GKGRSSLLNKYTLVNSSSNRVFQTTSELQPVSSSTYSDITGAMSSYIASIPSSKRYSN
                     SYYTLKDIRLKLGSGTGSLGKYRYYLLIVGPSSATDDDRILEMKQEGSSAVAIAVPGL
                     LPSSIYGNHEGARVTIATKAMLSNTDPLIGYTTVSSIPFMLHEKSPYQVDFDYTLLTT
                     KSKFMDAMGYSGKVVAKNHAISDKDYDAAIIAVSVDKEVTDITNGNKAVFKDEIVNFA
                     LDYVTQVEYDYV"
     gene            complement(11930..12526)
                     /locus_tag="COO91_00018"
                     /note="Nfsy_R00018"
     CDS             complement(11930..12526)
                     /locus_tag="COO91_00018"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II secretory pathway, component ExeA"
                     /protein_id="AUB34208.1"
                     /translation="MTLTRKNYGFQRRRGLIELVRQNGCTLSVVLLGHPKLKNDLRRP
                     SLEEIGARTNIFSLEGIRGHQVEYIKWLLSECIHDDYLPEDLITNEAIAFLAERLTTP
                     LQIEHYLQRAFEDAYQAATKPVTLGMAEAVLTVGLNDLEPRLIRHGYTKTVLAELLNI
                     RVSEVNSFLHAQLPPGRTQDLRDQMLKIGIPLYASEGN"
     gene            complement(12489..13235)
                     /locus_tag="COO91_00019"
                     /note="Nfsy_R00019"
     CDS             complement(12489..13235)
                     /locus_tag="COO91_00019"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34209.1"
                     /translation="MKRLAAWIDKQFNLKCCRESIRKTLKNLGFSWKKARKLLNKANS
                     KKRREFLEKLKGLLDDALHNGHLLIFIDEAHIHLDSDEGYGWSVKGERFWVSSNSPGR
                     AKVSFYGIYVYNYAKVKIFPYLKADQFNTIDVLKHLRTEFPDQEVTLIWDGAPYHRAQ
                     LVNEALQVLQINLQPLPSYSPDFMPVEHLWQWLREDVTYHTCYQSAAELIERVHLFEQ
                     DIHSNPFEISDRLWVKNHLDPDEEKLRVST"
     gene            complement(13334..13600)
                     /locus_tag="COO91_00020"
                     /note="Nfsy_R00020"
     CDS             complement(13334..13600)
                     /locus_tag="COO91_00020"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34210.1"
                     /translation="MLRVECDRWNESASKLREEALKANHARTRERLMALYEICNGKSA
                     TKVGRETGRNPQTVMEWVHRYNLSGIKALLYQRTGGHPPFFPQK"
     gene            14115..14318
                     /locus_tag="COO91_00021"
                     /note="Nfsy_F00021"
     CDS             14115..14318
                     /locus_tag="COO91_00021"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34211.1"
                     /translation="MEPNQLNLFPEVKPTPALLTEALVMSADALLKWKSQILDYQQKV
                     RENKPPEQVTLFDIAPNHCLTVM"
     gene            complement(14351..14476)
                     /locus_tag="COO91_00022"
                     /note="Nfsy_R00022"
     CDS             complement(14351..14476)
                     /locus_tag="COO91_00022"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34212.1"
                     /translation="MRSLPTQAIAYFPRLILTDKFFLLAFPFCFAKLHQRLKQCL"
     gene            14534..14680
                     /locus_tag="COO91_00023"
                     /note="Nfsy_F00023"
     CDS             14534..14680
                     /locus_tag="COO91_00023"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34213.1"
                     /translation="MIGTPTRAPKPRGKSPGWEPGKKRHRKNRYPIVKKTVTPPLKEP
                     SIAV"
     gene            15142..15933
                     /locus_tag="COO91_00024"
                     /note="Nfsy_F00024"
     CDS             15142..15933
                     /locus_tag="COO91_00024"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34214.1"
                     /translation="MSKAYPSNLTRVQYEFLSEMIPEPKPGGRKREVDIWEVLNGIFY
                     VLVEGVRWRSLPGDFPAWQTVYTYFRNWRKDGTWLEIHDTLRQWTRIEQERHSSPSEA
                     IIDSQSVKTAAMVHKAVGYDAGKKIKGRKRFMTVDTLGLVLRVLVTAASVGEREGGKK
                     VLKRVKQSSNQVSRLTTIWVDGGFNGDPFMQWVMDFCRWIVQVVLRPEQTKGFVLLKK
                     RWVVERTFGWLMGCRRLVRDYELLPETSETFIYLAMIRIMVRRLA"
     gene            complement(15945..16682)
                     /locus_tag="COO91_00025"
                     /note="Nfsy_R00025"
     CDS             complement(15945..16682)
                     /locus_tag="COO91_00025"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34215.1"
                     /translation="MALADADHKHSNQHTAEKPKDAVEHSEVIFQAIGVIVGEVNISS
                     SGEKTITINGSTYQFFYIPRKVREFELLAKEIETTGNHTQRLLVYPRVMHFPRKEQPY
                     QISFQLLAFDRGQERDVYLRKLKDFEFHLSGLWQFIPVCRFPCISIFRNFSFERLEYI
                     KQAEPMTKVQYMKASHLPILWKDALVEPFKFNPKAEQDQGYPMFVSIKAKFIPQKNVF
                     SFDALLSLPQETLPRFLKVSKRLFEKF"
     gene            17003..18259
                     /locus_tag="COO91_00026"
                     /note="Nfsy_F00026"
     CDS             17003..18259
                     /locus_tag="COO91_00026"
                     /codon_start=1
                     /transl_table=11
                     /product="Helix-turn-helix domain"
                     /protein_id="AUB34216.1"
                     /translation="MIASERDAQTQKVESSAEVTLSLPFIPAWLDDYGLNPPEFRVYA
                     HIARRAGKTGKCWESVVNIAKACRLCRNLTLKALHSLTEKYRLLIRNKREGETYEYSL
                     APQSEWAPPVPPEDRCLSRTKREKAPTDPSLQGTGSDTLEEHQPVAGEDTKVIQFKEY
                     QERQQQDNVVVPIDFEKLSIWRRNQDATRYCQIPPIYDEATGVEVQQQMDTEGITAQK
                     VVSRAIALSKVPRLLLEIMASVGEKLVNVCKSLEEGLQKPNNQKQTQKIDTTKPSSVP
                     ETDSIPEHEFQHLKEQGIYLNRAVADKLWLKHSSEFADAIAYVLSKDKVKDKAAYFRK
                     CLEQGWLKDSKSQRRDPYELNEEQKQWYEWASSCGLCDGRPIRHCCLMNGEVAIVVFE
                     PELKCHTPMPLSRAMQKYPYLQLEGV"
     gene            complement(18329..18499)
                     /locus_tag="COO91_00027"
                     /note="Nfsy_R00027"
     CDS             complement(18329..18499)
                     /locus_tag="COO91_00027"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34217.1"
                     /translation="MALRKEKIVEAAGVQRSGGAGEKEEVLGIAFGYLEIPLCTPAPL
                     PLCNPYAAYSSA"
     gene            complement(18977..20773)
                     /locus_tag="COO91_00028"
                     /note="Nfsy_R00028"
     CDS             complement(18977..20773)
                     /locus_tag="COO91_00028"
                     /codon_start=1
                     /transl_table=11
                     /product="P-loop containing nucleoside triphosphate
                     hydrolase"
                     /protein_id="AUB34218.1"
                     /translation="MLYDKKALLVVDDAWNPEHVEPFRVGGSDCRVLVTTREAVIKGA
                     TAYKLDVLTPDESIKLLEKSCSSLKLEERHLAQELAATVGYLPLALDLAASQVAEGVT
                     WTELLEDLQKDIAYLETLDLPGLEKYSTEEKRKHYSLIASFNLSLRSLTPEMLQQFAW
                     FGVLPEDVNITPAMAATLWAITPRQALTTLRSFKTKALVLPGITLNEQQTYRLHDLMH
                     DMAKRSLVSEPSPYQPHELPGLGLKLAEAHSQLLERYQNKTTSGLWHTLEDDGYIYAN
                     LSWHLEQAQRVEDLHQLFEEETEKGHNGWYEACDRLGQNGIFVTDVARAWRLAEDMYT
                     ENSSNSIYLQCFYALITASLNSLVANLPNDLLIALVNKKVWTPNQGLAYALQSSNPSQ
                     KADSLTALANHLPPNLEKLALEKALAAAKLIQDERHRAEALFALVDKRPELLPEALAA
                     ARQIQNEESRAIEALFALVDKLPSELLLEILVAAKQIQDEESFPEALFALVDKLPPEL
                     LPEALAAAKLIQDEEYRADALSALAILLSRIPTDQLFSFWKQILHELSLRTRQNLLAD
                     IEKLVPVIFALGNDAAIASVNCAIQDVARWWH"
     gene            21152..22461
                     /locus_tag="COO91_00029"
                     /note="pseudogene"
     gene            22680..22868
                     /locus_tag="COO91_00032"
                     /note="Nfsy_F00032"
     CDS             22680..22868
                     /locus_tag="COO91_00032"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34219.1"
                     /translation="MDILDTSTGQDTAIGEMIQLVEAIARHLRPAERLQHLKKLRRFK
                     RILNFRVNLLAGLVAYNH"
     gene            23063..23503
                     /locus_tag="COO91_00033"
                     /note="Nfsy_F00033"
     CDS             23063..23503
                     /locus_tag="COO91_00033"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34220.1"
                     /translation="MAKKYTVNLSNEEVEKLRSLIKTGKSKARTITRAHILLMASEGE
                     TDATIADRLRVSVSTVERTRAKLIKSGIEGTLNDRPHPPKPRKLDGFKEAFLIATACS
                     KPPNGRTRWTLKLLADRIVRIEIVDSISYETVRSYLKKTMSNRG"
     gene            24259..24738
                     /locus_tag="COO91_00034"
                     /note="Nfsy_F00034"
     CDS             24259..24738
                     /locus_tag="COO91_00034"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34221.1"
                     /translation="MAAGNIMAKKYTVNLSKEEVEKLRSLIKTGKSKARSMTRAHILL
                     MAWEGEIDKAMPKAGYAYAECLRVHVSTVERTRARYVEGGIELAVQDRPHPPKQRKLD
                     GEQEAFLIATACSKAPSGRNRWTMKLLAERIVSLNIVDSVSKETVRSYLKKTKLNLG"
     gene            24762..25436
                     /locus_tag="COO91_00035"
                     /note="Nfsy_F00035"
     CDS             24762..25436
                     /locus_tag="COO91_00035"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34222.1"
                     /translation="MDAEYVLRMEDLLDLYSQPYDPKHPVICFDERPYPLLEDVRERL
                     PPEPEQPERYDYEYKRNGSVNLFAIFEPHKGWRHIEVTQQRTKKDFALQMKNLVDIHC
                     LQAESIRLVVDNLNTHNPSALYEVFPPEEARRIVQKLEFHYTPKHASWLNQVEIEFSV
                     LSRQCLERRIADVQTLSQEIAFWESDRNSQKASVNWRFKITDARKKMGRLYPDASPIK
                     VRLADY"
     gene            complement(25696..25812)
                     /locus_tag="COO91_00036"
                     /note="Nfsy_R00036"
     CDS             complement(25696..25812)
                     /locus_tag="COO91_00036"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34223.1"
                     /translation="MQGFYSIKYLWKFPDKILVVTSFGVLLSRLLLNSLLHG"
     gene            26062..27550
                     /locus_tag="COO91_r01"
     rRNA            26062..27550
                     /locus_tag="COO91_r01"
                     /product="16S ribosomal RNA"
     gene            27961..30854
                     /locus_tag="COO91_r02"
     rRNA            27961..30854
                     /locus_tag="COO91_r02"
                     /product="23S ribosomal RNA"
     gene            31020..31137
                     /locus_tag="COO91_r03"
     rRNA            31020..31137
                     /locus_tag="COO91_r03"
                     /product="5S ribosomal RNA"
     gene            complement(31505..31720)
                     /locus_tag="COO91_00037"
                     /note="Nfsy_R00037"
     CDS             complement(31505..31720)
                     /locus_tag="COO91_00037"
                     /codon_start=1
                     /transl_table=11
                     /product="Winged helix-turn helix domain"
                     /protein_id="AUB34224.1"
                     /translation="MKRLAAWIDKQFNLKCCRESIRKTLKNLGFSWKKARKLLNKANS
                     KKRREFLEKLKGLLDDALHNGGMTKYV"
     gene            complement(31819..32085)
                     /locus_tag="COO91_00038"
                     /note="Nfsy_R00038"
     CDS             complement(31819..32085)
                     /locus_tag="COO91_00038"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34225.1"
                     /translation="MLRVECDRWNESASKLREEALKANHARTRERLMALYEICNGKSA
                     TKVGRETGRNPQTVMEWVHRYNLSGIKALLYQRTGGHPPFFPQK"
     gene            complement(32176..33801)
                     /locus_tag="COO91_00039"
                     /note="Nfsy_R00039"
     CDS             complement(32176..33801)
                     /locus_tag="COO91_00039"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34226.1"
                     /translation="MRASPLNIRVQDIDHCGIVAGICDEMNLVEQINRLLGTHSQEII
                     SAGQVVKAMILNGLGFVSAPLYLFEKFFVGKATEHLLGEGIRPEHLNDDRLGRVLDKL
                     YEAGLTEVFVTVAICAARKFGVKMDSLHLDSSSFHVDGDYINNPTAQEAAEPGGIEIT
                     YGYSRDHRPDLKQFILDLMCSGDGDIPLYLRVGDGNESDSAMFATIIADFQRQWQIDA
                     LFVADAALYTEENLQQMKHLRWVSRVPGTLTAAKMLSENIPEQAFNDSAMPGYEIAAI
                     CSEYGGIRQRWLVVESQARKDADLKQLEKRLTKQLSKAQSELRLLLNQEFACSKDALI
                     AAQRLSSKLPLHQLANIQVNEVKKHTGRGRPSKDASPTFYYQVDASLEPKEIAIAIET
                     KRAGRFILATNVLDAEELSNDDILREYKAQQSTERGFRFLKDPLFFTSSVFLNSTERV
                     AALAMVMGLCLLVYSLGQKALRQALERAKKTIDNQLGKPTSTPTLRWVFQCFMSIHLV
                     TIAQIKQIANLTHERQWILQFFGAPCRKYYLLS"
     gene            complement(34147..34431)
                     /locus_tag="COO91_00040"
                     /note="Nfsy_R00040"
     CDS             complement(34147..34431)
                     /locus_tag="COO91_00040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34227.1"
                     /translation="MLSGTIQPYSQRQTVLRTDDGDFLIPGQEIHRLGLWRMLRLGLL
                     WGQKATAQADQSFMNDTQFLGIIGIIKFNTLQLENLSALIEASKQLQRQT"
     gene            34566..34733
                     /locus_tag="COO91_00041"
                     /note="Nfsy_F00041"
     CDS             34566..34733
                     /locus_tag="COO91_00041"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34228.1"
                     /translation="MFDNTLTHGLRPKSHLEWFGLVCLGASSSLLSKILEAVSKKGSY
                     YSSKDEGEILL"
     gene            complement(34730..34951)
                     /locus_tag="COO91_00042"
                     /note="Nfsy_R00042"
     CDS             complement(34730..34951)
                     /locus_tag="COO91_00042"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34229.1"
                     /translation="MSARVERQNTITRKNLVSSLIIGLIVGLLAGLPLGWIAHQFYAE
                     RRLTDVLVCREKNRNLPEVQLQSLCGSRF"
     gene            complement(34989..37856)
                     /locus_tag="COO91_00043"
                     /note="Nfsy_R00043"
     CDS             complement(34989..37856)
                     /locus_tag="COO91_00043"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent exoDNAse"
                     /protein_id="AUB34230.1"
                     /translation="MASDSQIRALLKAWLDYIHVENLSNAKVEADDSEQPNIWDSLVN
                     LVGDKLLIDESLFKKLKQPFKSAKNFEQTKLPSIAVAFPQQYIVESNRRQFRPLFTIN
                     VSTLFEGNYRSSGWNLTDYEFQPVIPNLMQWYGLEEEAAESLVTREGLKVFLETTFNR
                     PFKTLQDFMGLIEIPPFPVRSKLLPYLLDFDYAAFNYNLKKDFQKISDQNYFQWSRPG
                     HPAYEYLFGQPKSPQHDVLFLGAFPNSQPDDYQALALKHSQSNPLTAVIGPPGNGKTT
                     LLLHKIAQQVVRRAVDLATTGEDRSNLTVVTSTNKFAVNNVEKILASNLTSDRFYLSG
                     GSRDLVDTQVLPSLQAALDWLAKETFNYDEWESTKQQLLAGVQQIESYRKQDSDELQK
                     ICVDEQLLDELCLDIQSVESALKTSAFESSSPLESGSDYSRFPVEAYQQIKQHLGSAR
                     RSLPRVDYWQPSLRDNKWFVQILQTIKRFWQSITKTSAHHVLKRLHKQIEMPVLATLA
                     TPFQFQIPLTTESLIAAQQSVDQLIAEASFWQQQQNGIDSTQQQIESRKQQREDLITR
                     RSQVESRLATYPTKDFYSRFYTELHSLQVELFEWSWQFQQQEALRRKDEVIASIRTYI
                     ALLNGEWDAYRQLSHNWRNIYRDISLLFPVFLCTLHSIRNLLPYPDSGCIDQVIVDEA
                     GQIPPHQVFPVLVRCNRALIVGDPLQLEPVVNLSDQKKEEYRSKSFLEQGLTDVDYDR
                     YSPTASTAYHRAAGASGQPQDIGQGIILKYHYRCVPMIADFCDRLCNYGMVIKTEPKA
                     SRLGTNLIACNVEGKLENNVNWAEVDAVEALIEELLAAGYCLNSPDSDNTIGVISPYR
                     RQVDALTQRLKSRWSDFSKQSIGTVHTFQGGQKSVIIFSTRQCSATDSLWFINRRPNL
                     LNVAVSRARELFILVGDLGRISEGGYTRDLVEYIKEFGETR"
     gene            complement(37940..39016)
                     /locus_tag="COO91_00044"
                     /note="Nfsy_R00044"
     CDS             complement(37940..39016)
                     /locus_tag="COO91_00044"
                     /codon_start=1
                     /transl_table=11
                     /product="parB, chromosome partitioning protein, ParB
                     family"
                     /protein_id="AUB34231.1"
                     /translation="MIRRKQTDKPFGGQITTPPPAPWLSSPDGNPAAATETTIKLSDI
                     VLPQHQPRRYFDPQALKELVSSVKQHGILQPLLVRPIGGGKYELVAGERRYRAGQEAE
                     LEVAPVVVRELSDDQAFQLALIENLQREDLNPIEETEGILHLLAIRLHCDVEAVKSLL
                     YRMKNAHSKGEQPSKSSLNESSKNVSPNPDNPQSEDNVSEHLAEKNESSKNVSPNLDE
                     EQSNTVQEVFLSLGLMNWLSFITTRLPLLNLPEEILMALRSGQLEYTKAQVLARVRNN
                     EIRKKLLSEAIANYWSLSQIKEKITAWTNVELTPDSKATNQIPDRLQNITQRIKKRQL
                     WKEKDKQKQLVNLLNKLEALLGDE"
     gene            complement(39013..39924)
                     /locus_tag="COO91_00045"
                     /note="Nfsy_R00045"
     CDS             complement(39013..39924)
                     /locus_tag="COO91_00045"
                     /codon_start=1
                     /transl_table=11
                     /product="parA, chromosome partitioning protein"
                     /protein_id="AUB34232.1"
                     /translation="MLLDSIKSTAEITVLARTSLLLIHFNKLETKTESVDQTSTYLLG
                     IMPVSTSDPLCRIIALFNQAGGVAKSTLTQNLGYHLAKREHRVLLIDIDPQASLTKFM
                     GLVPSQLQKTVADAIIDEQPLPIHEGIHGMDLVPASRVLSGAEMQLVSAAMRDLRLKE
                     AVEFVLEEYDFILIDCPPSLGLLSYIALVAATHVLVPVETHIKAFEGTDELLQTITHV
                     KNKANRKIQIAGFIPTRYAQQNSADKRALAAITEQLSAWGRIFPPIPRATAFVDASEE
                     RAPLAVFDPKHPVVAILEEIAKALEAL"
     gene            39937..40152
                     /locus_tag="COO91_00046"
                     /note="Nfsy_F00046"
     CDS             39937..40152
                     /locus_tag="COO91_00046"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34233.1"
                     /translation="MTTKQAIFEAIEQLPEQHQEDVLRYVQQLARTQKSPTTNSPTGS
                     SDPLANFIGAVSHGSLAANLDSELYGD"
     gene            40214..41923
                     /locus_tag="COO91_00047"
                     /note="Nfsy_F00047"
     CDS             40214..41923
                     /locus_tag="COO91_00047"
                     /codon_start=1
                     /transl_table=11
                     /product="Superfamily II DNA or RNA helicase, SNF2 family"
                     /protein_id="AUB34234.1"
                     /translation="METNYTFKFNSSTALEALKVGKYDPLNFYEARLNLFNLSVMADY
                     DQLICLPTLTAIDKYWYQIETARKVLRQLGGRALLADEVGLGKTIEAGLIIAEYLARG
                     MVQSMLVLTPASLVSQWQSELSDKFNIATITTDNRDPQQPIDEFWTNNPRIIASLNTA
                     KSAKHYPHVTSRTWDLVVVDEAHHLKNRTTLNWKLVNALNKRFILMLTATPVQNSLVE
                     LFNLLTLLKPGLLQTEAAFKKEYVDSRNGRVPKNPEKLRSLMREVMVRNTRALVDVKL
                     PKRFATTITVTPAAGEEKLYQDLSEYLRSSEDKLDRLSRTNLLMRAGSSPGALADSLK
                     QLSKRLPDEELKSLARRAAQVKQVEKAKVLVEMLSKSSQKTLVFTTHKATSTYLAQTL
                     QAANIPFAEFTGGMSLKQKDEAIAAFRDNVSVLLASETGGEGRNIQFANAIVNYDLPW
                     NPMKIEQRIGRIHRIGQTQDVFIFNFCLLGSIEEYILRILHDKINMFELVVGEIETIL
                     GNVDDEFDFSEIVMDIWLKHQVKPELDTAFEQLADNLLKAKNQYQQIQELDEQIFGED
                     FEA"
     gene            41943..42983
                     /locus_tag="COO91_00048"
                     /note="Nfsy_F00048"
     CDS             41943..42983
                     /locus_tag="COO91_00048"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34235.1"
                     /translation="MLSDPIIATLEKIVSLHDGIAEPAGEHILNVLLTENIASLLSLP
                     EEVTFTTIADVPQSVFVTYHSEVLNKLSELLAVKGLISALGVKIDGHLKNTGFEKILL
                     ERLAPQNGLIRFLDAKPEITRYILCNVAYTAQASEKRIGLVSFIINEITGVTPVEIGD
                     ALFWESDLMTVEHQETPLAMPIEELLRLIEHQSAILIGKSLDNWQAKLTRARARDEER
                     LTCYYNTISDSIRNKIELKKMIGDEQDKELARIEATNRELERKLLDIQERYAMSVEAW
                     LHSAMIIHLPTVHIQCELQRKKVKRTVTAVWNPFTKILEPLRCELSGEPVYNFYLDDQ
                     SAKIISPTVWRK"
     gene            complement(43044..44828)
                     /locus_tag="COO91_00049"
                     /note="Nfsy_R00049"
     CDS             complement(43044..44828)
                     /locus_tag="COO91_00049"
                     /codon_start=1
                     /transl_table=11
                     /product="Armadillo-like helical"
                     /protein_id="AUB34236.1"
                     /translation="MLIHREQAQLPKERRELYDSAINTLLHSWDKEKELNNYEVLQYL
                     KQDDLRWFMARLAYWMHTQGGLGHKEGGMLIERDTLLEQLSEYIQDELGVKLREAEAE
                     AKRFLDRIVRERAGLISHLGDGYYAFVHRTFQEYLTAEDICNRAKEQREIEPLLKEIH
                     SHLHNPHWHEVILLLVAQLNGNKAAKVIETILNNNSEYEQWLYRDLLLAGRCLAEYPK
                     CLRQKEENAKLVTEILTRLVKLETTDGLRVGRKTKQLIPEILLNLSGTIFAEEAIQLI
                     KYYASPINDSNRILIYRLALGDHQEAVTNIFNLLKNKYFFEQTLNMLNTVVKYSNISD
                     FLIQQLCSEFHGELGIAKGLRQLGYHDEYVDLTLIDDDYDEYWNDMAYEAHLQGEIEE
                     AASIYSKIETLLSELRNNSEAAIDKLLRDWLDYEDYGVGEYVAKKLGEASSTYRLIEL
                     KLLEKLQDKSFWEYGNTILALGYLINPSQDIIDTLVSLLQNHEDKIVCVSAAKALIQL
                     DIYHKIVLSQLLNLFRNPNRFDDFYEQDLSFNSQVFEALVQLGKTFDGVAPALSQWIE
                     QHQDKEYLVNGIDALWTLVEGSTTSYER"
     gene            complement(44933..45724)
                     /locus_tag="COO91_00050"
                     /note="Nfsy_R00050"
     CDS             complement(44933..45724)
                     /locus_tag="COO91_00050"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34237.1"
                     /translation="MSKAYPSNLTYAQYQFLSEMLPEAKKGGRKREVDIWSVLNAIFY
                     ILLEGVRWRSLPGDFPAWQTVYTYFRNWRRDGTWMKIHDNLREWTRIEEERHPSPSEA
                     IIDSQSVKSAAMVSQEVGFDTGKKIKGRKRFMTVDTLGLVLRVLVTAANVPERSGGKQ
                     VLKRVKEMGNKVSRLTTIWTDGGFDGPAFMMWVMDTCRWIVQVVLRPEQTKGFVLLKK
                     RWVVERTFGWLMGCRRLVRDYELLPETSETFIYLAMIRIMVRRLA"
     gene            complement(45762..45947)
                     /locus_tag="COO91_00051"
                     /note="Nfsy_R00051"
     CDS             complement(45762..45947)
                     /locus_tag="COO91_00051"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II secretory pathway, component ExeA"
                     /protein_id="AUB34238.1"
                     /translation="MLSDVMTYFGLKRTLDHVGYFETQEQTNLFKELKPQIRQGRLIA
                     LRGCLKSRSGCKKALSV"
     gene            complement(45937..47586)
                     /locus_tag="COO91_00052"
                     /note="Nfsy_R00052"
     CDS             complement(45937..47586)
                     /locus_tag="COO91_00052"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase InsO"
                     /protein_id="AUB34239.1"
                     /translation="MPKKQIPIDTIVDLRRRLEQLPPRSPSRRVLVQEIAQLYGISED
                     TVYRTLREGNVVRPVRRVDCDVPRVIPKAGLERYCEIIAAIKIRTSNRKGRHLSTVQA
                     IRLLEEDGINTPDGHLRVPVGLLKPTTVNRYLNKWGYDRDTLLRQPPAVRFQAEYSNQ
                     CWHFDLSPSDLKHVKAPAFLEPGRGHPLLMLYSVVDDRSGFAYQEYHGVYGEDVEAAL
                     RFMFAAMSLKSETDFPFQGIPQMLYMDNGPIAKSLVFQKVMGYLGIEVRTHLPNGKDG
                     RRVTARSKGKVERPFRTVKEMHETLYHLHEPETEAEANAWLMKFLLHYNSRPHRSEPH
                     SRMEDWVSNLPSNGIRQMCNWERFCTFARSPERRKVGIDARVTVEGVAYEVEPDLAGE
                     TVVLWWGLFDNELYVEHGERRYGPFLPVDGPIPLHRYRSFKKTRTQKRADRIESLAKQ
                     LSLPNSVIGKGNPPEFGSSTTQLKVQPFVDPNPFQELTFSTVIAAKLAIADYLARPLA
                     KLTPEQMAYINAVLVSTLNKQEVMKQIRDFFNPLSGTSHVE"
     gene            complement(47588..48223)
                     /locus_tag="COO91_00053"
                     /note="Nfsy_R00053"
     CDS             complement(47588..48223)
                     /locus_tag="COO91_00053"
                     /codon_start=1
                     /transl_table=11
                     /product="Site-specific DNA recombinase related to the DNA
                     invertase Pin"
                     /protein_id="AUB34240.1"
                     /translation="MVIYAYLRVSSDRQDLHNQRHGILEYANIHALSPIQFIEDTVSG
                     REKWSERGVGQLLTQTALESDVVIFSEVSRMARSTLQVLEMLECCVRRGINVHIVKLG
                     MVLDDSMQSRITATVLGLAAEIERELIVLRTTEALAKRKAEGKTLGRPKGRQSAHLKL
                     DTREAEIRSYLAKGMSKRSIAKLVDCSPSTLYDWLSRKHLHSRHDKLVEKS"
     gene            complement(48316..49062)
                     /locus_tag="COO91_00054"
                     /note="Nfsy_R00054"
     CDS             complement(48316..49062)
                     /locus_tag="COO91_00054"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34241.1"
                     /translation="MKRLAAWIDKQFNLKCCRESIRKTLKNLGFSWKKARKLLNKANS
                     KKRREFLEKLKGLLDDALHNGHLLIFIDEAHIHLDSDEGYGWSVKGERFWVSSNSPGR
                     AKVSFYGIYVYNYAKVKIFPYLKADQFNTIDVLKHLRTEFPDQEVTLIWDGAPYHRAQ
                     LVNEALQVLQINLQPLPSYSPDFMPVEHLWQWLREDVTYHTCYQSAAELIERVHLFEQ
                     DIHSNPFEISDRLWVKNHLDPDEEKLRVST"
     gene            complement(49161..49427)
                     /locus_tag="COO91_00055"
                     /note="Nfsy_R00055"
     CDS             complement(49161..49427)
                     /locus_tag="COO91_00055"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34242.1"
                     /translation="MLRVECDRWNESASKLREEALKANHARTRERLMALYEICNGKSA
                     TKVGRETGRNPQTVMEWVHRYNLSGIKALLYQRTGGHPPFFPQK"
     gene            complement(50237..50419)
                     /locus_tag="COO91_00056"
                     /note="Nfsy_R00056"
     CDS             complement(50237..50419)
                     /locus_tag="COO91_00056"
                     /codon_start=1
                     /transl_table=11
                     /product="CopG-like ribbon-helix-helix domain"
                     /protein_id="AUB34243.1"
                     /translation="MLTMSGKGRIAVTLEPEIYQWIVERAAKEGRSLANLAAFLLSGT
                     VKEQMEEEATKEKGAA"
     gene            50626..50901
                     /locus_tag="COO91_00057"
                     /note="Nfsy_F00057"
     CDS             50626..50901
                     /locus_tag="COO91_00057"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34244.1"
                     /translation="MQQAQTVSNGTVPVFTADEGNESLAAMVTRAVDEWNMIRYYQQL
                     LDFECSETPDSLVLLTNCYRILSEPHREELQLTLTAIYKLIQAKGGS"
     gene            50933..51067
                     /locus_tag="COO91_00058"
                     /note="Nfsy_F00058"
     CDS             50933..51067
                     /locus_tag="COO91_00058"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34245.1"
                     /translation="MKTSYSKGLQESTYYILNQTGVLGVLLYELQPKTPRELLGHCSP
                     "
     gene            51616..54195
                     /locus_tag="COO91_00059"
                     /note="Nfsy_F00059"
     CDS             51616..54195
                     /locus_tag="COO91_00059"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA primase/helicase"
                     /protein_id="AUB34246.1"
                     /translation="MNSCSDNITLAVAAQHLTEWTELSGVSDAIATLNIESLSAEELN
                     ARIKPKHPIKTGGWWCRGVNWRNGQPMGLFYGQGKPDKEHVIDPNKKPAKYMTASGME
                     PDAIFLAMPDKHYWAKVYADESIVRVWTEGAKKAAAGLTLFLATIALTGVWNWGKDGK
                     LAPEVERWAQPGTKHVIAFDSDYVSKPSCRQAIIQFAKLLTAKGCEVLIATWTQEDKG
                     MDDFIVKHGGDAFHEAIANAQTVQQWEKQFKSESEQGTKLTPRKVAHQIVESYRESWK
                     YHLEQNTWRKCVDGKVWRSVRDEVFTKIVYSHLETLGISDNFANFSYLENVIKFLKIE
                     LLEAEWQTVDRHKWIAFNDCVYEVESKKTHNHAPGFGFLTALEHNFPKIVIDPKSSLL
                     EQVQLHAPTFFDWAMHSQKQDPLKVLKLLAIINGVIKFRFHELQMFVHLQGVPGAGKG
                     AFVRLLESIVGKSNRTSTRLTKLGNDYTIADIINAQLVICPDERKQVGEWEGLLNMTG
                     GDTISYREIYKPVSKGNFYGTIVIVSNPPIFAGDTTGIDRRLCLVTFDVPVPKRDAAI
                     EAKMQQEVPALTALALAMADEQVSELIRGTGASAIPDFKRAAWLHKTENDSVALFMEE
                     MLVTANPESYVVVGNKSSGTDTLYGAYANLCEDNNSKSLFTANNFKNHLLELCRDIGW
                     NQVREAKQRDGQYRVYGARLRLAADTDVSISEFLTKCERVWPGCESSVTTPKPLENMG
                     CDRCDKENAKIITISIDSISETENSKKVLDAQKNSHTAHTPDLSSTPEISHSDHTPVT
                     PSHTAPEFSVGDEVEYTGAERKSLHGKKLVVSEVDGDVFWLAQSGYKCAVISATAAEL
                     RRR"
     gene            54199..54495
                     /locus_tag="COO91_00060"
                     /note="Nfsy_F00060"
     CDS             54199..54495
                     /locus_tag="COO91_00060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34247.1"
                     /translation="MNKNQSFELWALRALVEFDFDEEKQMVWTCEELCSGTIRQCMNH
                     AATLVPRYRGWGLTLNSIAGAWDKIFCQNLSREWLDGKREYFYVERVGWRGELM"
     gene            complement(54918..55577)
                     /locus_tag="COO91_00061"
                     /note="Nfsy_R00061"
     CDS             complement(54918..55577)
                     /locus_tag="COO91_00061"
                     /codon_start=1
                     /transl_table=11
                     /product="Site-specific recombinase XerD"
                     /protein_id="AUB34248.1"
                     /translation="MSIYKPKSRPHLKLVYDSLNPKVEPVKREPIMKRPKNEDVRPRE
                     HLRPSEVERLIAAAKTVGRHRLRDELLLLMMYRHGLRVSEAISLRWSDIDWDTATIYV
                     RRMKRGNPSTQPIYPDEFKLLRSFKNKVKDKTPWIFMSERGAPIADDTVRVIISRAGE
                     IAEFDFPLHPHMLRHSCGYALAAKGTDTRRIQDYLGHNNINHTVKYTQLSPNKFDGLW
                     D"
     gene            55745..55969
                     /locus_tag="COO91_00062"
                     /note="Nfsy_F00062"
     CDS             55745..55969
                     /locus_tag="COO91_00062"
                     /codon_start=1
                     /transl_table=11
                     /product="Bifunctional DNA-binding transcriptional
                     regulator of stationary"
                     /protein_id="AUB34249.1"
                     /translation="MYTLKIRRVGNSLGVTLPKEALQKLRVKEGDNVFVTETSSGVQL
                     TAYNPDFERAMEAYRKVSTKYRNALHELAK"
     gene            56008..56361
                     /locus_tag="COO91_00063"
                     /note="Nfsy_F00063"
     CDS             56008..56361
                     /locus_tag="COO91_00063"
                     /codon_start=1
                     /transl_table=11
                     /product="doc, death on curing protein"
                     /protein_id="AUB34250.1"
                     /translation="MHEDQLAQHGGLAGIRDNNLFLASLDRPKNLLAYGEPTPTILDL
                     AAAYGYGFAKNHAFVDGNKRVAFVTMATFLELNGYSLNIPETEVVLMMERLATGKETQ
                     ESIAEWLQENCVQHE"
     gene            56462..56593
                     /locus_tag="COO91_00064"
                     /note="Nfsy_F00064"
     CDS             56462..56593
                     /locus_tag="COO91_00064"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34251.1"
                     /translation="MEVKSCDRVSQGRQCSFWVKAQSGEKRDCAVAQNKNSVFFGVL"
     gene            56795..56962
                     /locus_tag="COO91_00065"
                     /note="Nfsy_F00065"
     CDS             56795..56962
                     /locus_tag="COO91_00065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34252.1"
                     /translation="MRGKVTEAVTRGKVACKYYDATVSVFKMIGASDAYGGLRLRLPL
                     LKSSDLNWSRN"
     gene            complement(57164..57304)
                     /locus_tag="COO91_00066"
                     /note="Nfsy_R00066"
     CDS             complement(57164..57304)
                     /locus_tag="COO91_00066"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34253.1"
                     /translation="MVSAIAAQVQRKLQRSSMQKAMHQKRDRDRNFQLLTSDFRLPPT
                     SW"
     gene            57688..58236
                     /locus_tag="COO91_00067"
                     /note="Nfsy_F00067"
     CDS             57688..58236
                     /locus_tag="COO91_00067"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34254.1"
                     /translation="MLIFIDEAHIHLDSDEGYGWSVKGERFWVSSNSPGRAKVSFYGI
                     YVYNYAKVKIFPYLKADQFNTIDVLKHLRTEFPDQEVTLIWDGAPYHRAQLVNEALQV
                     LQINLQPLPSYSPDFMPVEHLWQWLREDVTYHTCYQSAAELIERVHLFEQDIHSNPFE
                     ISDRLWVKNHLDPDEEKLRVST"
     gene            58329..58964
                     /locus_tag="COO91_00068"
                     /note="Nfsy_F00068"
     CDS             58329..58964
                     /locus_tag="COO91_00068"
                     /codon_start=1
                     /transl_table=11
                     /product="Site-specific DNA recombinase related to the DNA
                     invertase Pin"
                     /protein_id="AUB34255.1"
                     /translation="MVIYAYLRVSSDRQDLHNQRHGILEYANIHALSPIQFIEDTVSG
                     REKWSERGVGQLLTQTALESDVVIFSEVSRMARSTLQVLEMLECCVRRGINVHIVKLG
                     MVLDDSMQSRITATVLGLAAEIERELIVLRTTEALAKRKAEGKTLGRPKGRQSAHLKL
                     DTREAEIRSYLAKGMSKRSIAKLVDCSPSTLYDWLSRKHLHSRHDKLVEKS"
     gene            58966..60615
                     /locus_tag="COO91_00069"
                     /note="Nfsy_F00069"
     CDS             58966..60615
                     /locus_tag="COO91_00069"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase InsO"
                     /protein_id="AUB34256.1"
                     /translation="MPKKQIPIDTIVDLRRRLEQLPPRSPSRRVLVQEIAQLYGISED
                     TVYRTLREGNVVRPVRRVDCDVPRVIPKAGLERYCEIIAAIKIRTSNRKGRHLSTVQA
                     IRLLEEDGINTPDGHLRVPVGLLKPTTVNRYLNKWGYDRDTLLRQPPAVRFQAEYSNQ
                     CWHFDLSPSDLKHVKAPAFLEPGRGHPLLMLYSVVDDRSGFAYQEYHGVYGEDVEAAL
                     RFMFAAMSLKSETDFPFQGIPQMLYMDNGPIAKSLVFQKVMGYLGIEVRTHLPNGKDG
                     RRVTARSKGKVERPFRTVKEMHETLYHLHEPETEAEANAWLMKFLLHYNSRPHRSEPH
                     SRMEDWVSNLPSNGIRQMCNWERFCTFARSPERRKVGIDARVTVEGVAYEVEPDLAGE
                     TVVLWWGLFDNELYVEHGERRYGPFLPVDGPIPLHRYRSFKKTRTQKRADRIESLAKQ
                     LSLPNSVIGKGNPPEFGSSTTQLKVQPFVDPNPFQELTFSTVIAAKLAIADYLARPLA
                     KLTPEQMAYINAVLVSTLNKQEVMKQIRDFFNPLSGTSHVE"
     gene            60605..61594
                     /locus_tag="COO91_00070"
                     /note="Nfsy_F00070"
     CDS             60605..61594
                     /locus_tag="COO91_00070"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II secretory pathway, component ExeA"
                     /protein_id="AUB34257.1"
                     /translation="MLSDVMTYFGLKRTLDHVGYFETQEQTNLFKELKPQIRQGRLIA
                     LTGVVGCGKTTTLQRLQLELSSEKDIIISRCLAIDKDKVSVGVLMSALFCDLSTEKDA
                     KPPTQPELRERKFLALIQKCRKPVVLFVDEAHDIHHGTLVKIKRLIELVRQNGCTLSV
                     VLLGHPKLKNDLRRPSLEEIGARTNIFSLEGIRGHQVEYIKWLLSECIHDDYLPEDLI
                     TNEAIAFLAERLTTPLQIEHYLQRAFEDAYQAATKPVTLGMAEAVLTVGLNDLEPRLI
                     RHGYTKTVLAELLNIRVSEVNSFLHAQLPPGRTQDLRDQMLKIGIPLYASEGN"
     gene            61863..61982
                     /locus_tag="COO91_00071"
                     /note="Nfsy_F00071"
     CDS             61863..61982
                     /locus_tag="COO91_00071"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34258.1"
                     /translation="MVSKSPCLRFKAFMFAVRYNYPQFFAASILKIKFPNHLR"
     gene            62175..62870
                     /locus_tag="COO91_00072"
                     /note="Nfsy_F00072"
     CDS             62175..62870
                     /locus_tag="COO91_00072"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator, IclR
                     family"
                     /protein_id="AUB34259.1"
                     /translation="MKIRASRIADELQISRQAVYKAIDALSEKEYIEKEDVEYSLKLR
                     SRGCLCDSLENRPQLSTDGDSCKLEATVVNAGRQLSTDGDSCKLEATVVNAGRQPEAE
                     TLVEEESQSSKINKTYSDFKKTLSEDERENFIEFAKKKAAQLPNPPLLPQRWIEKNFD
                     ELRSQWYKSTGKVSSAQSSKWEADPRSQEWLDKIRSLGFAAFIYESKDLDKERKEFYE
                     WANSNNLIWGDET"
     gene            complement(62923..63039)
                     /locus_tag="COO91_00073"
                     /note="Nfsy_R00073"
     CDS             complement(62923..63039)
                     /locus_tag="COO91_00073"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34260.1"
                     /translation="MRSRSELYVGITSLARCGSTMPKSLQQKHLQEGCQISF"
     gene            63107..63379
                     /locus_tag="COO91_00074"
                     /note="Nfsy_F00074"
     CDS             63107..63379
                     /locus_tag="COO91_00074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34261.1"
                     /translation="MRFTAAICQELDRINRENWRQATQQQFERYKNQVDIATGAIAQS
                     HSLAVTNRTSNDDREVAQRKAEIEAISPEQWEAMNKAYLVGSNKDE"
     gene            63372..64070
                     /locus_tag="COO91_00075"
                     /note="Nfsy_F00075"
     CDS             63372..64070
                     /locus_tag="COO91_00075"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34262.1"
                     /translation="MSKYSIGDFKVGDRIIASGNRLGMVSSVHSKKITITWENGLSAE
                     YTPKQMQAWNYKKLSEEKEAIASCQDSHNLTSAQELEPIFAMQDSSTDLNLSEPQRLT
                     ITAQASSNCDIPAYTTTATCEISQDLLNADSDTICTPIESIYLQLPHPAPHSPQKANG
                     LEAQTSVIASPQSSKPLENYSQGLQPLKMSQDSSPAPITQDNPQAHISYHVRIIAYDK
                     SNEYKYDLCRNESI"
     gene            64049..64540
                     /locus_tag="COO91_00076"
                     /note="Nfsy_F00076"
     CDS             64049..64540
                     /locus_tag="COO91_00076"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34263.1"
                     /translation="MPKRINIAEHSNISELEQLYKHAKDAIESRQYQIIWLLAQGKKT
                     EEVEEITGYSRTWIYALVKRYNELGICGIGDRRSENQGVKALGDDIHQALLWQALQDN
                     APDGGFWNGRKVADWLSEVTGITISRQRGWEILRQMTFRLRVPRPSHTESDPVEQEAW
                     KKN"
     gene            64677..65111
                     /locus_tag="COO91_00077"
                     /note="Nfsy_F00077"
     CDS             64677..65111
                     /locus_tag="COO91_00077"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34264.1"
                     /translation="MSIGDLSGYGCMHSYILKQEKQKAWILPYVNTELFNQVLADFAR
                     EFELGAKKHILLAVDRAGWHISHDLKIPVGLHLTLLPSHSPELQPAERLWTLVDEPIA
                     NQSFKTLDDLEEVLFQRCQSLLQMKDFIQGLTGFHWWIKIGV"
     gene            complement(65095..65208)
                     /locus_tag="COO91_00078"
                     /note="Nfsy_R00078"
     CDS             complement(65095..65208)
                     /locus_tag="COO91_00078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34265.1"
                     /translation="MAATDSKPFRIVPEKVKGVDHASDIMSGKSLTIKLRF"
     gene            65177..66070
                     /locus_tag="COO91_00079"
                     /note="Nfsy_F00079"
     CDS             65177..66070
                     /locus_tag="COO91_00079"
                     /codon_start=1
                     /transl_table=11
                     /product="PUA-like domain"
                     /protein_id="AUB34266.1"
                     /translation="MRNGLLSVAAILPAPTLESEYCWLRSPGALSSTGKGRPPGLTKQ
                     EAGLKNLGAIKSGQVVNPEFLESSYALPLGWTDPQENRSALELLAKMELSELAAPPLE
                     TPLIGELRVSDFAALPTLIPYVENQQLQKLKAITLHQPWAYLVGRYKWFETRSWSTNY
                     RGKIAIHAAKKQHDTDEWCSLLEDLLPPVEELVFGAVVAIADLTDCILMTEEFISQQS
                     ETELKCGLWEPGRYAWKLENIQILPEPIPARGKQGLWNIELPFALAQPAAGIAPQSLI
                     DRFLEENRDYECTQQSEAEWH"
     gene            66061..66231
                     /locus_tag="COO91_00080"
                     /note="Nfsy_F00080"
     CDS             66061..66231
                     /locus_tag="COO91_00080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34267.1"
                     /translation="MALRKGKIVEAALVQRSKGAGEKEEILGIRTEKIEIPLCPPAPL
                     PLEHPYAAYLSA"
     gene            66288..67661
                     /locus_tag="COO91_00081"
                     /note="Nfsy_F00081"
     CDS             66288..67661
                     /locus_tag="COO91_00081"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34268.1"
                     /translation="MLKHISAIVTVFILILGFASTSQAATPRSTWVENEIYQYNHPFA
                     SQLPQELAMKMQKMTASPFAFYRGTAHIFYRDMQTLPGSGFVNSFTSAIYLEGDMHMQ
                     NLGGMRDSNESNVFDTTDFDEGYLGPYVWDLRRMAVSILLAAKENALSSSDAQDIVRN
                     FLDAYLNKMSDFKGTNDELSYRLSESNTNGVVKDLIQEAAGKGRSSLLNKYTLVNSSS
                     NRVFQTTSELQPVSSSTYSDITGAMSSYIASIPSSKRYSNSYYTLKDIRLKLGSGTGS
                     LGKYRYYLLIVGPSSATDDDRILEMKQEGSSAVAIAVPGLLPSSIYGNHEGARVTIAT
                     KAMLSNTDPLIGYTTVSSIPFMLHEKSPYQVDFDYTLLTTKSKFMDAMGYSGKVVAKN
                     HAISDKDYDAAIIAVSVDKEVTDITNGNKAVFKDEIVNFALDYVTQVEYDYASFKDAY
                     NRGVTLY"
     gene            67790..67993
                     /locus_tag="COO91_00082"
                     /note="Nfsy_F00082"
     CDS             67790..67993
                     /locus_tag="COO91_00082"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34269.1"
                     /translation="MEPNQLNLFPEVKPTPALLTEALVMSADALLKWKSQILDYQQKV
                     RENKPPEQVTLFDIAPNHCLTVM"
     gene            complement(68026..68151)
                     /locus_tag="COO91_00083"
                     /note="Nfsy_R00083"
     CDS             complement(68026..68151)
                     /locus_tag="COO91_00083"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34270.1"
                     /translation="MRSLPTQAIAYFPRLILTDKFFLLAFPFCFAKLHQRLKQCL"
     gene            68209..68355
                     /locus_tag="COO91_00084"
                     /note="Nfsy_F00084"
     CDS             68209..68355
                     /locus_tag="COO91_00084"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34271.1"
                     /translation="MIGTPTRAPKPRGKSPGWEPGKKRHRKNRYPIVKKTVTPPLKEP
                     SIAV"
     gene            complement(68763..69554)
                     /locus_tag="COO91_00085"
                     /note="Nfsy_R00085"
     CDS             complement(68763..69554)
                     /locus_tag="COO91_00085"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34272.1"
                     /translation="MSKAYPSNLTYAQYQFLSEMLPEAKKGGRKREVDIWSVLNAIFY
                     ILLEGVRWRSLPGDFPAWQTVYTYFRNWRRDGTWMKIHDNLREWTRIEEERHPSPSEA
                     IIDSQSVKSAAMVSQEVGFDTGKKIKGRKRFMTVDTLGLVLRVLVTAANVPERSGGKQ
                     VLKRVKEMGNKVSRLTTIWTDGGFDGPAFMMWVMDTCRWIVQVVLRPEQTKGFVLLKK
                     RWVVERTFGWLMGCRRLVRDYELLPETSETFIYLAMIRIMVRRLA"
     gene            complement(69623..70357)
                     /locus_tag="COO91_00086"
                     /note="Nfsy_R00086"
     CDS             complement(69623..70357)
                     /locus_tag="COO91_00086"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34273.1"
                     /translation="MALADADHKHSNQHTAEKPKDAVEHSEVIFQAIGVIVGEVNISS
                     SGEKTITINGSTYQFFYIPRKVREFELLAKEIETTGNHTQRLLVYPRVMHFPRKEQPY
                     QISFQLLAFDRGQERDVYLRKLKDFEFHLSGLWQFIPVCRFPCISIFRNFSFERLEYI
                     KQAEPMTKVQYMKASHLPILWKDALVEPFKFNPKAEQDQGYPMFVSIKAKFIPQKNVF
                     SFDALLSLPQETLPRFLKVSKRVFEK"
     gene            70678..71934
                     /locus_tag="COO91_00087"
                     /note="Nfsy_F00087"
     CDS             70678..71934
                     /locus_tag="COO91_00087"
                     /codon_start=1
                     /transl_table=11
                     /product="Helix-turn-helix domain"
                     /protein_id="AUB34274.1"
                     /translation="MIASERDAQTQKVESSAEVTLSLPFIPAWLDDYGLNPPEFRVYA
                     HIARRAGKTGKCWESVVNIAKACRLCRNLTLKALHSLTEKYRLLIRNKREGETYEYSL
                     APQSEWAPPVPPEDRCLSRTKREKAPTDPSLQGTGSDTLEEHQPVAGEDTKVIQFKEY
                     QERQQQDNVVVPIDFEKLSIWRRNQDATRYCQIPPIYDEATGVEVQQQMDTEGITAQK
                     VVSRAIALSKVPRLLLEIMASVGEKLVNVCKSLEEGLQKPNNQKQTQKIDTTKPSSVP
                     ETDSIPEHEFQHLKEQGIYLNRAVADKLWLKHSSEFADAIAYVLSKDKVKDKAAYFRK
                     CLEQGWLKDSKSQRRDPYELNEEQKQWYEWASSCGLCDGRPIRHCCLMNGEVAIVVFE
                     PELKCHTPMPLSRAMQKYPYLQLEGV"
     gene            complement(72004..72174)
                     /locus_tag="COO91_00088"
                     /note="Nfsy_R00088"
     CDS             complement(72004..72174)
                     /locus_tag="COO91_00088"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34275.1"
                     /translation="MALRKEKIVEAAGVQRSGGAGEKEEVLGIAFGYLEIPLCTPAPL
                     PLCNPYAAYSSA"
     gene            complement(72652..74448)
                     /locus_tag="COO91_00089"
                     /note="Nfsy_R00089"
     CDS             complement(72652..74448)
                     /locus_tag="COO91_00089"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34276.1"
                     /translation="MLYDKKALLVVDDAWNPEHVEPFRVGGSDCRVLVTTREAVIKGA
                     TAYKLDVLTPDESIKLLEKSCSSLKLEERHLAQELAATVGYLPLALDLAASQVAEGVT
                     WTELLEDLQKDIAYLETLDLPGLEKYSTEEKRKHYSLIASFNLSLRSLTPEMLQQFAW
                     FGVLPEDVNITPAMAATLWAITPRQALTTLRSFKTKALVLPGITLNEQQTYRLHDLMH
                     DMAKRSLVSEPSPYQPHELPGLGLKLAEAHSQLLERYQNKTTSGLWHTLEDDGYIYAN
                     LSWHLEQAQRVEDLHQLFEEETEKGHNGWYEACDRLGQNGIFVTDVARAWRLAEDMYT
                     ENSSNSIYLQCFYALITASLNSLVANLPNDLLIALVNKKVWTPNQGLAYALQSSNPSQ
                     KADSLTALANHLPPNLEKLALEKALAAAKLIQDERHRAEALFALVDKRPELLPEALAA
                     ARQIQNEESRAIEALFALVDKLPSELLLEILVAAKQIQDEESFPEALFALVDKLPPEL
                     LPEALAAAKLIQDEEYRADALSALAILLSRIPTDQLFSFWKQILHELSLRTRQNLLAD
                     IEKLVPVIFALGNDAAIASVNCAIQDVARWWH"
     gene            74827..76136
                     /locus_tag="COO91_00090"
                     /note="pseudogene"
     gene            76355..76543
                     /locus_tag="COO91_00093"
                     /note="Nfsy_F00093"
     CDS             76355..76543
                     /locus_tag="COO91_00093"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34277.1"
                     /translation="MDILDTSTGQDTAIGEMIQLVEAIARHLRPAERLQHLKKLRRFK
                     RILNFRVNLLAGLVAYNH"
     gene            76738..77178
                     /locus_tag="COO91_00094"
                     /note="Nfsy_F00094"
     CDS             76738..77178
                     /locus_tag="COO91_00094"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34278.1"
                     /translation="MAKKYTVNLSNEEVEKLRSLIKTGKSKARTITRAHILLMASEGE
                     TDATIADRLRVSVSTVERTRAKLIKSGIEGTLNDRPHPPKPRKLDGFKEAFLIATACS
                     KPPNGRTRWTLKLLADRIVRIEIVDSISYETVRSYLKKTMSNRG"
     gene            complement(77374..78837)
                     /locus_tag="COO91_00095"
                     /note="Nfsy_R00095"
     CDS             complement(77374..78837)
                     /locus_tag="COO91_00095"
                     /codon_start=1
                     /transl_table=11
                     /product="IS4 transposase"
                     /protein_id="AUB34279.1"
                     /translation="MPKFNYNQLITQFQDFRQKIYNCFESCSDACMNLLDALAGNTGA
                     NSIAELSLNPLFPRSYNSIYKAISESFNTTSQDTSNKVEEAEEEKDNLIRVISELIDQ
                     PQKRPFYLFATDTTPHPRPYAKTLAERGYIYQPNTIKGNKPINIGHSYSILSILPEKK
                     NANAAPWSIPISGERVSLDKSSVEVGSEQIQALMCDSSLHWHEKLCVLVADSAYSQRS
                     FLFEQSKHQNLVIVARCRSNRIFYQSPPVEESKKKRGCPKKYGERFDLADAETWHLPD
                     ETTQTQQTTRKGRLLNITILAWHQMLMRGTKEQKMYRHPFTLIRVHVTDNTGNSVWKP
                     MWLIVIGNQRQQISATVAYQSFRQRFDIEHMFRFCKQHLLMTEFQTPDVKHEENWIRL
                     VMLAYAQLWASKDLATHLPRPWERYLKPESDTIMTPSAVQRDFQRIISEIGTPARSPK
                     TRGNSIGRVQGQAQTQRTKHPIVKKQSKPTPDKQKAA"
     gene            78888..79019
                     /locus_tag="COO91_00096"
                     /note="Nfsy_F00096"
     CDS             78888..79019
                     /locus_tag="COO91_00096"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34280.1"
                     /translation="MGIWWLSFFSARAKASVINLTFPVISLIERSLTIPLAQSPILS"
     gene            79275..79958
                     /locus_tag="COO91_00097"
                     /note="Nfsy_F00097"
     CDS             79275..79958
                     /locus_tag="COO91_00097"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34281.1"
                     /translation="MFANYTRTSFFVQSPIDLYGEAYDPKRPVVCFDECPYQLLEDVR
                     EPLPAEPEQPLRYDYEYKRKGSVNIFAFFQPLAGWRHLEVTQQRTKVDFALQMKNLVD
                     IYHRDADVIRLVVDNLNTHNPASLYEVFSPEEARRIVQKLEFHYTPKHASWLNQVEIE
                     FSVLSRQCLERRIKDVQTLSSEIATWEQQRNDASASVNWRFKTTDARRKMERLYPTMS
                     PSKVELTEY"
     gene            80016..80495
                     /locus_tag="COO91_00098"
                     /note="Nfsy_F00098"
     CDS             80016..80495
                     /locus_tag="COO91_00098"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34282.1"
                     /translation="MAAGNIMAKKYTVNLSKEEVEKLRSLIKTGKSKARSMTRAHILL
                     MAWEGEIDKAMPKAGYAYAECLRVHVSTVERTRARYVEGGIELAVQDRPHPPKQRKLD
                     GEQEAFLIATACSKAPSGRNRWTMKLLAERIVSLNIVDSVSKETVRSYLKKTKLNLG"
     gene            80519..81193
                     /locus_tag="COO91_00099"
                     /note="Nfsy_F00099"
     CDS             80519..81193
                     /locus_tag="COO91_00099"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34283.1"
                     /translation="MDAEYVLRMEDLLDLYSQPYDPKHPVICFDERPYPLLEDVRERL
                     PPEPEQPERYDYEYKRNGSVNLFAIFEPHKGWRHIEVTQQRTKKDFALQMKNLVDIHC
                     LQAESIRLVVDNLNTHNPSALYEVFPPEEARRIVQKLEFHYTPKHASWLNQVEIEFSV
                     LSRQCLERRIADVQTLSQEIAFWESDRNSQKASVNWRFKITDARKKMGRLYPDASPIK
                     VRLADY"
     gene            complement(81453..81569)
                     /locus_tag="COO91_00100"
                     /note="Nfsy_R00100"
     CDS             complement(81453..81569)
                     /locus_tag="COO91_00100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34284.1"
                     /translation="MQGFYSIKYLWKFPDKILVVTSFGVLLSRLLLNSLLHG"
     gene            81819..83307
                     /locus_tag="COO91_r04"
     rRNA            81819..83307
                     /locus_tag="COO91_r04"
                     /product="16S ribosomal RNA"
     gene            83718..86611
                     /locus_tag="COO91_r05"
     rRNA            83718..86611
                     /locus_tag="COO91_r05"
                     /product="23S ribosomal RNA"
     gene            86777..86894
                     /locus_tag="COO91_r07"
     rRNA            86777..86894
                     /locus_tag="COO91_r07"
                     /product="5S ribosomal RNA"
     gene            complement(89489..89561)
                     /locus_tag="COO91_t01"
     tRNA            complement(89489..89561)
                     /locus_tag="COO91_t01"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala-TGC"
     gene            complement(89645..89718)
                     /locus_tag="COO91_t02"
     tRNA            complement(89645..89718)
                     /locus_tag="COO91_t02"
                     /product="tRNA-Ile"
                     /note="tRNA-Ile-GAT"
     gene            complement(89850..91338)
                     /locus_tag="COO91_r08"
     rRNA            complement(89850..91338)
                     /locus_tag="COO91_r08"
                     /product="16S ribosomal RNA"
     gene            91934..92077
                     /locus_tag="COO91_00101"
                     /note="Nfsy_F00101"
     CDS             91934..92077
                     /locus_tag="COO91_00101"
                     /codon_start=1
                     /transl_table=11
                     /product="Retron-type reverse transcriptase"
                     /protein_id="AUB34285.1"
                     /translation="MVLEPEWEAAFEPNSYGFRPGRSCHDGATRSGVPLTEEPSFLRD
                     SFP"
     gene            92097..92228
                     /locus_tag="COO91_00102"
                     /note="Nfsy_F00102"
     CDS             92097..92228
                     /locus_tag="COO91_00102"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34286.1"
                     /translation="MTSATFVLVTAQMESKPLKQEHWEPNLVGMQGKDLEGLTRVNQ"
     gene            complement(92568..93746)
                     /locus_tag="COO91_00103"
                     /note="pseudogene"
     gene            94118..94249
                     /locus_tag="COO91_00105"
                     /note="Nfsy_F00105"
     CDS             94118..94249
                     /locus_tag="COO91_00105"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34287.1"
                     /translation="MWRGKQSLKKQFDRFIKYKYLVNWRELADNEKGKSRKKVLYTG"
     gene            94334..95092
                     /locus_tag="COO91_00106"
                     /note="Nfsy_F00106"
     CDS             94334..95092
                     /locus_tag="COO91_00106"
                     /codon_start=1
                     /transl_table=11
                     /product="opuA, osmoprotectant transport system
                     ATP-binding protein"
                     /protein_id="AUB34288.1"
                     /translation="MPQNNQTTVEFRDVTFSRNHRPLVSNLNFTIRQGEALVLLGRSG
                     SGKTTTMKLINRLFTPTQGEVLFDGIPTTQWNEIKLRRKIGYVIQEIGLFPHFTVERN
                     VGLVPVLEGWQPKQIKTRVYELLQLVGLEPAQFAGRYPHELSGGQRQRVGVARALAAD
                     PPVLLMDEPFGALDPITRLELQQEFRHLQQELGKTVVFVTHDIQEAFVLASRIGLMYG
                     GELVVLEAKDEFMRSQHPESLAFIQCLRTLQENL"
     gene            95089..95721
                     /locus_tag="COO91_00107"
                     /note="Nfsy_F00107"
     CDS             95089..95721
                     /locus_tag="COO91_00107"
                     /codon_start=1
                     /transl_table=11
                     /product="opuBD, osmoprotectant transport system permease
                     protein"
                     /protein_id="AUB34289.1"
                     /translation="MNNFFLVKYAPEILQHTLEHLFLVGIAIGIAILVGIPLGILITR
                     KTYLRQPILGIANIFQTIPSLALFGLLIPVPIIGGIGAVPAIVALTVYSLLPIIRNTY
                     TGISGVDPAIREAGRGMGMTDRQLLLQVEIPLALGVILAGVRVATVIAIGIATIAAAI
                     GAGGLGVFIFRGISVVNNQLILAGAVPAAVIALLADFAIGWTENKLKIKN"
     gene            95729..96640
                     /locus_tag="COO91_00108"
                     /note="Nfsy_F00108"
     CDS             95729..96640
                     /locus_tag="COO91_00108"
                     /codon_start=1
                     /transl_table=11
                     /product="opuC, osmoprotectant transport system
                     substrate-binding protein"
                     /protein_id="AUB34290.1"
                     /translation="MKKFLTLLFLNFAVFLLITGCTQNLNSSSNDGNIIVASKDFTEQ
                     DILGELLAQQIETTTNLKVVRRPRLGGSFVCHNAINAGIIDAYIEYTGTALTAILKQK
                     PVNGSKEVYEIVKQTYDQQFNLEVMPSLGFENTFAMIIRGDDAKRYNIQTLTQATQYT
                     PQWRGGFGYEFLEREDGFPGLAKTYDLRFAKPPQIMDLGLIYRALIQKQVDMVAGNST
                     DGQISRLGLLVLKDDKHYFPPYETVPIVRQETLKKYPELRRAFAQLSGKISADEMRQL
                     NYLVEGELREIKDVVQEFRKSKGLGLS"
     gene            complement(96728..96847)
                     /locus_tag="COO91_00109"
                     /note="Nfsy_R00109"
     CDS             complement(96728..96847)
                     /locus_tag="COO91_00109"
                     /codon_start=1
                     /transl_table=11
                     /product="Endonuclease, Uma2 family"
                     /protein_id="AUB34291.1"
                     /translation="MLTESSYFPNVREIVQQCLQMANKQTKSEVIRWLKNFLH"
     gene            complement(96991..97722)
                     /locus_tag="COO91_00110"
                     /note="Nfsy_R00110"
     CDS             complement(96991..97722)
                     /locus_tag="COO91_00110"
                     /codon_start=1
                     /transl_table=11
                     /product="phytochelatin synthase"
                     /protein_id="AUB34292.1"
                     /translation="MLRKISKTFFKALTIGLCISSGSVLSQTLPLSSNLVGFNTPEGE
                     KLLFESKSNEDFFPLSMQFTTQNNQAYCGVATMVMVLNGLQIPAPEVPQYKPYRIFTQ
                     ENFFSNNNTKKVLTPEVVSRQGISLDQLGQLLASYGVKVNVYHAADTSLEQFRKQAAA
                     NLKQPQNFVLVNYLRKEIGQDKGGHISPLAAYNEQTDRFLILDVSRYKYPPVWVKTAD
                     LWKAMLTNDSSVNKSRGFVFVSKSL"
     gene            97985..99796
                     /locus_tag="COO91_00111"
                     /note="Nfsy_F00111"
     CDS             97985..99796
                     /locus_tag="COO91_00111"
                     /codon_start=1
                     /transl_table=11
                     /product="ggt, gamma-glutamyltranspeptidase / glutathione
                     hydrolase"
                     /protein_id="AUB34293.1"
                     /translation="MLTVAKPKRVALAIFSFSVLLYSQVASAALTLPLRSKKGMVVSA
                     HPLASEAGISMLRKGGNAVDAAVATTFAISVVEPFSAGIGGGGFLLMHSEKTGDMKAL
                     DFRERAPLKATRNMYLDAKGKVRPNASINGYLAVATPGTVAGLYEVHRRYGKLSWQEV
                     MKPAIALAKDGFVLSSQITWRSLPEYENRKEAILNNPAAREIFTRNGEFYQPGEKLVQ
                     RDLAGILTEIAQNPQSFYTGSIARAIASDMVKNGGLITLEDLKAYKPIWRNPVCSNFR
                     KAKICSMPPASSGGVHLLQILNIIGDTDLKSLGWHHPDAIHLMVEAMKIAYADRSEYL
                     GDPDFVKVPMQELLSPHYAKKRRQEINMQVARPSTEVKPVDKEILQRFSQANIQKSEE
                     NIIPSSLQSQQTNTSRHESTETSHLTVVDEERNAVSLTFTINLGFGAGIVTPGTGIVL
                     NNEMDDFASAPGVPNAFGLVGNDANAIAPRKTPLSSMTPTIVTENGHFRMAAGAPGGS
                     TIITQVLQVILNVLEYNMDVGAAVSVPRIHHQWLPDQLRVESWGLDALTVEDLRRRGH
                     KIKETIPWGNGNVIAVTSDGTLEGAADPRGEGSPRGL"
     gene            complement(99886..100149)
                     /locus_tag="COO91_00112"
                     /note="Nfsy_R00112"
     CDS             complement(99886..100149)
                     /locus_tag="COO91_00112"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34294.1"
                     /translation="MHRQMCWLPKFGGDGEKILYLQTEPNQPWRPYTAFRGFTVPDYQ
                     IPGGSKGWATYQKLLKAGWTLVPSARANEFGSSSYVESTTQNQ"
     gene            101390..103246
                     /locus_tag="COO91_00113"
                     /note="Nfsy_F00113"
     CDS             101390..103246
                     /locus_tag="COO91_00113"
                     /codon_start=1
                     /transl_table=11
                     /product="Tetratricopeptide"
                     /protein_id="AUB34295.1"
                     /translation="MQKRLLGTSKVQITPILMGTWQAGKRMWVGVEDADSIKTIRAAY
                     EAGITTVDTAEVYGEGHSEQIVAEALSDVRTHVEYATKVFANHLKYEQVIEACERSLT
                     NLKTDYIDLYQIHWPSGAFNSEIVPIEETMSALNLLKEQGKIRAIGVSNFSHAQLAEA
                     ASYGRIDSSQPPYSLFWRQVEQDVLPYCIENNISILAYSSLAQGLLTGKFAHGHKFDL
                     ADNRAKNKLFQGENFERAQQALQQLRPIALLHNCTLAQLALAWLIAQPQTNAIAYYQQ
                     TVAASPSPLTKVQAQLNHLRILIEDQRVAEIQTLLPLIESQIDQLPLSRASIYAQVNF
                     SQSLAKVKNGILHASSHNYYSGFSTKDSAVLLARAIQQSRSLGDKRTEAYALKSLGGL
                     YEETKQWAEAQDLSRKGLALAQSSNAPEIIYTLEWQLGRLLRAQKDINGAIAAYDAAV
                     ETLQSLRRDLVANKDVVNQDVQFNFRNSVEPIYRESVELLLKSQEGKSPNEKILEKAR
                     ERIEALQLAELNDFFQEACLQGQTATGDRRATLGLAGAAVRAGARSTIAWLWQIDDKS
                     TAMFVSAFYRELKSGKITKAEAVHRAQLELLKHPNYKAPGFWSAYVLIGNWL"
     gene            103339..103887
                     /locus_tag="COO91_00114"
                     /note="Nfsy_F00114"
     CDS             103339..103887
                     /locus_tag="COO91_00114"
                     /codon_start=1
                     /transl_table=11
                     /product="2'-5' RNA ligase"
                     /protein_id="AUB34296.1"
                     /translation="MSRFFVALLPPQDIQDYANQIKQYFADHYASSGALKSPPHITLQ
                     PPFEWADDNLPLLETSLKEFASRQQPVAITLKGFDAFAPRVIYINVVRSPELLTLQAD
                     LMAYAESNLGIVDKVSKTRPFAPHITVAFRDLTKQNFRVAWPEFEKRQLHFEFTADKL
                     TLLLHDGKRWNIKSEFGFLSNE"
     gene            complement(103920..104350)
                     /locus_tag="COO91_00115"
                     /note="pseudogene"
     gene            104834..105664
                     /locus_tag="COO91_00117"
                     /note="Nfsy_F00117"
     CDS             104834..105664
                     /locus_tag="COO91_00117"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidoglycan-binding"
                     /protein_id="AUB34297.1"
                     /translation="MLDLFIYTYIIFVNQDTLNGSLVAKEPKSMAVSSPEVIRHILIG
                     LGYLTPEIDPKPDLTKFAPWKRNDNSLTDDPTEEAIKKFQKQYAQKLEVNGNADAQTR
                     SVMEDTVIGLQNRLKFHGFATNTEIPPGKPFYGPATYTAVKKFQKSQGLTENGIATIE
                     QRQILQQPTLTNKPQSQPQSQIKLIDLLAQFKKNPKNPSYSAALSNLQQNLPKDVLHK
                     VTNKWRGTNDQNPEIVKLMNVFTYYDDNNQNHRDALTHLQSQLTPAIYKEFISLWNKK
                     "
     gene            106197..107384
                     /locus_tag="COO91_00118"
                     /note="Nfsy_F00118"
     CDS             106197..107384
                     /locus_tag="COO91_00118"
                     /codon_start=1
                     /transl_table=11
                     /product="arsA, arsenite-transporting ATPase"
                     /protein_id="AUB34298.1"
                     /translation="MRVILMTGKGGVGKTSVAAATGLRCAELGYQTLVLSTDPAHSLA
                     DSFDIELGHAPQKIRPNLWGAELDALQELEGNWGAVKRYITQVLQARGLDGIQAEELA
                     ILPGMDEIFGLVRMKRHYDEGEFDVLIIDSAPTGTALRLLSLPEVGGWYMRRFYKPFQ
                     NISVALRPLVEPFFRPIAGFSLPDKEVMDAPYEFYEQIEALEKVLTDNTQTSVRLVTN
                     PEKMVIKESLRAHAYLSLYNVATDLIVANRIIPNEVQDPFFQRWKTSQEQYRQEIHDN
                     FHPLPVKEVPLFSEEMCGLAALERLKETLYKDEDPAQVYYKETTMRVVQEQNQYSLEI
                     YLPGIPKNQVQLSKNGDELNITIGNHRRNLVLPQALAALQPGGAKIEDDYLKIRFTDN
                     IKV"
     gene            107637..110945
                     /locus_tag="COO91_00119"
                     /note="Nfsy_F00119"
     CDS             107637..110945
                     /locus_tag="COO91_00119"
                     /codon_start=1
                     /transl_table=11
                     /product="GAF domain-like"
                     /protein_id="AUB34299.1"
                     /translation="MTSNPEQDLPLCRHEESLLRRITNRIRRSLEFEEIITVTTAEVR
                     SLLKTDRVMIYKFHTDGSGQVIAESIYNNRLPSLLGLNFPADDIPPTARELFIKSRVR
                     SVVNVDTQKIGQSHLHDLENGETISQEIRYRPVDPCHLEYLTAMGVKSSVVAPIIYQD
                     QLWGLLVSHNSQARLISEYELEAVQMVVEQISVAIAQSTLLTQVRKTGEREAIINRIA
                     TLLHSLPTIVLQPALEAAVAAFNGVGGRLCIRNEAFDFHNGNVTSLTECLIPGNTCAR
                     LYICGQQPVMPEQTIYPLIEQYSVWQEHYKSGKYDIWAISDIYQTPSLRSLQPAFQAT
                     KIRSMLMIPLQYRQQLLGYLSIFRNEIDTETLWAGQYDSDQRQLYPRLSFEVWRESKK
                     AQAQKWTVEEIDLATDLGKHFASAIQQYELYQQVQTFNENLEKQVKRRTVELQRTAEQ
                     EQAVFKVIAEIRESLDTDTIFQTTTKEVCQLIKADRVSVYRFDSNWGGQFVGDFEAAS
                     PYWSNESELGVNTIWNDTYLQDTEGGRYRNNETFAVDDIYKMGFAQCHIDNLEQFQIH
                     AFVLAPIFVGQKLWGLLATYQHTGPRQWKASEVNFLSQIAGQMGVALQQADLLTQTRQ
                     QTLNLQQAAEQQRVLFEVVAKVRESLDLDAIFQTTTQEICKSLQADRVAVYRFHADWS
                     GEYIAEFVGDRWVKLVNDNVNTVWQDSYLQETQGGRYRHNESFAVDDIYQAGHSECHI
                     AALEQLQARAYAIAPIFIGQQLWGLLAAYQNSAPRHWEASEIKFITQIANQLGVALQQ
                     AQLHNQTKEQTEKLTQALHDLKQTQTQLIQTEKMSSLGQLVAGIAHEINNPVNFIYGN
                     INHVNDYAEDLLSILDLYLQNTPNPSPEIRDRAFEIDLEFVIEDLPKTLSSMKIGIDR
                     IRQIVLGLRNFSRLDQAEMKPVNIHDGIDSTLLILQHRLKAKPESPAIKLVKEYSDLP
                     LVECYAGPLNQVFMNVLSNSIDALEDYRESQSNLDTSQITIRTALGKLEGNVKSVVIR
                     IADNGPGIPETLKARICDPFFTTKPVGKGTGLGLSISYQIVVDKHGGVFKCDSQPGLG
                     TEFWIEIPIRQITK"
     gene            complement(111177..112340)
                     /locus_tag="COO91_00120"
                     /note="Nfsy_R00120"
     CDS             complement(111177..112340)
                     /locus_tag="COO91_00120"
                     /codon_start=1
                     /transl_table=11
                     /product="DPO3B, DNA polymerase III subunit beta"
                     /protein_id="AUB34300.1"
                     /translation="MKLVCSQSDLSTNLSLVSRAVPSRPTHPVLANVLLQADAQTNQV
                     SLTAFDLSLGIRTSFNAEVWQSGAIALPAKLLVDITSRLPEGEITLDDESALTGATSG
                     GEGLIVTLTPKSGHYQVRAMGPEEFPELPVIENTEVIHLTTTALIEGLRGSLFATSAD
                     ETKQVLTGVHLTVKQDTLEFAATDGHRLAVVETSNERPLGGTRQLEVTVPARALRELQ
                     RMLAHSASSDEPVALYFDQGQVVFAWQNQRLTSRTLEGQYPAYRQLIPRQFERQVTIE
                     RRQFVSTLERIAVLADQKNNIVKLSIDSEAQEITLSCEAQDVGSGRESMPAQISGENI
                     EIAFNIKYLMEGLKELPSSEIQMHLNQSLTPVIFTPLGGLKMTYLAMPVQLRS"
     gene            complement(112889..113107)
                     /locus_tag="COO91_00121"
                     /note="Nfsy_R00121"
     CDS             complement(112889..113107)
                     /locus_tag="COO91_00121"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34301.1"
                     /translation="MEEQLLQSIEQLLQLIIHLQEILKRFLYMEEHLLQSIKQLLQLI
                     IHLQEMLKRFLYMEEHLLQTFKFLQSEA"
     gene            113309..113635
                     /locus_tag="COO91_00122"
                     /note="Nfsy_F00122"
     CDS             113309..113635
                     /locus_tag="COO91_00122"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase involved in DNA repair"
                     /protein_id="AUB34302.1"
                     /translation="MARRKRNSTLLERADRRIESLQSISVELDFGQGLTMQAYNMTIN
                     DLRSKLAAYNTADRQSICRATANPEESLLVRLLVDLERHGLVIPLSKKLLPSPRKYLK
                     ILLNCL"
     gene            114621..114755
                     /locus_tag="COO91_00123"
                     /note="Nfsy_F00123"
     CDS             114621..114755
                     /locus_tag="COO91_00123"
                     /codon_start=1
                     /transl_table=11
                     /product="Choline dehydrogenase or related flavoprotein"
                     /protein_id="AUB34303.1"
                     /translation="MNPGWSYQDVLPYFKKSENQYCDADAYHGVNGELSVTEGGSKIG
                     "
     gene            114845..116119
                     /locus_tag="COO91_00124"
                     /note="Nfsy_F00124"
     CDS             114845..116119
                     /locus_tag="COO91_00124"
                     /codon_start=1
                     /transl_table=11
                     /product="Non-ribosomal peptide synthetase component F"
                     /protein_id="AUB34304.1"
                     /translation="MNRILTASEQLMWLSYNNSPENVTLSVTIKGSFTIDLLTEALAW
                     LQLRHSRLRVKIVTNNQNQPQFSLENVPPIPLRVIERQGEEHWCREMVEELRHPLSWS
                     KEPLLRVLLLHSPDISNLIITFHHCIGDGLSGAYLIRDILQFIGEPDNPRELLPDLPP
                     VDEIIPDITKDVVIENLNESKYTKYILTTNYRNKPSENILDSLAIRLFHWTLSSAETT
                     KLVARCRVEKTSGHGALCAAFLLAIAAEVKSSTEIILRCQTPVNIRNYLTIPVNENLG
                     EYITRLVTAHRLNQKTDFWDLAREVKYKLNQVVADGKLFDDVLKARALLSSNSNKGGE
                     TSDSRKLGGIIDITITNLGNLNIKQQFGKIQLQELYLMATGSKSLPLLIGVATLKDKM
                     CFICRYQESLVPDANAYNIKNTAMEQLLTALA"
     gene            complement(116370..117752)
                     /locus_tag="COO91_00125"
                     /note="Nfsy_R00125"
     CDS             complement(116370..117752)
                     /locus_tag="COO91_00125"
                     /codon_start=1
                     /transl_table=11
                     /product="dnaA, chromosomal replication initiator protein"
                     /protein_id="AUB34305.1"
                     /translation="MEIPIESLWSQVLERLQLELSQPTFETWIKTANAERLENNCLVI
                     RTPNPFARNWLQKYYINTIAHVVQDILGHPVGIYITVAQGDEVSHLSEREVSWESPNP
                     SSISEAVPNHNKKTTELNSKYVFSRFVVGANNRMAHAASLAVAESPGKEFNPLFLCGG
                     VGLGKTHLMQAIGHYRWQISPNCKIFYISTEQFTNDLITAIRKDSMQSFREHYRAADV
                     LLVDDIQFLEGKEYTQEEFFYTFNTLHEAGKQVVIASDRPPNQIPSLQERLCSRFSMG
                     LIADIQKPDLETRMAILQKKAEDENIRLPRDVIEYIASNYTSNIRELEGALIRAVAYI
                     SIWGLPMTVENITPVLEPPNQKMAATPEAILKVVADNFDVSIDDLKGNSRRREISWAR
                     QIGMYLMRQHTSLSLPRIGEEFGGKDHTTVIYSCDKITQLHESDRTLAQTIRQLSDRI
                     NITSRSQKSS"
     gene            117898..119160
                     /locus_tag="COO91_00126"
                     /note="Nfsy_F00126"
     CDS             117898..119160
                     /locus_tag="COO91_00126"
                     /codon_start=1
                     /transl_table=11
                     /product="Periplasmic serine protease, S1-C subfamily,
                     containing C-terminal PDZ domain"
                     /protein_id="AUB34306.1"
                     /translation="MEKQRHMKTTNHDLAPKKIDARGLPHRLWMLSCGVAVVFLGSCS
                     LLPAKTFETRQSETQAQKTIEPNPVIVPPAIISSSEDANFVVKVVQQVGPAVVRIDSS
                     RTITSRVPDEFNNDPFFRRFFGEGAPQPRQRVERGSGSGFLINSSGQIVTNSHVVDGA
                     DTVTVTLKDGRTFDGKVLGEDPVTDVATIKIDANNLPTLAVGNSDALQPGEAVIAIGN
                     PLGLNNTVTSGIISATGRSSSDIGASDKRVDYIQTDAAINPGNSGGPLLNARGQVIAM
                     NTAIIRGAQGLGFAIPINTVQRIAQELIANGKVDHPYLGVQMVTLTPDIKERIKNKAG
                     DRLNLTADEGVLLVDIVPRSPASTAGLRVGDVIKSINNQPVTKIEEVQKLVENSKIGT
                     NLPIEVERDGQTVQVGVQPAPLPVTREG"
     gene            119249..119779
                     /locus_tag="COO91_00127"
                     /note="Nfsy_F00127"
     CDS             119249..119779
                     /locus_tag="COO91_00127"
                     /codon_start=1
                     /transl_table=11
                     /product="PDF, peptide deformylase"
                     /protein_id="AUB34307.1"
                     /translation="MTELAPIIQLGNPTLRQKAAWVENIQDEHIQKLIEDLIATVAKA
                     NGVGIAAPQVAQSYRLFIVASRPNARYPNAPEMEPTAMINPKIIAHSTEVVKDWEGCL
                     SVPGIRGVVPRYKTIEVEYTDCQGNLQRQELTDFIARIFQHEYDHLDGIVFVDRIENT
                     LDMITEQEYQQRVVNK"
     gene            complement(119875..121566)
                     /locus_tag="COO91_00128"
                     /note="Nfsy_R00128"
     CDS             complement(119875..121566)
                     /locus_tag="COO91_00128"
                     /codon_start=1
                     /transl_table=11
                     /product="Voltage-gated potassium channel Kch"
                     /protein_id="AUB34308.1"
                     /translation="MKPRIIVCGLGRTGYKTFRLLRHQGAFVVGIHHQSIPGETGGDV
                     IVGDLQAASTLTAAGIQQAHTLVIAGSKDALNLSIMMQARVLNPQIRIINRFYNTNLG
                     ERLDQSLPDHLSMSVVGLAAPVFTFAAMGNRAIGQIKLFQQTWPIHEEYIDENHFWRG
                     LKLSELWEDRSRMLIYYLPVEGEMDLVSGVISGQEIKVGDRLIIGTQPRIRSPRRSLI
                     KKLLKALTNFRQFQEHGRSVVVGAIVLLAVILIATFTYMSAELSLSPVDALYFSVGMI
                     TGAGGNDKVVENAPNSIKLFTVVMMLIGAVVIGIWYAMLTDFVLGSRFKQFWDAARIP
                     QRYHYIVCGLSGIGVRIVQQLHASGHEVVVVEPDSNNKYINTARELGIPVIQGDASFR
                     TILKASNIDSAAAVLAVTSNDATNLEIALKAKGLTPSIPVIVHYADPDFAGIAQQLFG
                     FEAVLSPAELAAPAFAAAALGGRILGNGITADSLWVAFATVITPSHVFCGQWVKDVAM
                     SADCVPLYVETNHQNLHGWDLLETKLSAGDVLYMTMPATRLYQLWRGEQVCEAHV"
     gene            complement(121719..123155)
                     /locus_tag="COO91_00129"
                     /note="Nfsy_R00129"
     CDS             complement(121719..123155)
                     /locus_tag="COO91_00129"
                     /codon_start=1
                     /transl_table=11
                     /product="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /protein_id="AUB34309.1"
                     /translation="MFESTITKPDERHALVIGGSIAGLLAAQVMTKYFNQVTIIERDH
                     LSAQPEQRPGVPQAHHFHILLKRGLVVIEQLFPGIQTELAASGAVAINASADCLWYGL
                     GGWTPRFNSDLNFYSLSRNLLEWIIRRRLAANNRVVFVQASQVTSLLSNPNKTQVTGV
                     QVRQKIAHKQDTSYRQTDFTADLVVDASGRNSRAPRWLEAMGYTPPKETVINSFLGYA
                     SRLYELPENFQTDWQGALVTAKAPGTRSGGMFAIEGNRWIVTLAGIGRDYPPTDEAGF
                     LDFARSLRNPIIYEAILNAKAISPPIAYHRTENSWHHYEKLSRLPSGFVVIGDAVCAF
                     NPVYGQGMTTAALGALTLDECLNKQLSRHADGNLVGLSQSFQKQLSKIIAVPWLMATG
                     EDFRWNTTVGGRPNLMTKLMQLYLDQVLLLAAESSDIHRLFLEVMHLLKPPSVFFHTN
                     VFRQVLQRIIRESDKKWNKSGDKLLVDH"
     gene            123547..123696
                     /locus_tag="COO91_00130"
                     /note="Nfsy_F00130"
     CDS             123547..123696
                     /locus_tag="COO91_00130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34310.1"
                     /translation="MSMISFRPLILIINTSIALLPGLGVELTRGNKIIYKNMAIFVGC
                     DTLSA"
     gene            123717..124820
                     /locus_tag="COO91_00131"
                     /note="Nfsy_F00131"
     CDS             123717..124820
                     /locus_tag="COO91_00131"
                     /codon_start=1
                     /transl_table=11
                     /product="ddl, D-alanine-D-alanine ligase"
                     /protein_id="AUB34311.1"
                     /translation="MAKLRVGLLFGGRSGEHEVSIKSARAIAKALSAEQNANKYEILP
                     FYIQKDGRWLAGEAPEKVLATGTPLLESEQSTSSEGNLTSNPQAQTLSKWQSPSQVAQ
                     VDVWFPILHGPNGEDGTIQGLLTLMQVPFVGSGVLGSAMGMDKIAMKMAFEQAGLPQV
                     KYKAITRTQVWSNPCVFPKLCDEIEAALGYPAFVKPANLGSSVGIAKVRSRQELEAAL
                     DNAASYDRRLVVEAGVVAREVECAVLGNDQPQASVVGEITYDSDFYDYETKYTEGLAD
                     LLIPAQLPDAIARQIQDMALQAFAGVDAAGLARVDFFYVEATQEVLINEINTLPGFTA
                     TSMYPQLWAHSGVSFPELVDRLIQLAIERHSPS"
     gene            125180..125674
                     /locus_tag="COO91_00132"
                     /note="Nfsy_F00132"
     CDS             125180..125674
                     /locus_tag="COO91_00132"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34312.1"
                     /translation="MFLGGGAFALYSLGNAGQVTQEEPEKIPVIVEEPINAPSENSNP
                     TPLWMVAAIVLSCGSGCLLIFRMLNRTKEPQKVQKLVNRHQARLAQNHYQRLEPRLPN
                     NQPVFVPQSQLMPVMQMRPKTKHLVTVLPAEHKHHLDTRTESLADLMDLRKDSSLSAI
                     LRQS"
     gene            complement(126204..126530)
                     /locus_tag="COO91_00133"
                     /note="Nfsy_R00133"
     CDS             complement(126204..126530)
                     /locus_tag="COO91_00133"
                     /codon_start=1
                     /transl_table=11
                     /product="Sodium-dependent phosphate transporter"
                     /protein_id="AUB34313.1"
                     /translation="MIWGIHLLIWGTHLLIWGTHLLIWGTHLLIWGTHLLIWGTHLLI
                     WGTHLLIWGTHLLIWGTHLLIWGTHLLIWGTHLLIWGTHLLIWGTHLLIWGTHLLIWR
                     VHNAWL"
     gene            126656..126781
                     /locus_tag="COO91_00134"
                     /note="Nfsy_F00134"
     CDS             126656..126781
                     /locus_tag="COO91_00134"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34314.1"
                     /translation="MLDGVFPTCMYTVAACREGLGVGCNNCGNHNYLCGHDITQR"
     gene            126838..127254
                     /locus_tag="COO91_00135"
                     /note="Nfsy_F00135"
     CDS             126838..127254
                     /locus_tag="COO91_00135"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34315.1"
                     /translation="MNNIVRLVLTAILLVLVTACGSIGLLPTSELVQKAIALGLEQTQ
                     QKLSQQLDLDFQGFEIKRLSITQEQPLTIENLPAFHVRGTYDLILKLPKRRLTQPKKP
                     FDVYLQIQQEGKTWRLLLPQKGSKETQSIWRSYLIQ"
     gene            complement(127472..128950)
                     /locus_tag="COO91_00136"
                     /note="Nfsy_R00136"
     CDS             complement(127472..128950)
                     /locus_tag="COO91_00136"
                     /codon_start=1
                     /transl_table=11
                     /product="ilvC, ketol-acid reductoisomerase"
                     /protein_id="AUB34316.1"
                     /translation="MSSLHFNTKTFNKEKILLANTEEYIIRGGHHLFPILPKAFAGIG
                     QIGVIGWSSQGSAQAQNLRDSLMGTDIKVKIGLRENSTSIPLAQKAGFTTDDGTLGEM
                     YEVLSSSQLSILLISDAAQANNIERIFESLCPGSTLGLSHGFLLGYLKSIGKDFPKNI
                     NVIAVCPKGMGLSVRRLYEQGKEVNGAGINSSFAIHQDINGKATDYALGWSIAIGSPV
                     TFKTTLEEEYKSDIFGEKGVLLGAVHGIVESLYRWFIGQGFSKESAFIKSVESLTGPI
                     TKLISQKGILSVYEFLNKTDQEAFKKAYSAAYHPAFEILMEIYDDVASGSEIKSVIEA
                     EHRHQRYPMKNIDGTQMWQVGASVRAKRQPENIAVNPITAGIYIATMMAQVDLLREKG
                     HSYSEIANESIIESVDSLNPYMHHKGIAFMVDNCSITARLGARKWASRFDYILYQQAF
                     TTLDSNLSIDQELFDQFLTHKIHQVLSVCAKLRPSVDISIVG"
     gene            129065..129952
                     /locus_tag="COO91_00137"
                     /note="Nfsy_F00137"
     CDS             129065..129952
                     /locus_tag="COO91_00137"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator, LysR
                     family"
                     /protein_id="AUB34317.1"
                     /translation="MELRHLRYFVAVAEELHFGRAAQRLHMAQQPLSQQIRQLEAELG
                     VSLFHRTKRQVQLTEAGKAFLQEARQVLDKASHAIKVARLVAQGEIGRLAVGFSGFAT
                     YSILPKVLQVFRERFPSVELDLEEMTTSAQVQALQNRQIHLGLMIPPVNDASLSLSMI
                     LQEPFVVVLPESHPLAKKPELTLSALGNESFILVSRHLEPGYYDLCISLFQQAGFSPK
                     VVQKASHKQTILGLVSAGMGVSLAPASIRNIHRTGVVYTNLNTSIAKVELAAVWRQDE
                     SSPILQSFIEVIREIVLQN"
     gene            130180..130953
                     /locus_tag="COO91_00138"
                     /note="Nfsy_F00138"
     CDS             130180..130953
                     /locus_tag="COO91_00138"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34318.1"
                     /translation="MYINFFISSIAGIVIVVLTAFGLLQWLHIPAGNFLDWVIGGASF
                     WWLLVIVTVPWNVHFQAKEVLAEAAQSKEKGIPVDEKQVKYVTVLAKRSLWVAIALHL
                     FSAVGLYTLAATGISTVGYISSGAALLLTILRPAIRAYEYLYARLAMIRQEWKYPRED
                     IVELRDRFSILEQKIQSFEEQLNPEQSYSLPATQQRFAEETRRDLARIAANLEELRAT
                     NQTEHERLAREARTAIAQLSTDGQFLDHVREIIRFFKTA"
     gene            complement(130961..131734)
                     /locus_tag="COO91_00139"
                     /note="Nfsy_R00139"
     CDS             complement(130961..131734)
                     /locus_tag="COO91_00139"
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent 3-hydroxy acid dehydrogenase
                     YdfG"
                     /protein_id="AUB34319.1"
                     /translation="MTSLENQIILITGASSGIGTACARIFAGAGAKLILAARRLERLQ
                     QLADALIKEFGIEIHLLQLDVRDRNAVEEAISTLPSAWSDIDILINNAGLSRGLDKLH
                     EGSFQDWEDMIDTNVKGLLYVSRYVVPGMVSRDRGHVVNLGSIAGHQTYPGGNVYCAT
                     KAAVTAISEGLKQDLLGTRVRVTSVDPGMVETEFSNVRFHGDAERANKVYQGVKPLTA
                     DDVADVIFFCVTRSPHVNINEVVLMPVDQASATLVNRRT"
     gene            132410..133747
                     /locus_tag="COO91_00140"
                     /note="Nfsy_F00140"
     CDS             132410..133747
                     /locus_tag="COO91_00140"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34320.1"
                     /translation="MGVQQCLIDADKETKALLEYLCEQSGKLYNTGIYLARQTFFKTN
                     KLLTGKFDLAFEPLIAKSMLAQSLPSKPMQQTLMSVTEAFKSFKEVRNLYLKGEFNFR
                     PKAPGYLKGSKLFKVAYPNSGGQKPTLINGQLRFSLGLTVRRWFGVSEFFLPMPSNID
                     YSRVKEFTILPKNGAFYLEMSYKVEKQKHDLDINQALSIDLGTADNLAACVDTLGNSL
                     LIDARAMKAMNQLWNKKVSTRKECKPEAYWDNWLDRVTRKRNHQMRDGINKAAKLIID
                     HCLKYGIGTLVIGWNEGFKESANMGRVNNQKFVQMPLGKLKDRLKQLCDLHGIRFIET
                     EEAYTSKASYLDGDSLPVYGQKPVGWKALGKRVERGLYRSANGSIVNADLNGSANILR
                     KVASNLSLDLGLLGRRVLTTAARVRLWTLPKFTLSAESQTLKGLRVSTLVYNS"
     gene            complement(133937..134776)
                     /locus_tag="COO91_00141"
                     /note="Nfsy_R00141"
     CDS             complement(133937..134776)
                     /locus_tag="COO91_00141"
                     /codon_start=1
                     /transl_table=11
                     /product="cyanobacterial hypothetical protein"
                     /protein_id="AUB34321.1"
                     /translation="MTNIITALGRRQLRFPASIWLVSFLLTLGLTSGWQRTQATTPQQ
                     LAQAGTAQNVPADLKNLLTQVDAAASRGDVKGVLQFYSPNFTHGDGLNLQTLEKSLNS
                     LWQRYPKLQYSTKLLSSKPEGSAIIAETETKITGLPSGNSNNLALNATIKSRQRIVGG
                     KIVRQDILSERTQLTSGSKPPQIDMKLPEQVKVGQKYNFDAIVQEPLGDDFLLGAALE
                     EPIQADKFFNPTSVDLQLLTSGGLFKTGQAPSTPGSQWVSAVILRGNGMTMVTQRLQV
                     VKK"
     gene            134862..135935
                     /locus_tag="COO91_00142"
                     /note="Nfsy_F00142"
     CDS             134862..135935
                     /locus_tag="COO91_00142"
                     /codon_start=1
                     /transl_table=11
                     /product="murG, UDP-N-acetylglucosamine"
                     /protein_id="AUB34322.1"
                     /translation="MANAPIRLLIAASGTGGHLFPAIALAQKLPDYQIEWLGVPNRLE
                     TELVPKEYPLNTIAVEGFQQGFGLSSIRILGKLAGSIIEVRRILKQGNFQGVFTTGGY
                     IAGPAVIAARSLGLPVVFHESNAIPGKVTRFFGPWCSAVALGFEVAAKYLPRAKTVCV
                     GTPVRAQFLDGAIDAPLDLAIPNGVPLIVVFGGSQGAVAVNKLVRESTKAWFDAGAYV
                     VHLTGDRDPEADSLKHSQYIALPFYNNMAALLQRATLAISRSGAGSLTELAVCGTPAI
                     LIPYPFAAEDHQSYNADVFTKAGAALTLKQSELTAQILQSNVLNLLQSPDELAKMGEK
                     AKAIAVPDSADKLAQLVREVIET"
     gene            136029..137318
                     /locus_tag="COO91_00143"
                     /note="Nfsy_F00143"
     CDS             136029..137318
                     /locus_tag="COO91_00143"
                     /codon_start=1
                     /transl_table=11
                     /product="Membrane-bound lytic murein transglycosylase"
                     /protein_id="AUB34323.1"
                     /translation="MLVGLASSYVYTQSKTKQLTQQYQSFTQQENFTPLESHISLTSN
                     QVDQKVDLRLQNSLITQQASDEIIGKQNVFSSKQNLLAASAPYPVVDEFKKYKFNING
                     SQVITPVKLPSSKVNFNQKDLLTVLVNTKKYFQDYSSEDPDILRTGILATQGVTVPDV
                     LKTLDFMIAVLKEDIANNRATRLQDPKFINSNFRVIKWTAYNPKDKKQKQLRITKYAV
                     FTHTGSRKKNSTFNTPIYSLKDNSNKNTFYTKYTKQDVLSGIYEPGGKEFGKVKSLAY
                     LTRTGLEEALMQGTILINFTDGYRAFFNVDRNNGMSYIRGLKATAQKRYWYFREVDAI
                     KGYGYKIDAKISIKPGVTFAGDVLNIGLGRVIVIEHTKGGRKHLQMGVMADTGGAFLP
                     NLYQLDFLAGIFKSQKEFRQNISQLPEYATAYFLVKK"
     gene            complement(137342..137590)
                     /locus_tag="COO91_00144"
                     /note="Nfsy_R00144"
     CDS             complement(137342..137590)
                     /locus_tag="COO91_00144"
                     /codon_start=1
                     /transl_table=11
                     /product="Catechol 2,3-dioxygenase or other
                     lactoylglutathione lyase family enzyme"
                     /protein_id="AUB34324.1"
                     /translation="MHINDAFTLDFADAEAFEQHHYAFHVSDEEFDAIFARVKEAGIE
                     YSSDPMHENKGQINHWNEGRGFYFYDSDGHNLELLTRA"
     gene            137572..137700
                     /locus_tag="COO91_00145"
                     /note="Nfsy_F00145"
     CDS             137572..137700
                     /locus_tag="COO91_00145"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34325.1"
                     /translation="MHHLYAQQQSDQLEPRPLNQKFLQRTSLMLPCHVQALWCDLE"
     gene            138021..139103
                     /locus_tag="COO91_00146"
                     /note="Nfsy_F00146"
     CDS             138021..139103
                     /locus_tag="COO91_00146"
                     /codon_start=1
                     /transl_table=11
                     /product="psbA"
                     /protein_id="AUB34326.1"
                     /translation="MTATLQQRSSANVWDRFCEWITSTNNRIYIGWFGVVMIPTLLAA
                     TACFVIAFIAAPPVDIDGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASL
                     DEWLYNGGPYQLVVFHFLIGVFCYLGREWELSYRLGMRPWIAIAYSAPVAAATAVFLV
                     YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGSLFSAMHGSL
                     VTSSLVRETTETESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLA
                     AWPVIGIWFTALGVSTMAFNLNGFNFNQSIIDSSGRVISTWADVINRANLGMEVMHER
                     NAHNFPLDLAAGDVAPVAMSAPAING"
     gene            complement(139199..139879)
                     /locus_tag="COO91_00147"
                     /note="Nfsy_R00147"
     CDS             complement(139199..139879)
                     /locus_tag="COO91_00147"
                     /codon_start=1
                     /transl_table=11
                     /product="Pyrimidine reductase, riboflavin biosynthesis"
                     /protein_id="AUB34327.1"
                     /translation="MSAIQTTVVLAMTADGKISAVDPKAPRDSDPVDQAHLEYQASLA
                     DLVLVGAGTIRAEGGTYTIRNPELLAAREVRGQSPQPITCVVSGSLDLSLDLPFLSQD
                     IKRWIFTTRTGLKRNTDATSLQKLAELIDLGETDLDWDRAYSLMAERGIHKVIVLGGG
                     SLTAALVKAGRIDYWWLTIWPVIYGGKHAPSPVEGEGFLPQAAPHLELVETRQVGSQL
                     FLHYRTLN"
     gene            140004..140117
                     /locus_tag="COO91_00148"
                     /note="Nfsy_F00148"
     CDS             140004..140117
                     /locus_tag="COO91_00148"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34328.1"
                     /translation="MWQWVFTRIEPKLTRLKNEIGKTLGEQLDTEKQPPVQ"
     gene            complement(140241..140720)
                     /locus_tag="COO91_00149"
                     /note="Nfsy_R00149"
     CDS             complement(140241..140720)
                     /locus_tag="COO91_00149"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphohydrolase, protein tyrosine
                     phosphatase"
                     /protein_id="AUB34329.1"
                     /translation="MINAIQINENLTTTGQVIPKQLEQAIQEGFKSVLNLRSPDELGF
                     SQDEQKVAEALGLHYTNVPLKVDLKNLNEEAITKILTTLEQIPKPAVVHCAAGMRSTG
                     IALLSIAIQEGLTPEETLARAKNLGFGFFEHAGVSPRLKQLFVDYVNKHAKVAVPTC"
     gene            complement(140971..141120)
                     /locus_tag="COO91_00150"
                     /note="Nfsy_R00150"
     CDS             complement(140971..141120)
                     /locus_tag="COO91_00150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34330.1"
                     /translation="MSHNSLDNLLSDFLNIVTRSSNMSNYSRTRSLGIATDHTAACNS
                     INDNF"
     gene            141410..141856
                     /locus_tag="COO91_00151"
                     /note="Nfsy_F00151"
     CDS             141410..141856
                     /locus_tag="COO91_00151"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribosomal protein S18 acetylase RimI and related
                     acetyltransferases"
                     /protein_id="AUB34331.1"
                     /translation="MLSAIHIAAIKALPATFYTRKELLAWRNNRDKPDGSYILKSMKV
                     ETFWVAIKGDVVIGFASFIVDELIGLYVHPKYQGKGIGRALVQHFCDEATNQGINNVI
                     TTASLYAEGFYLRLGFIAIQRAPHFLRNGVVVPVTKMSKILAIAPK"
     gene            142020..142619
                     /locus_tag="COO91_00152"
                     /note="Nfsy_F00152"
     CDS             142020..142619
                     /locus_tag="COO91_00152"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator, AcrR
                     family"
                     /protein_id="AUB34332.1"
                     /translation="MIEAASQVFATLGVQGATTREIARVAGVNEVTLFRHFASKEQLL
                     GAVIENASALQTEALAHPEAWTQDLKTDLKQYAHLYNTMLEAQENLIRTFIGEAKRHP
                     EAAKQVIQKAAKPLGEKLVAYLQSSQRRGKVKADLDPFPAVDMFTGMLLAGMLCRSTN
                     YNQGSYSCEDYIETCVDIFVCGISATSLSVINTAVSHDF"
     gene            142637..142942
                     /locus_tag="COO91_00153"
                     /note="Nfsy_F00153"
     CDS             142637..142942
                     /locus_tag="COO91_00153"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34333.1"
                     /translation="MTPYQNYSRVNSFGDRCNSSLLRVVSFIPVSSNTELSEAIAPLP
                     GTIATSPPQIPDFIGKPILTANWAEASYNPQVDITALTIRRFCADKQPFSQAKSFSS"
     gene            complement(142935..143168)
                     /locus_tag="COO91_00154"
                     /note="Nfsy_R00154"
     CDS             complement(142935..143168)
                     /locus_tag="COO91_00154"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutaminase"
                     /protein_id="AUB34334.1"
                     /translation="MKGLKKLTTTELLTWIQQAKIQVEGGQVAHRIPQLAKANPGWFA
                     IHICCESGKTITFGDIACVFPLISVIKTFSLLS"
     gene            complement(143903..144652)
                     /locus_tag="COO91_00155"
                     /note="Nfsy_R00155"
     CDS             complement(143903..144652)
                     /locus_tag="COO91_00155"
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent 3-hydroxy acid dehydrogenase
                     YdfG"
                     /protein_id="AUB34335.1"
                     /translation="MTGKLEEKVAIITGASAGIGEATAIALASVGATVVLAARRGDRI
                     QALTQRIEASGGKALPIVTDVTDETQVNNLVAKANAELGRVDILVNNAGIALLGTIEA
                     GNSSDWRRSFDLNVLGLLYATHAVLPLLKAQKSGHIVNISSVAGRTARAGVGVYNATK
                     WGVNALSEALRQEVHKDNIRVTIIEPGLVDTEIDSQITDPVAKQRIEERRKAITPLQS
                     EDVAAAIVYAVTQPSRVNVNEILIRPTGQEH"
     gene            complement(144649..144777)
                     /locus_tag="COO91_00156"
                     /note="Nfsy_R00156"
     CDS             complement(144649..144777)
                     /locus_tag="COO91_00156"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34336.1"
                     /translation="MLNTQCPIRWILNRRKRNKTGIINAQDPMPHSQLSITKDLDK"
     gene            145197..145646
                     /locus_tag="COO91_00157"
                     /note="Nfsy_F00157"
     CDS             145197..145646
                     /locus_tag="COO91_00157"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34337.1"
                     /translation="MTQKAALSRFALAFIAGFVSVLLFHQGMLALLYAVNFTARAPYG
                     TAPTPPFGIPQIWSSAFWGGIWGLIWVAISPRFRHDKSYWFAALVFGAIVPTLVAWFV
                     VAPLKGQPIAGGWKLVGIVTGLLVNGAWGVGTAGLLRLFSRRQLFNS"
     gene            complement(145693..145806)
                     /locus_tag="COO91_00158"
                     /note="Nfsy_R00158"
     CDS             complement(145693..145806)
                     /locus_tag="COO91_00158"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ester cyclase"
                     /protein_id="AUB34338.1"
                     /translation="MFIHWIVGKIIETRRNADKLVRVLQFGARIEPGMSGQ"
     gene            145889..146836
                     /locus_tag="COO91_00159"
                     /note="Nfsy_F00159"
     CDS             145889..146836
                     /locus_tag="COO91_00159"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycosyltransferase, GT2 family"
                     /protein_id="AUB34339.1"
                     /translation="MPKITVCIPTFNRVHLLPYAIDSVLNQSEQDFELIVCDDGSSDR
                     TPELMSQYTDHRIKYIRHLQNIGKSNNMRSGFDAASGEYFIKFDDDDQLTPDFLASTA
                     AILNQYSSIDFVGTDHWIIDINNVRDEAKTQENSHRWGRNNLPAGVVDNLLEVVFIQQ
                     SFQVGATLFRRKTLQELGYMQPNMQNCEDNDLFVRLALAGKKGYYLPELLMEYRSHPE
                     QQGINRAIPYLFDKIRYLESYKFESEKLETIRKNRLTETKLLLGLRLIEKGETQKGRE
                     LVLAGQSFSTAKAWTGLSLSFLPVGLRGKAFNALRQVRG"
     gene            complement(146916..147671)
                     /locus_tag="COO91_00160"
                     /note="Nfsy_R00160"
     CDS             complement(146916..147671)
                     /locus_tag="COO91_00160"
                     /codon_start=1
                     /transl_table=11
                     /product="Winged helix-turn-helix DNA-binding domain"
                     /protein_id="AUB34340.1"
                     /translation="MDSLESKIIEILKRGTPLRAVKIADMLGVERREVNHYLYSSLKN
                     IVVQDSEYKWSLKTNEIGNNQRIPTQPRTPQNQSSKPGTQNNVYSFTKKEIRQDTPIQ
                     PPIQPNQSSQPVKHEKLEKFYQQNFQPNSQTPSSQPVKQSNAYEVVNRKLAQVSSEEK
                     VKILENAFRQNRYAELEDEQINALQSILEEARREVNIANRAYTQGKLSFWKTNSLAIA
                     VVSIALTLGTFFMISQLRSNSTYQPTPTIPQNR"
     gene            complement(147705..148445)
                     /locus_tag="COO91_00161"
                     /note="Nfsy_R00161"
     CDS             complement(147705..148445)
                     /locus_tag="COO91_00161"
                     /codon_start=1
                     /transl_table=11
                     /product="Chromosome segregation protein Spo0J,
                     containings ParB-like nuclease domain"
                     /protein_id="AUB34341.1"
                     /translation="MKLATSLVAVKKISSNKLRSIFVDDELEQAARLILDSEGVINPI
                     VVRRTSLQSYEVVDGDFEYYAAVRAREIDPRKGEMIGVFIIESENEETLTKQVELFRK
                     SKAFIANNVSASSDGIESRLINTESRFTNTESRMTNLESRFENRTIELQTEFRLEIKN
                     INDRLKEIENRIPKPMEPLEALNTLGISELTSKLRRVGINIKIIEKIISERDNGKFKS
                     FSNVVERIKGLGDKTMLKIIDSFAEGTV"
     gene            complement(148445..149752)
                     /locus_tag="COO91_00162"
                     /note="Nfsy_R00162"
     CDS             complement(148445..149752)
                     /locus_tag="COO91_00162"
                     /codon_start=1
                     /transl_table=11
                     /product="Cellulose biosynthesis protein BcsQ"
                     /protein_id="AUB34342.1"
                     /translation="MQYLLPQLGYTPDTWHQEVAVGSIRLDFLAFAAQVIPFVLDANS
                     PLSVVMEAKHPKQNLNNHVLRLRHYLTSLNVRYGLLTNGKEIRIYQKLQTDIQLIFQC
                     SGKEVETKLENIKVLIGRETLKEGQLLDKAEVKITENILNLETKRQHSMKIIAVYHNK
                     GGVGKTTTVVNLAAAIRKKGKRVLVIDLDSQANTTFATGLVKFDDEEFDDIKDSNIFH
                     VLQSEDFYPIAEVARKSNFSNPEIYVVPAHIDLIRLETELNALDYSRLILIEKLEKVK
                     DQYDIVLIDTPPSLNLYAKIALIATDFLIIPSDLKPFANQGLTNVQEFIKTINGFRKQ
                     IRKPPIEIIGVLACKISTNAKFVQSTLKNRLEKIYSRYGINVMNAVIYEREDLAKCAE
                     RIQIVGDIEIADPISVLDFKPDSTSAHEFELLAIEVLEKIGLS"
     gene            150069..150440
                     /locus_tag="COO91_00163"
                     /note="Nfsy_F00163"
     CDS             150069..150440
                     /locus_tag="COO91_00163"
                     /codon_start=1
                     /transl_table=11
                     /product="Signal transduction histidine kinase,
                     nitrate/nitrite-specific"
                     /protein_id="AUB34343.1"
                     /translation="MATVSCPHCHQLVDSQAISCPYCRTTLKAYGHPGIPLHRATGDG
                     YLCDTCTYHADDTCNFPQRPYAKDCTLYQNIEETKLELEQQRYSNSFAITVKSWVKRN
                     QALLLLLGLLLVCLLFVILRS"
     gene            150437..150577
                     /locus_tag="COO91_00164"
                     /note="Nfsy_F00164"
     CDS             150437..150577
                     /locus_tag="COO91_00164"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34344.1"
                     /translation="MICVYWGVGSRGSRGRRTNAKCSMPNSLIFLISLISPTPHSPFP
                     TP"
     gene            complement(150581..152527)
                     /locus_tag="COO91_00165"
                     /note="Nfsy_R00165"
     CDS             complement(150581..152527)
                     /locus_tag="COO91_00165"
                     /codon_start=1
                     /transl_table=11
                     /product="nblS, two-component system, OmpR family, sensor
                     histidine kinase NblS"
                     /protein_id="AUB34345.1"
                     /translation="MLSLLKTIRHAIATWWSEFTLQTKLLAVVTMVVSLVMSGLTFWA
                     VNTIQQDARMNDTRFGRDLGLLLAANVAPLIADNNLTEVAQFSQRFYSSTSSVRYMLY
                     ADENGEIFFGIPFWEAEVENSLTIKRRIQLPEDYPGDGEKPMVRQHTTPDGIVTDVFI
                     PLIVNKRYLGVLAIGINPNQTAVISTNFTRDVTIAVFITIWVMVILAGVINALTITKP
                     IKELLVGVKQIATGNFKQRIDLPLGGELGELILSFNEMAERLERYEEQNIEELTAEKA
                     KLQTLVSTIADGAVLIDNNMQVILANPTAERIFGWENADVVGQNLLHHLPPAVQMEIA
                     SPLYEMAAGECESAEFRIFINQPTPRTIRILLTTVLNVQRESIKGIAITVQDITREVE
                     LNEAKGQFISNVSHELRTPLFNIKTHIETLYDYGEDLDLQKRQEYLQTVNHETDRLTR
                     LVNDVLDLSKLESGRNYSFDGVDLTQAIEQTLRTYQLNAKDKGVELLQEIDPNLPLVM
                     GNYDLLVQVFGNLIGNSLKFTKAGGKVAIRAYQLDFKPSQTQSSPVRIEISDTGIGIA
                     TEDQRSIFERFFRVENRVHTLEGTGLGLSIVRNIIDRHRSKVHLVSEVGIGTTFWFDL
                     AAFEEKAPPILIEPVAEASKITTV"
     gene            complement(152542..152691)
                     /locus_tag="COO91_00166"
                     /note="Nfsy_R00166"
     CDS             complement(152542..152691)
                     /locus_tag="COO91_00166"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34346.1"
                     /translation="MPNAQCPMPNTSTSLSTSAQCPIPNSPSPNMFVKLTVNFLVVRL
                     YNKDY"
     gene            complement(152802..154079)
                     /locus_tag="COO91_00167"
                     /note="Nfsy_R00167"
     CDS             complement(152802..154079)
                     /locus_tag="COO91_00167"
                     /codon_start=1
                     /transl_table=11
                     /product="purD, phosphoribosylamine--glycine ligase"
                     /protein_id="AUB34347.1"
                     /translation="MKVLVVGNGGREHALAWKLLQSKQIEQVICVPGNGGTASMERCH
                     NLPLAVDDFEGMSRYALLNGITLVIVGPEVPLSKGITDYLQDEGLMVFGPVRAGAQIE
                     ASKAWAKALMQEAGIPTARAAVFTEAAAAKSYIKATGVPIVVKADGLAAGKGVTVAET
                     VAQAESAVDAIFQGQFGSAGEFVVIEECLIGQEVSVLALTDGVTIRPLLPAQDHKRIG
                     DDDTGENTGGMGAYSPAPIATPELMARIQTEVLERAIATLRAKGIDYRGVLYAGLMIA
                     PDGDLKVLEFNCRFGDPETQVILPLLETPLEELLLACVQQRLSELPPIAWKEGASATV
                     VAASGGYPGEYEKGQVITGIGEAEATGATVFHAGTKLNQQQEVVTDGGRVLNVTGIGE
                     NFEQAIAQAYAGIKYIQFEGIYYRRDIGHRVRS"
     gene            154565..155512
                     /locus_tag="COO91_00168"
                     /note="Nfsy_F00168"
     CDS             154565..155512
                     /locus_tag="COO91_00168"
                     /codon_start=1
                     /transl_table=11
                     /product="Nucleoside-diphosphate-sugar epimerase"
                     /protein_id="AUB34348.1"
                     /translation="MAKIIVTGAAGFIGSHLAETLLQQGEEVIGIDEFNDYYDPMLKR
                     KNIAHLHQSPGFTLIEGDIQFLDWQKLLKNVDVVYHQAAQAGVRASWGKAFRGYTERN
                     INATQILLEAAKDAKHLKRLVFASSSSIYGDAEALPTHEGICPQPVSPYGITKLAAET
                     LCRLYHKNFGVPSVSLRYFTVYGPKQRPDMAFHKFFKSILQDEAIPIYGDGQQTREFT
                     FISDVIAANLAAASAPVAVGEIFNIGGGSRVVLAEVLDTIEEIVGKSIKRNHIEKAMG
                     DARHTGADVSKAQRILGYQPQVSLREGLTQEWEWIKSLY"
     gene            complement(155783..155920)
                     /locus_tag="COO91_00169"
                     /note="Nfsy_R00169"
     CDS             complement(155783..155920)
                     /locus_tag="COO91_00169"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="AUB34349.1"
                     /translation="MKQAQTLLWKGKVEATKALFTDRKGKQIQSFYRYLDKHCHRLIN
                     I"
     gene            complement(155981..156109)
                     /locus_tag="COO91_00170"
                     /note="Nfsy_R00170"
     CDS             complement(155981..156109)
                     /locus_tag="COO91_00170"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="AUB34350.1"
                     /translation="MNHVVIDWVNDQPLANTVTCIGDGDDGIWNIIDQLAPDVQHR"
     gene            156413..156559
                     /locus_tag="COO91_00171"
                     /note="Nfsy_F00171"
     CDS             156413..156559
                     /locus_tag="COO91_00171"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34351.1"
                     /translation="MLPGDFPPSSTVYSYYRKWQKRGIWEELNHALRDKVREKVVGQH
                     NQQR"
     gene            156624..157067
                     /locus_tag="COO91_00172"
                     /note="Nfsy_F00172"
     CDS             156624..157067
                     /locus_tag="COO91_00172"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34352.1"
                     /translation="MYGFDGGKLVKGRKRQTIVDSLGLLLKVVVSEGNAGERVLAAYA
                     LMELVEERPELLEKVEVMWVDSGYDGDKFALAVWLMIQAHVDVIRRTDKNFEVLPKRW
                     VVERTFAWFNQYHRLSKEDYERLPEMSEAAIYAVMTRIMLRRLAV"
     gene            157284..157901
                     /locus_tag="COO91_00173"
                     /note="Nfsy_F00173"
     CDS             157284..157901
                     /locus_tag="COO91_00173"
                     /codon_start=1
                     /transl_table=11
                     /product="putative protein related to plant photosystem II
                     stability/assembly factor"
                     /protein_id="AUB34353.1"
                     /translation="MTNSTNLQWFPTNAPIASSRTDDIWFIDPLVGWAVNSNGQIIKT
                     TDGGDNWKIQFQTPIVNRRPVYLRCVGFSTPLNGWVGTVSEQQRLYHTTDGGETWAIV
                     ENLPENAPVKICGISVVNESVIYASGTNDPADIPARMMKTVDGGATWTAWDMSEYATI
                     LIDNYEHLAEKALAEPSLLLNFTSILNLGDRPFAHAMLQSDRLSN"
     gene            complement(157918..161445)
                     /locus_tag="COO91_00174"
                     /note="Nfsy_R00174"
     CDS             complement(157918..161445)
                     /locus_tag="COO91_00174"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF2157"
                     /protein_id="AUB34354.1"
                     /translation="MSSPLERPLKLEIRLPSDHPHLLEGLDIWLRLGLISDTQVKQLC
                     REFLVCTVVLQPQPEAETKVAFVTSDSVQQLPVATLQSSSRRQPPQQKPAKPNLISTM
                     LQSLGAELSVRWLLFLGVFLVVVSSGVLAASQWERFPASGQYGVLFAYTLSFWGLSFW
                     ATRQSNLRLTAQTLLIVTLLLVPVNFWAMDSFRLWQNPKDWIVVAIACPSLTAITILL
                     SKNRSIFPNLLTGKLPLINILGLNYLHWGWQLRGFPLIAVYVAMIGTTIITVYHNYQQ
                     PNPISEEDRRDVYDGLRQRQRLSISLSASVIIYALIVLLVRAIFVAKVDVTQLGLAIG
                     ICGWLVTWLAQQGRAGGRGQGETIQNDARGLANAALTKFKIQNYSPSSPPFPSSLLLW
                     ERLGGILLFLGWLVSVVNYPMSAIAVSALGLWFVGSRLRQYSFKVDFAAVFVIGLQMI
                     WLGWRLVPDSLQKLAIATGTQLTNSQNEPWALLSVALFPYIILMVALTDRLHRSQKRE
                     LAKFGELLTLLFGAFLTTIAIINPALRSLNLLFSTITLAFVTQRRSPSSLPLIYLTHI
                     IGVLTFCFTINWLLPTLSQPAWASILLALMVAEWVFSLTEGLWQRSGWDIGLGLAAAS
                     FFLLWMNAESSWYGIADSQANWGVLWLVTPIALTGVANATIIERRLTSRYLSVLAVVT
                     AQLLTLQLPETRLIGLSVGTGLMFANTRYLRNQISAVITEGFLLSFIVALLWVDVPGL
                     PRLALAGWFVVGAIAILILWLARTILNRRGNELAIIYAAASDKWAIALCGFELFGLTL
                     NSILIYSGFITSGFFYLAATAIILVAIVYRSWREPTNWAFYGIGWSLELLTAQVLGFG
                     ERSTLRIAFAERGLSIANIALGLTAQLVGEWWRRNSQTSPSIFGGITIAEMWVYLGLL
                     EVAGMRVYWRETAVGRFWAGPLVPWNGAIACVVAYFLYILPWESWGWSKRPWQQAAYI
                     IPLISLWETRLQVYPITLLLAAGFYIFLAKVGENIRFTYISVALIDWALYRWFDSLRL
                     TDALWYVTPIGFSLLYIAQVDTQLKLPEYKAARHILRVIGSGLICGWAILFNQDTAWI
                     PGIFSLIAIFAGLALRVRAFLYIGTATFLITTIYQSVIFSLQYSFLKWVVGLLVGILL
                     IYIAANFETRRAQITSLIRSAIDEFQSWE"
     gene            complement(161794..162195)
                     /locus_tag="COO91_00175"
                     /note="Nfsy_R00175"
     CDS             complement(161794..162195)
                     /locus_tag="COO91_00175"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase YbfD/YdcC associated with H
                     repeats"
                     /protein_id="AUB34355.1"
                     /translation="MKDKQWGIDGKVIVKVRILPKEGVKLKPKITIADHFAQMSDPRI
                     DRTKRHKLIDILTIAICAVICGADSWVAIETYGCAKSEWLKTFLELPNGIPSPDGDAT
                     RTHDTFARVFAQLNPQQFQSCFSEMLYLFCL"
     gene            complement(162265..163836)
                     /locus_tag="COO91_00176"
                     /note="Nfsy_R00176"
     CDS             complement(162265..163836)
                     /locus_tag="COO91_00176"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AUB34356.1"
                     /translation="MKKQFSNNWFISQSSLRFLIIIILVIGVFFRFVNLDKKLYWGDE
                     VFSSLRISGYMQSEMNEQLSNGRLLTIQDLHKYQYPNHEKNVIDTIKGIILEDSQILP
                     LYIVMNRFWVESFGNSVAVTRSFSAFISLLTFPFIYLLCQELFESSLVGWIAIALVAV
                     SPIHVVYAQEVRAYSLWIVSILISSVALLRAMRLKTKDSWCIYAAALSLGFYSHIFFS
                     LVAFAQAIYVIIIERLRLTKTLISYLLSSLAGFITFVPWIWIIITNPQSEAVTWANVK
                     QTLFASAIRWAGIFSRTFLDLGISPSDPGILKIALIPFILIILALILYSIYVLCRRTS
                     KEVWLFVLTLIGSIGLPLLIVDFVFEKRYATSRYTLPSVLGIQLAVAYLFSTKLTSIS
                     SKVWQKKLWSLVAFMVIISGIISCTISSQAQIWWNKFPERYQEIPTIANMVSQGNKPL
                     LITDDSIIPSIQILGHLVDPKVQFQIVQKNQLPEITNGFSDIFLFSPSDFLKAGIEKI
                     YNSKLQQINDLLWKI"
     gene            163843..163968
                     /locus_tag="COO91_00177"
                     /note="Nfsy_F00177"
     CDS             163843..163968
                     /locus_tag="COO91_00177"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34357.1"
                     /translation="MNFLKALINGGVILFSPESFIKRHFASNATFKDFARCYNYF"
     gene            complement(163959..164072)
                     /locus_tag="COO91_00178"
                     /note="Nfsy_R00178"
     CDS             complement(163959..164072)
                     /locus_tag="COO91_00178"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34358.1"
                     /translation="MDTNLLSNDSYLSKWMTISTICDFWINLKLNLAVGQK"
     gene            164738..166849
                     /locus_tag="COO91_00179"
                     /note="Nfsy_F00179"
     CDS             164738..166849
                     /locus_tag="COO91_00179"
                     /codon_start=1
                     /transl_table=11
                     /product="N-Dimethylarginine dimethylaminohydrolase"
                     /protein_id="AUB34359.1"
                     /translation="MTSRIRFLMCPPDHYDVDYVINPWMEGNIHKSSRDRAVEQWQGL
                     NQILKQHAIVDLVPPEKGWPDLVFTANAGLVLGNNVVLSRFLHKERQGEEPFFKQWFE
                     ANGYTVNELPKDLPFEGAGDALLDREGRWLWAGYGFRSELDSHPYLAKWLDIEVLSLR
                     LIDERFYHLDTCFCPLANGYLLYYPGAFDSYSNRLIEMRVAPEKRIALEEADAVNFAC
                     NAVNVDSIVIMNKASDALKTRLADVGFQVLETPLTEFLKAGGAAKCLTLRVTEPVRDE
                     LHANVSVESRVIRMEGHLLDAGLINRALDLIIDAGGSFKVLNFNLGEQRQSTSAAEVR
                     VSAPSHEVMEEIISRLIDLGAVDLPHDERDAILEPVIQDGVAPDDFYVSTIYPTEVRI
                     NGQWVKVENQRMDGAIAITQTANGFVARCKILRDLKVGERVIVDVLGIRTIRKTESRE
                     LRSTQEFSFMSAGVSSERRVELVVEQVAWELRKIRDAGGKVVVTAGPVVIHTGGGEHL
                     AQLVREGYVQALLGGNAIAVHDIEQNIMGTSLGVDMKRGVAVHGGHRHHLKVINSIRR
                     YGSIPKAVEAGAIKSGVMYECVHNNVPFVLAGSIRDDGPLPDTVMDLIQAQEEYAKHL
                     EGAEMILMLSSMLHSIGVGNMTPAGVKMVCVDINPAVVTKLSDRGSVESVGVVTDVGL
                     FLSLLIQQLDKLTSPYVNKVG"
     gene            166974..167492
                     /locus_tag="COO91_00180"
                     /note="Nfsy_F00180"
     CDS             166974..167492
                     /locus_tag="COO91_00180"
                     /codon_start=1
                     /transl_table=11
                     /product="Permeases of the major facilitator superfamily"
                     /protein_id="AUB34360.1"
                     /translation="MTRVAFSEELQVNWVSLIADFLLVGMVFGPPIAPFLAASGVSLL
                     PGIADIIYFMGNHVCPQPDMGLDLAPPFIMAVCMRCYGTVTGLLITRLLYGITGGKGF
                     YWLNQYGWSGVALASVLMIAYPLELAAQIFGLWSFNNYLVTPFGLITGLAWGLFTMPI
                     LHGWGGAKPRLC"
     gene            complement(167484..168002)
                     /locus_tag="COO91_00181"
                     /note="Nfsy_R00181"
     CDS             complement(167484..168002)
                     /locus_tag="COO91_00181"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34361.1"
                     /translation="MVGQFPGERFWVSSSSPGREKVSFYGVYVYNYAKVKIFPYLKAD
                     QFNTIDVLKHLRTEFSERDITLIWDGAPNHRAQAVKDALAVLQINLQPLPAYSPDFMP
                     VEHLWQWLREDVTYHTCYQSSTELIERVHLFEQDINSNPFEISVGVARRRHRLWVKNH
                     LDPDEEKLRVST"
     gene            complement(167980..168252)
                     /locus_tag="COO91_00182"
                     /note="Nfsy_R00182"
     CDS             complement(167980..168252)
                     /locus_tag="COO91_00182"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34362.1"
                     /translation="MKRLVNWIEKEFNLKCCRESVRKTLKNLGLSWKKARKLLNKANS
                     KKRAEFLATLQSLLDDALHNGHLLIFIDEAHIHLDTDEGYGWSIPR"
     gene            complement(168357..168521)
                     /locus_tag="COO91_00183"
                     /note="Nfsy_R00183"
     CDS             complement(168357..168521)
                     /locus_tag="COO91_00183"
                     /codon_start=1
                     /transl_table=11
                     /product="Homeodomain-like domain"
                     /protein_id="AUB34363.1"
                     /translation="MALYEICNGKSATQVGRSTGRNPQTVMEWVHRYNRSGMETLKYR
                     HTGGYPPLFH"
     gene            complement(168554..168685)
                     /locus_tag="COO91_00184"
                     /note="Nfsy_R00184"
     CDS             complement(168554..168685)
                     /locus_tag="COO91_00184"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34364.1"
                     /translation="MKTGVFAKNILLWITGVVENKTEMLKVECDRWNESASILRVLP"
     gene            complement(168794..169387)
                     /locus_tag="COO91_00185"
                     /note="Nfsy_R00185"
     CDS             complement(168794..169387)
                     /locus_tag="COO91_00185"
                     /codon_start=1
                     /transl_table=11
                     /product="PEP-CTERM protein-sorting domain"
                     /protein_id="AUB34365.1"
                     /translation="MALLSESESAVVNLDAKEVLFTIDFNRVPDFFTLDQVGRQADSF
                     QYFIDPSGELPIFRPPSAYSNLSSIIRGEEINVAGDIRIRDVFSVGPLEPNSGGWGKI
                     RGSVPYSLDGTVLKFSAPLQFIGDSDGLFSYRLELYEFGGGGGNANENKSIIASVPEP
                     TSALGALTFGALSLGLRRKRKHKLAPSPVNRYDSVKA"
     gene            complement(169468..170271)
                     /locus_tag="COO91_00186"
                     /note="Nfsy_R00186"
     CDS             complement(169468..170271)
                     /locus_tag="COO91_00186"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase YdaD"
                     /protein_id="AUB34366.1"
                     /translation="MFDNVCRFLAESFSADFATWLLGESIALTQLSPSELSLEPIRAD
                     ALILLQSDEIVLHIEFQTEAKAEIPFRMTDYRLRVYRRFPQKRMHQVVIYLQPTTSEL
                     VQQTAFVLENTRHEFGVIRLWEQPSEIFLNTPGLLPFATLSQTEDKTRILQQVAEVIE
                     QINDTRTQSNIAASTAILAGLVLNKELIKRLLRSDAMRESVIYQDIQQEKALSIIIRQ
                     LRRKIGTVPPAQLLKIQALDSTHLDDLAEALLDFSSLTDLEAWLAQNQS"
     gene            complement(170478..171350)
                     /locus_tag="COO91_00187"
                     /note="Nfsy_R00187"
     CDS             complement(170478..171350)
                     /locus_tag="COO91_00187"
                     /codon_start=1
                     /transl_table=11
                     /product="mtaP, 5'-methylthioadenosine phosphorylase"
                     /protein_id="AUB34367.1"
                     /translation="MAQASIGIIGGSGLYKMDALKDIEEVHVQTPFGSPSDALILGTL
                     DATRVAFLARHGRNHTLLPSELPFRANIYAMKQLGVKYLISASAVGSLKEEAKPLDMV
                     VPDQFIDRTKNRISTFFGEGIVAHIAFGDPICKNLAGVLADAIASLNLPEVTLHRGGT
                     YVCMEGPAFSTKAESNLYRSWGATIIGMTNLPEAKLAREAEIAYSTLALVTDYDCWHP
                     DHDSVTVELVIGNLLRNAANAQKVIQETVRRLSENPPPSEAHSALQYAILTQLDKAPA
                     TTKEKLGLLLQKYL"
     gene            171643..172767
                     /locus_tag="COO91_00188"
                     /note="Nfsy_F00188"
     CDS             171643..172767
                     /locus_tag="COO91_00188"
                     /codon_start=1
                     /transl_table=11
                     /product="3',5'-cyclic AMP phosphodiesterase CpdA"
                     /protein_id="AUB34368.1"
                     /translation="MALNFRFAVVSDLHLALPHTIWDHPNRFHLVEVSISAFQSVLEH
                     LTQLDLDFLLLPGDLTQHGEPENHAWLQQCLAQLPFPVYVVPGNHDVPVLLADQQSIA
                     FADFPYYYTKFGYEDPQQIYYIRQLLPGVKLIGLNSNSFNDQGEQVGCLDAKQLRWLE
                     EVLAASSDELIMVMVHHNVVEHLPNQSNHPLANRYMLSNSAELLQLLRRYGVKLVFTG
                     HLHVQDIAYSDGVYDITTGSLVSYPHPYRVLEFHRDNQGKESLQILSHRVESVPEFPD
                     LQQSSRQWMGDRSFPFLIKLLTHSPLNLPLSQAKELAPSLREFWATIADGDAVLDYPH
                     FPLEVRRYIQSYGALAQPNPGMANNGTLTLIDNNSTLLLG"
     gene            complement(172916..173347)
                     /locus_tag="COO91_00189"
                     /note="Nfsy_R00189"
     CDS             complement(172916..173347)
                     /locus_tag="COO91_00189"
                     /codon_start=1
                     /transl_table=11
                     /product="codA, cytosine deaminase"
                     /protein_id="AUB34369.1"
                     /translation="MDEFMEAAIQEAKQGRQEGGIPIGSVLVKDGKILGRGHNKRVQD
                     ADPVTHAEIDCLRNAGRVGSYRGTTLYSTLMPCYLCAGAVVQFGIKKVIVGESRTFPG
                     AKEFMVSHGVEVIDLNLDDCEQMMSEFIETNPELWNEDIGN"
     gene            173363..174286
                     /locus_tag="COO91_00190"
                     /note="Nfsy_F00190"
     CDS             173363..174286
                     /locus_tag="COO91_00190"
                     /codon_start=1
                     /transl_table=11
                     /product="iunH, purine nucleosidase"
                     /protein_id="AUB34370.1"
                     /translation="MTKQLVLMDHDGGVDDYLATMLLLTMDHIELLGVVVTPADCYIQ
                     PAVSATRKIIDLMGFSHIPVAESTVRGINPFPTLYRRDSFIVDHLPILNQSETITTPL
                     VAETGQDFMIKVLREVSDAVTLMVTGPLTTVAVALDKAPDIEAKIHRIVWMGGALNVG
                     GNVEKSLEAGQDGSAEWNVYWDAVSAARVWQTQIEIIMCPLDLTNNVPVTSELVYKMG
                     RQRHYPISDLAGQCYALVIPQDYYFWDVLATAYLGHPEFYQLREWETEIITTGLSQGR
                     TKVVSGGRKIFAMDKVDKEAFYNYILRQWAR"
     gene            174842..175282
                     /locus_tag="COO91_00191"
                     /note="Nfsy_F00191"
     CDS             174842..175282
                     /locus_tag="COO91_00191"
                     /codon_start=1
                     /transl_table=11
                     /product="Harbinger transposase-derived nuclease domain"
                     /protein_id="AUB34371.1"
                     /translation="MPTFEVLGLHFGISKTEANDTFHYWLEILRKVLPSSLLEQVEKH
                     DSDYAIAIELLTEFQLIVDSMEQPRARPSDNQEQKKYFSGKKRQHTFKNQFVTLPEGK
                     DIVDVEVGEKGPTSDINLFRGQQEKFDNNQMFEGDKALSWRKEY"
     gene            complement(175675..175863)
                     /locus_tag="COO91_00192"
                     /note="Nfsy_R00192"
     CDS             complement(175675..175863)
                     /locus_tag="COO91_00192"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34372.1"
                     /translation="MKILPDDELKIAFLEALAELEDNECHRTRKFPKTRLHKVKGVKQ
                     AIYRADIDKVSGWRIHVQ"
     gene            complement(175923..176078)
                     /locus_tag="COO91_00193"
                     /note="Nfsy_R00193"
     CDS             complement(175923..176078)
                     /locus_tag="COO91_00193"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34373.1"
                     /translation="MTVDEDPIFGQVIFTLFRVVKHDDLDKAYKSVAESLYQGLLHQN
                     QETARIW"
     gene            complement(176555..177043)
                     /locus_tag="COO91_00194"
                     /note="Nfsy_R00194"
     CDS             complement(176555..177043)
                     /locus_tag="COO91_00194"
                     /codon_start=1
                     /transl_table=11
                     /product="8-oxo-dGTP pyrophosphatase MutT and related
                     house-cleaning NTP pyrophosphohydrolases, NUDIX family"
                     /protein_id="AUB34374.1"
                     /translation="MVLDHPWCQVRQDEIELPNGKIIDDYFVSIKPNVAMVLPITSSK
                     EIIFVRQYRHAVGEFFLELPAGNFDPTKESAEVAAIRELTEETGYLPEEFIKIGTLYD
                     KPSKDTNKIHLFLAENVIKVGEQQLDITEEIEVVLIPLESVLDKIAQGEFSVAGTMWL
                     SS"
     gene            complement(177432..178493)
                     /locus_tag="COO91_00195"
                     /note="Nfsy_R00195"
     CDS             complement(177432..178493)
                     /locus_tag="COO91_00195"
                     /codon_start=1
                     /transl_table=11
                     /product="Spore coat polysaccharide biosynthesis protein
                     SpsF, cytidylyltransferase family"
                     /protein_id="AUB34375.1"
                     /translation="MTPNKNDCIPEQFRFGLVKSCPVVVNFNGEPVTSDAGLILIAEL
                     DRKREITSRLAACFKDYREPNKILHPVNGLIAQRIYGLIMGYEDVNDHETLRHDGIFA
                     LAVGKAINLEQEPITLAGKSTLNRIEHCPEDISSRADSRYHRIEHDASAIETLLVELF
                     LVVEFFETLFPPSPDLKNDAAVFVDNSVWYCSLDYQTLDSWSRQRRVVAKVEYSYKEV
                     DTRFVVTSLPVNKIPPGRLYTQKYCPRGNMENCLKEQKLGLHSDRTSTHTFEGNQLRL
                     WFASIAYILMNALREQCLANTEFKNATVEIIRTKLLKLGAVITIRKRRILIAISSACP
                     YKEIFAMVYKSLSQLPCPG"
     gene            178689..179696
                     /locus_tag="COO91_00196"
                     /note="Nfsy_F00196"
     CDS             178689..179696
                     /locus_tag="COO91_00196"
                     /codon_start=1
                     /transl_table=11
                     /product="ycjG, L-Ala-D/L-Glu epimerase"
                     /protein_id="AUB34376.1"
                     /translation="MTISRGTTAQTTNVWVRISQDGIEGWGEASPFGVGNHRQSTDAI
                     KDALQQVMPQLQTFSPLQRQEIEQVLTQNQVPSAARAALDIAMHDWLGKRVGLPLWQI
                     WGLDRNTIVPTSVTIGINSPEGARARARDWLQFTDVRLFKVKLGSPDGIDADKKMLLA
                     VQEEAPLLEFFVDANGGWSLEDAIAMCNWLANLGIKYVEQPLPRGQEKNLAKLKEHSP
                     LPIFVDESCFTSSDIPHLANYVDGINIKLMKSGGLTEAMRMVHTARAYRLQVMFGCYS
                     DSALANTAALQLAPLADYLDLDSHLNLIDDPFTGALLKEGRVLPNDLPGLGVQQSASI
                     T"
     gene            179680..180726
                     /locus_tag="COO91_00197"
                     /note="Nfsy_F00197"
     CDS             179680..180726
                     /locus_tag="COO91_00197"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34377.1"
                     /translation="MRLSPNQRVAILLHEGITGHHGKTGLAILRYSEAPIVAVIDHEC
                     AGKSLPELTNIKRDVPIVASVAAALEYKPEVLVIGIAPGGGAVPDDYWLEIKGALEAG
                     MSLVNGLHTPMANIPELNALLKPGQLIWDVRKEPPNISVASGMARTLSCRRVLTVGTD
                     MAIGKMSTSLELHWASKQRGWRSKFLATGQTGVMLEGDGVALDAVRVDFAAGAVEQIV
                     MRYGKNHDILHIEGQGSLLHPGSTATLPLIRGSQPTQLLLAHRAGQVHVRNHPHVLIP
                     PLPEVIQLYETVASAGGAFASVPVVGIALNTAHLDQSAAEDAIAQTIAETGLPCTDVV
                     RFDANVLLDAVMKN"
     gene            181018..181188
                     /locus_tag="COO91_00198"
                     /note="Nfsy_F00198"
     CDS             181018..181188
                     /locus_tag="COO91_00198"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34378.1"
                     /translation="MYTTVNEDGIINNYASEPKMYYAEYPAIWEQRKYVLQALFATLI
                     VTTIVLVGFTVS"
     gene            181391..182137
                     /locus_tag="COO91_00199"
                     /note="Nfsy_F00199"
     CDS             181391..182137
                     /locus_tag="COO91_00199"
                     /codon_start=1
                     /transl_table=11
                     /product="Endonuclease, Uma2 family"
                     /protein_id="AUB34379.1"
                     /translation="MTTQLGEAKSSTELVISWEALPADFQLEDEPVENTGQPLLAGAL
                     RESLEISGFIQPQMLIASNFGLCATINGQFVAKAPDWVYVPSVNQVLGERKSYTPNLD
                     GDIPAIVMEFLSDIEGGEYSFKRTYPPGKWFFYEQILQVPIYVIFDPNGGLLEFYQLE
                     NSRYELKQPDENGRHWIDSMGLFLGTWQGTKEARTGYWLRWWDEAGNLLLWAVEQIEQ
                     ERQRAEQERQQKERLIAYLQSQGIDPNNLK"
     gene            182341..183954
                     /locus_tag="COO91_00200"
                     /note="Nfsy_F00200"
     CDS             182341..183954
                     /locus_tag="COO91_00200"
                     /codon_start=1
                     /transl_table=11
                     /product="Tetratricopeptide"
                     /protein_id="AUB34380.1"
                     /translation="MLPAWKWVLLSTATSILIILTQATSPLLAQEPAASTTIETTKPS
                     SETTKIQKLREALQRSSTPEAPQPSPEVSEPKKPESPQEPPLSPEELTRQLKFIEADK
                     LYLAGQIPEAEKIYREVKQPFAKISENQQRKAAILDPTQLSPGGKVYWRESEAGIAQK
                     LQTKTLVPLQLLVEQYPEFIPGHIRYAEVLKQYDRTKEALDILERASSLYPDQPELIK
                     ARITALAADKKWMEASLAARQFAILNPKDPQAPEFTKLAEENLNRYKSYTQGEIRGNV
                     IGNIITGALGYAVTGSLLGPFSALDSTIMLLQGEQAIGESVAKQAKKQLSVIIDEPIL
                     AYVNEIGQKLAKVGGRDEFKYEFFVIPEESLNAFALPGGKIFINAGAIAKTNSEAELA
                     GLISHELSHVLLSHGFQLVSQGNLISNVTQYLPLGGTIGQLFALSYGRDMERQADNLG
                     TRLIVATGYAADGLRNLMVTLEKQQKNAPPSWLSSHPGGNERVSYLENLITRSSYNRY
                     AYEGVGRHLEIQARVKKLLEEKKAREEKK"
     gene            184036..184812
                     /locus_tag="COO91_00201"
                     /note="Nfsy_F00201"
     CDS             184036..184812
                     /locus_tag="COO91_00201"
                     /codon_start=1
                     /transl_table=11
                     /product="Circadian oscillating protein COP23"
                     /protein_id="AUB34381.1"
                     /translation="MPSQLLRLISLGSLGLSLCLGNSVAMAQYDSNGDSVVVPTVPSG
                     GSSVPIDTSTGIPTSPSSDGTTRFTCQTYNGQYTVMYQPQSQPGQYFAWAAPAALGGG
                     WDTQRRCTAIASRLELYRPDGLQELQTSVENNENIVCVTTEANPTCRIVLTVPPGKDP
                     VVIRNSIFQNLTTADSGQQTIAVNTYGDRSRGGNELYNLGRTLLGGGNNRVSSSRGGI
                     NLKPFLDRKDGGTGNNLRSGVAIRRQSQPNSVRLKPGNFR"
     gene            complement(185039..185329)
                     /locus_tag="COO91_00202"
                     /note="Nfsy_R00202"
     CDS             complement(185039..185329)
                     /locus_tag="COO91_00202"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34382.1"
                     /translation="MEFKDSLTSIKDSFTSIKDSFTSIKDSFTSIKDSFTSIKDSLTE
                     FKDSFTSIKDSLMEFKASLMEFKDSLMEFKDSLMELSYPVAYSGSRLREVHP"
     gene            185409..187415
                     /locus_tag="COO91_00203"
                     /note="Nfsy_F00203"
     CDS             185409..187415
                     /locus_tag="COO91_00203"
                     /codon_start=1
                     /transl_table=11
                     /product="putative protein YjbI, containings pentapeptide
                     repeats"
                     /protein_id="AUB34383.1"
                     /translation="MALDFSGQNLRGRNFKGQDLADANFSYADIRGANFTNANLTGAN
                     FSHAKAGLQRRWAIFLVLVSWLLSGLSGFLWAVNGYFVSLIFDSKLDNQIGGWITLIV
                     LIVFFFVTIRQGIAAGLGVFAVTIAFLVAAGTGNAIFIAAAAAFAVAFAFAFAFAVAF
                     AFALAFAVAVAGAVAGAVAVAIAVAGAVAGAVAGAVAGAGVGTLFNIYISWRAMKGDE
                     KHSLVRNIAVTFAATGGTSFRGANLTNADFTQATLKSTDFRNTILICSRWHQAKMLDR
                     IRPGSTYLQNSQVRQLLVTGQGQDKNFYRENLRGINLQSANLADASFIGADLSEANLQ
                     DADLSRAKLKQTQLDGTDLTGANLTGAFIEDWGITNTTKLHGVRCEYVFMRVPTKEDP
                     DPLRKPDNKREVFADGDFANFIKPIFDTLDLYHNQGVDPRAIAIAFNNLAENHPEAEL
                     EIVAMEKRGNDKILLRAKTATGSDKSQLSAEYFDDYNQLKALSQSQQLLLIEKDSYVN
                     DLKNMLTTALGQPKFYTQGDTNMSDISGINIEGSSNVSGIAGNNSIANLGTISGNVSI
                     ALNQLPDATDAEKPGIKELLSQLQDAIIQSTYLPEEEKTEALEQVKALAEAGKNPQES
                     TKQKTAKTAITMLKGIFTGLPAVASLVEAGNKLLPAIAKLFGLA"
     gene            187572..189134
                     /locus_tag="COO91_00204"
                     /note="Nfsy_F00204"
     CDS             187572..189134
                     /locus_tag="COO91_00204"
                     /codon_start=1
                     /transl_table=11
                     /product="cruP, lycopene cyclase CruP"
                     /protein_id="AUB34384.1"
                     /translation="MSFSKMSLTEEILSQLPGNALAGLRQSDRILTSLRENSAPVPTL
                     VKESQQPLGVVDNDLLICGGTLGILIGCALAVKGLRVALLERGILRGREQEWNISRKE
                     LDVFVELNLLTEEELESAIATQYNPARVSFDGGTEVWVEDVLNIGVDPVYLLATLKTR
                     FLAAGGKLLENTPFTEAVVHPDGVMVNNQFKTRLLIDAMGHLSPITQQARQGKKPDAL
                     CLVVGSCAQGFAENNSGDLLLSFTPLQNQCQYFWEAFPARDGRTTYLFTYMDADPQRL
                     SLEALFEEYLRLLPEYQGVELSKLKFQRSLFGFFPTYRQSPIKTPWSRILPAGDSSGS
                     QSPLSFGGFGAMVRHLKRLTYGISEALETEQLSAKALVLLQPYQPSLTVTWLFQRAMS
                     VGVNQKIAPDQINQLLSAVFEEMQQLGTPVLKPFLQDIVQFSALTKTLLKTGLYHPLL
                     VAKIIPQVGLASLLDWMLHYSNLGVYTTLFWLSPMLETWIKNQPKEQQYYWHRLIDAW
                     KYGSGGDYSDET"
     gene            189158..189862
                     /locus_tag="COO91_00205"
                     /note="Nfsy_F00205"
     CDS             189158..189862
                     /locus_tag="COO91_00205"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoethanolamine transferase for periplasmic
                     glucans"
                     /protein_id="AUB34385.1"
                     /translation="MIERKSVGIKYFAVLIGFLRDRQGFLEEVRQGTRLPNKIISLLV
                     CSSLFLAAYGGIIGAYHSWMQAISSAIKLPALYLITLLICIPTLYFANIVFGSKRTFG
                     QHLALVLTAVSVTSVLLFSFAPITLFFLITTNNYQFLILLNVFIFASTGFIGISSLYQ
                     ATSLVLEQDNEGSKTRQKILQFWLFLYAFVGSQLGWTLRPFFGTPDSAFQLFREREGN
                     FYLSVIQAISYLLGIR"
     gene            189905..190612
                     /locus_tag="COO91_00206"
                     /note="Nfsy_F00206"
     CDS             189905..190612
                     /locus_tag="COO91_00206"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoethanolamine transferase for periplasmic
                     glucans"
                     /protein_id="AUB34386.1"
                     /translation="MRNKEKFGIQQFGVLVNLLRDRQAFLEEIRQGVRLQNKISSLFV
                     SSSIFFAIYGAIIGASNSWAQALSGAIKLPAFYLLTLIICFPTLFFFNVLFGSRSSIQ
                     QHFVVLLTSISVISVLLFSLAPVTLFFLITTPDSYQFFKLLNVLIFGITGIFGVKFLY
                     EGMQLLSQQDEVGKKTRTTILRSWLLLYAFVGMQLGWFLRPFFGAPDSKFELFRAVKG
                     NFYLDIVAAISEILGLR"
     gene            complement(190790..191362)
                     /locus_tag="COO91_00207"
                     /note="Nfsy_R00207"
     CDS             complement(190790..191362)
                     /locus_tag="COO91_00207"
                     /codon_start=1
                     /transl_table=11
                     /product="Lipoprotein-anchoring transpeptidase ErfK/SrfK"
                     /protein_id="AUB34387.1"
                     /translation="MAKSLILKMLKQLDKLVIFICASGLNFNPAMSLASELKVPSHTS
                     TKNLVSQTTNINNLITQTLHLQISLRKRQVTLYRGKTRIKSYPIAVGRQGWDSPIGNF
                     RVRTMLENPTWINPFTGKAIPGGDPENPLGKYWIGFWTNGKNWIGFHGTPNPDSVGKA
                     ASHGCIRMYNKDVRELFDQVSLGTPVIVVR"
     gene            complement(191600..191761)
                     /locus_tag="COO91_00208"
                     /note="Nfsy_R00208"
     CDS             complement(191600..191761)
                     /locus_tag="COO91_00208"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34388.1"
                     /translation="MEQTTALLERSKIKIQVVTIQQVDKTLVEVLERYGNLLALHGLA
                     TLLSLLSSR"
     gene            complement(191884..192270)
                     /locus_tag="COO91_00209"
                     /note="Nfsy_R00209"
     CDS             complement(191884..192270)
                     /locus_tag="COO91_00209"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator, OmpR family,
                     containings REC and winged-helix"
                     /protein_id="AUB34389.1"
                     /translation="MTTKQILVVDNEQYIQEVAKICLETVAGWKVETASSGQEGIIKA
                     ETYQPDAILLDVMMPGMDGIATFEKLQANPLTKAIPVILLTAKIQASDRHRYTQMRMI
                     SAIAKPFNPLELATEVAVALGWNLEK"
     gene            complement(192242..193015)
                     /locus_tag="COO91_00210"
                     /note="Nfsy_R00210"
     CDS             complement(192242..193015)
                     /locus_tag="COO91_00210"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator, OmpR family,
                     containings REC and winged-helix"
                     /protein_id="AUB34390.1"
                     /translation="MQIATESTERLVRLINDILDIERIESGKAKMEPEICNIVDLITQ
                     AVNVIQPLADKAGVTLSISALSGQVLADCDRIVQTLTNLLSNAIKFSSAGSTVWLGAQ
                     QQGNEVLLTVKDTGRGIPSDKLESIFERFQQVDSSDSRNHDGTGLGLAICKSIMQQHG
                     GRIWAESVLGESSTFYVTLPLFGTFQNTDLENSSNIPVNKSNYEQTTNSQPSPDTECL
                     TKGRVTNEEFEQRVMDLLQRITLNQQEDGSNDNKANSSG"
     gene            193290..193649
                     /locus_tag="COO91_00211"
                     /note="Nfsy_F00211"
     CDS             193290..193649
                     /locus_tag="COO91_00211"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type methionine transport system, ATPase
                     component"
                     /protein_id="AUB34391.1"
                     /translation="MPVTYVLAKEFNVAANIIRAQVAPNQIGKLVVELSGDIDQLDAA
                     IEWMRSRHVNVSHTLGEIAIDEDVCVHCGLCTGVCPTEALTLHPETYKLTFTRSRCIV
                     CEQCIPTCPVQAISTNL"
     gene            complement(193687..194754)
                     /locus_tag="COO91_00212"
                     /note="Nfsy_R00212"
     CDS             complement(193687..194754)
                     /locus_tag="COO91_00212"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase, GNAT superfamily"
                     /protein_id="AUB34392.1"
                     /translation="MSKSNLLNQVFLTFVDNFKDHREDLSALLLTHDKYLWLGSDETS
                     TIERLSLVNTDKFTDHQQFRVAEFINLPAPEDQEIDIEGLAYTDYYLWFVGSHSYKRK
                     KPKPDKTDAQNFKRLTKIESEPNRYLLGRIPLIDGKLFSSCPHPQNPDVELNAAKLEV
                     TNQGNLLMTALADDAHLGLFIKAGTAGKDNGFDIEGIGIYQNRIFLGLRGPVLRGWAV
                     VLEIELEDSSPGILKLRQIGEAKELYKKHFIWLNGLGIRDLSVDGNDLLILAGPTMDL
                     DGPVQVYRWINGVNLRENVFSNPDFVQDIPYGNREDHAEGMTLFQDVAGIPSLLVVYD
                     SPATTRLVGDSVVIADVFRLG"
     gene            195032..196015
                     /locus_tag="COO91_00213"
                     /note="Nfsy_F00213"
     CDS             195032..196015
                     /locus_tag="COO91_00213"
                     /codon_start=1
                     /transl_table=11
                     /product="CHAD domain"
                     /protein_id="AUB34393.1"
                     /translation="MKLATQTTVKTLGDYAYQAIEKHFKKTLKWEKSVKKDEDPEALH
                     QMRVGMRRLRTTVTSFGLAMDLPKPVNDKNIGKIARRLGSLRDLDVLKESLENNYKPN
                     LPRKEQESLKTAFKALAKQREDVESSVQKTLKDESYKSLKDALDKWLEKPNYQPLASF
                     TIQQVLPDLLLPEVSSFLVHPAWLVGTEFVESEVIIQKNWKPQKIEKQLTTEGEIIHS
                     LRKEAKRLRYQMELFTDLYGESYAAYLTEVKNIQEILGTMQDSAVLTDWLTDVFNSEI
                     QTELPTLAALLTENRYQSWQKWQPLQERYLKAETKHSLHLTILHPLSGVLG"
     gene            196967..198553
                     /locus_tag="COO91_00214"
                     /note="Nfsy_F00214"
     CDS             196967..198553
                     /locus_tag="COO91_00214"
                     /codon_start=1
                     /transl_table=11
                     /product="Radical SAM superfamily enzyme YgiQ, UPF0313
                     family"
                     /protein_id="AUB34394.1"
                     /translation="MNVLLLYPRFPKSFWSFEKTLALLDRKAMLPPLGLVTVAAILPQ
                     EWEYKLVDRNVRVCTEAEWAWADLVIMSAMIVQKEDLLSQILEAKRRGKRVAVGGPFP
                     TALPDEMTSAGADYLILDEGEITLPLFVAAIARGDRTGIFRSGGEKPDVTNTPTPRFD
                     LLEFEAYAEMSVQFSRGCPFQCEFCDIIVLYGRKPRTKNPEQLLAELDYLYKLGWRRS
                     IFMVDDNFIGNKRNVKLFLKSLLPWMVEHNYPFSFATEASVDLAQDQELMDLMVACNF
                     GAVFLGIETPDEESLTFTQKYQNTRDSLSEAVNRITRSGLRVMAGFIIGFDGEKVGAG
                     ARIVKFVEQTAIPTALFSMLQALPDTALWHRLEKEGRLRNKSANINQTTLMNFVPTRP
                     LEDIAREYVQAFCDLYEPERFLERTYKHFRLLGEATYPKKGKAAKKPLNWKVLRAFLI
                     ICWRQGVRRQTRWQFWRNLWNMFQHNPGGVSSYLAVCAQIEHFLEYRQIVRDEIEAQV
                     AEFLEAEARVKLEAQVMVNS"
     gene            198580..198813
                     /locus_tag="COO91_00215"
                     /note="Nfsy_F00215"
     CDS             198580..198813
                     /locus_tag="COO91_00215"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34395.1"
                     /translation="MLMYPDAMLMRRPAMPLHPDAMLMRRPAMPLHPNAMLMHRPAMP
                     LHPNAMLMHRPAMPLHPDTMLMRSSALKTLRFY"
     gene            198895..199938
                     /locus_tag="COO91_00216"
                     /note="Nfsy_F00216"
     CDS             198895..199938
                     /locus_tag="COO91_00216"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF2891"
                     /protein_id="AUB34396.1"
                     /translation="MPSDNLEINETIAAQFAQLVLDCIGREYPNSNLYWADSDEDIKP
                     PRELTPAFYGCLDWHSAVHGHWLLVRLMRHFPEASFYAASKQALDQSLTPEKIQGEIA
                     HFQRLPFYEFPYGVAWLLQLAAELHEWNHPQAKQWRVVLEPLEKLIAGNLHRWIEALK
                     LPNRTGMHSQTAFALGLMLDWARITENAEFIQLVENKARQFYLSDRNYSLQFEPLGYD
                     FLSPGLAEADLMRRVLPTTAFADWLTDFLPQIPIDNSANWLQSPGVDNPKDYMQAHFY
                     GLNLSRAWMLEGIISGLANSDRRRETLRSAALHHRQHGLADIVSEHYAASHWVGTFAV
                     YLLTNRGLQGQTI"
     gene            200388..201431
                     /locus_tag="COO91_00217"
                     /note="Nfsy_F00217"
     CDS             200388..201431
                     /locus_tag="COO91_00217"
                     /codon_start=1
                     /transl_table=11
                     /product="GAPDH, glyceraldehyde 3-phosphate dehydrogenase"
                     /protein_id="AUB34397.1"
                     /translation="MTKLKVGINGFGRIGRLVLRAGIDNPNIEFIGINDLVPPDNLAY
                     LLKYDSTHGKLKHKVEAKEDGILIDGHFIPCVSVRNPAELPWGKLGADYVVEATGLFT
                     DYEGAANHLKAGAKRVVISAPTKDPDRVPTLLMGVNHHLFNPSKDIIVSNASCTTNCL
                     APIAKVINDNFGLTEGLMTTVHAMTATQPTVDGPSKKDWRGGRGASQNIIPSSTGAAK
                     AVALVLPELKGKLTGMALRVPTPDVSVVDLTFKTAKATSYKEICAAMKEAAAGSLAGI
                     LGYTDEEVVSTDFQGDTHSSIFDAGAGIELNSNFFKVIAWYDNEWGYSNRVIDLMLSM
                     SQKEKLAPTAAVV"
     gene            201594..203090
                     /locus_tag="COO91_00218"
                     /note="Nfsy_F00218"
     CDS             201594..203090
                     /locus_tag="COO91_00218"
                     /codon_start=1
                     /transl_table=11
                     /product="PK, pyruvate kinase"
                     /protein_id="AUB34398.1"
                     /translation="MHGLGDRSNHPNLQVTPQPLIPMRRTKIICTVGPATSAPEKLQA
                     LVKAGMNVARLNFSHGAYEFHAQTAHYLRQISSEQQKPIAIMQDLCGPKIRLGTLPPE
                     GLNLEAGTEVTFVLQEKGESIDELPLPLPTLFAMVRPGEPILINDGRVKLIVTARDAD
                     RIRAQVKIGGLISTHKGVNLPQTPLPVSSITEKDLLDLRFGIQLGVDWVAVSFVRSPQ
                     DLEPAKRMIEAAGASIRLIAKIERAEAVENFDSILKVADAIMIARGDLGVEVPIHEVP
                     LIQKDIIRRCNRAGKPVITATQMLESMISAPDPTRAEATDVANSILDGTDAVMLSGET
                     AVGQYPIAAVEMMHNIAVRTEQALDEGSKHAWCHEAGSLSVTESVAESVCRIAYETGS
                     RAILCNTSSGSTARMVSKYRPTSPIIALTPDITAYRQLALSWGVEALLIPPVHNAEEM
                     FTNVVNTVVDMGLANKGDKVVITSGVPIGKSGTTSLIKVHSIGQPISA"
     gene            203239..204243
                     /locus_tag="COO91_00219"
                     /note="Nfsy_F00219"
     CDS             203239..204243
                     /locus_tag="COO91_00219"
                     /codon_start=1
                     /transl_table=11
                     /product="transaldolase"
                     /protein_id="AUB34399.1"
                     /translation="MSKNLLEQLRQVTVVVADTGDIQAIEKFKPQDATTNPSLITAAA
                     QMPEYQGIVDQTLLQAKKDAGAGATQAQIVSLAFDRLAVAFGLKILQIIPGRVSTEVD
                     ARLSYDTEATLTKARDLIAQYKAAGIGRDRVLIKIASTWEGIRAAEILEKEGIHCNLT
                     LLFGLHQAIACAEAGITLISPFVGRILDWYKKDTGRDSYPATEDPGVLSVTKIYNYYK
                     KFGYKTEVMGASFRNLGEITELAGSDLLTISPSLLAELQATVGELPRKLDPAKAANLE
                     IEKISVDKATYDKMHAADRMATDKLDEGIKGFTKALEDLEKLLADRLVRLEGEVVAAH
                     "
     gene            204396..204515
                     /locus_tag="COO91_00220"
                     /note="Nfsy_F00220"
     CDS             204396..204515
                     /locus_tag="COO91_00220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34400.1"
                     /translation="MVGYFGIVRKAVGVEYFGIVQKAALAEYIGIAQRAAVAE"
     gene            complement(205005..206498)
                     /locus_tag="COO91_00221"
                     /note="Nfsy_R00221"
     CDS             complement(205005..206498)
                     /locus_tag="COO91_00221"
                     /codon_start=1
                     /transl_table=11
                     /product="katE, catalase"
                     /protein_id="AUB34401.1"
                     /translation="MAHDQQKNDLTDSEENILTNRQGHLISDNQNTRTVGERGPTVLE
                     NYNFLEKITHFDRERIPERVVHARGAGAHGYFEAYGTIGDERASKYTRAKLFQEKGKI
                     TPTFVRFSTVTHGGNSPETLRDPRGFAIKFYTEDGNWDLVGNNLKIFFIRDPIKFPDL
                     IHAFKPDPVTNRQDPNHIFDFISLTPEATHMITWLFSPWGIPASYRFMEGAGVNTYKM
                     VNDDGVAHLVKYLFLPKQGLKFLTQAQAEEIQAKNFNHATQDLYEAIERGDYPEWEFC
                     VQIMSDDEHPELDFDPLDPTKIWPAEQFPVLPVGRLVLDKNPRDYFAEVEQAAFGTGV
                     LVDGLDFSDDKLLQGRTFSYSDTQRYRVGANYLQLPINKPKTRVATNQHGGQMDFVDG
                     DKGSENPHINYEPSSIDGLKEAPKSRKDYTPHVEGQVMRKKISRTNDYQQAGDRYRSF
                     EKWERDDLILNLVTQLKKCNPDIQERMIGHFTEADPEYGERVRSGLA"
     gene            207358..207663
                     /locus_tag="COO91_00222"
                     /note="Nfsy_F00222"
     CDS             207358..207663
                     /locus_tag="COO91_00222"
                     /codon_start=1
                     /transl_table=11
                     /product="Rhodanese-related sulfurtransferase"
                     /protein_id="AUB34402.1"
                     /translation="MSHIETAAQIDALIPDLAALSTVSKDRPIVVYCAVGYRSAKLAQ
                     QLNQAGMKCIYNLSGGIFQWANEGKLIFKDDQPTQVVHPYNAIWGKLLKSSYHAQEH"
     gene            208140..208895
                     /locus_tag="COO91_00223"
                     /note="Nfsy_F00223"
     CDS             208140..208895
                     /locus_tag="COO91_00223"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycosyltransferase, catalytic subunit of
                     cellulose synthase and poly-beta-1,6-N-acetylglucosamine
                     synthase"
                     /protein_id="AUB34403.1"
                     /translation="MSQVSIIIPTLNEATNLGRTLRQLTLLNPPPSEVIVVDGGSQDQ
                     TVTVAKQIFESFNQTLNGQVLLSQQPGRSLQMNYGASAATGDILCFLHADTWVPDDLI
                     TVINKTLAEPTVACGGFISLMSGSQTTRWGISLHNYLKTYYAPLLFKPHLFFRGLRLL
                     FGDQVMFCRRIDFWDCGGFDEALPIMEDGDLCLKLVKKGRIYLVNRIVQSSDRRVAKW
                     GSFKATGIYLYIGFLWGIGVNANYLKQFYQDIR"
     gene            complement(208880..209581)
                     /locus_tag="COO91_00224"
                     /note="Nfsy_R00224"
     CDS             complement(208880..209581)
                     /locus_tag="COO91_00224"
                     /codon_start=1
                     /transl_table=11
                     /product="Glucoamylase"
                     /protein_id="AUB34404.1"
                     /translation="MIDFEPWDRLLRQYVDQQGRVDYVAWKKEQPQAIADWLSSEKNL
                     PLKSNSNNLEQLALWINLYNAFTISTILERYPIESIRPRILGIPNWLAFLWFFQRRAY
                     SIFGESYSLAEIENSILPDKLQEPRIHFAIVCASVGCPLLRSGAYFPELVSQQLDEDA
                     RRFINNPEKVRYDMESKTLYCNKILKWYRQDFLKVAPSIPEYIRSYLKTDYPLNASTR
                     ISYFHYDWSLNQRIS"
     gene            210216..210704
                     /locus_tag="COO91_00225"
                     /note="Nfsy_F00225"
     CDS             210216..210704
                     /locus_tag="COO91_00225"
                     /codon_start=1
                     /transl_table=11
                     /product="putative esterase"
                     /protein_id="AUB34405.1"
                     /translation="MTAMENINAAKMTERYIALAIGIAYLLLGLAGFIPALVSLPGTN
                     ESFIPLDESTGAYSAGFGYIFGLIPTNFLHNLVRCAVGLFGITSYSNASTARLFNRAF
                     AISYALLAVMGLLPFAKTSFGLMPLFGYNVLLNALAAIAAAYYSLVIPAKVKGVNVAE
                     NI"
     gene            210844..211380
                     /locus_tag="COO91_00226"
                     /note="Nfsy_F00226"
     CDS             210844..211380
                     /locus_tag="COO91_00226"
                     /codon_start=1
                     /transl_table=11
                     /product="Nucleoside-diphosphate-sugar epimerase"
                     /protein_id="AUB34406.1"
                     /translation="MDAKQLSQELRQGKDPHMSRRRAIIGLSMLGGSMGQLVTLYQTG
                     IVNHLPDPPIPIFDADRVDASNYAYSRFNSPDGPIMVVTYALTAWLAAAGGLDRARRN
                     PFIPIAMGVKLVLDTAVSAKLAQEEWSENKAFCEYCQVATVCSIASLVLAVPEILAAI
                     RTLRGKPDKNIAASNSTQ"
     gene            complement(211472..211624)
                     /locus_tag="COO91_00227"
                     /note="Nfsy_R00227"
     CDS             complement(211472..211624)
                     /locus_tag="COO91_00227"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34407.1"
                     /translation="MCHCDRSNSDTSAVTATALPPISEISSTKDSSPAWLRADTTNDA
                     PRLAKL"
     gene            211616..212461
                     /locus_tag="COO91_00228"
                     /note="Nfsy_F00228"
     CDS             211616..212461
                     /locus_tag="COO91_00228"
                     /codon_start=1
                     /transl_table=11
                     /product="putative esterase"
                     /protein_id="AUB34408.1"
                     /translation="MTQNNNPPDWTRRQLLQFGLAGMILPLAASQLSNCQKRNLLVME
                     SSKQVDSRATEGQLLSRPTRPTTTALTELHPLGLDGQRDGFVYVPETYRADQPAPVVL
                     ILHGAGGDAEGALKILRHLANRFGTILLAVDSRQQTWDIIRGGYGPDITFLDRALAQT
                     FSHYAIAPNQVAIAGFSDGASYALSVGITNGDLFNHIIAFSPGFMAPASQSGKPRVFI
                     SHGKFDTVLPIERCSRRIVQQLKQAGYDLEYREFNGLHTVPTAIAERAMEWFTQSAPD
                     KVFHS"
     gene            212472..213044
                     /locus_tag="COO91_00229"
                     /note="Nfsy_F00229"
     CDS             212472..213044
                     /locus_tag="COO91_00229"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34409.1"
                     /translation="MKTDPGIAIDSNPPKVEPQKNRWGTIGILLFLVIFVSFFASRLE
                     FVLGKTPSLDKTFTPVTQAAPQEVGSYDVLGYAINKEEATRLLNTEEGRKQLSPENGA
                     FAVTEETLKLGRDAFYSETFGNEIFQTDVVGALNGPINMITVGQAITCKSWLYHSRTD
                     RFNSIPPQFGRSTRNSAQFTLTKYSFYSFA"
     gene            213328..213567
                     /locus_tag="COO91_00230"
                     /note="Nfsy_F00230"
     CDS             213328..213567
                     /locus_tag="COO91_00230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34410.1"
                     /translation="MEREIKDSDGITWTCIQAFSGLSDISKAEDAAEVEGEPDTYWVV
                     CTPSGGAQSVRLKLKGKWEEEYSDEALLKEIKTQQ"
     gene            214278..215096
                     /locus_tag="COO91_00231"
                     /note="Nfsy_F00231"
     CDS             214278..215096
                     /locus_tag="COO91_00231"
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent 3-hydroxy acid dehydrogenase
                     YdfG"
                     /protein_id="AUB34411.1"
                     /translation="MTNTVIITGASQGIGKATALLFARHNYDVVLAARQLDRLEATAA
                     QIRELGREAIAISCDVKDPLQVNNLIEKGIDHFGHIDVLINNAGIFCLGPVEDFSLDD
                     WHQIIDTNLWGYIHTINAILPHFLERRKGTIVNVSSIGGIEPIPYHVPYTTTKYAITG
                     LTKSLHAELSPKGIHVSGIYPSFISTQLMERAIFRGKDEETAQARSELVGKAIQAPVL
                     EKPEDVAKSIWEAVKDQRSDVMVGTTNFWKAIYHLSPSLMQSAFRRLFGMEERS"
     gene            215150..215284
                     /locus_tag="COO91_00232"
                     /note="Nfsy_F00232"
     CDS             215150..215284
                     /locus_tag="COO91_00232"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoglycolate phosphatase, HAD superfamily"
                     /protein_id="AUB34412.1"
                     /translation="MIAFRCGGFDDSQLKDAIAIYNEPADLLAHYDTSPLATKAMTSK
                     "
     gene            complement(215289..216248)
                     /locus_tag="COO91_00233"
                     /note="Nfsy_R00233"
     CDS             complement(215289..216248)
                     /locus_tag="COO91_00233"
                     /codon_start=1
                     /transl_table=11
                     /product="putative metal-dependent hydrolase"
                     /protein_id="AUB34413.1"
                     /translation="MNIDNIRLKNIKTQQNIILQSIFNVVSNSTLKSTQTQQITQSLV
                     KTVTAIEEICFNKQATPANLSRSSRQIYSWMKFLTDEVNLQLHLESTFRMQQIAKKML
                     IKHGQESVKLMIEFTIFALLYKGKRFGDAAHIIVNEGFINASEEVMTALVESALFGRN
                     QDNTRLIRSFASCEEYSNVLLELDLIVEVIAENPQGKFYNLNELFDKLNCEYFAATLA
                     KPRLAWSQIHTYRKFGHYEPARDRVVISLTLDNGSVPEFVSEFVLYHELLHKYHGTNW
                     VQGRRMVHTREFRISESQFKLYEEASTWLEKLATGQSSKRRHF"
     gene            complement(216716..218842)
                     /locus_tag="COO91_00234"
                     /note="Nfsy_R00234"
     CDS             complement(216716..218842)
                     /locus_tag="COO91_00234"
                     /codon_start=1
                     /transl_table=11
                     /product="treX, glycogen operon protein"
                     /protein_id="AUB34414.1"
                     /translation="MYVAVWPGNVYPLGASWDGKGTNFALFSENATGVELCLFDADNH
                     EIRLPLTEKNNFVWHAYLPGVGPGQRYGFRVHGPWAPELGHRFNPNKLLIDPYAKAID
                     GDFSDNPANFGYSLDAPEQDLAFSDLDNAEIMPKCIVVDQSFDWGDDKLLSIPWHETI
                     IYETHVRGFTKLHPEIPEELRGTYAGLAHPAAIQYLQQLGITSVELMPVHHFLSSPGF
                     LVAKGLKNYWGYDSINYLTPYSGYSASGSLGQQVTEFKQMVKDLHSAGIEVILDVVYN
                     HTGEGNHLGPTLSLRGIDNAVYYRLVKDNSRYNMDFTGCGNSLNVRHAQVLKLIMDSL
                     RYWVTEMHVDGFRFDLASALARELYEVDNLAAFFDIIHQDPVLADVKLIAEPWDLGEG
                     GYQVGNFPLRWSEWNGRYRDTVRDFWRGEDDSLGQFAYCFTGSPDLYQANGRNPSASI
                     NFVTAHDGFTLNDLVSYNEKHNQANGEDSRDGESHNRSWNCGVEGETDDPDVIRLRER
                     QRRNFLATLMLSQGVPMLLAGDEIGCTQKGNNNAYCQDNEISWRDWSLQKSNSELLDF
                     SRELIDFRHKHPVFRRRKWFQGRPIHGFGINDIAWFNADGSEMTEKQWLVSYAKAMEI
                     FLNGEGIVTPGRRGERIIDESFLLFFNAHYETLEFALPNVFQDREWEIVIDTNESRFL
                     SPGKLVMGEQTVPVTDRSIMVLRRLA"
     gene            219415..223533
                     /locus_tag="COO91_00235"
                     /note="Nfsy_F00235"
     CDS             219415..223533
                     /locus_tag="COO91_00235"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutamate-1-semialdehyde aminotransferase"
                     /protein_id="AUB34415.1"
                     /translation="MSQYIFSSLTADEELNFSEETEVFAFPTSFAQQRLWFLDQLASG
                     NPFYNVSTALCLKGSLNFTALKQTFNEIVRRHETLRTTFAIVEQQPVQLIAPSLNIPL
                     PLINIRNFDQERETQVRRIATAEAQHPFNLTTGPLLRVKLLQLDEAEYVLLLNLHHIV
                     ADGWSIGVLIRELGVLYKAFVEDKRCLMSTLLPELPIQYADFAQWQREWLQAVGENGC
                     SPLQTQLAYWQKQLNGISVLNLPTDRVRPAVPTYRGAKQFLELPHSLTQALETLSYQE
                     DVTLFMTMLAAFQTLLYRYTQQEDIVVGSAIANRNRSELEGLIGFFVNSLVLRSDLSG
                     NPTFRELLNRVREVTLGAYTHQDLPFEKLVEELHPERDLSRHPLFQVVFSLQNTPIEA
                     LELPGLKLSLFNFDSKIAKLDLEFHLWRDLETLKGEVVYSTDLFDQSTITRMLGHFQI
                     LLESIVANPKQRISDLALLTEGERQQLLIDWNDTKKTYPNGKCFHQLFEAQVEKSPDA
                     IALVFGNQQLSYKELNIRSNQLAHYLTKRGVETETLVGICVERTLEMIIGLLGILKAG
                     GAYLPLDPSYPQERLNFMLEYAQVSVLLTQEKLLQHFTEFSNQIISIHKDWATITQYS
                     RENPNSCVTLENLAYVIYTSGSTGQPKGVLIEHRGLSNLAAEQIEVFNLQPSNRILQF
                     ASLSFDASIFEIVMALQTGATLYLAKKESLLPGKALLQLLREKALTHVTLPPAVLAVL
                     PTESLPALQTIISAGESCSEDIVKRWWNPSRRFFNAYGPTEGTVWSTVAEIKSVSEKT
                     PIGRPIANTEIYILDKHLQPVPIGILGELYIAGDGLARGYLNCPELTAKKFIPNPFNA
                     KKGAKLYKTGDLARYRADGNIEFLDRIDNQVKIRGFRIDLSEIETVLSQHNNVEKAIV
                     IAQGNLYDNKHLVAYIVTNSTQEQTIIELRQFLKEKLPEYMIPKAFVILDSLPLTANG
                     KVDRYALKAVDSQSRSIDKTFIAPRTPTESTLAKIWAEVLNVENVGIHDNFFDLGGNS
                     LLAIRLLDQINKQFERDLPLSNLFLNQTIESLAITLYTKTDSLAWSPLVPIQPNGSNP
                     PLFCVHPIFGVVFPYYELAHQLGENQPFYGLQPIGIDGETPLNRIEDMATHYIEALRS
                     VQPKGPYFIGGWSFGGWVAFEMAQQLQNSGEEVALLAVLDTVAPIKSNLPSLSNAFKF
                     IFTTVVPYMWPFFLDYLCLITAHSKNRINSLTSQFPNFQKLMRSLKRNLFSHFIQKED
                     ATVNLISNESKRRLLTESGIVPMLRVFYANSQAVLNYVPQVYPKRINLFRTRVQLNVA
                     EGEPSMGWDQLAVGGTEIHHIPGNHLTMLRKPHIQVLAAQLRGCIEKTQTLK"
     gene            complement(223896..224030)
                     /locus_tag="COO91_00236"
                     /note="Nfsy_R00236"
     CDS             complement(223896..224030)
                     /locus_tag="COO91_00236"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34416.1"
                     /translation="MITTNVAFACEFYVEYKKEIKLIGCFYYLYFEINTSLINLSPDF
                     "
     gene            224111..224950
                     /locus_tag="COO91_00237"
                     /note="Nfsy_F00237"
     CDS             224111..224950
                     /locus_tag="COO91_00237"
                     /codon_start=1
                     /transl_table=11
                     /product="Nucleoid-associated protein YgaU, containings
                     BON and LysM domains"
                     /protein_id="AUB34417.1"
                     /translation="MGIVIFSSLAASFLLPELSDAIFQKNDYVAQAQQRNTIQYTVAP
                     GDFLSNIAQRFYGDGSEASWRKIYEANRSVIGPDPTQLQAGMLLVIPEANQSQPNSVA
                     SRGNLEDLLLALGRRETGQENPPYNIENQLGFMGKYQFGEALLIDLGYYRANFYYGNG
                     ASRNEWQGTWTGKNGVNSKQDFLNNQNNVQETAIREAFELNLKRINSQLEQNGLSLRQ
                     YIGQQRGGVVITISGILAAAHLRGETGVIRLLRYNQVSQDENGTSILTYLREFAGFQT
                     PYD"
     gene            225633..228893
                     /locus_tag="COO91_00238"
                     /note="Nfsy_F00238"
     CDS             225633..228893
                     /locus_tag="COO91_00238"
                     /codon_start=1
                     /transl_table=11
                     /product="Non-ribosomal peptide synthetase component F"
                     /protein_id="AUB34418.1"
                     /translation="MSSEEVFVFPVSFAQQRLWFLDQLIPDNTIYNVPTVIRLTGSLN
                     LTALEQTFNEIVHRHETLRTTFIVLDGQPLQAIALSLTIPISVLDLQLLPDDEREVEV
                     KSIVTAEIEHPFNLSSGPLLRVKLLVLSNTEHILLLNMHHIICDDWSIGVLIRELGML
                     YTAFAQNQPSPLLELPLQYADFAHWQREWLQGEVLQTQLTYWQQQLNGISMLHLPTDK
                     PRPAIQSYEGATQFFELPKKLTDALETLSQQEGVTFFMMLLAAFKTLLYRYTDQEDIA
                     VGSPIANRNRSEIEGLIGFFVNSLVLRSNLSGNPSFQEVLGRVREVMLGAYSQQDLPF
                     DKLVEELHPERNLSHHPLFQVVFSLQNAPMSALELSGLVPSFLNIDFKKTRFDLELHL
                     WKCSDDFRSLWGANWEYSEGLRGVIVYNKDVFDKATISRVLEHFKTLLSSIVANPEQR
                     IANLPLLSEVELYQILLEWNNTKTDYPYDKCIHQLFEEQVQHHPNSIAVIFDNEQLTY
                     QELNVRSKKLAQYLQKIGVGSEKLVGICISQSIEMIVGLLGILKAGGAYLPLDSSYPQ
                     ERLKFMLEDAQVSVLLTQEKLLKHFECFLNPIVCIDKDWEIITQENKNNLERSATSNN
                     LAYVIYTSGSTGKPKGVAITHKAVNRLVCNTNYIKLLPSDKIAQASNISFDAATFEIW
                     GALLNGAKLVGVSKDVILSPHKFALQLQQKEISVLFLTTALFQQIARDVPQAFASLRY
                     LLFGGEAVNIRWVKKIIQHGAPKHLIHVYGPTENTTFSSYYHIQGLAEAATFVPIGCP
                     ISNTQIYILDTHLQPLPIGIIGEVYIGGDGLAQEYLNHTELTTEHFITNNFSNNSKIR
                     LYKTGDLARYLPDGNIEFLGRIDNQVKIRGFRIELSEIEAVLNEHPSVKETVVIADED
                     IPDNKYLIAYIVLNVVEVSNLASLLRKYLKEKLPEYMVPTAYLVMESIPLTPNGKVDR
                     RALPRTDIVTFDRYDYVAPRSQVEELLGEIWAKVLGKEQIGVHDNFFELGGHSLLATQ
                     LVSRIRDTFQIDVTVRNLFEAPTIEQLAKCVDTMCWAAKGVDKTRTTGEEREEVEF"
     gene            229036..229170
                     /locus_tag="COO91_00239"
                     /note="Nfsy_F00239"
     CDS             229036..229170
                     /locus_tag="COO91_00239"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34419.1"
                     /translation="MGFFYYESRQVGKTHLSQVSQFGQANISVFDMTQDYLLSIDDKN
                     "
     gene            229377..229598
                     /locus_tag="COO91_00240"
                     /note="Nfsy_F00240"
     CDS             229377..229598
                     /locus_tag="COO91_00240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34420.1"
                     /translation="MSSGIYAPAAVAINLNIRKIRELAGFKLKGINKSPLAYFLMVFI
                     YSLTACVFQPWEFLTSLLSCYATIFRQNL"
     gene            229629..231158
                     /locus_tag="COO91_00241"
                     /note="Nfsy_F00241"
     CDS             229629..231158
                     /locus_tag="COO91_00241"
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose-phosphate synthase"
                     /protein_id="AUB34421.1"
                     /translation="MHIGFLNPQGNFDSNNSHITKHPDFGGQLVYVKQVAIAIAQMGH
                     KVDILTRQIIDPEWPEFAETFETYPGVDNVRIIRLPAGPKEFLPKELLWPHLVADWVP
                     NILKFYQQEGGLPDAMTAHYGDGGLCGVLIEEETGIPFTFTAHSLGAQKMDKLEVTPE
                     NLTAIDEQFNFRYRILAERLSMNRSAVNITSTQQERKEQYSHRVYSGAVDVDNNNRFA
                     VIPPGADFSIFGAKARSENEEATQEFIQERLARDIAEARRDLPVIVASSRLEPKKNIL
                     GLVQAFAMSPTLQERANLMLITGGLDDPLREEASDGIAEEVLAPIREVVKENDLWGKI
                     SAFGLSDQSQESLAAAYRFMVKRRSVFALTALYEPFGLAPLEAAVAGLPVVATKNGGP
                     SESFRQGNKEYGVLVDPEDPADIARGLERLLCDAQEWEYFAQAGQQRVLKKYTWESTA
                     ENYLTLLEQILSSPETRSRAELLPIHPYFRNPESQTDVFLEELGDLYFGSNQKVLINA
                     S"
     gene            231204..231548
                     /locus_tag="COO91_00242"
                     /note="Nfsy_F00242"
     CDS             231204..231548
                     /locus_tag="COO91_00242"
                     /codon_start=1
                     /transl_table=11
                     /product="Periplasmic hemin-binding protein"
                     /protein_id="AUB34422.1"
                     /translation="MEVLTGKAEVATDCAKHRNVKAEALAGKAEVATDCAKHRNVKAE
                     ALAGKAEVATDCAKHRNVKAEALAGKAEVATDCAKHRNVKAEALAGKAEVATDCAKHR
                     NVNPGAIFFDGC"
     gene            complement(231566..232666)
                     /locus_tag="COO91_00243"
                     /note="Nfsy_R00243"
     CDS             complement(231566..232666)
                     /locus_tag="COO91_00243"
                     /codon_start=1
                     /transl_table=11
                     /product="Lysophospholipase, alpha-beta hydrolase
                     superfamily"
                     /protein_id="AUB34423.1"
                     /translation="MPHIFLLVWLVQLLSVGVLGGGIYILYEWYEGELVGTSYLVAGL
                     VMVLWTFGGRFISLPLLRRPGKEEPKFMRSKTVQRLPRPDGSVLQVEFFGPEDGQPII
                     LSHGWGPNSTIWYYAKRQLSDRFRVIVWDLPGLGKSSKPKNNDHSIEKYARDLEAVIA
                     IAGDKPVILVGHSMGGMINLTFCRLFPEQLRSRVAGLILVDTTYTNPVKTCIFSNLAR
                     KLQKPLLEPVLYLTIVLWPVFWLMTWLSYFNGSLYITVELSGFTGTETRGQLNFAGLL
                     SALGSPGVLARGTLGMLKFDETDTLATINVPVLVMCGASDIATKPVASDRMKAELPYS
                     ERVTLKPGGHMALMEQNQQFAKAVSTFCDSCS"
     gene            232901..237613
                     /locus_tag="COO91_00244"
                     /note="Nfsy_F00244"
     CDS             232901..237613
                     /locus_tag="COO91_00244"
                     /codon_start=1
                     /transl_table=11
                     /product="Non-ribosomal peptide synthetase component F"
                     /protein_id="AUB34424.1"
                     /translation="MNTVELLSYLRSLDIKIFLDGEKFRCNAPEGILTVELRAEIQKR
                     KAEIIEFLKATNRTYNHSFKPLVPISRSENLPLSFAQQRLWFLDQLIPNNPFYNIPVA
                     LHLTGSLNKAALEQTFNEIVRRHEALRTNFVIQSGQPVQIINPTLIITLPIIDLRQLP
                     QAEREIQARQFTNQEAQRPFNLSTDSLLQVKLLWLDETEYILLLNMHHIVSDGWSIGV
                     LIQEIAALYTAFTSNQPSPLPKLTIQYADFAYWQRQWLQGEVLEKQLGYWQKQLDGIS
                     ILNLPTDRPRLAVQTYQGARQPLQLSKSLSEALLALGQQEGVTLFITLLAAFKVLLYR
                     YTQQEDIAIGSPIANRNRSEIEGLIGFFVNSLVLRTDLSGNPTFRELLNRVKEVALGA
                     YAHQDLPFEKLVEELHPERNLNQNPLFQVVFALQNAPMSALELTGLTLSPLPFDTETT
                     RFDLEFHLWEPNTQNGLWVDISEGISGFVIYSTDLFDNATITRMLGHFQTLLEGIVAN
                     PEQRIAQLPLLSEPELYQLLIGSNNTQADYPQDRCIQNLFENVAEQNHDAIALVFGDD
                     KLSYKELNIRSNQLAHYLKKLGVKTEVLVGLCVERSFDMVIGMLGILKAGGTYVPLDP
                     SYPSERLDFMLKDAQVSVLLTHEQWLKRLENSNSNIICLDKDCKIIAQEIEDNLPSEV
                     RADNLAYVIYTSGSTGKPKGVQIEHRGLLNLVFWHQKAFAVSPIDRVTQIAGVAFDAC
                     SWEIWPYLSAGASIYIVDDEIRRSPEYVRDWLISQKITISFLPTLIAEKFLLLDFPED
                     AALRILLTGGDKLNQYPLTSHSFQVYNNYGPTENTVVTTSGHISVKNKDNLAPAIGGA
                     IANTQVYILDKHLQPVPIGVSGELYISGDGLARGYLNRPDLTAECFISHSFTNKLKAR
                     LYKTGDLVRYRVDGNIEFLGRVDEQVKIRGYRIELGEIEAVLSQHPAVQQTVVIIHED
                     EDEKRLVAYLVAKAEYSSQQENVQLMQLQNEQVLQWQMLYNETYNQPALDSDVTSNFV
                     GWNSSYTNQPIPAEQMHEWVNNQVAQILALQPKRVLEIGCGTGLILFRIAPHCTKYWG
                     TDFSPVSLNYIQQQLEKQEMPQVTLHQQMATDFEKVETAAFDAVILNSVVQYFPTIDY
                     LIRVLEGAVRATAPGGFIFIGDVRILPLLEAFHTSVQLEQAESSLTRSELQQRVKMQI
                     FQETELVIDPVFFSAIKQCFPQISNVQIQLLRGRDRNELTQFRYNVILHIDDKTINNT
                     GNNSVLNWSEENLTVSAVHQLLIETKPEILCIKNVPNARVMAAVKTAEWLSDVEGFKT
                     VGQMRKALQELENLGVEPEDLYTLDVPYEVDITWSHSSIEGRYDVVFVRQDKIAKRAI
                     FPHSTAHSRPWQSYANNPLQAKAARKLVPQLQTYIAKKLPEYMIPSAFVILESLPLTA
                     NGKVNRRALRGFYDAIQPQLSENYIAPRTPVEQVLVKIFAEVLGLKQVGIYDNFFELG
                     GHSLLATQLVSRVRDTLRVELPLRSVFEAPTIAQISKIVESFKESNPQSQAPVLVPLS
                     RESRRIKLSFLNEDTKRR"
     gene            complement(237756..238811)
                     /locus_tag="COO91_00245"
                     /note="Nfsy_R00245"
     CDS             complement(237756..238811)
                     /locus_tag="COO91_00245"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC.FEV.P, iron complex transport system
                     permease protein"
                     /protein_id="AUB34425.1"
                     /translation="MRQIIFKKNTYLNLTKPFQTIFTEHRVLWAVLLLSAALVVTLAL
                     SLSQGAVPLSMSEFWQAILREGDPVKQTILWDLRLPRITAALIVGAALGMSGALLQGM
                     LRNSLADPFILGISAGAGLIVILMIVWQIFPIAIPLAAWMGAILTSAIVILLGRAGSG
                     ISVERLILGGVAVSSLLGAVQSTLLLLAEDGQIQIALSWLVGSLNGRGWQEIATAGPY
                     IIVALLGGCLLARSVNVLALGDDLAVGLGVSLTRSRLLIGGVATLLAAGAVSISGLIG
                     FVGLVVPHGVRLIVGTDHRFVLPLSALAGACLLTFADLLSRLGAVELPVGSVTALLGS
                     PLFIWLLYRRSAGVNKF"
     gene            238879..239019
                     /locus_tag="COO91_00246"
                     /note="Nfsy_F00246"
     CDS             238879..239019
                     /locus_tag="COO91_00246"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC.FEV.P, iron complex transport system
                     permease protein"
                     /protein_id="AUB34426.1"
                     /translation="MNVEPQKVKVEPQKVKVEPQKVNFQVLTPHAPCPMPYALCPMPH
                     AP"
     gene            complement(239038..239661)
                     /locus_tag="COO91_00247"
                     /note="Nfsy_R00247"
     CDS             complement(239038..239661)
                     /locus_tag="COO91_00247"
                     /codon_start=1
                     /transl_table=11
                     /product="nrdG, anaerobic ribonucleoside-triphosphate
                     reductase activating protein"
                     /protein_id="AUB34427.1"
                     /translation="MEIKPTDPSLALMEIPPGYLNIMGYVDQSEVNGPGCRAVIWVQG
                     CLRECPGCFNTNSWSFEANQLIAVDTLAENILSNPHNTGVTFSGGEPFWQATALASLA
                     RKVKAAGLNVMSFTGFTLKQLQSQSAPPGSQALLEQLDILIDGPFVQSLAINSPNSPV
                     SSSNQRVRVLNPAFQDQITWASDQIEIHILKDGGRIVTGYQGGLELT"
     gene            239858..241051
                     /locus_tag="COO91_00248"
                     /note="Nfsy_F00248"
     CDS             239858..241051
                     /locus_tag="COO91_00248"
                     /codon_start=1
                     /transl_table=11
                     /product="ndh, NADH dehydrogenase"
                     /protein_id="AUB34428.1"
                     /translation="MTQQTSRICILGGGFGGLYTALRLSQLPWESTQKPEIVLVDQSD
                     RFLFSPLLYELLTGELQTWEIAPPFEELLQGTGVRFYQGVVSGIDIDQKLVNVHEGPE
                     IPYDRLVLALGGETPLDLVPGATSYAYPFRTISDVYRLEERLRFLEESDADKIRVAII
                     GAGYSGVELACKLADRLGERGRFRIVEIADQILRTSPEFNREAAKKAIEARGVFIDLE
                     TKVESIEQNSISLEYKNQLDTIPVDLVIWTVGTRVAPVVKSLPLKQNQRGQISTTSTL
                     QVLDHPEIFALGDLADCHDIEGQQVPATAQAAFQQADYTAWNIWASLTNRPLLPFRYQ
                     QLGEMMALGIDNATLTGLGIKLDGRLASVARRIAYLYRLPTLDHQLKVGFNWLVRPII
                     ETLSK"
     gene            241186..241833
                     /locus_tag="COO91_00249"
                     /note="Nfsy_F00249"
     CDS             241186..241833
                     /locus_tag="COO91_00249"
                     /codon_start=1
                     /transl_table=11
                     /product="putative hydrolase of the HAD superfamily"
                     /protein_id="AUB34429.1"
                     /translation="MEQPKVIFLDAVGTLFDVKGSVGKVYSQIAQEFDVTVSAETLNT
                     AFIKSFKAAPPPIFPDAELQDIPQREFDWWRIIALNTFESAGVLKEFSDFSAFFSELY
                     IHFGTAEPWFVYPDVLPALINWRRLGVTLGVLSNFDSRIYSVLQSLGLREFFTSVTIS
                     TQVRAAKPDPQIFAIALDKHKCSPEAAWHIGDSIVEDYHAAKAAGLRGVWINRGK"
     gene            complement(241977..242144)
                     /locus_tag="COO91_00250"
                     /note="Nfsy_R00250"
     CDS             complement(241977..242144)
                     /locus_tag="COO91_00250"
                     /codon_start=1
                     /transl_table=11
                     /product="putative nuclease, containings PIN domain,
                     potential toxin-antitoxin system component"
                     /protein_id="AUB34430.1"
                     /translation="MPEHLEEHWRDAGHIWGLVWLRSSGNLSIWAETIYLIWEATEAE
                     EWIDRLDWIPF"
     gene            complement(242331..242663)
                     /locus_tag="COO91_00251"
                     /note="Nfsy_R00251"
     CDS             complement(242331..242663)
                     /locus_tag="COO91_00251"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34431.1"
                     /translation="MQLEDYFEFIDPDDIRIKGHRIGIDNVIQYYLQGYSPEQIIEEL
                     PSLNLEKIYATLTYYLHNRVEIDAYMLRLAKWREQRYQESLANPSPLMQRLRALKVQR
                     EQELLNSW"
     gene            complement(242804..242974)
                     /locus_tag="COO91_00252"
                     /note="Nfsy_R00252"
     CDS             complement(242804..242974)
                     /locus_tag="COO91_00252"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34432.1"
                     /translation="MGSWERGIGTRDFQLKKYPIPAGRYANAFRAGGRKQRGETSRVE
                     SRNWDNLFFGVP"
     gene            243055..243915
                     /locus_tag="COO91_00253"
                     /note="Nfsy_F00253"
     CDS             243055..243915
                     /locus_tag="COO91_00253"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF1092"
                     /protein_id="AUB34433.1"
                     /translation="MGSIWEIDFYSRPILDDNQKKVWEVLVCESALDISTKVDSLFRY
                     AQYCPSTQVNSGWLRTALQEAINQAGKAPIKIRFFRRQMNNMITKACQDLGIPAQPSR
                     RTLVLNHWLEQRMEEVYPQEAGYQGGANPSVRLEKPLPQRLPDALEGQQWVFVTLDGA
                     DLAEMPEWEIGFGEAFPIELAKVSPETRIPGILIFSPRALPLAGWMSGLDLAFLRFDT
                     SEEGRLLLETGVTESWIVANIKKPQLLAEAKGFEEAKQKANGVHFIGVQSDPKAQSFA
                     GFWLLQEVNL"
     gene            244252..245565
                     /locus_tag="COO91_00254"
                     /note="Nfsy_F00254"
     CDS             244252..245565
                     /locus_tag="COO91_00254"
                     /codon_start=1
                     /transl_table=11
                     /product="pmbA, PmbA protein"
                     /protein_id="AUB34434.1"
                     /translation="MGSENLSQDTLAEQLLELAIKSGAEAAEVYQSRSLSRPVFFEAN
                     RLKQLETNQSEGTALRLWRNGRPGLTVAYGSVLAEVMVEKALALSQLNQPETVELGSN
                     SQPSYPDLGKGVPIEILVDWGKEAIALIRDAYPDVVCNSDWECDAETTRIVNTKGLDC
                     YYTDTTLNCYMSAEWVRGDDFLSVSDGQTKRGELHPEILANQILQRLIWARENVSSPT
                     GRVPVLFTSKAADMLWGTVQEALNGKRVLEVASPWAERLGNPVIAPSLTLYQDPEAGP
                     YSCPFDDEGTPTQFLVFIQNGTLQHFYGDRTTGRQLGTNTTGNGFRPGLGSYLTPGLF
                     NFLIQPGSASLPDLIQELDDGIIVDQMLGSGGSISGEFSINVDLGYRVQNGQVIGRIK
                     DTMVAGNVYTALKQLVTLGNDADWNGSCYTPSLIVEGLSTTGRSN"
     gene            245622..245876
                     /locus_tag="COO91_00255"
                     /note="Nfsy_F00255"
     CDS             245622..245876
                     /locus_tag="COO91_00255"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34435.1"
                     /translation="MEFKASLMQFKDSLMQFKASLMQFKDSLTEFKASLMQFKDSLTE
                     FKASYAIPPAPAPCPMPHALIPKNYVSSRSESALSHLVAA"
     gene            245827..248451
                     /locus_tag="COO91_00256"
                     /note="Nfsy_F00256"
     CDS             245827..248451
                     /locus_tag="COO91_00256"
                     /codon_start=1
                     /transl_table=11
                     /product="TC.CIC, chloride channel protein, CIC family"
                     /protein_id="AUB34436.1"
                     /translation="MSLPVLNQRFRTWWQPRRGLAIAEACVIGLVAALSAVLLKVGSG
                     WLGTWRVHTTHIFPVWLALPAIGLVLGFVAGWLVDRLAPEAYGSGIPQVKATLANVPM
                     KLSWRVAGIKLLSAIIAIGSGMTLGRQGPTVHVGAGLAAGMSRWVPTSPDHRRQMIAA
                     GAGAGLAAAFNAPIAGVLFIVEELLQDLSGLTLGTAIIASFIGGVISRLLGGGSLDLN
                     LQLTQSSSQFSIPEIPFFVLLGILAGLLGALFNRGLIFSIKFYKKLHISLPLRVALAG
                     FLSGVVVSMLPASFRDNTGLRESLITGGSQPSVAAIAFAAQFILTLIAFGSGAPGGLF
                     APSLILGSCLGHIIGVSELYITGAGSPTTYALAGMGGFFSAVSKVPITAIVIVFEMTT
                     DFNLVLPLMIVSVAAYLVADKVVPGSLYEKLLELKGITLTKEAPMEGALTKLTAKDVM
                     QERVETLDAEMSLEEAMQSFARSHHRGFPVVEDNKLVGIVTQSDLLKIRESAKHRLRD
                     RNLANDILLKEIMTPVPMTVTPIHTLSNVLYLLDRYQISRLPVVDGRKLIGIITRADI
                     IRAEADHLNCDNRTLKLRPEPSYVVYQTRSPSTGSGRLLVPVANPETAGILLRMAAAI
                     ARDRHYEIDCVQVMLIPRHSSPSETQVRTAKSRRLLRQAEVLAKKWKIPLHTQIRVTH
                     DVAQAILETINEQHIDLILMGWKGNTSTPGRIFGNVVDTVIRQATCEVVLVKLGTTGN
                     SFNRWLVPMAGGPNSPLAIKLLPALITLGNDPKIRLTQVFKPSELKPDMSVSEQAIRH
                     LMRRRKLSSSVVALPVQANSVAEGVINLVQTEGYDVVVLGASREGLLQQAIQGNIPEA
                     IASGVESTVILVRGAINK"
     gene            complement(248481..248663)
                     /locus_tag="COO91_00257"
                     /note="Nfsy_R00257"
     CDS             complement(248481..248663)
                     /locus_tag="COO91_00257"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34437.1"
                     /translation="MFVIFLGFGCIWILMGVVGWIAFLKSEGEEIKFGKWGLIVAIPI
                     LIPIIVALIIGVFYHK"
     gene            complement(249324..250544)
                     /locus_tag="COO91_00258"
                     /note="Nfsy_R00258"
     CDS             complement(249324..250544)
                     /locus_tag="COO91_00258"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycosyltransferase involved in cell wall
                     bisynthesis"
                     /protein_id="AUB34438.1"
                     /translation="MIDKHHFYLIFPNIFDFKGGIQVYSTFLLKALQDVYLEANYDVF
                     LKYDKRNLKQQENLQFLSSTKFHYFGNLPRLLQTIFFATKIIILAILQRPTIVISTHV
                     NYATACYILKLLTGIPYWVVAHGLEVWDIKNNVTKLALQNADKIISVSNYTRQRLLQY
                     KNIDPDKIVLLPNTFDANKFKINPKPTYLLQRYKLTDKQPVILTVTRMGRMAKYKGYD
                     QILHALLKVRLHIPNVHFILAGKGDDIPRVKALVSNLILEDCVTIAGFVPDEELCDYY
                     NLCDVFALPSKGEGFGIVYLEALACGKPVLAGKQDGSIEPLAEGKLGCLVDPDNVEEI
                     ADNLIQILQGDCSNPVIYQPEYLQQKTIEAFDFSQFRTSLAKLVGGHIALLRIQNSKF
                     KIQNSKFKINKPHK"
     gene            complement(250561..251814)
                     /locus_tag="COO91_00259"
                     /note="Nfsy_R00259"
     CDS             complement(250561..251814)
                     /locus_tag="COO91_00259"
                     /codon_start=1
                     /transl_table=11
                     /product="O-antigen ligase"
                     /protein_id="AUB34439.1"
                     /translation="MINIFFLLILFSSVLGRIKFPGINIGIHYLLIPAFSFGIISLSL
                     KSIPEVVNKHKIILISISLMYMWMWISSLMSRFPTIAISYSIKYSTYFILFLAFLLLT
                     FKSIKTPSLTFYYRCILYLLQIIAILGFLEVLLPNHWIFKLLKFPSFYPEIGSIMQNP
                     NQFGVIIAIGLCLSLILEKQNKISKIELYVSELIFIISLAFSASGNGWLIFIIGTFLL
                     LIYKIISFRKMIYLTSFLLLCIVTVPVSTQRIGLANSKIFPLINVFNAFSENSNLVNP
                     NKKPLITIIKTGFSRVEIWQAAINETIKRPLTGIGIGVFPEQIGVKVWGQKGYHAHNI
                     FLNVLAEQGIPGLLLFTNFLVKITFKVKYSNPLVTVPIILFLASQMLDFFAEDYIFTT
                     IEFYFIAAAINSRRDFVMQLKPEII"
     gene            complement(252218..252517)
                     /locus_tag="COO91_00260"
                     /note="Nfsy_R00260"
     CDS             complement(252218..252517)
                     /locus_tag="COO91_00260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34440.1"
                     /translation="MKRFNVSKILGSTALALSLATLPTVLPASAQTTSTPDATVTDTT
                     TDRAATDSNYQDGDWGLLGLLGLFGLFGRKSRKADDNVAYRDPNAVGSSGSRSNY"
     gene            253255..254100
                     /locus_tag="COO91_00261"
                     /note="Nfsy_F00261"
     CDS             253255..254100
                     /locus_tag="COO91_00261"
                     /codon_start=1
                     /transl_table=11
                     /product="LysM repeat"
                     /protein_id="AUB34441.1"
                     /translation="MKWLLTTALILSSTTQYPAQLIAQTKQPATTKQPVQPVRTPASP
                     QQRSSRPVFVLPKIPARLSPISGRRAGMSSRDNCSAVPTALTALVPLQQEKKVGKLTD
                     KSVIGIVQGLTTSERPTFWFYVPYTQDLANSSAKFILQDSAGTNIYEDAIALPPEPSV
                     IGVSIPKNATSLEVGKTYRWYLIVSCKQQTASVPVYVEGDIQRINLDSRVMQQLEAAD
                     DPRQKIVIYAKEGIWFDALTMLAQIRVSNPNDASVKEDWQSLLQSVNLGNISTAPLLN
                     SRNSQ"
     gene            complement(254283..256907)
                     /locus_tag="COO91_00262"
                     /note="Nfsy_R00262"
     CDS             complement(254283..256907)
                     /locus_tag="COO91_00262"
                     /codon_start=1
                     /transl_table=11
                     /product="Tetratricopeptide"
                     /protein_id="AUB34442.1"
                     /translation="MAKLQRPKRVVRFAVTPVVLFTLAVFLIIIPSTFAKQLQTNSPN
                     GFHIQTNKLPATTPQPLLEQGEALYQAGRFTEAVTILQQAVRSYQRESNNLAQAAALT
                     NLCLVYQQLGSWKEAYATIDNSLNLLGWDEINQKLNVNNPKSELLEILAQTLNIQGEL
                     QLADGQTDASVKTSQQAEQIWKKLGDNAGVTRSRINQAQALRVDGFYRRSLDILNEVS
                     QQLISQPDSLVKVTALRSLGNVLQQLGELESSQTNLQQSLEIAQRLQLPLEISLTEFS
                     LGNTARSLSDIKNATAHYENAAKIAPNPLAKVQALINQLSLLVENERITEAKSLIPTI
                     QSQVPNLPTNQAGIYARINFAQTWATIGNKKDIAEILGSSVQQAKIIGDERAESYALG
                     SLGEVYEQNQQLQEAQDLTQQALFMAEKIDASDIAYRLEWQLGRLLKAQGNIPAAISA
                     YDSAVTTLQSLRSDLVGVNREVQFNFRDRIEPLYRQSVELILQEKGKGKPDLDKARQR
                     IEALQIAELDNFFREACLSNQFVVIDKVVDRDNTNTAIFYPIILDNYLEIIIKLPKQP
                     LIHKTSQVNRQQVEQVITKIRETIVEPDAHRQFQAVSQQLYNWLIKPVETDLKNSKVN
                     TLVFIPDGLLRNIPMSALYDGREYLVQKYSVVISPGLQLFTPKPLGHKKLNALAGGLS
                     QSPKKENFAALPNVLDELKFIQESGVSTTILLDKNFTSTTLAKTINARAFKVVHLATH
                     GQFSSKAKDTFILADDGRINVSELDSLLKSREQKLTEPVELLVLSACETAAGDNRAAL
                     GLAGVALRAGARSTLASLWQIGDNSTALFIGEFYRLLMTGKTTAEALRFAQLKLLEAP
                     EYNRPMYWAPYVLVGNWL"
     gene            complement(256873..257190)
                     /locus_tag="COO91_00263"
                     /note="Nfsy_R00263"
     CDS             complement(256873..257190)
                     /locus_tag="COO91_00263"
                     /codon_start=1
                     /transl_table=11
                     /product="Large exoprotein involved in heme utilization or
                     adhesion"
                     /protein_id="AUB34443.1"
                     /translation="MSPTEPLQDSSTVSAWVRLRPKSENLANTTTQPQLTAVSTTPHN
                     VATTTLIMEASGWVIDRNGNIELVAQVPQLNPHSPWQTPASCPVSQGGVKYGKTSEAK
                     ASS"
     gene            257180..257296
                     /locus_tag="COO91_00264"
                     /note="Nfsy_F00264"
     CDS             257180..257296
                     /locus_tag="COO91_00264"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34444.1"
                     /translation="MGLMGSPPRPVTTNVFWNCGVPGVQAVEICLVQAGKNN"
     gene            257300..257503
                     /locus_tag="COO91_00265"
                     /note="Nfsy_F00265"
     CDS             257300..257503
                     /locus_tag="COO91_00265"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34445.1"
                     /translation="MLEVVSSTDKLKESKQKGEGRNASTSCDRHQINRTTKTVVRTNN
                     SRPYKSVSVSAKGTAKDSGQLGE"
     gene            257861..258613
                     /locus_tag="COO91_00266"
                     /note="Nfsy_F00266"
     CDS             257861..258613
                     /locus_tag="COO91_00266"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34446.1"
                     /translation="MLQPHRSRYWLNANPPDPKVFKQEVQQVCHLYQKAEELKLESVH
                     VVSTDEMTGIQALERAYPTQEMELGKIEYQEFEYIRHGTLSLIASWGVAEGLVLNASV
                     KETRNEDDFANHIAQIIATNPNDGWIFVTDQLNTHKSESLVRQVATNCGIDIDLGIKG
                     KSGILHSMESRAAFLTDTSHRIRFVYTPKHSSWLNQIECWFSILVRRLLRRGNFISTH
                     DLKQQILNFIDYFNCTLAKPFVWKFLGYPDSA"
     gene            complement(258623..263005)
                     /locus_tag="COO91_00267"
                     /note="Nfsy_R00267"
     CDS             complement(258623..263005)
                     /locus_tag="COO91_00267"
                     /codon_start=1
                     /transl_table=11
                     /product="Large exoprotein involved in heme utilization or
                     adhesion"
                     /protein_id="AUB34447.1"
                     /translation="MSFRAMRLDWLQGLGIAIASAIALYANISVAQIIPDGTLPNNSN
                     VTLENNTFKITGGSQARGNLFHSFKDFSVSTGSEAFFNNAADIQNIISRVTGKSISNI
                     DGLIRANGTANLFLINPNGIIFGQNARLNIGGSFFATSANSMKFADGFEFSAKKPQST
                     PLLTINVPIGLQFGSNTGGVLVRGSSLQVNPGRSLTLVGGNVSMDGGKLVAPSGRVEL
                     GGVTGENTVGLFPNRDFLGLNFPQGVPQADVSLTNQAEVNVLASSGGSIAINAANLNI
                     SEGSQLITGISDVGLSKTPAGDIKINATGIVAIADSSNISNQVLENAVGNSGNININA
                     DSLSLSNNSFLAASTNGQGNAGNVTINTNSLSVFESSFLAASANGEGDAGNITINARD
                     TVSFNKESHAYTDVTVKGNGGDIKITTGSLFVTDDSFLASSTKGDGNSGNIIINARDA
                     ISLDRSWAYTDVGENGNGQAGNFNIASDSLSLTNGSQLDASTKNDGNAGNITIDTGLL
                     SVSDNSFLAASANGQQGNAGNITIDARDRILFDRAGQVYTNVTGTGKGGDLNITTGSL
                     SVVEGSYLAASANGQQGNAGNITINARDTVSFAKGSQAYTDVTVKGNGGDIKITTGSL
                     FVTDDSFLASSTRGEGNSGNITINARGAISFDKGSAYTDVKENGNGQAGNFNITSDSL
                     SLTNSARLIASTKNEGNAGNITINTGVFSVTNESFLAASANGQQGNAGNITINARDRV
                     LFDLGSQAYTNVTTKGKGGDISISTGLLTVTNSSKLNASTSGVGDAGNITFSTGSFSV
                     TNDSQVTASTSGVGNAGNITINTNSLFATNESFLAASANGRGNAGNITINARDHISFD
                     YGAKVYTDVNQLPFGDTTEAEGNGGDIKITSESLSLTNGAQLISNTQGEGNAGSIIID
                     TGILSVTSKSFLAASANGQNGDAGNITINAGARVLFDQGSAFSNVGICSLIAVGCTLT
                     NNTIKGNGGNIRITAPSLQLINGSFLATGVGDDNNLEKKVEGNAGGISIYLRDGLSLD
                     KSFIATTLFANGKGEAGDIDIQAGFISSYQSLISASTQGQGNAGGVSVQTKGAISLAD
                     SDISTAVQKGATGDAQGINITARSLLLTDGAQLNTVTSGEGKAGNILINTTDKVNVSG
                     TNTTVAPTDLFQNNIPPRFNSPPQFVDAVSSGIFSSTNSSGVGGNITVNTNTFSISKS
                     AVVDARTTASGTGGAININTNTIDAISGGQLTAITSGSGRAGSITLNATDSATITDSD
                     LTYSARLAQFGADNIDIYGKPKVGNQGAASRLTVSSVGSGSAGDLTVQANSIRLDNSA
                     KISADTTGGGGDIFLNSPLLLLRRGSSITTNASGNEITGGNITIDNKNGFIIAVPNEN
                     SDIRADSANFRGGNVTIKNIAGIFGIQSRNKPSPNTNDITATGATPNLSGNVQINTPD
                     VNPSNGLVELPTNLVDASSACRQK"
     gene            263218..263628
                     /locus_tag="COO91_00268"
                     /note="Nfsy_F00268"
     CDS             263218..263628
                     /locus_tag="COO91_00268"
                     /codon_start=1
                     /transl_table=11
                     /product="Gamma-crystallin-related"
                     /protein_id="AUB34448.1"
                     /translation="MSNINNHGVDMNKKTLAELSFSAVKELNDEVAATCSGGVFYKNS
                     SDPDVIFFRDINFGGDRLGLNASTGDGDPNIGIENGGVNGFNDQASSIQILRGSWNFF
                     TDSNFRGQSTGILGPGNYNLGANNDAITSAFRVV"
     gene            complement(264776..264892)
                     /locus_tag="COO91_00269"
                     /note="Nfsy_R00269"
     CDS             complement(264776..264892)
                     /locus_tag="COO91_00269"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34449.1"
                     /translation="MNTAMTASKIHNFRQFCYLDKMPIKVVVNLTLRYTRER"
     gene            267562..267711
                     /locus_tag="COO91_00270"
                     /note="Nfsy_F00270"
     CDS             267562..267711
                     /locus_tag="COO91_00270"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA:NAD 2'-phosphotransferase"
                     /protein_id="AUB34450.1"
                     /translation="MYTVAQRARRGSCTRANASKLYLLTTEVKNQRKISISRLIYFHR
                     FKAIA"
     gene            267875..268012
                     /locus_tag="COO91_00271"
                     /note="Nfsy_F00271"
     CDS             267875..268012
                     /locus_tag="COO91_00271"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34451.1"
                     /translation="MSLCTRENINKLALLDQVNTIMSLLPIKNQEGLINQRLPSVPAQ
                     I"
     gene            268030..268233
                     /locus_tag="COO91_00272"
                     /note="Nfsy_F00272"
     CDS             268030..268233
                     /locus_tag="COO91_00272"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34452.1"
                     /translation="MSNINKHGVSRWSLKNTTKLRNLNRLKADIKSVSGALYKFTQFG
                     LIVRTYLSEVVRYYKISFCAFVV"
     gene            269551..271743
                     /locus_tag="COO91_00273"
                     /note="Nfsy_F00273"
     CDS             269551..271743
                     /locus_tag="COO91_00273"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type bacteriocin/lantibiotic exporters,
                     containing an N-terminal double-glycine peptidase domain"
                     /protein_id="AUB34453.1"
                     /translation="MKYHSVLQHSEEDCGAASLATVAKHYGRTFALNRVREAVGTGSR
                     GTTLLGLRRGAETLGFHARQVQATAQLLEKLNEVPLPAIIHWKGYHWVVFYGLKGKKC
                     IISDPAVGIRYITLKELMAGWSDGVMLLLMPDDNRFYEQSEDKIGGFGRFIARILPYR
                     NLLIQAIAINFAIGLLSLASPLMMQLLTDDVLVRGDTQLLTTVAIGVIAMNLIQSAIG
                     LVQSHLIGHFGQRLQYGLILEYGRKLLRLPLSYFEARRSGEVVSRIADVHTINNLVSQ
                     IVLGLPSQFFVALVSFGFMLFYSWELTLASLAAFVIVTLVNLLFLPALRQKTRSLIVK
                     GTENQGFLVETFHGVQVLKTTQATEQAWQEYQTNFGRLANLGWNTMKLGLYSSTVTGI
                     LSNLTSIGILWFGSSLVINQTLSIGQLLAYSGMSGSFLGFLGSVVGLIDEFITAQIVV
                     QRLTEVIDATPEDENDFKKPWAEISGNADITCSQVNFHHAGRTDLLENFSLTIPGGKV
                     IALIGQSGCGKSSLGKLITGLYEVQSGNIRYGLYNQQDLSLECLRQQVVLVPQEPHFW
                     SRSIVDNFRFSYPNISFEEIVKACQIAGADEFISKLPDKYQTVLGEFGANISGGQRQR
                     LAIARAIVTEPPILILDESTGALDPVSESQLLDRLLASRQSKTTIMISHRPQVIKRAD
                     WIVLLENGRLKIQGTPEELRQIPGEHLSFIDEIPFSKNGFKSSLVIRN"
     gene            271782..273284
                     /locus_tag="COO91_00274"
                     /note="Nfsy_F00274"
     CDS             271782..273284
                     /locus_tag="COO91_00274"
                     /codon_start=1
                     /transl_table=11
                     /product="Multidrug efflux pump subunit AcrA"
                     /protein_id="AUB34454.1"
                     /translation="MVSNSQKNFLPLVQDNEFLPPISRWTTFGGLFILFALSLAVPVA
                     AVVKYKVAVKGQAVVRPAGELRIVQAATEGQVMQIYVKENQTLQKGDTIATIDDSRLQ
                     TKKNQLQTNIQQATLQLVQTVAQINAIDSQIRAESDRTNRTIASAKAELIGRDRSHQD
                     KKSTTIAELQEAEANVKMAQEELYVGQAQLQSALANLHATEAALGAATSKQNRYESAA
                     KQGALSRDQLEEVQLAVKQQEQAVQAQKATYKAQEKTNERLKQAVLGAIARRSRAQAA
                     LNPSNAEVAMATERIAQEKASGEVNKATLERERQTLIKQKIETQKQLERDTSEFKQVE
                     TDLKQTTITATADGIISKLNLRNPGQTLRAGEEVVQIVPSHAPLVIKAAVGSEEKGKI
                     KVGQKVQMRVTACPYPDYGTLKGEVKAIAPDAVSSQKNDANSDTNSIPRATAVGAFYE
                     VVIEPENLALGRTAKKCQIQLGMDGRIDIITREETVLQFVLRKARLITDL"
     gene            complement(273757..274669)
                     /locus_tag="COO91_00275"
                     /note="pseudogene"
     gene            complement(274854..275342)
                     /locus_tag="COO91_00278"
                     /note="Nfsy_R00278"
     CDS             complement(274854..275342)
                     /locus_tag="COO91_00278"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase specialized sigma
                     subunit"
                     /protein_id="AUB34455.1"
                     /translation="MNYSQKVANSENFWALYWYKHWQEESHSFARMHLSAYLQEPERQ
                     VWEAVANLYNRERQNQLTQPTPECTKEKIEQWLTQAAIYVRAYLYPPVNSLNLVISED
                     DATITFDLPDLSSDSLIAEMIAAEDVQNQQKQQSQIQTILLKALQKLDIKTQEILNWS
                     LD"
     gene            complement(275789..277741)
                     /locus_tag="COO91_00279"
                     /note="Nfsy_R00279"
     CDS             complement(275789..277741)
                     /locus_tag="COO91_00279"
                     /codon_start=1
                     /transl_table=11
                     /product="Serine/threonine protein kinase"
                     /protein_id="AUB34456.1"
                     /translation="MSLLRNRFRVIRVLSDEGGFGRTYLSEDVDKLNERCVIKQLAPK
                     FQGTWSQKKAMELFAEEAQRLQDLGEHPQIPTLLAYFEQDGCLYLVQQFINGENLLKE
                     FQQRKPYNAREIQSILLDLLPILKFIHDRKVIHRDIKPENIIRNKSDGRLSLIDFGSS
                     KQFTAKVQQKSGTSIGSHGYSPLEQIRDGKAFPASDLFGLGTTCFHLLTGNSPFQLWM
                     ESGYAWVNNWREYLRSPLNPELDFVIDKLLKKDIHERYQSADEVLRDLSPKQLLALPP
                     AGKSSGKIPPTKAPDLPKSYPLVRILILVSALILLFGFQESWYRHFRRIQTSLVSRLT
                     QHNNSGKDEAFLSQPLKITLGKVSLANTLQGHENSVLSVAISPDGKTIVSSGGDRTIK
                     LWNFATGKQISSLNAYSQQVNVVAISPDGKTLVSGSDDNTIKIWNLATRKQIRTLTGH
                     SDSVHALAISADSETLVSGSDDNTIKIWDLATGEQIRTLVGHTFWVRSLAISPNGVIL
                     ASGSFDKTIKIWNLTKGYSIRTLEGNYQTVTAVAISPDGKTLASGSRDRTIKLWNLTT
                     GKEIRTLAGHANTVTSVAFSTDGKIVASGSRDRTIKLWNSATGEEILTLRGHTNTVTS
                     VTFSPDGKTLVSGSEDNTIKVWQLSQ"
     gene            complement(278251..279303)
                     /locus_tag="COO91_00280"
                     /note="Nfsy_R00280"
     CDS             complement(278251..279303)
                     /locus_tag="COO91_00280"
                     /codon_start=1
                     /transl_table=11
                     /product="Serine/threonine protein kinase"
                     /protein_id="AUB34457.1"
                     /translation="MDRFSQKITNSQESISQQTQLGQMCGSKKLFRDRYEILQILGRG
                     GFGITFLAKNAVLPGNPLCVIKQLCPKVTNPQSWQRACTRFEKEARTLGQLGSHSQIP
                     MLLDYFQANGEFFLIQEYVPGLTLAREVRQTGAKSEASVKQFLQELLPVLQYLHKHRV
                     IHRDIKPQNLLRCEYDRRIVLIDFGAVKEQLADACENSRNQVANTNFIGTRGFAPPEQ
                     FSLRPVYASDIYALGITCIFMLTAKSPLEFDYDENTGEICWRKEVIISNSFAQILGKM
                     VKISLTDRFKTADEVMKALGNDSYLPTLADCLTTQKLNSKSIAQHGNSYETPDVYLPP
                     VARTASAIRKWRARPK"
     gene            complement(279669..281291)
                     /locus_tag="COO91_00281"
                     /note="Nfsy_R00281"
     CDS             complement(279669..281291)
                     /locus_tag="COO91_00281"
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane protein assembly factor BamB,
                     containings PQQ-like beta-propeller repeat"
                     /protein_id="AUB34458.1"
                     /translation="MIKTYSSYKQTLGIVTVALVLIMPTISSSAKESHSQSDNQWSLG
                     GQNLNNTRYQAGERYLNPKNVRQLSPKWVFSAGGELSATPAVVDKTVYMPDWGGNFFK
                     IDAQTGTQIWANSIASYINDPSIPKAVSRTSPALKGNKVIIGSQEGAFLIAVNKDTGK
                     LIWKTKLDKHPYAIITQSPTIYGNRVYVGVSSSEETAANQPNYPCCTFRGSMTAVDLN
                     TGKLLWKTYTVPENYGESDGYSGGAVWGSTPAIDPKRNLVYIATGNNYNVPKTVKNCI
                     TKLSSQKAPDESQCLDRNNYIDAIVALDLNTGTIKWANKLQGYDTWTLACFYGGISNC
                     PDPKGPDYDFAQAPMLFTVKDAGKSRDLLGAGQKSGVFWALDRDTGKVVWSRIVGPGG
                     AAGGIMWGSATDGQQIYVAISNYGFEKYTLDPSGETINGGSWSALDAATGKIIWQTAD
                     PTGERDMAPMTVANGVVYAGSMASVADKNNMYALDAKAGKILWNFNSGGSVIAGAAVV
                     DGTVYWGSGYSRIPGGFKSNNKFYAFTVLEHR"
     gene            282296..282460
                     /locus_tag="COO91_00282"
                     /note="Nfsy_F00282"
     CDS             282296..282460
                     /locus_tag="COO91_00282"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34459.1"
                     /translation="MRLVLLSLITNAIDHYCSIALVMRQYGSVKEIYLLRQAGGAGDA
                     GEAGGEKRLN"
     gene            complement(282595..284712)
                     /locus_tag="COO91_00283"
                     /note="Nfsy_R00283"
     CDS             complement(282595..284712)
                     /locus_tag="COO91_00283"
                     /codon_start=1
                     /transl_table=11
                     /product="Alpha-amylase/alpha-mannosidase, GH57 family"
                     /protein_id="AUB34460.1"
                     /translation="MHGTKDYLDLVLLLERYPKLHQTVNLVPSLILQLEDYIAGTAFD
                     PYLTASLTPDEQLTQQQREFIIQHFFDANHHTLIDPHPRYAELYQQRQEKGQAWCLAN
                     WELPDYGDLLAWHNLAWIDPLFWDDPEIATWLKQGRNFTLSDRQRIYSKQREILSRII
                     PQHRKMQEAGQLEVTTTPYTHPILPLLADTNSGRVAVPNMTLPKQRFQWAEDIPRHLR
                     KAWNFYKDRFGQIPRGLWPSEQSVSPAILPDIINQGFKWICSDEAVLGWTLKHFFHRD
                     GAGNVQQPELLYRPYRLQTAEGDLSIVFRDHRLSDLIGFTYSAMPAKKAAADLVGHLQ
                     AIAKMQRESQSEEPWLVTIALDGENCWEFYPQDGKPFLEALYQSLSDEPHLKLVTVSE
                     FLEEFPATATIPGGQLHSGSWVDGSFTTWIGDPAKNRAWDYLTEAREMLASHPEATEE
                     NNPEAWEALYAAEGSDWFWWFGAGHSSNQDAIFDQLFREHLFGIYKALNEAVPPYLKQ
                     PVEIHQAQGNHAPQGFIHPVIDGRGDEQDWDKAGRIEIGGARGTMHNSSVIQRLWYGV
                     DHLNFYLRLDFKSGSAPGQDLPTELNLLWFYPEKTMVNSPIPLADVPDAAPLNYHFHH
                     LLEVNLLTQSIQFREAGDNYQWHPRFNRAQVALNNCLELAVPWADLQVPPDYPLRLIL
                     VLADEGRFCNYLPENALISIEVP"
     gene            complement(284908..285138)
                     /locus_tag="COO91_00284"
                     /note="Nfsy_R00284"
     CDS             complement(284908..285138)
                     /locus_tag="COO91_00284"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S cluster biogenesis protein NfuA,
                     4Fe-4S-binding domain"
                     /protein_id="AUB34461.1"
                     /translation="MELTIDNVETVLDEMRPYLMSDGGNVELVELEGPIVKLRLQGAC
                     GSCPSSAMTLRMGIERRLKEMIPEIAEIEQVV"
     gene            complement(285699..287462)
                     /locus_tag="COO91_00285"
                     /note="Nfsy_R00285"
     CDS             complement(285699..287462)
                     /locus_tag="COO91_00285"
                     /codon_start=1
                     /transl_table=11
                     /product="K+-sensing histidine kinase KdpD"
                     /protein_id="AUB34462.1"
                     /translation="MTITANSQLSNVFSQNLEPITSKTDGSLATLGAELVYTQDQAGR
                     YLTFSWQHSELLGLNTEKIVDELNQSQTFAPVDKVTYLERLHQILTSLVPERFQCWFS
                     YQQELFELDLVISPIMPSLGTTATTVLVMGRLVQATFNKKQVPVAAKTPTQIEVAIRS
                     QQHQKVVNRITRNIRRTLDLDIIWQQTVDSLGKALRLERCIICPYQPSSSKVEVKAEY
                     HQAALKSMLGLQIDIASEPAFAQALATLEPVVMQVPGYAQSGQQKTLVIATCYQDQAN
                     GLVALSWQDECYTLTESELELAKEAADQLGTAIAHATLYEELEVARQKAEEASRLKSE
                     FLANVSHEIRTPLNGMIGFLKLILEGMADDPEEQNQFLLEAHQLSIHLLNIINDILDI
                     AKIEAGKMELAYAPVKLDELFSDVENFMRPQAEMRNLSFQMQMPPTSDEIIVQSNYQR
                     LLQVMLNLVGNAIKFTHEGGVTVSADLVLKKANFQDQQFPGMVKVRVADTGIGVSLDK
                     QDKLFQLFSQVDGSRTRHYGGTGLGLAISQKLVEAMGGEVHFYSLGEGLGSTVTFTVP
                     LYQQPVMVSSNDGDSTNSAEC"
     gene            complement(287634..287864)
                     /locus_tag="COO91_00286"
                     /note="Nfsy_R00286"
     CDS             complement(287634..287864)
                     /locus_tag="COO91_00286"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34463.1"
                     /translation="MQEKTTEAENTPTDKVEISVRLDSKLLEQIQHLTNDPSKVIEVA
                     IRQWLRGEILRDDELTRTPVRTPVPPRGEWND"
     gene            288444..290255
                     /locus_tag="COO91_00287"
                     /note="Nfsy_F00287"
     CDS             288444..290255
                     /locus_tag="COO91_00287"
                     /codon_start=1
                     /transl_table=11
                     /product="lepA, GTP-binding protein LepA"
                     /protein_id="AUB34464.1"
                     /translation="MTDVPAVRIRNFCIIAHIDHGKSTLADRLLQATGTVEDRQMKEQ
                     FLDNMDLERERGITIKLQAARMNYTAKDGQQYVLNLIDTPGHVDFSYEVSRSLVACEG
                     ALLVVDASQGVEAQTLANVYLALESNLEIIPVLNKIDLPGAEPERVIGEIEEIIGLDC
                     SGAILASAKEGIGIDEILEAVVERIPPPPNTINERLRALIFDSYYDSYRGVIVYFRVM
                     DGTVKKGDRIHLMASGKEFEIDELGVLSPTQKQVDELHAGEVGYLGAAIKAVADARVG
                     DTITLSKAKAESPLPGYAEANPMVFCGMFPIDADQFEDLREALEKLELNDAALHYEPE
                     TSSAMGFGFRCGFLGLLHMEIVQERLEREYNLDLIITAPSVVYKVITLKGEELYIDNP
                     SRLPSPNDREKIEEPYVQVEMITPETYVGSLMELSQNRRGIFKDMKYLTQGRTTLTYE
                     LPLAEVVTDFFDQMKSRSRGYASMEYHIIGYRENPLVKLDIMINGDPVDSLAMIVHRD
                     KAYNVGRAMAEKLKELIPRHQFKVPIQASIGSKVIASEHIPALRKDVLAKCYGGDISR
                     KKKLLQKQAKGKKRMKSVGTVDVPQEAFMAVLRLDQN"
     gene            complement(290785..290976)
                     /locus_tag="COO91_00288"
                     /note="Nfsy_R00288"
     CDS             complement(290785..290976)
                     /locus_tag="COO91_00288"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34465.1"
                     /translation="MAETPNSVPVSSSARFPDTLQISKKLHFPKNTRVANVVSMFTKI
                     LRFFNSYFVKAYQRLSTVG"
     gene            291012..292127
                     /locus_tag="COO91_00289"
                     /note="Nfsy_F00289"
     CDS             291012..292127
                     /locus_tag="COO91_00289"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycogen synthase"
                     /protein_id="AUB34466.1"
                     /translation="MYPELVKLGHEVHLITAEFGHASMYEVVEGVKVHRVPVAHSNDF
                     FHWVANLNLSMGDHGGKLILEEGPFDLIHAHDWLVGDAAIALKHNFKIPLIATIHATE
                     YGRYNGIHTDIQGYINAKETLLAYNAWRIIVCSNYMRQEVERALHSPWDKIDVIYNGI
                     RAEKKQHNVDFHALNFRRQFATDDEQIVYYLGRMTYEKGVPILLNAAPKILSQMRGNV
                     KFVIVGGGNTDHLKRQAWDLGIWHHCYFTGFLSDQYLDRFQTVADCAVFPSLYEPFGI
                     VALESFASRVPVVVSDTGGFPEVVQHTKTGIVTWVNNPDSLAWGILEVLKNPGYRQWL
                     VDNAYEDLKRRFSWPKLAKQTEEVYQRVVQERSQIAW"
     gene            292434..293240
                     /locus_tag="COO91_00290"
                     /note="Nfsy_F00290"
     CDS             292434..293240
                     /locus_tag="COO91_00290"
                     /codon_start=1
                     /transl_table=11
                     /product="Pullulanase/glycogen debranching enzyme"
                     /protein_id="AUB34467.1"
                     /translation="MIQCAEQLEGPKEILEQTYTNSTWQNETLGAAKSVASGNKGDLA
                     NLGFKLGLDGYPSEITNNGDKIAKTALQYIENHDHSRFVCNFGAIARDNDLLQEGNRN
                     LWYKVQPYLIGFFTGKGIPLLWQGQELGENYFLPEQGYGKVMLIRPVRWDYFYDPIGK
                     SVLALVRKLIKLRRQQPQFTEGEHFFYNDYDRYHSKNVLLFSRKHGNKFSLVALNFSD
                     RDQSVPFWFPIAGNYQEELNGENNLIDVPSYSEYWLTIPSNYGRIWTTST"
     gene            293837..294901
                     /locus_tag="COO91_00291"
                     /note="Nfsy_F00291"
     CDS             293837..294901
                     /locus_tag="COO91_00291"
                     /codon_start=1
                     /transl_table=11
                     /product="Cyanophycinase and related exopeptidases"
                     /protein_id="AUB34468.1"
                     /translation="MTKAFPSIARRLKSTGIKLLKMGTFLITRFIASWKRYFLGDTVD
                     VRPSPSPSPSPSFDNARPSLAGPVLTLGGGGPDVDDAIQWMINQVRGGSNSGTRVNVV
                     VLRTNGNHDYNRLIYAMKGVNSVETLLIRNREEANKAEIYEKVRNADVIFFAGGDQCQ
                     YIRNWKDTKLEAAVKSVYLKGGGIGGTSAGAMIQSDCVYDACASSEKGIETRDALDDP
                     YRDITFTYNFFNWSNLKGTIVDTHFDRRQRMGRIMAFIARQIKDGVSNSVLGIAVSES
                     TSVLVDKNGLVKVMGRGDAYFVLGNHIPEVCEPRKPLTFSNYKIWKVRSGDTFNLRNR
                     PTSGYYLRSVKRGRIDSNPY"
     gene            complement(294867..295442)
                     /locus_tag="COO91_00292"
                     /note="Nfsy_R00292"
     CDS             complement(294867..295442)
                     /locus_tag="COO91_00292"
                     /codon_start=1
                     /transl_table=11
                     /product="Chromosome segregation ATPase"
                     /protein_id="AUB34469.1"
                     /translation="MLSPEIGIIYFLEFPKGAWGIEQELDNWVHPPFISVNESLNWMN
                     PPFISVNESLNWMNPPFISVNEALNWMNPPFISVNESLNWMNPPFISVNESLNWMNPP
                     FISVNESLNWMNPPFISVNESLNWMNPPFISVNEALNWMNPPFISVNEALNWMNPPFI
                     SVHRACLLLLFSPLPTPHSPFNMDLNQSVPF"
     gene            complement(295487..296227)
                     /locus_tag="COO91_00293"
                     /note="Nfsy_R00293"
     CDS             complement(295487..296227)
                     /locus_tag="COO91_00293"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34470.1"
                     /translation="MSEDLKGKVALITGANKGIGYEIARQLGSRGATVLVAARDIKRG
                     EEAANKLGLNEIDARSVQLDVTDQKTIDSAAKQIESEFGKLDILVNNAGIVSDGDRLP
                     PSQVDIETLRHTYETNVFGVFAVTKAMLPLLKKSTAGRIVNLSSGLGSLTQNSDPNYE
                     FADFKLLAYNSSKTAVNALTVLLAAELKDTPIKINAADPGFTATDINQYQGYRTVEQG
                     AIAAVRLATLPDDGSSGGFFDEDGVVPW"
     gene            complement(297419..298627)
                     /locus_tag="COO91_00294"
                     /note="Nfsy_R00294"
     CDS             complement(297419..298627)
                     /locus_tag="COO91_00294"
                     /codon_start=1
                     /transl_table=11
                     /product="iscS, cysteine desulfurase"
                     /protein_id="AUB34471.1"
                     /translation="MSIRPIYLDCHATTAVDERVLAAMLPYFTEKFGNPSSIGHVYGW
                     EAEAAVKQTREILAAAINATPEEIVFTSGATEANNLAIKGVAEAYFKKGQHIITVATE
                     HNAVIDPCNYLKTLGFEITILPAKKDGVIDLNELNKAFRPETILISVMAANNEIGVLQ
                     PLAEIGELCHAYNIIFHTDAAQAIGKIPLDVQAMKIDLMSLTAHKVYGPKGIGALYVR
                     RRNPRVQLAPQQHGGGHERGMRSGTLYTPQIVGFGKAVEIALAEQATENQRLTQLRQS
                     LWSQLSQLEGIHLNGHPQQRLAGNLNISVEGVDGAALLLGLQPVMAISSGSACSSAST
                     APSHVLTALGNSQQLAYASVRFGIGRFNTQEEIDIVAKHAIATIQSLRKTSFMDSRAR
                     KYQSDLAPAD"
     gene            complement(298633..299259)
                     /locus_tag="COO91_00295"
                     /note="Nfsy_R00295"
     CDS             complement(298633..299259)
                     /locus_tag="COO91_00295"
                     /codon_start=1
                     /transl_table=11
                     /product="putative type IV restriction endonuclease"
                     /protein_id="AUB34472.1"
                     /translation="MVQFIQAQNVGLAYLEEKFSLQLAEDEAFFREWFENLPEITDLE
                     KQDLDRIKLHFLRLVKRPPLSEETVKLVVLSPLLNLAGFYDEPFYMRGEESIRISAED
                     EGEIIRGRIDILVIQEQFWLLVIESKRSSFSLLEAVPQALVYMLANPNQDKPTFGLVT
                     NGSHFIFVKLTKQNIPKYALSDEFTLLRRKNELYQVLSVLKNLSQSLS"
     gene            complement(299335..299991)
                     /locus_tag="COO91_00296"
                     /note="Nfsy_R00296"
     CDS             complement(299335..299991)
                     /locus_tag="COO91_00296"
                     /codon_start=1
                     /transl_table=11
                     /product="putative type IV restriction endonuclease"
                     /protein_id="AUB34473.1"
                     /translation="MIQVIQAQNVTLAYLKEKFALYKSEDEQFFTEWFDYIPKISELE
                     KQSLDRVKNNYLNVLENAPLFEEAVKLVVLSPLLDLADFYRHPFYITTEESVEISEEV
                     LIENEVNTEYTKEIIKGKIDVLVLQNQLWLLIIESKRSSFSLAKAIPQALTYMLANPH
                     PENPAYSLVMNGEDFQFIKLIKQDQPTYDLSDRFTLYRRENELYKVLNILKKIGQIVS
                     "
     gene            complement(300101..300580)
                     /locus_tag="COO91_00297"
                     /note="Nfsy_R00297"
     CDS             complement(300101..300580)
                     /locus_tag="COO91_00297"
                     /codon_start=1
                     /transl_table=11
                     /product="BCP, peroxiredoxin Q/BCP"
                     /protein_id="AUB34474.1"
                     /translation="MTNIPQVGQPAPNFSTPDQNGNLVTLDDLSSQWVVLYFYPKDDT
                     SGCTTEAKDFTELYQDFSALGTKILGVSPDLGKSHCKFISKHNLSITLLSDPEHILTE
                     AYGAWRLKKFMGKEYMGVVRSTFLISPDRIIVYAWPNVKTKGHAMAVLTKLRELAAT"
     gene            complement(300735..301760)
                     /locus_tag="COO91_00298"
                     /note="Nfsy_R00298"
     CDS             complement(300735..301760)
                     /locus_tag="COO91_00298"
                     /codon_start=1
                     /transl_table=11
                     /product="Serine/threonine protein kinase"
                     /protein_id="AUB34475.1"
                     /translation="MWRDSALQISKQVAGLIDYLMEAFPGKRPQNAQMILRCLSEINS
                     TVQAYSTGSSASQLPPTEIEKPKQSKQLKTSVTTQIESSKTQINIFSNKTAQSTGTAI
                     GFAILILIKFGSLVIHKTFQSHPSQRRVTSTPTELQASNSEELANNSEQLNTDSTRQK
                     PSISEENIPSGVPSGWKKFEGGGAQLWLPPSWEGGDLSEKLDELRTSLGSHNPDLENF
                     AQIVKQNPSAFSIWAFDTNTANSTSLGSIVMIINERIYPGTNFNNLLNESGENGFILL
                     DKKIYKIEGYYVGRIIQLGKNSREVKYIIKDSGTLWTILYSGRKHEFEQNLSIFEASI
                     KTFLFKR"
     gene            302021..302863
                     /locus_tag="COO91_00299"
                     /note="Nfsy_F00299"
     CDS             302021..302863
                     /locus_tag="COO91_00299"
                     /codon_start=1
                     /transl_table=11
                     /product="phrB, deoxyribodipyrimidine photo-lyase"
                     /protein_id="AUB34476.1"
                     /translation="MQREFTNRDELVAYLREQFPDAAQRDDHISETVGGRKAAQKALQ
                     QIDPVSYAQTRNFFAGAVTRLSPYIRYGVLSLREIRDYVLERVQHQNDATKLINELGW
                     RDYWQRLYVNLGDEIWKDQEEYKTGYTMAEYAPELPQDIRQATTGRVCIDSFSRDLKE
                     TGYLHNHARMWLAAYIVHWLRIRWQAGAKWFLEHLLDGDPASNNMSWQWVASTFSQKP
                     YFFNRENLERYTKGIYCQKCPLYGHCDFEGSYEELEQRLFPKGEFSKQANSQSWQRGK
                     KGKK"
     gene            302882..303340
                     /locus_tag="COO91_00300"
                     /note="Nfsy_F00300"
     CDS             302882..303340
                     /locus_tag="COO91_00300"
                     /codon_start=1
                     /transl_table=11
                     /product="Deoxyribodipyrimidine photolyase"
                     /protein_id="AUB34477.1"
                     /translation="MNKPIVWIHGDCLSPYNPVLQKYPDAPAIWVWDEALIEEWQLSL
                     KRIAFIYECLLELPVVIRRGDMAQEILAFAQEHDANLVVTAKSPSPRFDDICNQMEGS
                     ITVEVLEVEPFFGYDGYIDLKRFSRYWKVAQNYVFRSNLSLSDSEKDSFA"
     gene            303571..305169
                     /locus_tag="COO91_00301"
                     /note="Nfsy_F00301"
     CDS             303571..305169
                     /locus_tag="COO91_00301"
                     /codon_start=1
                     /transl_table=11
                     /product="nirA, ferredoxin-nitrite reductase"
                     /protein_id="AUB34478.1"
                     /translation="MSSRHTHRLLPALHGEGVPNLLSGFATCPGLFYATPAADGILSR
                     IRIPGGIISSQQCRAIADIAEQHGGGYVDVTNRANLQVREIRTGINAEVLKHLQDIGL
                     GSRNPVVDHIRNIMTSPTAGIDPLELIDTRPFVQGWDNYIAAHPALSGLSAKFSVCFD
                     GGGIIRVCDRLNDILFAAVLVDGNVYFRLHLSVGAKGQPPSDMGILLPPEKCLPVLAG
                     LADVYLAHSNTTGKRRLRLLELLNTLGYENYLQEVQQRLPFSLLYSDLTPQPPSLLGK
                     GEEFSTLLQGEEKYRHIGIHPQRQKGLFYIGVVLPLGRLESSQIRGLADLATKYGSGT
                     LRLTPWQNLLLTDIPQQWVGDVLREIAFLGLDSSGTNIKSALVACSGKKGCAASATDT
                     KDHALALAEYLETRVTLDCPVNIHFSGCEKSCAQHSKSDITLLGVSIEGDNGTVEGYH
                     VYVGDSKHKFGRELYQNVTFVELPTLIERMLYVYKIQRLNSDESFGTFANRYAIAQLQ
                     QLFNIIPKSFVNNKIPNFLEKSAI"
     gene            305840..306544
                     /locus_tag="COO91_00302"
                     /note="Nfsy_F00302"
     CDS             305840..306544
                     /locus_tag="COO91_00302"
                     /codon_start=1
                     /transl_table=11
                     /product="cobI-cbiL, precorrin-2/cobalt-factor-2
                     C20-methyltransferase"
                     /protein_id="AUB34479.1"
                     /translation="METKGRLYGIGVGPGDPELLTLKALRLLRAAPVVAYQSAIDKES
                     IARAIVAQYLPGNQIEVLFHLPRALEPEKAKSIYDKEIEPIADHLAAGRDVVVLCEGD
                     PFFYGSFMYLFTRLCDQYETEVVPGVSSLMACPVALGVPFTYYTDILTVLPAPLPAEE
                     LTTHLLMTDAAAIMKLGRHFTKVRDILHKLGLASRARYIERASTSQQRIIPLDEVDPD
                     EVPYFSMIVIPTKNRL"
     gene            complement(306904..307911)
                     /locus_tag="COO91_00303"
                     /note="Nfsy_R00303"
     CDS             complement(306904..307911)
                     /locus_tag="COO91_00303"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase"
                     /protein_id="AUB34480.1"
                     /translation="MQKRKLGNSNLEVSAIGLGCMGMSFSYGPPKDTQEMTALLGAAV
                     DRGITFFDTAEVYGPFLNEELVGEALAPFRDQVVIATKFGFDISPNSDPRGMKGSPGL
                     NSRPEHIKEAVEGSLKRLKVEAIDLLYQHRVDPNVPIEDVAGAVKELIQSGKVKHFGL
                     SEAGVQTIRRAHAVQPITALQSEYSLWWRKPEAEVIPTLEELGIGFVPYSPLGKGFLT
                     GKIDENATFDSSDFRSTLPRFTPEALKANQALINLLGSIAERKQATPAQIAIAWLLAQ
                     KPWIVPIPGTTKLHRLDENIGAVSVELTPDDLRDINDAASKITVQGARYPEKLEQMTG
                     R"
     gene            complement(308061..308810)
                     /locus_tag="COO91_00304"
                     /note="Nfsy_R00304"
     CDS             complement(308061..308810)
                     /locus_tag="COO91_00304"
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent 3-hydroxy acid dehydrogenase
                     YdfG"
                     /protein_id="AUB34481.1"
                     /translation="MIKDKVVIITGASSGIGEATAKLLASKGAKVVLGARREHQLRKL
                     VDEIQIDGGQAVYQVMDVVNPSDNAQIVKLAKETFGGVDVIFLNAGIMPNSPLSALKT
                     DEWNQTVDVNIKGVLNGIAAVLPTFISQKQKSGHVITTSSVAGLKAYPGGAVYGGTKW
                     FVRDFMEVLRMESAQEGTNIRTATIYPAAINTELLDQITDQDVAEKMTQLYEQYGISP
                     DRVANVVAFAIDQPEDTNVNEFTIGPTTQPW"
     gene            complement(308950..309081)
                     /locus_tag="COO91_00305"
                     /note="Nfsy_R00305"
     CDS             complement(308950..309081)
                     /locus_tag="COO91_00305"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34482.1"
                     /translation="MLPNSNGNFTGKVAFVTGAAKSIGRARALAFVQTLTSDMAKTS"
     gene            complement(309105..309611)
                     /locus_tag="COO91_00306"
                     /note="Nfsy_R00306"
     CDS             complement(309105..309611)
                     /locus_tag="COO91_00306"
                     /codon_start=1
                     /transl_table=11
                     /product="Alpha/Beta hydrolase fold"
                     /protein_id="AUB34483.1"
                     /translation="MGAAYRNGLRHSTTLEQRKKAIAEAAEQRYVEFTGGETKYTGGT
                     VHELNENTHPIQREFYDFYRTPRGEYTPKGSSPNLTTHPTLASIVKFGNFYPFNDIET
                     ISPRPMLFITGADAHSREFSEDAYKRAAEPKDLYIVPNAGHVDLYDRVNLIPWDKLAS
                     FFNQHLSR"
     gene            309579..310178
                     /locus_tag="COO91_00307"
                     /note="Nfsy_F00307"
     CDS             309579..310178
                     /locus_tag="COO91_00307"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34484.1"
                     /translation="MPQPITVGCTHVIHADRRNSLHARVDLGGTDNEAAAAANPKNAN
                     PVPVNEWPGAQKIDRSTEILNINIWRNNVAGLPLTLAPKGQIKGQGDESLFSQFLGVQ
                     IRALFFDCTHWVPNDDCGILGALIQGFGNEESPSNLHVVLVFERNFLHSHLVTLIEVV
                     CPLDHSGVLGGCLGYLMRGARFVERNCRRRRADCTNQER"
     gene            complement(310258..311031)
                     /locus_tag="COO91_00308"
                     /note="Nfsy_R00308"
     CDS             complement(310258..311031)
                     /locus_tag="COO91_00308"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34485.1"
                     /translation="MTTNENGKYTGKVAFVTGAANGIGRATALAFAREGANVVVADVS
                     EQGNQETAHMIEELGGRAIAVKCNVTQAEDVKAALSKTIETFGRLDFAFNNAGVEQKN
                     TATAEIEEEEWDRIVDIDLRGVFLCMKYEIPLLLKQGGGAIVNTSSGAGVIGIKGGAA
                     YTAAKHGVIGLTKSAALDYASQNIRVNAVAPGYIDTPMMDRFTGGTAEGRKQVISEEP
                     VGRMGQPEEIANAVVWLCSDAAAFIIGHALVVDGGQTVQ"
     gene            complement(311089..311586)
                     /locus_tag="COO91_00309"
                     /note="Nfsy_R00309"
     CDS             complement(311089..311586)
                     /locus_tag="COO91_00309"
                     /codon_start=1
                     /transl_table=11
                     /product="Cupin domain protein related to quercetin
                     dioxygenase"
                     /protein_id="AUB34486.1"
                     /translation="MKLLATTIISFSLLASALAHAGQTQVTSDNSTRTVEITRKGSQP
                     STRGSTEYFTGSVRIDSLFSARDPSRTAGASVTFEPSARTAWHTHPLGQTLIVTAGSG
                     YVQQWGGQIQEIRPGDVVRIAPGLKHWHGATATTAMTHIAIHEELNGKPVDWLEHVSD
                     EQYPN"
     gene            311620..311736
                     /locus_tag="COO91_00310"
                     /note="Nfsy_F00310"
     CDS             311620..311736
                     /locus_tag="COO91_00310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34487.1"
                     /translation="MGLKPRHKGRLFGTILATGRALSVGLGDVRRAMPAVAV"
     gene            complement(311773..311904)
                     /locus_tag="COO91_00311"
                     /note="Nfsy_R00311"
     CDS             complement(311773..311904)
                     /locus_tag="COO91_00311"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34488.1"
                     /translation="MEEYLSAVEMVFHQGEKLAAENADFGSRPSDIQASPSSLEIVY"
     gene            complement(312087..312392)
                     /locus_tag="COO91_00312"
                     /note="Nfsy_R00312"
     CDS             complement(312087..312392)
                     /locus_tag="COO91_00312"
                     /codon_start=1
                     /transl_table=11
                     /product="Cupin domain protein related to quercetin
                     dioxygenase"
                     /protein_id="AUB34489.1"
                     /translation="MDIKRSGSQPSAKGQADYFTGTVRIDPLFEAHDPARTSGASVTF
                     EPGARTAWHTHPLGQTLLVTAGCGLVQRWGGAIEEIRPGDAIWISPGEKHWHVILLG"
     gene            312602..313582
                     /locus_tag="COO91_00313"
                     /note="Nfsy_F00313"
     CDS             312602..313582
                     /locus_tag="COO91_00313"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC-type DNA-binding domain and AraC-containing
                     proteins"
                     /protein_id="AUB34490.1"
                     /translation="MNAAKTSEKSDIDLMNDPQAKREVDRAQANRDELKELIAQAIRH
                     DGTIEPLKGLHFNRASSPSECVHSVSIPAFCAIAQGSKEVLLGSDRYQYDPMHYLLAT
                     VELPIISQILEASKEQPYLSLRLDLDPTLVGSVMVEAGYPSRSRADVKAIDVSPLNAN
                     LLDAVVRLVRLLDSPAEAHVLAPLIKREIIYRLLMGEQGNRLRHIAVLGGCTYHIALA
                     VERLRKDFNEPIKIESIARELGMSVSGFHHHFKSVTAMSPLQYQKQLRLQEARRLMLG
                     EKLDATSAAYRVGYDDASHFNREYKRLFGAPPMRDVERLREAARETASSI"
     gene            313682..314008
                     /locus_tag="COO91_00314"
                     /note="Nfsy_F00314"
     CDS             313682..314008
                     /locus_tag="COO91_00314"
                     /codon_start=1
                     /transl_table=11
                     /product="arsR, ArsR family transcriptional regulator"
                     /protein_id="AUB34491.1"
                     /translation="MASNSTFTPDTIAAGFHALSDPLRIKVLELLRSQELCVCDLCDH
                     LGTTQSKLSFHLKTLKEAGLVRARQEGRWIYYSLNLPQFVALEQYLAEFRRFSPILPI
                     RPPCEI"
     gene            314149..314307
                     /locus_tag="COO91_00315"
                     /note="Nfsy_F00315"
     CDS             314149..314307
                     /locus_tag="COO91_00315"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34492.1"
                     /translation="MALALGMLALTTSCTAASNTSTQTQQSPSVTQVRDSSKVNQLVH
                     YETLNVAV"
     gene            314313..315380
                     /locus_tag="COO91_00316"
                     /note="Nfsy_F00316"
     CDS             314313..315380
                     /locus_tag="COO91_00316"
                     /codon_start=1
                     /transl_table=11
                     /product="TC.ACR3, arsenite transporter, ACR3 family"
                     /protein_id="AUB34493.1"
                     /translation="MMNKKTSKRLSFIDRFLTLWIFLAMAIGVALGYFFPGVEGFINQ
                     FQVGTTNIPIAIGLILMMYPPLAKVRYEELGDVFRNGKILGVSLIQNWIIGPILMFAL
                     AATFLHGYPEYMTGLILIGLARCIAMVVVWSDLARGNTEYTAGLVAFNSIFQVIFYSP
                     YAWFFITVLPPLFGLQSSVVNVSIAEIAQSVFIYLGIPFLAGFFTRFFLVKVKSKQWY
                     HEEFVPKISPITLIALLFTIVVMFSLKGNLIVQIPLDVVKIAIPLIVYFIIMFLVSFY
                     MAWRVKTDYSRAASVAFTSAGNNFELAIAVAIAVFGINSGVAFAAVVGPLVEVPVLIG
                     LVNVAFWFEKRYFSPSESRTF"
     gene            315412..315825
                     /locus_tag="COO91_00317"
                     /note="Nfsy_F00317"
     CDS             315412..315825
                     /locus_tag="COO91_00317"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein-tyrosine-phosphatase"
                     /protein_id="AUB34494.1"
                     /translation="MKRVMFVCKKNSARSQMAEGFAKTLGKGKIEVISSGLEASQLRP
                     EAIATMKEIGIDITDQHSKPLSDFQAKDFDVVISLCGCGVNLPPQWVVREVFEDWQLD
                     DPAEQPEIFPRVRDEIKERVTQLIESVNKEFTPAR"
     gene            315876..316031
                     /locus_tag="COO91_00318"
                     /note="Nfsy_F00318"
     CDS             315876..316031
                     /locus_tag="COO91_00318"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34495.1"
                     /translation="MEQETIQPISENLWWVIPGKLAGVRKPMAEELTELRATGVGAIA
                     SVMDGKS"
     gene            316095..316781
                     /locus_tag="COO91_00319"
                     /note="Nfsy_F00319"
     CDS             316095..316781
                     /locus_tag="COO91_00319"
                     /codon_start=1
                     /transl_table=11
                     /product="arsH, arsenical resistance protein ArsH"
                     /protein_id="AUB34496.1"
                     /translation="MTTFDYPPRILFLYGSLRERSYSRLLAEEAARIIEEFGAEVKFF
                     DPRELPIYGSVPDSHPKVQELRQLSLWSEGQVWSSPELHGQISGIMKNQIDWIPLSIG
                     AVRPTQGRTLAVMQVSGGSQSFNAVNTLRILGRWMRMFTIPNQSSVAKAYEEFNEDGT
                     MKDSPYRDRVVDVMEELYKFTLLLRDNVDYLTDRYSERKEKAAKQTIMIASQALEVNS
                     NIVPQHTGSP"
     gene            complement(317457..317582)
                     /locus_tag="COO91_00320"
                     /note="Nfsy_R00320"
     CDS             complement(317457..317582)
                     /locus_tag="COO91_00320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34497.1"
                     /translation="MGSVPLSVFALSEAEVSRRSFTRSKKQAREKPTPQTDFSRY"
     gene            complement(318005..318922)
                     /locus_tag="COO91_00321"
                     /note="Nfsy_R00321"
     CDS             complement(318005..318922)
                     /locus_tag="COO91_00321"
                     /codon_start=1
                     /transl_table=11
                     /product="Harbinger transposase-derived nuclease domain"
                     /protein_id="AUB34498.1"
                     /translation="MSDILNHIEENPKRTKRLIGLEYEQLQQLIQNAERLHYDKQELL
                     ESKKVRIIAGGGGRKPKLSLKEQIILTLVYLRHLTTFELLGIQFGVSESTANDTFNYW
                     LPILRELLPSSLIEQVKKNESDLMVVKEILTDYELIVDSYEQVRERPVDNKEQEKYYS
                     GKACKHTFKSQIIILPDAKDIVDVVAGEPGPKSDITMFRENRDNFDPKQKFKGDLGYL
                     GEDLIDTPIKTPRNGKLTIEQKKENKEFSSNRVFVEHRIRSVKIFRVVQERFRLNPKK
                     YEQVILTICGVVRLRIGALILPAEIYAFT"
     gene            319090..319545
                     /locus_tag="COO91_00322"
                     /note="Nfsy_F00322"
     CDS             319090..319545
                     /locus_tag="COO91_00322"
                     /codon_start=1
                     /transl_table=11
                     /product="Ca2+-binding protein, RTX toxin-related"
                     /protein_id="AUB34499.1"
                     /translation="MSGELGADTLTGGQGADTFSFQFGQSLVSGTDRITDFTIGTDAI
                     GLLTSDPLTVTTPSSFTRAADKTATTLLNLANQVFTDANGAVAGNQALGVSGATLVRV
                     TSGANAGTYLAINNSTAGFQANSDLLVNLTGLTGTLPTLGNIAVSSFFV"
     gene            complement(319673..320359)
                     /locus_tag="COO91_00323"
                     /note="Nfsy_R00323"
     CDS             complement(319673..320359)
                     /locus_tag="COO91_00323"
                     /codon_start=1
                     /transl_table=11
                     /product="putative metal-dependent phosphoesterase TrpH,
                     containings PHP domain"
                     /protein_id="AUB34500.1"
                     /translation="MVVNLARTTASTELLKQVFQNIDAQSCPRLFNFHMHTVYSDGRL
                     QPSALMEQAIAIGLKGLAITDHHGIIGYQAALAWLEDWKWNNPGASTPYLWSGVEINA
                     SLLDIEVHILAYAFTPDHPSIKPYLQRRPTTGQEYQASNVIAAIHEAGGLAVLAHPAR
                     YKRSLFDLIPAASEKGIDGVETFYAYNNPNPWKPSVVESEQVQKLADEYFLFNTCGTD
                     THGLSLLQRL"
     gene            complement(320683..320835)
                     /locus_tag="COO91_00324"
                     /note="Nfsy_R00324"
     CDS             complement(320683..320835)
                     /locus_tag="COO91_00324"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34501.1"
                     /translation="MELREEYSDSGAIASFLEAIVDLTYAMPAAGYPTLKSLLVIYSS
                     VITDNN"
     gene            complement(320813..321949)
                     /locus_tag="COO91_00325"
                     /note="Nfsy_R00325"
     CDS             complement(320813..321949)
                     /locus_tag="COO91_00325"
                     /codon_start=1
                     /transl_table=11
                     /product="purM, phosphoribosylformylglycinamidine
                     cyclo-ligase"
                     /protein_id="AUB34502.1"
                     /translation="MAQALDQVDYDTLDAAKRRFIDAAKRTLGFASAYGIVPASGLGA
                     SANAFSFNLAPFLEAGARELSMTLVPEGLGTADDTRPDDLSEEELRRFWWNIGIKIIS
                     CLTNDAATSGMQTILLGLYLPSSTPETIFTPAFLDGFLDGVVEGCKRVGCVYLSGETP
                     QLKTKMIPGRLDIAGSVFGVMPAGVSPIDSSRLDAGNTIVLVESSGPHENGFTPLRKL
                     AESLPDGYRTKLPSGQEFWEAMNAASYLYTPLVQAVLGEGIRPTAMENITGHGWQKLM
                     RSVKPLRYVIETMLPVPEIFTFVEGHLEGGAETMLTVFNYGAGFAFYTESEQDAERIV
                     ILAREHKLTAVIAGRVEASLSREVVIKRLGVTLKGDSFGIARGV"
     gene            complement(322037..322243)
                     /locus_tag="COO91_00326"
                     /note="Nfsy_R00326"
     CDS             complement(322037..322243)
                     /locus_tag="COO91_00326"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34503.1"
                     /translation="MDSKELAQYIEATNSITKPWLLVQLRLKKLQERRATLTDNVYNK
                     ELKDIYQDMMNLGEWWRGIEDDVF"
     gene            complement(322382..322984)
                     /locus_tag="COO91_00327"
                     /note="Nfsy_R00327"
     CDS             complement(322382..322984)
                     /locus_tag="COO91_00327"
                     /codon_start=1
                     /transl_table=11
                     /product="SOD2, superoxide dismutase, Fe-Mn family"
                     /protein_id="AUB34504.1"
                     /translation="MAFVQDPLPFDINALEPHGMKAETFEYHYGKHHKAYVDNLNKLT
                     EGTELANKSLEEVIKTSFNDSSKAGIFNNAAQVWNHTFFWNSLKPAGGGAPTGDLAAK
                     IDKDFGSFDKFKEEFSNAAATQFGSGWSWLIDDGGTLKVIKTPNAENPLAHGKKALLT
                     LDVWEHAYYIDFRNARPAFIKNFLDNLVNWDFAAENLAKA"
     gene            complement(323201..323410)
                     /locus_tag="COO91_00328"
                     /note="Nfsy_R00328"
     CDS             complement(323201..323410)
                     /locus_tag="COO91_00328"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34505.1"
                     /translation="MLSKRQFLLKAERRQLFHLGKPLCVAFRREDRTASRRKNLLRKL
                     ILLVGILRLIMPIYLITYWFLTRKY"
     gene            complement(323658..325412)
                     /locus_tag="COO91_00329"
                     /note="Nfsy_R00329"
     CDS             complement(323658..325412)
                     /locus_tag="COO91_00329"
                     /codon_start=1
                     /transl_table=11
                     /product="panC-cmk, pantoate ligase / cytidylate kinase"
                     /protein_id="AUB34506.1"
                     /translation="MPNAQCPMPNAQCPMPNAHSHNYSPSSIISSLYFRYKLTGEGSI
                     RTRGIFVRLLTTVAALRCYLTKRCSENKLIAVTEDLKLDEMTGWYQTAVGLVPTMGNL
                     HQGHLSLIQRARQENSTVIVSIFVNPLQFAPNEDYQRYPRTLEQDQQFCEQAGVDAIF
                     APTPEEMAVPQKSIQDSKVTQVIPPSAMITGLCGRSRQGHFQGVATIVTKLFNLVQPD
                     RAYFGQKDGQQLAIIKRLVADLNLPVEIVGCPTVREASGLAFSSRNQYLTATAKEQAA
                     ALYRGLRRAEAAFLAGDRNSNKLIALVQQEVAIVSTILVEYIELVEPTTLMSLEKVQE
                     EGMLAIAARLESTRLIDNIILRDRQPIIAIDGPAGAGKSTVARQVAAKLGLVYLDTGS
                     MYRAVTWLVLQKGIAIDDECAIAELTSKCKIELTPNQDLQSSVRVWIDGIDVTQAIRT
                     IEVTSQVSAIAAQSYVRQALVKQQQNWGKKGGLVAEGRDIGTHVFPDAEVKIFLTASV
                     SERARRRQEDFNKQGQPEISLEQLERDIAERDWKDSTRKVSPLQKAADAVEVQTDGLN
                     ISEVTAQIVNYYQQRLSQ"
     gene            complement(325516..326619)
                     /locus_tag="COO91_00330"
                     /note="Nfsy_R00330"
     CDS             complement(325516..326619)
                     /locus_tag="COO91_00330"
                     /codon_start=1
                     /transl_table=11
                     /product="rlpA, rare lipoprotein A"
                     /protein_id="AUB34507.1"
                     /translation="MNQRHLWIIVALSMAPLGIPSVGCTQTTKGNALASQKSPAPDVV
                     KVGEYQSRAGKQTLDAVITEIHPHNVRGRKAATLFIRNIPVLTFLSSVSNTNLETKKV
                     GAIGNSGGVLLYALIASNSSNALDTGSVTDVSNQISSANNDPVQIAGVIAAKINQLNR
                     ENVDGSKITVSWKAGKKSTDNQAQNKSAPVQPNGDRYVIKIDGEELVEINEGTRLADS
                     TNNLAQDALQATNRLRRLLGNASPLKEIANLPVRSPIAMPKQPQQIAVGVVQTTLRGI
                     ASFYGYDFSGNRTASGQRFNPEGMTAAHRSLPFGTKVRVTNTRNGRSVVLRINDRGPF
                     IRGRVIDVSTGAARILGMMGSGVAPVHIEVLGK"
     gene            327304..327438
                     /locus_tag="COO91_00331"
                     /note="Nfsy_F00331"
     CDS             327304..327438
                     /locus_tag="COO91_00331"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34508.1"
                     /translation="MNDKKIKKSLRSLIDQICRVLKSTITFFCPKYLLKYDFLEQTIC
                     "
     gene            327488..328501
                     /locus_tag="COO91_00332"
                     /note="Nfsy_F00332"
     CDS             327488..328501
                     /locus_tag="COO91_00332"
                     /codon_start=1
                     /transl_table=11
                     /product="glsA, glutaminase"
                     /protein_id="AUB34509.1"
                     /translation="MSILGNAISVMTNQAHQGDLEIDPSPLLAVLKDLHSQYKLLGEG
                     AVAKYIPELAKVNPDLFSICIVTVDGQVYKVGDYDQLFTIQSISKVFAYGLALEDHGQ
                     DYVLTRVGVEPTGDAFNAIVLDEQSKRPYNPMVNAGAIATTSLIKGSGPTERLNRMLD
                     MFRRYIGHDVFVDISVFTSERSTGHRNRAMAHLMLNFGMIDRNIEESLDLYFQQCAVM
                     VNCQDLAVMAATLANRGINPITKEQAVDKRYIKDILSVMYTCGMYNFAGEWAYKIGIP
                     AKSGICGGIIAVVPNKMGIGVFSPLLDVRGNSVRGVKVCEELSQRLGLHLFDCSGQQA
                     KFG"
     gene            complement(328565..329368)
                     /locus_tag="COO91_00333"
                     /note="Nfsy_R00333"
     CDS             complement(328565..329368)
                     /locus_tag="COO91_00333"
                     /codon_start=1
                     /transl_table=11
                     /product="putative nucleotidyltransferase"
                     /protein_id="AUB34510.1"
                     /translation="MPVPEPQRELLEQILAKLKTDNRLLGVAIGGSYLSRKMDEYSDL
                     DLIIVVDDVHYQQVLKERQLLASKLGKLLAAFTGEHVGEPRLLICLYDSPLIHVDLKF
                     LLLQDFQTDRIENPIILWERGNLLTLAVSDNPRNYPPFDPQWIEDRFWVWVHYGATKL
                     GRGELFEVIDFLSFLRGQVLAPLAKVQAGLLPRGVRNLETEIPFYLNDFRQTIPAKHD
                     QEEIGRSLQHTIRFYCQLRSKLAMSELIIHSQAEAASTKYLQSVIDKFK"
     gene            329685..330002
                     /locus_tag="COO91_00334"
                     /note="Nfsy_F00334"
     CDS             329685..330002
                     /locus_tag="COO91_00334"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34511.1"
                     /translation="MHEVSKQTIETAQKHAQKSIEHSKEVQELGKSLQTDDQIEPEQK
                     ERIEAYGETMHEHAQKFEELAHRLIKDPSTDVFSEVVEEHIKVNQAHIEATKEFQKIE
                     PPA"
     gene            330131..333607
                     /locus_tag="COO91_00335"
                     /note="Nfsy_F00335"
     CDS             330131..333607
                     /locus_tag="COO91_00335"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator, OmpR family,
                     containings REC and winged-helix"
                     /protein_id="AUB34512.1"
                     /translation="MCLSPNNTPAVTEVDVLITEALASRPARQPNLAAENRSLHILSQ
                     QLIDDPQSTLKTLVEIAIDLCRADTAGVSLLETDSNGESRFRWVAIAGALEFLEQTTT
                     PSNFSPCGTTLQSRQPQLYAHPERYFTYLYHPQFPIVEGLLIPLSVNNQPLGTLWILS
                     HHEARQFDAEDHRLMTSLAGFTASALQSIHQAHQTALEAVRHEQATRAELHYSQMQFE
                     ALVANVPGMVYRYLPRTDSPHRFTFVNSGSHELLELEPETILQDANSFVKLIYSEDLA
                     SFETSVAQAIENLLPWCWEGRIVTPSGKLKWIQGSSRAVQTAEGYVWDGLLIDLTSHK
                     RAEAALRQSEEFNRQILESSDDCIKVLDLSGLILYMSPGGQAALNISDVRPLLNSSWI
                     EFWQGADRQAVLNAIGCAKAGKISTFQGCLPTQTGEPKWWDNKISPIKGVDGQVERLL
                     CISRDITARRQAEAALRESEERLRRAIAIETVGVIFFNTNGSITESNDAFLKMSGYSR
                     EDIEQGLVGWDKMTPPEWMPHSLRAMEEFKATGSTTPYEKEYIRKDGSRWWGLFSAKR
                     LNEEDGVEFIIDITNRKQTQAEREQLLAREQHYANQLQGLTTAALAINSALSVQEVLQ
                     VITEQAASIISTHQSVASMTIDQNWAQAINAIHLSDKYAQWRDYDQKSDGSGIYACVC
                     NLNQSMRMTQAELESHPRWRGFGNEAKNHPPMRGWLAAPLIGRDGHNIGLIQLSDKYE
                     GDFTEADEAILVQLAQMASIAVENARLYEAEQQARLAAEASREEAEAANRVKDEFLAV
                     LSHELRSPLNPILGWSNLLQSHKLDEAKTMQALAAIQRNAKLQSDLIEDLLDVSRILR
                     GKLSLNVAPVDLAATIQAGMETVRLAAQAKSISVQTVLEPNVGKVLGDSTRLQQVIWN
                     LLSNAIKFTPEAGQVNIRLEQLGSVAQISVSDTGKGIHADFIPYVFDYFRQADGTTTR
                     KFGGLGLGLAIARHLVELHGGTVEAESPGIGQGATFTIRLPLMSTQPATNQDSKLFAP
                     FLDLTGINVLVVDDDTDTRDLTAFVLEQYGAIVTAVSSATEAFLVLTQSKPDVLLSDI
                     GMPDVDGYMLIEYVRSLFAQGDQIKAIALTAYAGEMNQQQALKAGFHRHISKPIEPMM
                     LVQAISSLVRST"
     gene            complement(334006..334821)
                     /locus_tag="COO91_00336"
                     /note="Nfsy_R00336"
     CDS             complement(334006..334821)
                     /locus_tag="COO91_00336"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF1838"
                     /protein_id="AUB34513.1"
                     /translation="MVAQIQELEAQHWVKTRSSLDPSESTFLIWKGKIYAFIPGEKKQ
                     LLFKMLGLSVSRCIPTAEGSWDFTSRELTYYLNPQTDEVLTKWENPWTGETVPVIHVA
                     NNPVQGKFKGNFPAQVDGDSTTFVFDIFPYYPNPLAEDPKFAEYSPNPIYQAAELFKL
                     TVPTADLFNTALSSVSQLKLSWDRIGQWLPWMKMGDRPGQLIYSAVGSKVNGLAELPP
                     LLQDEINNRIPLYKKAPKALIDGEDMTSWLYFQKHFQAYLAGEIFPLPQAEEF"
     gene            complement(334872..335576)
                     /locus_tag="COO91_00337"
                     /note="Nfsy_R00337"
     CDS             complement(334872..335576)
                     /locus_tag="COO91_00337"
                     /codon_start=1
                     /transl_table=11
                     /product="trpF, phosphoribosylanthranilate isomerase"
                     /protein_id="AUB34514.1"
                     /translation="MERTANPRVKICCISSIEEAWIAIRCGASALGLVSQMPSGPGVI
                     SEELIAEIAACVPPPIATFLLTSSLDAQEIIQQVRRCRTNTVQICDRLESGSYQDIRD
                     GLPGISIVQVIHVITEKSIEEAINVAPYVDAILLDSGNQSLLIKELGGTGRLHDWNLS
                     AQIRKQVNVPIFLAGGLKPENVAIAVEQVAPFGLDLCSAVRNNGKLDENKLKLFFQQL
                     NRALGRSEIKLLTPNS"
     gene            complement(335791..335988)
                     /locus_tag="COO91_00338"
                     /note="Nfsy_R00338"
     CDS             complement(335791..335988)
                     /locus_tag="COO91_00338"
                     /codon_start=1
                     /transl_table=11
                     /product="Cystathionine beta-lyase"
                     /protein_id="AUB34515.1"
                     /translation="MECNNESLILANESLILVNESFLLANDSLILANESFLLVDAHHN
                     SPAFPGASQMCKFTYLDLGGQ"
     gene            complement(336044..337225)
                     /locus_tag="COO91_00339"
                     /note="Nfsy_R00339"
     CDS             complement(336044..337225)
                     /locus_tag="COO91_00339"
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB protein"
                     /protein_id="AUB34516.1"
                     /translation="MNQSLSVAPNLEEHTHENPVVSKQQLTKQLIVLVLEMLLALPLG
                     LLLAKFQIGRIAWIFGGIAAGTVILQGCRIFYQYSPQPNRTARKVGMALVGLTVGASN
                     AHGNLASVASSIPIFIFLTLFLLLSGSCIGYIYSRLSKTNLLTAMLATVPGGVGIMAA
                     IAADYNKNVSLVALVQAIRVTSVVILIPFIAKTSTGNYSPQTLPINAAWLNFDPFQLE
                     LLLLVLVITGLVVYPAILFKIPAGDFFGALLIGIGFNPLLHWLPFVGDISFSPPPIIN
                     LLGQMLLGITIGEYWGDKPNFRKRTVVYALMSVGMTLIAGAIAAILAMQLTSWDWLTC
                     LLVTAPGGSAEMILVSLALNHNVEIVTTGHLVRLIAINSSLPLWLFLFRRLDERLSES
                     V"
     gene            complement(337529..337867)
                     /locus_tag="COO91_00340"
                     /note="Nfsy_R00340"
     CDS             complement(337529..337867)
                     /locus_tag="COO91_00340"
                     /codon_start=1
                     /transl_table=11
                     /product="Excinuclease ATPase subunit"
                     /protein_id="AUB34517.1"
                     /translation="MSQEHNESLQIQEITKLKPKHFADLVRSAQLIFDPTAGVSGRHI
                     TVDWEQFGIPGDVADNLKSLGQQYQYASPHIPVEDIWSKLTPKTRIWFVENKDRLWQL
                     EEAFPALDED"
     gene            complement(338309..339247)
                     /locus_tag="COO91_00341"
                     /note="Nfsy_R00341"
     CDS             complement(338309..339247)
                     /locus_tag="COO91_00341"
                     /codon_start=1
                     /transl_table=11
                     /product="Molybdenum cofactor biosynthesis enzyme MoaA"
                     /protein_id="AUB34518.1"
                     /translation="MYTISNNKIDTKRYCEINVVHHCNLSCRACTHLSPGIPKYIADP
                     EKIYRDLSILSKSYIPRGVKLVGGEPLLHPNIIEIIEAVRASGITKFVKMVTNGHLLS
                     KAPDLFWEKIDAIEISLYPSKPINPETLKTLKQKAKDSKTILESYSWDDFRESYSELG
                     TENTELVQKIYSNCAVAHVWRCHTISEGYLYKCPQAVFIPKVITKENLQNDGIKITDS
                     GNFFEQLLAYLKSEEPLGSCYHCLGCVGKRFNHEQMNPKLWRSPQQFTSEELVDLDYL
                     SFLEKQPSQAKGCHKELSLPEKISNIATKLFNNYRK"
     gene            complement(339541..339906)
                     /locus_tag="COO91_00342"
                     /note="Nfsy_R00342"
     CDS             complement(339541..339906)
                     /locus_tag="COO91_00342"
                     /codon_start=1
                     /transl_table=11
                     /product="Conserved hypothetical protein CHP02058"
                     /protein_id="AUB34519.1"
                     /translation="MARKRLIIEMGMGIDQHGQEPTVAASRAVRNAIAHNALPGVWEV
                     AGLSHPNEMIIEVQVAVPYPEQVREEEVLAVLPFGRKTLTVEAGGMVVQGRAIPELND
                     KNDEMLIAIAAVTVLIEDE"
     gene            complement(340023..340391)
                     /locus_tag="COO91_00343"
                     /note="Nfsy_R00343"
     CDS             complement(340023..340391)
                     /locus_tag="COO91_00343"
                     /codon_start=1
                     /transl_table=11
                     /product="cAMP-binding domain of CRP or a regulatory
                     subunit of cAMP-dependent protein kinases"
                     /protein_id="AUB34520.1"
                     /translation="MLSPVVTVSIFQKQPNPQAFSAGQVIFEEGQSGEHMYGILEGTV
                     DILVNGKVVETIETGEVFGVGVLVGVKNRTYTAIAKVDSKLAFVDEKAFLFAVQETPM
                     FALKVMKSYSERLSRVQRMV"
     gene            340750..343632
                     /locus_tag="COO91_00344"
                     /note="Nfsy_F00344"
     CDS             340750..343632
                     /locus_tag="COO91_00344"
                     /codon_start=1
                     /transl_table=11
                     /product="IARS, isoleucyl-tRNA synthetase"
                     /protein_id="AUB34521.1"
                     /translation="MTESGSYKDTVNLPKTNFDMRANAIKREPEIQKFWEENKIYDRL
                     SENNPGELFILHDGPPYANGSLHIGHALNKILKDIINRYQLLKGRKVRYVPGWDCHGL
                     PIELKVLQNMKSAERQNLTSLQLRQKAEEFALTTVNDQRQNFQRYGIWGDWNHPYLTL
                     KPEYEAAQIGVFGQMFLKGYIYRGLKPVHWSPSSKTALAEAELEYPEGHVSRSIYAAF
                     AVTSLAEAVKPLLAEYLSDLGVAIWTTTPWTIPGNLAVAVNADLNYAVVEVSHPETEA
                     QSNLKYLIVAADLVERLSSTLGVELTVKATFKGNDLEHTTYRHPLFDRESPIVVGGDY
                     ITTESGTGLVHTAPGHGQEDYIVGQRYGLPILAPVDDNGNFTEEAGEFARLNVLGDGN
                     QAVIDALAAAGSLLKEEAYPHKYPYDWRTKKPTIFRATEQWFASVEGFREEALKAIAT
                     VKWIPAQGENRITPMVAERSDWCISRQRSWGVPIPVFYDEATGEVLLNEEIINHVQGI
                     IAQKGSDAWWELSVEELLPESYRQNGKSYRRGTDTMDVWFDSGSSWASVVQQRPELRY
                     PADIYLEGSDQHRGWFQSSLLTSVAVNDIAPYKTVLTHGFALDEQGRKMSKSEGNVVD
                     PNTIIEGGKNQKVEPPYGADILRLWVSSVDYSGDVRIGKNIIKQMNDVRGKIRNTARF
                     LLGSLHDFDPEKDTVPFEELPELDRYMLHRITEVFEEVTEAFESFQFFRFFQTVQNFC
                     VVDLSNFYLDIAKDRLYISATNAFRRRSCQTVLKIAIDNLARAIAPVLSHTAEDIWQY
                     LPYKTPYKSVFEAGWVQVDQEWRNPELAEFWSALRQLRTDVNKVLEQARIEKMIGSSL
                     EAKALIHIPHKQLGDAIKAFNRVKGNGIDELRYLLLTSQVELLDSAQGLQGLEYTAQT
                     EDWGIGVVKADGQKCDRCWNYSTHVGESAEHPLICERCVAALAGEF"
     gene            complement(344232..345698)
                     /locus_tag="COO91_00345"
                     /note="Nfsy_R00345"
     CDS             complement(344232..345698)
                     /locus_tag="COO91_00345"
                     /codon_start=1
                     /transl_table=11
                     /product="phrB, deoxyribodipyrimidine photo-lyase"
                     /protein_id="AUB34522.1"
                     /translation="MNYIQQGMSDLILFWHRRDLRISDNTGLAAAKQQSPKVVGVFCL
                     DPNLLERDDVAPVKVTYMIGCLQKLQERYAQVGSQLLILHANPVQAIPALAEAINAKA
                     VFWNWDVEPYSQERDRTVINALKEKGIQFLNQNWDQILNSPEQLRTGSNQPYTVYTPF
                     WKNWITKPKANPVETLQNVEGLTEAEQEIAKLAGALTLPSAKDLGFIWDGELIISPGE
                     VAAQERLEEFTAKAITEYQEQRNFPAVDGTSQLSAALKFGVIGIRTVWQATIEALENS
                     RSEETAVNIRTWQQELAWREFYQHAMYNFPELADGAFRDTFKNFPWQTNDEHFQAWCE
                     GRTGYPIVDAAMRQMNESGWMHNRCRMIVASFLTKDLLINPQLGEKYFMQHLIDGDLS
                     ANNGGWQWSASSGMDPKPVRIFNPASQTQKFDPEGEYIRQWVSELRSVDTEYLVTGKI
                     PSLERHAVGYPEPIVDHRIQQQQFKLRYQQQKTVSNAE"
     gene            345728..345844
                     /locus_tag="COO91_00346"
                     /note="Nfsy_F00346"
     CDS             345728..345844
                     /locus_tag="COO91_00346"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34523.1"
                     /translation="MNIILAINLFCGLALAISYSPFLILRFVSRNSGLLAQS"
     gene            345881..346147
                     /locus_tag="COO91_00347"
                     /note="Nfsy_F00347"
     CDS             345881..346147
                     /locus_tag="COO91_00347"
                     /codon_start=1
                     /transl_table=11
                     /product="Acireductone dioxygenase"
                     /protein_id="AUB34524.1"
                     /translation="MANLLLDDGTIESDLGEIALELALLGIQLRHYDPGTSLLFLNLL
                     DQDVLTESEKRYCVELHNSVFEFIQQENDAVWCDLLNVHPGSFN"
     gene            346346..347672
                     /locus_tag="COO91_00348"
                     /note="pseudogene"
     gene            348034..349059
                     /locus_tag="COO91_00350"
                     /note="Nfsy_F00350"
     CDS             348034..349059
                     /locus_tag="COO91_00350"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="AUB34525.1"
                     /translation="MWLADCYSQVLQATTLNLTTAYKNFFEKRAGFPKFKSKHALESI
                     QYPQNVKIVDGNVKFPGNIGIVKAKIHRAIEGKVKTVTVSKTPSGKYLASILTEIEGE
                     SPITSEGKIYGIDLGLKHFAVVTDGAKVSKYDNPKHLAKHEKNLKRKQKKLARKVKGS
                     KSRNRYRKVVAKVYERVSNSRQDFLHKLSYKLVSDSQAVIVENLNVRGMVRNHKLAKS
                     ISDVGWGTFTNFLAYKLERRGGKFVEIDRWFPSSKLCQKCFYQIGEMPLDVREWTCPD
                     CNTHHDRDANASTNIRAEGIRMIKAEGSAVSAVGGEVSPTLGRKSKFRHSPVITEAPP
                     SALCRVG"
     gene            349197..349442
                     /locus_tag="COO91_00351"
                     /note="Nfsy_F00351"
     CDS             349197..349442
                     /locus_tag="COO91_00351"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34526.1"
                     /translation="MQEFKSPTSRLARLFRNGRDNWKERALEKQKKLRALEIKVRDLS
                     ASRDYWKSRAKIAESKLLKQNIEIEDEKKRDSYKRSS"
     gene            complement(349588..349740)
                     /locus_tag="COO91_00352"
                     /note="Nfsy_R00352"
     CDS             complement(349588..349740)
                     /locus_tag="COO91_00352"
                     /codon_start=1
                     /transl_table=11
                     /product="putative restriction /modification enzyme"
                     /protein_id="AUB34527.1"
                     /translation="MKLFRLNNRANASKLLLITTKNKNQRKNQDFALDYFLSPKAMPA
                     AGYANA"
     gene            349933..350193
                     /locus_tag="COO91_00353"
                     /note="Nfsy_F00353"
     CDS             349933..350193
                     /locus_tag="COO91_00353"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34528.1"
                     /translation="MTVELGTEKALVVLGVSQQLLEEQVFPLKRRLGHQDVELLALEI
                     MYSTKGEYIEQKLSELTKKVGRPVQIIADHGSDIQTRISHKQ"
     gene            complement(350626..351297)
                     /locus_tag="COO91_00354"
                     /note="Nfsy_R00354"
     CDS             complement(350626..351297)
                     /locus_tag="COO91_00354"
                     /codon_start=1
                     /transl_table=11
                     /product="Regulator of replication initiation timing"
                     /protein_id="AUB34529.1"
                     /translation="MDLDVTDDLVHGNHVTSLPTNKVPPGKLYKQKYCKRALCWVHEG
                     RHYKKLTPFVACHQEILDDFLTEFWDYYRELLAYRDSPNQKKKLELQSKFGEIFGTET
                     GYKQLDERKRLTAAKVSELLLVLEYPELPLHNNPAELAARTMVQRRNISYATQTSQGT
                     KAWDIFMSLVATTRKLGISFFEYMQDRISHKSKIPSLGTIIRYKCFSQHQPLSCLEEL
                     LCMSG"
     gene            complement(351498..351815)
                     /locus_tag="COO91_00355"
                     /note="Nfsy_R00355"
     CDS             complement(351498..351815)
                     /locus_tag="COO91_00355"
                     /codon_start=1
                     /transl_table=11
                     /product="Spore coat polysaccharide biosynthesis protein
                     SpsF, cytidylyltransferase family"
                     /protein_id="AUB34530.1"
                     /translation="MNRPATRSLSKQFRFEQPKSPPVVVNFNGGLVTSDAGLNLIAEI
                     DRKLQITSQFAQCFQDYRKPYRIDHSIENLIRQRIYGLVMGYEDLNDHEELRHAPMFA
                     HAA"
     gene            351970..352728
                     /locus_tag="COO91_00356"
                     /note="Nfsy_F00356"
     CDS             351970..352728
                     /locus_tag="COO91_00356"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34531.1"
                     /translation="MALLLKHELVADEKYQSFIQQCTQCRQQLQQTELSFLSPPSQRS
                     QCRYFNIERLINWAIKLLDSPIDIIVELVPNIEPAILRQKLKSKLGWLINYQEPLSIW
                     SQMVQMTRTVETHLKTCGLHQKLSSVLKLQQLTMGANSLVNFQLKIIDYLTIESSKIQ
                     SEQTILATSDVIESLFGKYKQFSSRCPFKQISQMILSISLSTMKLTGSVVKLALETVR
                     YLDLEAWSDQVFGQSMLSKRRTVFTASNNDTESA"
     gene            352725..352844
                     /locus_tag="COO91_00357"
                     /note="Nfsy_F00357"
     CDS             352725..352844
                     /locus_tag="COO91_00357"
                     /codon_start=1
                     /transl_table=11
                     /product="Acireductone dioxygenase"
                     /protein_id="AUB34532.1"
                     /translation="MKIFGLISHKVNTLGCANAECWVPNYTGTQVSDSLNKPR"
     gene            353179..353793
                     /locus_tag="COO91_00358"
                     /note="Nfsy_F00358"
     CDS             353179..353793
                     /locus_tag="COO91_00358"
                     /codon_start=1
                     /transl_table=11
                     /product="Molybdopterin-binding protein"
                     /protein_id="AUB34533.1"
                     /translation="MYLQKINIYVVKYMALVDDFSIKMKKILPEKIFLLKQHIEFILG
                     RIIPSITKIDNIMPRKEQGWVTFQTSEDERKILEEFCEQSQRTKTEILRELVRSLNQH
                     SSAPISPPIHQEKQEDIYYTQKPDIESSIQKKSLKVSSRNILKGVVKRVVYGAVNSEV
                     TLEIIHKVELTSIITRASAEELELSEGKEAYAVIKSNDIVIARE"
     gene            complement(354063..354239)
                     /locus_tag="COO91_00359"
                     /note="Nfsy_R00359"
     CDS             complement(354063..354239)
                     /locus_tag="COO91_00359"
                     /codon_start=1
                     /transl_table=11
                     /product="Ca2+-binding protein, RTX toxin-related"
                     /protein_id="AUB34534.1"
                     /translation="MKITSSGGSSTAKIIYDAVSGQLFYNQNGSAAGFGSGGLFATLT
                     GAPTLSASDFVVQA"
     gene            354379..354501
                     /locus_tag="COO91_00360"
                     /note="Nfsy_F00360"
     CDS             354379..354501
                     /locus_tag="COO91_00360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34535.1"
                     /translation="MPKNRKSWCSNGFSHSPKFTLNYHPALKTLFLCDRAKSGL"
     gene            complement(354556..354708)
                     /locus_tag="COO91_00361"
                     /note="Nfsy_R00361"
     CDS             complement(354556..354708)
                     /locus_tag="COO91_00361"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34536.1"
                     /translation="MVTELVVPLPYGTLRERGSELRAASRREVRATLTQNFTLHVITP
                     GSPILN"
     gene            355124..355309
                     /locus_tag="COO91_00362"
                     /note="Nfsy_F00362"
     CDS             355124..355309
                     /locus_tag="COO91_00362"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF2949"
                     /protein_id="AUB34537.1"
                     /translation="MKPTDKLVHFLKEELGISGGAISLALRHCEQTPNFLAMTLWQYG
                     LVTLDQLAQIFDWLETV"
     gene            355401..357266
                     /locus_tag="COO91_00363"
                     /note="Nfsy_F00363"
     CDS             355401..357266
                     /locus_tag="COO91_00363"
                     /codon_start=1
                     /transl_table=11
                     /product="ftsH, cell division protease FtsH"
                     /protein_id="AUB34538.1"
                     /translation="MPIKEQPKSPRFRIIANILLAVSGLFLLLNLFLPGLFASGPSGV
                     PYSLFIHQVQEGEVSRVSVGQNQIIYQLKAENAEPPQVFATTPIFDLELPKLLEEKGV
                     EFAATPPPKNTWFTTLLSWVIPPLIFIGIWQFFLARGGGGGPQGALSIGKSKAKVYVE
                     GESAKITFADVAGVEEAKTELVEIVDFLKTPARFTQIGARIPKGVLLVGPPGTGKTLL
                     AKAVAGEAGVPFFSISGSEFVELFVGVGSSRVRDLFEQAKKQAPCIVFIDELDAIGKS
                     RSSNGFYGGNDEREQTLNQLLTEMDGFAAGDATVIVLAATNRPESLDSALLRPGRFDR
                     QVLVDRPDLSGREAILKIHAQKVKLGDDVDLRAIATRTPGFAGADLANLVNEAALLAA
                     RNLRESVAQEDFAEAIERVVAGLEKKSRVMNETEKKIVAYHEVGHAMVGALTTGNGRV
                     EKISIIPRGMAALGYTLQLPTEDRFLMNEDELRGQIATLLGGRSAEEIVFNSITTGAS
                     NDLQRATDLAERMVTTYGMSKVLGPLAYQQGQQSMFLGNGGANPRRAVSEDTSKAIDS
                     EVKEIVETAHEQALEILRQNRDLLEAIATQLLETEVIEGEKLHSLLGQIKPVANS"
     gene            complement(357354..358526)
                     /locus_tag="COO91_00364"
                     /note="Nfsy_R00364"
     CDS             complement(357354..358526)
                     /locus_tag="COO91_00364"
                     /codon_start=1
                     /transl_table=11
                     /product="MOCS3, adenylyltransferase and
                     sulfurtransferase"
                     /protein_id="AUB34539.1"
                     /translation="MLNPNLDEIQLTKDDYERYSRHLILPEVGLEGQKRLKAASVQCI
                     GTGGLGSPLLLYLAAAGIGRIGIVDFDVVDTSNLQRQVIHGTSWVGKPKIESAKNRIH
                     EINPYCQVDLYETRLTSENALEILQPYDIVVDGTDNFPTRYLVNDACVLLNKPNVYGS
                     ILRFEGQATVFNYQGGPNYRDLFPEPPPPGMVPSCAEGGVLGILPGIIGLIQATETVK
                     IILGQGNTLSGRLLLYNALDMKFRELKLRPNPIRPVIEKLVDYEEFCGIPQAKAEEAK
                     QQMESQEMTVKDLKELLDSGAKDFVLLDVRNPNEYDIAKIPGSVLVPLPDIENGNGVA
                     KVKEILNGHRLIAHCKMGGRSAKALAILKEAGIVGTNVKGGITAWSREIDPSVPEY"
     gene            complement(358605..359063)
                     /locus_tag="COO91_00365"
                     /note="Nfsy_R00365"
     CDS             complement(358605..359063)
                     /locus_tag="COO91_00365"
                     /codon_start=1
                     /transl_table=11
                     /product="Proteasome lid subunit RPN8/RPN11, containings
                     Jab1/MPN domain metalloenzyme"
                     /protein_id="AUB34540.1"
                     /translation="MIKLSQEHLQTIHTHAESTYPEECCGIILGYLANGGKVVVEVIP
                     TENAWNTEAAAEFSGKHTAESKKQQYAIAPEVMLKTQREARDRSLNIIGIFHSHPDHP
                     AIPSECDRLYAWQGYSYIIVSVQNGKAGELQSWSLDDTHHFQAEAIENII"
     gene            359620..359862
                     /locus_tag="COO91_00366"
                     /note="Nfsy_F00366"
     CDS             359620..359862
                     /locus_tag="COO91_00366"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34541.1"
                     /translation="MRKQYAFLLAESTEMSKQSSILRKRYTFLLAESTEMRKQSSILR
                     KRYTFLLAESTEMRKQSSILRKQYAFLLAESTEMRK"
     gene            360284..361141
                     /locus_tag="COO91_00367"
                     /note="Nfsy_F00367"
     CDS             360284..361141
                     /locus_tag="COO91_00367"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34542.1"
                     /translation="MNFFIGCAVWAYKGWAGELYPQGTRTADFLNLYSRRFTTVEGNT
                     TFYAVPNQETVTRWAAETPAGFEFCLKLPRDITHQGLLKPYIPAALKFLEGMRPLGKR
                     LGPIFAQLPPSYAPALLDDLTNFLEAWPCTEAPLALEVRHSDWFREPHASNLTTLLER
                     LGVGRVLLDSRPIYTGDDDPQLQSEQRKPKLPLQLSVTAPFTLIRFISHPNLSVNQPF
                     MEEWVRQIQQWLQMGVRIYFFVHCPIEARSPSTARHFQQLLEQSDTPVPPLPWNNLEH
                     PPNQLSLWS"
     gene            361439..361879
                     /locus_tag="COO91_00368"
                     /note="Nfsy_F00368"
     CDS             361439..361879
                     /locus_tag="COO91_00368"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34543.1"
                     /translation="MSRLLYENSVSYKGYLIIPFVFGKLDNYEVYSYKLLSEVGHTSQ
                     FHKAENPAGIYGSSVSNIVDIAKEHIDQNSEFVSRKDNFKSRYIYRNNLIIISQEGDK
                     YFYDHYPPELLNNIAAPKLFKSEYECLSWIKQGLNGEHVRQRAI"
     gene            362018..362134
                     /locus_tag="COO91_00369"
                     /note="Nfsy_F00369"
     CDS             362018..362134
                     /locus_tag="COO91_00369"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34544.1"
                     /translation="MAIKYLCSCDRYLNCSWLTLVFALLNWDIVAKFGQLVS"
     gene            362220..362345
                     /locus_tag="COO91_00370"
                     /note="Nfsy_F00370"
     CDS             362220..362345
                     /locus_tag="COO91_00370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34545.1"
                     /translation="MSDRGALNIAFSHSPYPYSLFPLIFICSRLDLNAPLSDHEE"
     gene            362380..363618
                     /locus_tag="COO91_00371"
                     /note="Nfsy_F00371"
     CDS             362380..363618
                     /locus_tag="COO91_00371"
                     /codon_start=1
                     /transl_table=11
                     /product="mgdE, monoglucosyldiacylglycerol epimerase"
                     /protein_id="AUB34546.1"
                     /translation="MLAENLIGIETKLQINWVWLNASLQFLTWGLFSLLLAEVLRDSY
                     HALCHQVNWLAKWHNKHHMAYRRDLSIVSLKVYQESQLYHDILESSLLLVVLVFISLI
                     VQHKGLWVGVAYCCTFLYGASVRYFQGKIDTDYNHLPGPLETIPSIWWVNRTYHWRHH
                     FDDVNAYYSGVFPLVDKILGTGLSLKGKTIALTGASGALGQALAAELVKNNAKVVALT
                     TNPEKLVEQVGVKVVPWQLGNEAELRNSLEKVDILIINHGINVYASRTSEAINTSYEV
                     NTFSALRLMDIFLTTVTGPQAKATKEIWVNTSEAEVSPALSPLYELSKRSLGDIVTLK
                     RLDGDCVIRKLILGPFKSQLNPYGVMSAQQVARAILFFARRDFRNIIVAINPLTYLLF
                     PLKETSTWLYYRVFSRTAKS"
     gene            complement(363833..363988)
                     /locus_tag="COO91_00372"
                     /note="Nfsy_R00372"
     CDS             complement(363833..363988)
                     /locus_tag="COO91_00372"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34547.1"
                     /translation="MRLAKLKEFRQPTYKYLGLGKAPDATFESMDAVLLTDNSYSLAD
                     FSLSPVF"
     gene            364264..368913
                     /locus_tag="COO91_00373"
                     /note="Nfsy_F00373"
     CDS             364264..368913
                     /locus_tag="COO91_00373"
                     /codon_start=1
                     /transl_table=11
                     /product="Ca2+-binding protein, RTX toxin-related"
                     /protein_id="AUB34548.1"
                     /translation="MLDTISTRITTYPTQDLHEKIPANRLVFIDPKVENYQTLIAGVL
                     PNTSVVVLDNDQDGIEQINQVLASHRGVNSLHIVSHGAPGRVYLGNSQLSNETLNRYA
                     AKLMGWANALSADAQLLLYGCEVAQTEQGMAFVQRLSELTGAVVAASDNLTGSATLGG
                     DWELDICTKASVRSLVFQPEVMAAYTSVLALVLPDKSFDGDGKVTTDLGFIAIDIGRS
                     IAVQNDGKIIVAGDSNGDFALVRYNTNGSLDNSFNGNGKVTTNITSTLALPLSTDIGY
                     SVAVQSDGKIIVAGVSNGDFALVRYNTNGSLDNSFNGNGKVTTNITSTLALPLSTDSG
                     YSVAVQSDGKIIVAGVSNGDFALVRYDTNGSLDTTFSGDGKVTTNISLIDTARSVTLQ
                     SDGKIIVAGTDGTDFALVRYNSDGSLDTTFSGDGKVTTDLRLIAVDIGYSVTLQTDGK
                     IIVAGTDNTDFALVRYNSDGSLDTTFGGGDGKVTTDLGLIAVDIGYSVTLQTDGKIIV
                     AGTNNTDFALVRYNSDGSLDSTFNGSGKVTTDLGFLAIDIGYGLAQQSDRKILVAGTN
                     GTDFAVVRYLVDEVPTDLALSQLNVNENVPAGTVIGTFTTTDLDAGDTFTYSLVTGTG
                     DTDNAAFTVVSNQLKINSSPDFETKPSYNIRVQTSDSSGASYQKTLTIAVNNSNDAPT
                     DLTVSQLAVNENVAAGTVIGTFTTTDPDANNIFTYSLVTGTGDTDNAAFTVVSNQLKI
                     NSSPDFETKPSYNIRVQTSDSGGASYQKTLTIAVNNLNDAGVNDAPTDLTVSQLAVDE
                     NVAAGTVVGIFTTTDPDANNIFTYSLVTGSGDTDNAAFTVEGNQLKINSSPDFETKPS
                     YNIRVQTSDSGGASYQKTLTIAVNNLNDAGVNDAPTDLTVSQLAVDENVAAGTVVGIF
                     TTTDPDANNIFTYSLVTGSGDTDNAAFTVEGNQLKINSSPDFETKPNYNIRVQTSDSG
                     GASYQKTLTIAVNNLNDAGVNDAPTDLTVSQLAVDENVAAGTVVGIFTTTDPDANNIF
                     TYSLVTGSGDTDNAAFTVEGNQLKINSSPDFETKPSYNIRVQTSDSGGASYQKTLTIA
                     VNNLDDAGVNDAPSDLTLSELTVDENVAAGSVVGTFITTDPDKDDKFTYSLVTGTGDS
                     DNSAFTIVGGQLQINNVPNIETKSSYNIRVQTTDSGGVSYQKALTIAVNDLDDLGVND
                     IPTLTKSANNDIFTIKGKGNGEKAKLSVKLTGQSSNQIYELGVFTVDDEQGKIQGIAS
                     NDAGYTEAALKRGKVILSSLNNYPTGFNADLSSMVEFTSGQQLRFYLVRNSSTDSILA
                     GQAAFTDVLISDSTNLKITSLGNNNFSLSWKASNSAEFQDLAVTIQATDEDLPLGTGF
                     QGQQQGEFLDLRDLTQPVKADFVVNREAAYDNYVGFYKVADENGGIDTNGDGTADVLV
                     GQAGYAQAAVSGRVTGVDLTTNNQGTATYSGTLNSDSLFAPFIIVDGKPDAILDGNVN
                     NDPKVYFAFLGANSDNTDHIRLLANNTFGFEDLANGGDKDYNDIIVRVNLSGNPV"
     gene            complement(369654..370931)
                     /locus_tag="COO91_00374"
                     /note="Nfsy_R00374"
     CDS             complement(369654..370931)
                     /locus_tag="COO91_00374"
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylhomocysteinase"
                     /protein_id="AUB34549.1"
                     /translation="MTATSPRLKHEVKDLGLAALGRQRIEWAGREMPVLRQIRDRFAI
                     EKPFAGLRLVACAHITTETAHLAIALKAGGADALLIASNPLSTQDDVAASLVLDHEIP
                     VFAQKGEDNETYNRHVQIALDHRPNIIVDDGSDVVATLVQERQHQIADLIGSTEETTT
                     GIVRLRAMFREGVLTFPAVNVNDADTKHFFDNRYGTGQSTLDGIIRATNILLAGKNIV
                     VVGYGWCGKGTALRARGMGANVIVTEIDPIKAIEAVMDGFRVLPMAEAAPQGDIFITV
                     TGNKHVVRGEHFDVMKDGAIVCNSGHFDLELDLKYLAAQAKEIKEVRPFTEEYKLKNG
                     KSVVVLGQGRLINLAAAEGHPSAVMDMSFANQALACEFLVKNKGKLEPGLHSIPVEVD
                     QEIARLKLQAIGITIDSLTADQIEYINSWTSGT"
     gene            371322..372977
                     /locus_tag="COO91_00375"
                     /note="Nfsy_F00375"
     CDS             371322..372977
                     /locus_tag="COO91_00375"
                     /codon_start=1
                     /transl_table=11
                     /product="mscS, small conductance mechanosensitive
                     channel"
                     /protein_id="AUB34550.1"
                     /translation="MRFQFLAIASSMAIAVVSVPKATAQIPLLPQLLPSPSSVSNDAN
                     NRLVTGWIYLDGRRLFQIAASRSNFPERSEDIQKKLEKIAQNYFQSPAKTTVKVEVRK
                     VNDLPVIYINGQYLMTITSEDAGLREVDMLTSANQIAESLQEDLQQAKQERQTQFLID
                     QGKIAAGIGLAMIVMSWGVYSWQRRSKNDVVYPLASQPPRGPLNSPISPAAAQPITTQ
                     LNQQQHRHIQEVKRRLFQLTQAGIWGGGSFVILGLFPYTRPFQVVILTAAQFPLRLGV
                     VFLVTYVAIRLIYALIDRFTTTLISSGALLTPESSERLQLRVSTFSGVTKSIATGICV
                     GVGFLLALVSLGIDIVPLLAGASLVGVAVSLASQNLIKDAINGFLIILEDQYALGDVI
                     TVGNVGGLVENLNLRMTQVRDSEGRLITIPNGEIKVVANLSSRWSRADLTIPIAYQAD
                     IEKALKLIESIGFEMDKDPQWERQILETPQVLGIDQFGDRGLIIRVWIKTQPLKQWDV
                     AREFRRRLKVALDQAGISISVPQQAIWVNDEQSLNFQGNGKAN"
     gene            373593..373793
                     /locus_tag="COO91_00376"
                     /note="Nfsy_F00376"
     CDS             373593..373793
                     /locus_tag="COO91_00376"
                     /codon_start=1
                     /transl_table=11
                     /product="Multidrug efflux pump subunit AcrB"
                     /protein_id="AUB34551.1"
                     /translation="MTSFAALLGFLPLVISEGAGASSRWSLGTALFGGLLLSTFLSLF
                     LVPILYILVKSLAQAYQQRLKE"
     gene            373970..374341
                     /locus_tag="COO91_00377"
                     /note="Nfsy_F00377"
     CDS             373970..374341
                     /locus_tag="COO91_00377"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34552.1"
                     /translation="MIEGQLASKSGMSGMALKTAFAALKGVKPGYIPYVVEQILPQCF
                     TALDPIWSEGVQKGDPIEYLSANRSQTADALLGVTDARVKNAKRQMVRGTYEKFRGSA
                     KKHVEEAVPDLAKVIENYTKS"
     gene            374504..376129
                     /locus_tag="COO91_00378"
                     /note="Nfsy_F00378"
     CDS             374504..376129
                     /locus_tag="COO91_00378"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34553.1"
                     /translation="MRASPLNIRVQDIDHCGIVAGICDEMNLVEQINRLLGTHSQEII
                     SAGQVVKAMILNGLGFVSAPLYLFEKFFVGKATEHLLGEGIRPEHLNDDRLGRVLDKL
                     YEAGLTEVFVTVAICAARKFGVKMDSLHLDSSSFHVDGDYINNPTAQEAAEPGGIEIT
                     YGYSRDHRPDLKQFILDLMCSGDGDIPLYLRVGDGNESDSAMFATIIADFQRQWQIDA
                     LFVADAALYTEENLQQMKHLRWVSRVPGTLTAAKMLSENIPEQAFNDSAMPGYEIAAI
                     CSEYGGIRQRWLVVESQARKDADLKQLEKRLTKQLSKAQSELRLLLNQEFACSKDALI
                     AAQRLSSKLPLHQLANIQVNEVKKHTGRGRPSKDASPTFYYQVDASLEPKEIAIAIET
                     KRAGRFILATNVLDAEELSNDDILREYKAQQSTERGFRFLKDPLFFTSSVFLNSTERV
                     AALAMVMGLCLLVYSLGQKALRQALERAKKTIDNQLGKPTSTPTLRWVFQCFMSIHLV
                     TIAQIKQIANLTHERQWILQFFGAPCRKYYLLS"
     gene            376508..377422
                     /locus_tag="COO91_00379"
                     /note="Nfsy_F00379"
     CDS             376508..377422
                     /locus_tag="COO91_00379"
                     /codon_start=1
                     /transl_table=11
                     /product="Murein DD-endopeptidase MepM and murein
                     hydrolase activator NlpD, containing LysM domain"
                     /protein_id="AUB34554.1"
                     /translation="MKKVTVYRYRTYALIGLISLTAVLSTTTPVLTQLADDSPIGAQT
                     LIPASNLIWPTQGFISQGFRKYQHEGIDIAGASGTPIVAAASGTVIKAGWDNWGLGNA
                     ITIKHIDGSITVYGHNRRFLASKGQQVIQGQIIAEMGSTGNSTAPHLHFEVHPNGRIA
                     VDPLRMLTSLTASVASAANQQMDNLKHPVSTPPLAKQVSPSEPIPIGFAPVSTDTKCN
                     GVTMIEGETASIRVKVCEENGQLFYIGQLKQEPTKPIKIAALNIGKGRYRADNSSFYY
                     LVSPEKVEVWRNGTQMRSDRFYNLTKSP"
     gene            377430..377558
                     /locus_tag="COO91_00380"
                     /note="Nfsy_F00380"
     CDS             377430..377558
                     /locus_tag="COO91_00380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34555.1"
                     /translation="MQYLTVLQAIAYPAQFAKSVHNSLYIAVAMINKRLTVKSSVR"
     gene            complement(378198..378654)
                     /locus_tag="COO91_00381"
                     /note="pseudogene"
     gene            378775..379152
                     /locus_tag="COO91_00383"
                     /note="Nfsy_F00383"
     CDS             378775..379152
                     /locus_tag="COO91_00383"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34556.1"
                     /translation="MINRGDLSNEQWERLKSLLPSEKPRTGKPNHDHRRVVNGILWIL
                     RTGAPWRDLPERYGKWQSVATRFYRWQKAGIWNQILAHLQAMPAAGYAYASLEGRLDW
                     EVHYVDGTVIRAHQHAAGGILGR"
     gene            379133..379543
                     /locus_tag="COO91_00384"
                     /note="Nfsy_F00384"
     CDS             379133..379543
                     /locus_tag="COO91_00384"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34557.1"
                     /translation="MEYWGDEHEKLGRSRGGFSTKIHIRCEGKGKPITFILSPGQRNE
                     SIFLEQLMEQGAVKRSGRGRPRLRPLRLVGDKGYTGRRIRNYLRRRGIRLTIPRLSNE
                     PRRGSFSREIYRQRNIVERAINRTLAVSPHRYPI"
     gene            complement(379820..380116)
                     /locus_tag="COO91_00385"
                     /note="Nfsy_R00385"
     CDS             complement(379820..380116)
                     /locus_tag="COO91_00385"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34558.1"
                     /translation="MLMTRRRSPPKASQPLLTANLKLAENFCIYLEKHRHRIVNYQYY
                     QAEQICSIGSGAIESTVKQIDRRTKISGAQWKIENVPQIIAHRCAYLNGLIFAP"
     gene            complement(380894..381022)
                     /locus_tag="COO91_00386"
                     /note="Nfsy_R00386"
     CDS             complement(380894..381022)
                     /locus_tag="COO91_00386"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34559.1"
                     /translation="MTEEENQLLIEHARAMPTAGYANAKILYKDAPIEELTSVRVD"
     gene            complement(381841..382470)
                     /locus_tag="COO91_00387"
                     /note="Nfsy_R00387"
     CDS             complement(381841..382470)
                     /locus_tag="COO91_00387"
                     /codon_start=1
                     /transl_table=11
                     /product="kaiB, circadian clock protein KaiB"
                     /protein_id="AUB34560.1"
                     /translation="MQEILDLPEPPHFLVPCYTATIDHWLDPRTQKVRTFAEAYPAVI
                     RHQALLNAIFATGELVWQAAPWQEGLCDRMVLTTYRSSFPQLWEDHDLIVRLDLSEPV
                     PKYHQPVIVQKKEVITQGYVLRLFVAGHSSTTERILQNLHELLERSLGHPYTLKVIDV
                     LSHPEQAELNQVSATPTLVKVWPHPIRRIVGELDHVEKILQMLAAKEKF"
     gene            382556..382876
                     /locus_tag="COO91_00388"
                     /note="Nfsy_F00388"
     CDS             382556..382876
                     /locus_tag="COO91_00388"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34561.1"
                     /translation="MPLNNWGVDSLFVVKLFTEVRKLKVKILSFTFYLSYNRNQDDKD
                     IWEWGVGDEGAGGAGEAGGDEGDEGQELITISHAQCPMPHAQFPMPILNSTSEKLCHF
                     VRSW"
     gene            complement(382829..384103)
                     /locus_tag="COO91_00389"
                     /note="Nfsy_R00389"
     CDS             complement(382829..384103)
                     /locus_tag="COO91_00389"
                     /codon_start=1
                     /transl_table=11
                     /product="pilT, twitching motility protein PilT"
                     /protein_id="AUB34562.1"
                     /translation="MTQSQSPSNSNSAAGRNLPPMPPPPPPTSSTQRQMTQTLDMSDR
                     STNAPVAGHRPVSPPPIPSSVPLKNSSPQLTLAKLIREAFDQGYSDIHLGVGEVPRFR
                     SRGEIQPTDYPETDKEAFMSWLREVMSEGEIQRFEEHLEFDGATQYDFARVRINVFGS
                     LKGPAMVLRLIPLKILTMEQLRLPPVFRDICHHHKGLILVTGPTGSGKSTTMAAMVDY
                     INKEMAKHIITIEDPIEFIHQSRKSLVKQREVGMHTRKFDNALKAALREDPDLILVGE
                     MRDKETVNTALKAAQTGHLVMGTLHTNSAVKTIERILNLYSGDEQDAMRVAISESLVA
                     VIAQGLCRTTDGKRAAFHDVLINTEAIKEWIKDGKYDEIGELMKQAGFDGMVTMNQSL
                     LNLYQDGRITEETALEMSPTPNEMAQFLRGRV"
     gene            383964..384134
                     /locus_tag="COO91_00390"
                     /note="Nfsy_F00390"
     CDS             383964..384134
                     /locus_tag="COO91_00390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34563.1"
                     /translation="MVLLSDISNVCVICLWVLEVGGGGGGIGGRLRPAAELEFDGDCD
                     CVIYLHIWQLKS"
     gene            complement(384690..384839)
                     /locus_tag="COO91_00391"
                     /note="Nfsy_R00391"
     CDS             complement(384690..384839)
                     /locus_tag="COO91_00391"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34564.1"
                     /translation="MTFPPKNTQRILIFSHISLIASKLILFLSEIQYIKTNWENEHLF
                     TKLYS"
     gene            384838..385212
                     /locus_tag="COO91_00392"
                     /note="Nfsy_F00392"
     CDS             384838..385212
                     /locus_tag="COO91_00392"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34565.1"
                     /translation="MVSAQSSNLGKTYSLLMIKSFLIWTFTLAVCLLVVGFPLVVLMA
                     TVGCLLSIILQSVMPVSAVLLVAGALIMFNVMAVVLAAGVLTVKGVHPSEIKWLSWLH
                     GEADQMQATVYAACPLTCEIKI"
     gene            385487..386617
                     /locus_tag="COO91_00393"
                     /note="Nfsy_F00393"
     CDS             385487..386617
                     /locus_tag="COO91_00393"
                     /codon_start=1
                     /transl_table=11
                     /product="wecB, UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="AUB34566.1"
                     /translation="MTNQKRVCIILGTRPEAIKLAPVIQVFQKSSSFESQVILTGQHR
                     EMVEQVMQLFNIKADYDLEIMQVQQSLNDITCRSLQGLEALFKEKKPDLVVVQGDTTT
                     AFAAALAAFYQKIPIGHVEAGLRTDDIFNPYPEEANRRLISQITQLHFAPTPWAVENL
                     HRSGVLGEIHMTGNTVIDALLNVAATQAVCNVPGLDWDSYRVLLATVHRRENWGEPLQ
                     AIAQGFLQILDKFPDTALLLPLHRNPTVRVPLQELLGNHPRIFLTDPLDYGELVGAIG
                     RSHLLLTDSGGLQEEAPSLGKPVLVLRDTTERPEAVAAGTAKLVGTTSENIFANAAEL
                     LSDPDAYEAMANAINPFGDGHAAERILQIVQNYLGLSSETST"
     gene            complement(387002..388084)
                     /locus_tag="COO91_00394"
                     /note="Nfsy_R00394"
     CDS             complement(387002..388084)
                     /locus_tag="COO91_00394"
                     /codon_start=1
                     /transl_table=11
                     /product="Lantibiotic modifying enzyme"
                     /protein_id="AUB34567.1"
                     /translation="MLNYSINQPLTSLFDIAKNIQIESNFCIYHPNYQPFALPTKIAE
                     RFQHNSVDLQQKYLTLLLRNFLYGIYYNGSLQSTLAVNTDPPKQNLADNSILEIDWDF
                     YEQLHASNHGIGYFDPRWQVLRKEPDGTMAVTKGGLTLYVEPDCHLESSKKSTKVGDM
                     VAIWMPKNRMQNGSYLAVSNIGQERQSNPDAELGAGRIYFNFTPSGAIAFMESLTLQL
                     NAASIPFNFQVLHNPSAYGRYDSGLLYFELPDYPAIRTILQAIYPENQSYFQPEIPLF
                     TKFLAPGLGLAEEPIQKFAAQESFGMNRCQIVANALFEAWQKGKNAMEERMKTIDEHF
                     ARHLIDLQRPYLNPSSEDIYKPIRLG"
     gene            complement(388166..389425)
                     /locus_tag="COO91_00395"
                     /note="Nfsy_R00395"
     CDS             complement(388166..389425)
                     /locus_tag="COO91_00395"
                     /codon_start=1
                     /transl_table=11
                     /product="putative kinase, aminoglycoside
                     phosphotransferase"
                     /protein_id="AUB34568.1"
                     /translation="MVLSLSSHNVIQYLLEAGLCSSEDDASDKSELPGSSKNNFGLLV
                     TLADNRQLLIKQKRNLNNNDAAPHELFQEWLFHQLLQQFPVLGNISAMPTAVNYAPLV
                     VHFDEENSILVRNYLGDYLELATFYHNNDIFPQEIATAIGTTLAGLHRATYNRREYKD
                     FMATAPQGEFRYGFYNPAQGVESIGPEIFGTVPTDALKFYLLYQQSESLESAIADLAY
                     SWNPCCLTHNDLKLNNILVHSRWEQLDNCLVRLIDWEACSWGDPAFDLGTLLASYLRI
                     WLNSLVVDPTIELQESLHLALTPLESLQPSIIALIRAYLNAFPMILEYHSDFIVRVIQ
                     FAGLALIHEIQDMITWRKSFNNADICMLQVAKSLLTMPQQGVLTIFGISESEILNPVA
                     KIHKLPQPIKEPQLLRLYYEKTRLRGC"
     gene            complement(389630..389758)
                     /locus_tag="COO91_00396"
                     /note="Nfsy_R00396"
     CDS             complement(389630..389758)
                     /locus_tag="COO91_00396"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34569.1"
                     /translation="MTTVHQTTSAANQFFAGNASALPPGDAATSMGFYHKNCSRCI"
     gene            complement(390177..390470)
                     /locus_tag="COO91_00397"
                     /note="Nfsy_R00397"
     CDS             complement(390177..390470)
                     /locus_tag="COO91_00397"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein A like"
                     /protein_id="AUB34570.1"
                     /translation="MLKDIIAVEPRENYQLHIRFEDDVEGIIDISKIVKFTGVFAPLQ
                     DKEYFATVCVNPEYGTIQWESGADLDPDVIYALITKEPIPQYQLSAVSANSAD"
     gene            complement(390474..390734)
                     /locus_tag="COO91_00398"
                     /note="Nfsy_R00398"
     CDS             complement(390474..390734)
                     /locus_tag="COO91_00398"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34571.1"
                     /translation="MPEISRFFGIIITMYYNDHPPPHFHVRYNNQKAIVSIQTLEILE
                     GELTARLFKLVTEWAILHQVELMEDWELARDNQTLEKISPLE"
     gene            complement(390739..390987)
                     /locus_tag="COO91_00399"
                     /note="Nfsy_R00399"
     CDS             complement(390739..390987)
                     /locus_tag="COO91_00399"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding transcriptional regulator
                     YafY, containings an HTH and WYL domains"
                     /protein_id="AUB34572.1"
                     /translation="MHLFAGLAFAYQAKPEDKINEWIPDKARVRRVIRRVSSTFWFIR
                     EVMQYAPDCVVILPENVRDRLKQKLLTLCHLYDIETRE"
     gene            391060..391411
                     /locus_tag="COO91_00400"
                     /note="pseudogene"
     gene            complement(391412..391822)
                     /locus_tag="COO91_00402"
                     /note="Nfsy_R00402"
     CDS             complement(391412..391822)
                     /locus_tag="COO91_00402"
                     /codon_start=1
                     /transl_table=11
                     /product="putative protein YjbI, containings pentapeptide
                     repeats"
                     /protein_id="AUB34573.1"
                     /translation="MRIDDYNAAKALTEKLKENLPIKARAGKEFLKTLKQKGVNADPD
                     REFEIDFVGYSGDEGGIMCGLKEPNNPESEEKYVSSITHLKIDTNHPLAAEVQTYQRQ
                     RIRKLMLQDSRGFKAELMTIEPRKNKNRGKGFGK"
     gene            391932..392552
                     /locus_tag="COO91_00403"
                     /note="Nfsy_F00403"
     CDS             391932..392552
                     /locus_tag="COO91_00403"
                     /codon_start=1
                     /transl_table=11
                     /product="Oxoglutarate/iron-dependent dioxygenase"
                     /protein_id="AUB34574.1"
                     /translation="MKHYQQQSNAFPSDYLNNLWGEIQACPYFAINNLNRDFVATKGF
                     SVVFQRSGLAKVEQQFPYFKPYLDLAIQPSCNAFYLNPLQLKEGSRVDPHIDRSLRSY
                     SKTIEPPAVVSVLYVRVPPDMEGGELVLRSHKRQLGQIKPQFNTLVYFQGDLTHSVNA
                     VKTPGNRLSLVCEQYSLSDAELQEIPEFTVESRSTQSTTKKRKYAS"
     gene            392542..393399
                     /locus_tag="COO91_00404"
                     /note="Nfsy_F00404"
     CDS             392542..393399
                     /locus_tag="COO91_00404"
                     /codon_start=1
                     /transl_table=11
                     /product="cas6, CRISPR-associated endoribonuclease Cas6"
                     /protein_id="AUB34575.1"
                     /translation="MPHSLVLNLLPQSPIPPQYLTGRHLHALFLTLVSSVDSTLGDRL
                     HDSTADKAFTLSPLQINSPLLKGGKGGSKLQYSHQQPIPAGTPCWWRISLLDDTLFGK
                     LTQLWLNLNPNRPWHLGPADLYITSIQGTPQSLQPWANASTYAQLYEEASDVCDGLRL
                     RNSSINLTFSTPTAFRQGQYDTTLPTRESVFNSLLSRWNKYSGIEFTQIAIESIFPSF
                     VNIHTEILADSRSKFIGIIGEVTYKILGAVEPIQIKQINALADFALYSGVGRKTTMGM
                     GMTRRLYSP"
     gene            393695..394225
                     /locus_tag="COO91_00405"
                     /note="Nfsy_F00405"
     CDS             393695..394225
                     /locus_tag="COO91_00405"
                     /codon_start=1
                     /transl_table=11
                     /product="cas1, CRISP-associated protein Cas1"
                     /protein_id="AUB34576.1"
                     /translation="MGTVYVTQADAFIGKVDERLTLKAEQKTILDIPLIKIEGIVVLG
                     RATISPAVVSELLERHICLTFLTQNGRYLGRLEPEVTKNIFVRKAQWQAVGESQPAIH
                     LVRGFVRGKLKNYRHSLLRTQREHPDIDLNNNITRLEKAIAPIEKTSSIDSLRGLEGA
                     GSAAYFGCFQQLIKTP"
     gene            complement(394572..395354)
                     /locus_tag="COO91_00406"
                     /note="Nfsy_R00406"
     CDS             complement(394572..395354)
                     /locus_tag="COO91_00406"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease III"
                     /protein_id="AUB34577.1"
                     /translation="MKIATWNVNSIRTRLEQVIDWLTTNPVDVLCLQETKVVDAEFPR
                     SPFEQLGYNLYVSGQKSYNGVAMVSRQPLVNVSSGFRAILPDLHHEWDEQKRVITGVI
                     DGVRIVNLYVPNGAAVGTEKYEYKLRWLTALREYLRLLVLSQPAICVCGDFNIALEDK
                     DIHEQVSTENHIMATESERQALRDILELGFADAFRKFTSEGGNYSWWDYRAAAFRRNL
                     GWRIDHHYLTPILYERATSCIIDVAPRKLAQPSDHTPVIVEF"
     gene            395814..396884
                     /locus_tag="COO91_00407"
                     /note="Nfsy_F00407"
     CDS             395814..396884
                     /locus_tag="COO91_00407"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycosyltransferase involved in cell wall
                     bisynthesis"
                     /protein_id="AUB34578.1"
                     /translation="MKIAQVAPLWERVPPPNYGGIELVVSRLTDELVRRGHEVTLFAS
                     GDSQTLAYLEAVYPRALRLDPNVKEYAVYEMLELSQVYQSAAQFDIIHSHVGISALPL
                     ASLITATSTVHTLHNDFTTDKRKAFSYHKKQPYVSISNSQRQIDLNYIDTVYNGIELA
                     DYPFIAQPSEPPYLAFLGRFSPEKGPQHAIAIAKQSGWRLKMAGKVDVQDSKFFEQEI
                     APLIDGQQIEYVGEINHAEKTELLGNAAITLFPISWQEPFGLVMIESMATGTPVIAMN
                     FGSVPEVIAHGKTGFICKSYAEMAAMIPLALELNRQTCRKHVENNFSVSQMVNGYEAV
                     YRQIIKDRIESNGCICAANIQF"
     gene            397362..398384
                     /locus_tag="COO91_00408"
                     /note="Nfsy_F00408"
     CDS             397362..398384
                     /locus_tag="COO91_00408"
                     /codon_start=1
                     /transl_table=11
                     /product="SORD, L-iditol 2-dehydrogenase"
                     /protein_id="AUB34579.1"
                     /translation="MLAALLYGQENLRLEEVPDPTPAAGEVVIQVGAATTCGTDLKVW
                     RRGGHARMLIPPTLFGHEAAGRIVALGTGVTNWQVGDRIVANNSAPCMKCFFCQRKEY
                     SLCPNLTWNNGTFAEYLKIPAPIVEHNLLQIPDELPWELAAMTEPLACVLHGIARSNV
                     KAKDKVVVLGDGAIGLMFVAALSRKTEVLLWGGNNHRLEIGQKLGATQTFNYHQIPDI
                     PSVVKELTQGWGADVVIEATGVPSVWETAIACARPGATVNLFGGCPRDTSITVNTEQL
                     HYSELTLKGVFHNTPEYVRQALALIASRKIPFELLISEQRPLKDLEQVFCEMKARQVI
                     KVAMIP"
     gene            398419..398697
                     /locus_tag="COO91_00409"
                     /note="Nfsy_F00409"
     CDS             398419..398697
                     /locus_tag="COO91_00409"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF3303"
                     /protein_id="AUB34580.1"
                     /translation="MLFMVVERFKDGKAKEIYRRFQEKGRMMPEGLKYLDSWVEINFD
                     RCFQLMECDDIRLFQEWIFHWQDLVEFEIIPIVPSKETAEVVTNTISL"
     gene            398792..398953
                     /locus_tag="COO91_00410"
                     /note="Nfsy_F00410"
     CDS             398792..398953
                     /locus_tag="COO91_00410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34581.1"
                     /translation="MTLERRERVPYLLPNKQMLLLNKQMRALNKQMLLLNKQMLSLNK
                     QMRALNKQM"
     gene            398950..399084
                     /locus_tag="COO91_00411"
                     /note="Nfsy_F00411"
     CDS             398950..399084
                     /locus_tag="COO91_00411"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34582.1"
                     /translation="MIAQQANAVAQQANVIAQQANAVAQPDFSRDVEKGIDFCKRSNI
                     "
     gene            complement(399168..400787)
                     /locus_tag="COO91_00412"
                     /note="Nfsy_R00412"
     CDS             complement(399168..400787)
                     /locus_tag="COO91_00412"
                     /codon_start=1
                     /transl_table=11
                     /product="4-amino-4-deoxy-L-arabinose transferase or
                     related glycosyltransferase of PMT family"
                     /protein_id="AUB34583.1"
                     /translation="MQEGSFIWSHLEKQHRTVGRWIDWVWLMVLLLAAVLLFSINLGG
                     LPLRDWDEGTVAQVAREIWHAPAGSMRWLYPTLGGEPYHNKPPLMHLLIAWAYSLGGE
                     NELTTRLPGAILTATSVPLLYCIAREIFRQRWAAIYSALIYLTMLPVVRHGRLAMLDG
                     AMVSFLMVMMLCVLRSRRDLRYCLGVGVSFGLICLTQGLLGVLLGAIAIVFLFWDTPR
                     LLTCYYLWIAILIGILPVAAWYSAQLVEYGYTFAQIGLVNPSLGRIGSFVEGNPEPPW
                     YYVIELLKYTWPWLLFLPQTVRLTWENRNLSWAKLVMAWSGVYLLVISFMITKVPWYL
                     FPIYPSLALAFGIQLSDTENSPLLSSYPRAWVAGLAILAVAASAGSIYFSCGTTPKTD
                     LQLIFAAVALTMTLAAILAERGDGQFLKILFWGSYISLLLLMKSNYWVWELSEAYPVK
                     PVAAMIVRANPATRKIYTSFPYHRPSLDFYSDRTIIPASVGELEYYWHYNGQPYFLLH
                     ASAFNNLELESMKLVDEAEGWKLVTKDTNRL"
     gene            401371..402552
                     /locus_tag="COO91_00413"
                     /note="Nfsy_F00413"
     CDS             401371..402552
                     /locus_tag="COO91_00413"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34584.1"
                     /translation="MTLPVVVDITIGLVFIYLILSLIASEIQELISTSLQWRAKHLKN
                     SIELLLAGGSETEESDITKSKKLVDKLYTDPLINTLNQQAKEKIEKQFRELSKSIDKK
                     GLGEKQSGPSYLPSETFAITLLDTLKIPQLINHVKHPSEETKTNLHMILAFYKELKIG
                     VNNRNSEEYKTIQTIYGDIDQKFIDFVNKDLPDDVPDNLIKSLAVIAQRSRIKISDLT
                     QEMNQFQNEIETWFDRSMDRASGVYKRNAKGVAILIGISVAIFTNTDTFHLVSRLSQD
                     SAIRSAITQSASQQADFIKDPEARRQIEKLLGDTSVPIGWQNINHQFELLDVKGSNSE
                     KALLIRFWQGFKLICGWIVSGFAIAMGAPFWFDILNKLVNVRNAGPKPVAYTKDQPPQ
                     K"
     gene            complement(402561..403901)
                     /locus_tag="COO91_00414"
                     /note="Nfsy_R00414"
     CDS             complement(402561..403901)
                     /locus_tag="COO91_00414"
                     /codon_start=1
                     /transl_table=11
                     /product="Site-specific DNA recombinase related to the DNA
                     invertase Pin"
                     /protein_id="AUB34585.1"
                     /translation="MKIIAYSYTNPLLESAPDQGDWGWEVDRVYEDLGKPESSGQATR
                     ESFRHATRSQLQQLFTDCETEPADYLLIRRLEELGDTVEEISDRLHQLEVMGVAIIAT
                     EQPYTSENYPLGADLLNLLHAIQRQQRSRRIRQGHARNRLEVAPPPGKVPYGYRRGKG
                     KYTIDRSTSPVVKDFFEHFLLYGSLRGSVRYLAKKYGKKISVTTGRRWLTNPVYRGNT
                     AYQNGEIISNTHIPIISKEEAAQVDRLLRRNSRLPSRTASAPRSLAGLVVCAECQSHL
                     TVTRVTQRNQDKEYLYLRSTSCPQRPKCKAIPYQEVLEHTIETVCRDLPLAVAGMNFP
                     QLDAVKNSLGQAIARQQEILAQLPALIETGILDIETAKLRAYKLRTEISALEAKLATL
                     PPVNLRSVAQAVSIPQFWLDLSETERRFYFREFIRQIDITVENKELKLRVIFIF"
     gene            403908..404045
                     /locus_tag="COO91_00415"
                     /note="Nfsy_F00415"
     CDS             403908..404045
                     /locus_tag="COO91_00415"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34586.1"
                     /translation="MVISHWSLVSNYYSLPAPPAPPAPPALPASPTPYSQLPLTPDST
                     R"
     gene            complement(404023..404382)
                     /locus_tag="COO91_00416"
                     /note="Nfsy_R00416"
     CDS             complement(404023..404382)
                     /locus_tag="COO91_00416"
                     /codon_start=1
                     /transl_table=11
                     /product="Catechol 2,3-dioxygenase or other
                     lactoylglutathione lyase family enzyme"
                     /protein_id="AUB34587.1"
                     /translation="MQITQSLHTAILVTDLERSEHFYGKVLGLSKIDRSLKYAGAWYQ
                     VGNYQIHLIVAPTVPTENPNEKWGRNPHVAFSVTDLDAAKEQFLNHNYPIQPSASGRP
                     ALFTQDPDGNIIELSQE"
     gene            404490..404609
                     /locus_tag="COO91_00417"
                     /note="Nfsy_F00417"
     CDS             404490..404609
                     /locus_tag="COO91_00417"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34588.1"
                     /translation="MDSTQKRYYIDAIALLSNKCPLAVEYLHRRVISMQTLAI"
     gene            complement(404581..404742)
                     /locus_tag="COO91_00418"
                     /note="Nfsy_R00418"
     CDS             complement(404581..404742)
                     /locus_tag="COO91_00418"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34589.1"
                     /translation="MIAFNRGATRSYSLVRRAEQVGTMALLVETMALSVETMALLVET
                     IKLQEFALR"
     gene            405431..405550
                     /locus_tag="COO91_00419"
                     /note="Nfsy_F00419"
     CDS             405431..405550
                     /locus_tag="COO91_00419"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34590.1"
                     /translation="MFIPVFISSYSQISQLFFSKLLLIYYCEVYERKFIKKAN"
     gene            405762..406124
                     /locus_tag="COO91_00420"
                     /note="Nfsy_F00420"
     CDS             405762..406124
                     /locus_tag="COO91_00420"
                     /codon_start=1
                     /transl_table=11
                     /product="CBS-domain-containing membrane protein"
                     /protein_id="AUB34591.1"
                     /translation="MAPFGATSVLIFGVPDSPLAQPRNVIGGNLVAALVSLIVLHLFG
                     SSPWTMGMAVATAIGMMQLTGTVHPPSGAVALVVMMTKAPWQFLLTPALEGSIILVLC
                     AVVFNNLAQERTYPKHWL"
     gene            406266..406595
                     /locus_tag="COO91_00421"
                     /note="Nfsy_F00421"
     CDS             406266..406595
                     /locus_tag="COO91_00421"
                     /codon_start=1
                     /transl_table=11
                     /product="putative nucleotidyltransferase"
                     /protein_id="AUB34592.1"
                     /translation="MGGSRARGNHTNKSDVDLGIYYNKEKPPDLIALNRLACELDDNH
                     RVNLITGIGEWGKWINGGGWLVVEGVGVDFLYRDLASVNRVIDDCHIGRITIDYQPGH
                     PLKVTKR"
     gene            406628..406741
                     /locus_tag="COO91_00422"
                     /note="Nfsy_F00422"
     CDS             406628..406741
                     /locus_tag="COO91_00422"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34593.1"
                     /translation="MLFRKQKYYSVSEGKTYLAALPAGYDGEFGPGGMPLS"
     gene            complement(406738..406908)
                     /locus_tag="COO91_00423"
                     /note="Nfsy_R00423"
     CDS             complement(406738..406908)
                     /locus_tag="COO91_00423"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34594.1"
                     /translation="MALRKEKIVEAAGVQRSGGAGEKEEVLGIAFGYLEIPLCTPAPL
                     PLCNPYAAYSSA"
     gene            406935..408101
                     /locus_tag="COO91_00424"
                     /note="Nfsy_F00424"
     CDS             406935..408101
                     /locus_tag="COO91_00424"
                     /codon_start=1
                     /transl_table=11
                     /product="Regulator of replication initiation timing"
                     /protein_id="AUB34595.1"
                     /translation="MSMYYGGNMTQGKLLEFLEDIGISMSSGYLSNLLIKNQEDFEAE
                     FNELYTEGLASSPWQHLDQTSARVKGINHTTNVICNPLYTVYYTTLRKDRLSVLGVLQ
                     NKQEIEFILNPLTSELLGNLNLPTKWKNQLKLLPQNISFTESEFNTLLDTYLSKLGSQ
                     HRTRVLEAAAISFYHQQADIPIVHTLVCDDAPQFRLLTDNLALCWVHEGRHYKKLTPF
                     VACHQEILDDFLTEFWDYYRELLAYRDSPNQKKKLELQSKFGEIFGTETGYKQLDERK
                     RLTAAKVSELLLVLEYPELPLHNNPAELAARTMVQRRNISYATQTSQGTKAWDIFMSL
                     VATTRKLGISFFEYMQDRISHKSKIPSLGTIIRYKCFSQHQPLSCLEELLCMSG"
     gene            complement(408594..408722)
                     /locus_tag="COO91_00425"
                     /note="Nfsy_R00425"
     CDS             complement(408594..408722)
                     /locus_tag="COO91_00425"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34596.1"
                     /translation="MLCTLLKYQILQRFANSKSKLLLDAKLHCDRLKFNLEKVRNL"
     gene            409312..411216
                     /locus_tag="COO91_00426"
                     /note="Nfsy_F00426"
     CDS             409312..411216
                     /locus_tag="COO91_00426"
                     /codon_start=1
                     /transl_table=11
                     /product="Methyl-accepting chemotaxis protein"
                     /protein_id="AUB34597.1"
                     /translation="MDQVITAMADALFITSNLGKIKKVNRAAQQLFGFSEEELINKPI
                     SLIIDDEQVLIEAIHQHSFFQTNLQNLEVVCRTKTREKRLIAFSCSVIPKKIKGLEEI
                     VYIGRDITARQQREQRTSAQYAITRILSESQTVKQVIPQILQSICQNLGWDLGELWTP
                     SQYIGTSIQGHSLNAVLRCVEIWSSRVISAREFKAITWQTTYTPSVGLPGRIWIRRLP
                     LWIQDITEDGDTRRSQPAAEAGLHAAFGFPILDDCEILGVMVFFSRDVQPKDKELLQM
                     MGSIGSQIAQFIKRKQAEDALVESEERYRDLFENANDLILCVNAYGRFLYVNRAWREA
                     LGYSEAEIVNMNIFDIIHPEFKQDCLQRFYRVLSGEKIGQVKAAFVTKDSQTIFLEGN
                     INCKFVEGHPVATRGIFRDVTQRLTVEEALRHQQEETEPLLLNSLPAAISKPLKEEAN
                     IVEDVADVTVLFADIVGFSEIAASMSAIQLVNLLNSIFSTFDRLSKQHGLQRIKTIGD
                     AYIVIGGLPTRRADHAQAIAQMALQMQTAIALFNTENNQNFSIRIGIHRGSVVAGVID
                     FNKFTYDLWGNTVNIARCMESQGIVGKIQVTENTYKSLCDEFLFEKRGEIEVQGKGKM
                     TTYLLIGCKR"
     gene            complement(411360..412532)
                     /locus_tag="COO91_00427"
                     /note="Nfsy_R00427"
     CDS             complement(411360..412532)
                     /locus_tag="COO91_00427"
                     /codon_start=1
                     /transl_table=11
                     /product="DHPS, deoxyhypusine synthase"
                     /protein_id="AUB34598.1"
                     /translation="MSKQLGQKIAPTPISNDINVVDLIDQYFTAYNSARLREICQLLS
                     RDVLTEGVTVGVSLSGAMTPAGFGVSALAPLIRNGFIDWMISTGANLYHDMHYGLGFE
                     LFAGNPFLDDVKLRQEGTIRIYDIIFGYDVLLETDAFIRKILQGEAFQKRMGTAEFHH
                     LLGKYVREVEKQLGVQHSCLLATAYEYGVPIYTSSPGDSSIGMNVAALALEGSQLVID
                     PSIDVNETAAIAYNARESGGKSAAVILGGGSPKNFLLQTQPQLHEVLGLEERGHDYFI
                     QFTDARPDTGGLSGATPSEAVSWGKIDPEELPNTIVCYTDSTIALPLVTAYVLNKCQP
                     RPLKRVYDRREAILDKLQKDYLAAKTQPSDQVPAAVADSAQKQTATYPCGRLIPNT"
     gene            412754..413668
                     /locus_tag="COO91_00428"
                     /note="Nfsy_F00428"
     CDS             412754..413668
                     /locus_tag="COO91_00428"
                     /codon_start=1
                     /transl_table=11
                     /product="Cellulose biosynthesis protein BcsQ"
                     /protein_id="AUB34599.1"
                     /translation="MGMRQQRTQPMGYVIATANMKGGVGKTTLTVNLATCLAKNYGKR
                     VLVLDLDSQISATLSLMSPLDFAKRRKQSKTFRYLIDQVINPEPEAKLTIQDIIQSQV
                     CNLPGLDLLPGDIDLYDEFVVSEMLHQQATALGEQDFETIWNRFERVLINNILKPVRQ
                     EYDFILLDCAPGYNLLTRSALAASDFYILPAKPEPLSVVGIQLLERRIAQLKDSHGHE
                     TKINIKMLGIVFSMSSANLLTGRYYKQVMHRVVEDFGVEKICKVQIPVDVNVAKAVDS
                     FMPAVLNAPQSAGSKAFFQLTQELLQKL"
     gene            413892..417278
                     /locus_tag="COO91_00429"
                     /note="Nfsy_F00429"
     CDS             413892..417278
                     /locus_tag="COO91_00429"
                     /codon_start=1
                     /transl_table=11
                     /product="Amino acid transporter"
                     /protein_id="AUB34600.1"
                     /translation="MLTKNFVQAEKDQRLVMRLPRTLSYLETWGFGLTGHVGWIGTAP
                     IIHAALGPKAILVWLFGTIISFLLNLQVQSLGRHWSDVAGGTPNYTTRLLKNFPGLGR
                     YVALGYFFSWAAAPALYAIILTNLIKVNFEALGISCPETFLKVLFTAIPFILAFSGTR
                     ALALLHLFFVLPAILLLLLFCVQGVVWSAFSTTGFKLLLTSTDSLSFGKWAKCFFVAS
                     YSIYACETTSSFVADSRHPHKTLGFLTVAAWLLPAVFLGGSWVLMCSAPNPTIGDDTF
                     LNLVAASKPFWGESASFIVTLIITVSCLLSAATAVSNSPRILYQLALDGEVSPLFALV
                     SPQGVLGPAILVTFLLSLLCLNLGNVPQLITVAGTCYLMSIMGLHLGLWLCRGKPQVL
                     WPWWSLGFLCVEAVVLIVGGLAWNWKDFLVGLLLPILLMIGDVALRRLKLPPLHLKWW
                     TQNYDVRSTSRNNQDFVVLQVVVLVSLICITATSSWVIRDLLDANYHNIHNSLLAILL
                     VTLSFAGVAIACWTTLPQIVAIDNARKQAKNLLITTLDTVPDTVLVLDENGKICQTNA
                     AAEELFQTTVQQLLGKKLNQILISYHGKPEQWSIRSEQTLKIIQGVRIVESTISQPFN
                     SQIREYIVIVRDITKRKLVEKELVQYRHQLEQMVLERTIELIRVNQQLEQDIIKRQQA
                     QEQLLHNSLHDGLTGLPNQRLFLERVQGAIERTKQQNKYLFAVLFLDLDRFKVVNDSL
                     GHLLGNQLLIEISHRLKSVLRVGDIVARFGGDEFTILLEEIEDISTAIQVAERIKKVL
                     ALPFQLNEHRVFTNASIGIALSKVDYEQAAQILRDADVAMYCAKSLGKARYEVFDRKM
                     HEGASLLLELETALRNALLKQEEFRLDYQPIISLITGKLIGFEALIRWHHPERGLISP
                     QDFIPLAEETGMIVSIGQWVLYEACHQMHKWHKQFPSSLPLTISVNFSGKQITQPDVF
                     KEVKHILQETGLKPCSLKLEITETFLMDNFELAITVLSQLAALNVEMHMDDFGTGYSS
                     LNYLHRLPIKTLKIDRSFVNNIGSRGENLEIVRAIVTLAHNLNMSVTAEGIETVEQLA
                     QLKALQCDYGQGYFFLPAMERAEVERLLAANLCYKNFLKR"
     gene            complement(418398..419375)
                     /locus_tag="COO91_00430"
                     /note="Nfsy_R00430"
     CDS             complement(418398..419375)
                     /locus_tag="COO91_00430"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34601.1"
                     /translation="MTGRRVLFLGIIVSILLTYAIWVGGSIPASITKLPDQGLNWYYW
                     KLPQPTFWSRATAWGMYLGHQFSIWGCIWWAQRSQLKYKSALHPINYLMLAINGAFIA
                     LHFLQTYIWYDALAQDTSIWASQGAVVLLLVFVLILETPRRGLFFGNSVPFHQQFLQI
                     IKLYHGYFFSFAAIYTFWYHPMEATLGHLIGFLYMFLLLLQSSLIFNRTHVNRWWTFT
                     LEITVLLHSVIVSFMLGQTKWPTFLFGFLGILVLTQLHGLPVNILTKRTIYGAFLVSV
                     MTVYGLTERGLGRIYEVTYIPLIEFGLVGVIYLIFLLILWTISRLPVKR"
     gene            complement(419405..419521)
                     /locus_tag="COO91_00431"
                     /note="Nfsy_R00431"
     CDS             complement(419405..419521)
                     /locus_tag="COO91_00431"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34602.1"
                     /translation="MADVSKILDTPKSSDKLEDFEKVIPPFYYELRITLAQR"
     gene            complement(419554..420774)
                     /locus_tag="COO91_00432"
                     /note="Nfsy_R00432"
     CDS             complement(419554..420774)
                     /locus_tag="COO91_00432"
                     /codon_start=1
                     /transl_table=11
                     /product="putative arabinose efflux permease, MFS family"
                     /protein_id="AUB34603.1"
                     /translation="MESKNNSRAIFVLFLTVFIDLLGFGIILPILPLYAEQFGANPNE
                     ATLLIAIYSLMQFLFAPLWGKFSDRYGRRPILLLTLLGSVIAYAGLGFANSLWILFIA
                     RSLAGIMAGNISTAQAYIADITTPANRARGMGIIGAAFGLGFILGPAIGGLLIGSDPN
                     NANFHLPSLFAAGLSLLALLCGLMLLPESLNSETKAKIQVHRHRQRRLNLLQLSQRPQ
                     FCLLVGIYFFVTFAVAAMDSTLALWSKQQLNWGPQQTSYLFAFMGIVSTIIQGGLIGF
                     LKKYFGEIKLLILGILGLGLGLLLIGFSQSLILLLIATTLVAWGISVSQPILNSLISQ
                     MTAPEEQGQILGIASSCSALARIGGPTWAGVSFMKFGSYAPFLSGSLVMLIALALSLR
                     VTTSASEQKTERIA"
     gene            complement(421614..422408)
                     /locus_tag="COO91_00433"
                     /note="Nfsy_R00433"
     CDS             complement(421614..422408)
                     /locus_tag="COO91_00433"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34604.1"
                     /translation="MKFTLHQFFKLSVKYLPAITAIITVLSLPVQAATFLVKERALLG
                     GNDEVDWASLGKVFNPSAPDFSVFLPNSFLATSQGGLGLDVNITPTNNPQITPPFIFQ
                     TLPAPGIRTNFAQGDFILFGGINPTGFQPLPPGSPDPRTQGNGGPLSISFAQPVYGAG
                     TQIAVDISNLEVETFINAFDSSNNLLGSFSVLSTSSLALDNSAVFLGVRSDTPNISRL
                     VFSSSAPQYGLAINQVSIVAAPEPTFTLAILAFGISGAVLKLRQRS"
     gene            complement(422680..423978)
                     /locus_tag="COO91_00434"
                     /note="Nfsy_R00434"
     CDS             complement(422680..423978)
                     /locus_tag="COO91_00434"
                     /codon_start=1
                     /transl_table=11
                     /product="Ca2+-binding protein, RTX toxin-related"
                     /protein_id="AUB34605.1"
                     /translation="MLTVLNPEDTVSILGGNLVFGGNGKSLVEQENNLILGGNIFDGS
                     NGTSLVEQGNNLINSGNISDGNNGNILLNQRNNVINSGNIFDGSNGNILLNQGNNVIN
                     GKDVNNSIDASQFSSGVSITADLEAQTISLNNVPVLGTLTFKIANIANVIGTNNADSI
                     KGDSQNNQLTGLADDDLIDGGLGNDVIDGGLGNDTLIGGAGDDTFNGSRGNDSINGGD
                     GFDKADYSKLGQAITLSGVGAIIKAGGFGTDQVFKVETVIADASVADNSIDASQSLSG
                     VSATANLEAQTISASNVPGLGTLAFNVVNFDNLIGTNESDSITGDSQDNRLVGNAGND
                     TIIGGLGNDTIIGGEGNDVLTGGFGADKFIFNSAKESLDIIKDYNFAQGDVIQVSKVG
                     FGTTNSSDFLYDTSSGKLSFLGNQFAFVENLSSNVSIQLV"
     gene            424646..424879
                     /locus_tag="COO91_00435"
                     /note="Nfsy_F00435"
     CDS             424646..424879
                     /locus_tag="COO91_00435"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34606.1"
                     /translation="MTNPVKTVIQVNLEMALEVAHELELAPSTQLGAYCLEILREIGC
                     TGTELPLNLQTRDQQLNFITGFASYAFGEVQNV"
     gene            424872..425153
                     /locus_tag="COO91_00436"
                     /note="Nfsy_F00436"
     CDS             424872..425153
                     /locus_tag="COO91_00436"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34607.1"
                     /translation="MYKALIEDIFSDPEETEETTFPATDKDLLILTEKFLGFEIPSKV
                     FLQAIAIADYDGAAAFRYVDNYLTTLKNKNKPKHKKLLVLGASTKYDNN"
     gene            complement(425377..426594)
                     /locus_tag="COO91_00437"
                     /note="Nfsy_R00437"
     CDS             complement(425377..426594)
                     /locus_tag="COO91_00437"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycosyltransferase involved in cell wall
                     bisynthesis"
                     /protein_id="AUB34608.1"
                     /translation="MNILMLSSTFPYPPTRGGTQVRTFNLLKYLSQRHSITLVTQREG
                     DVTDAEVAGLRNCVDHLAIFERPPDSQTTGILKKIQRFGKFLQQGTPPSVLNRYSVEM
                     QTWVDNWVEAGKCDVITCEHSVNEIYVRAHFPKQLKTIVNIHSSVYATCRNQLATGIS
                     ENSLRDKINLPLLRRYEQNYCAKFSAIVATTEEDKIQLQEFNPNSEITVIPNGVDLVS
                     FPNRTTDPGGHRLIFIGAMDNLANIDSVCFFSNEVLPEIQKLYQDTTFDIVGSHPVPE
                     VLALDQKPGINVIGRVPSMVEYLHQATICVVPMRTGFGIKNKTLEAMAAGVPIVASDR
                     GLEGLAVDSAGHPLRALRANKSAEYVTAISQLFEHPHLRSQLSHNGRQLVETEFTWDI
                     AGKSYEQVCLKRD"
     gene            complement(426864..427496)
                     /locus_tag="COO91_00438"
                     /note="Nfsy_R00438"
     CDS             complement(426864..427496)
                     /locus_tag="COO91_00438"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator, NarL/FixJ
                     family, containings REC and HTH domains"
                     /protein_id="AUB34609.1"
                     /translation="MIRVMVVATSPVVRAGLSAVVATNPRLTVVGSASDLDVLAREVG
                     QLQPDVVLVDLSGNLQQSVWEKLLLIQEQQYPLATIVIVEELDSIDLETGLRSGIRGI
                     LPSTSTESEIVAAVEAIAFGLLVLHPDAVELLSIREKVVANPVQTLTPREIEVLGMLG
                     SGLGNKAIAKSLHISEHTVKFHLSSIFQKLSVSSRTEAVAVGVRLGLIML"
     gene            complement(427493..428329)
                     /locus_tag="COO91_00439"
                     /note="Nfsy_R00439"
     CDS             complement(427493..428329)
                     /locus_tag="COO91_00439"
                     /codon_start=1
                     /transl_table=11
                     /product="Periplasmic serine protease, S1-C subfamily,
                     containing C-terminal PDZ domain"
                     /protein_id="AUB34610.1"
                     /translation="MANTTLTNIAAELTEVAAKLRLRTVKVKSGSLGVGSGVIWQADG
                     LIITNAHVATSNRATVELADGRVFDAVRTQFDPQQDLAALKIVATNLTAATIGNSEAL
                     RVGELVLAVGNPFADSGAVTTGIIHANNPRAVMADLQLYPGNSGGPLADCQGRVVGIN
                     TMIVNGLAVAVPSNTVERFLQGNSRPQLGVTLQPVLLSRRSLGLLVLSILPNSAAEIA
                     GVQIGDVLIGVSGRLLTSMNDLTKYLHDSKGSVPLQLLRGGKQFVIYVDVQSGKTAVE
                     AT"
     gene            complement(428701..429612)
                     /locus_tag="COO91_00440"
                     /note="Nfsy_R00440"
     CDS             complement(428701..429612)
                     /locus_tag="COO91_00440"
                     /codon_start=1
                     /transl_table=11
                     /product="Periplasmic serine protease, S1-C subfamily,
                     containing C-terminal PDZ domain"
                     /protein_id="AUB34611.1"
                     /translation="MSSLLALSNSLADTVEQAGSAVVAVNAGTRVSPSGIHWRNGIIV
                     TSDESLQRYDDITITLSNGSTAPVKLIGHDSSTDIAVFKLENVEIPVAKVGDAKTLKV
                     GHLVLGLARGSEGDLRAAMGAVSVVSGAWRSMSGGNIDQFIRPDITLYSGFAGGPLVD
                     AAGFVVGMNTSGRRGTALTIPTATVDRVVDQLVAKGRISKGYLGVGMQPVRLPNNLKT
                     ALNLSSATGVIVVNVESSGPADNAGVLLGDVLVTFDGVTVGDTGDVLALLNSSDRIGK
                     TVKVQVVRGGVLVELAIAVGERPTKEE"
     gene            429669..429962
                     /locus_tag="COO91_00441"
                     /note="Nfsy_F00441"
     CDS             429669..429962
                     /locus_tag="COO91_00441"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34612.1"
                     /translation="MTSEKWGEFILEKWLVPLWGSQKLTLSAVEGSKVKSQILNPSVL
                     LPERENLSPLEWTLAISLGINSKAGYRSARHFDFYKNVGKISRTPNVLHSKLK"
     gene            429970..430839
                     /locus_tag="COO91_00442"
                     /note="Nfsy_F00442"
     CDS             429970..430839
                     /locus_tag="COO91_00442"
                     /codon_start=1
                     /transl_table=11
                     /product="hemD, uroporphyrinogen-III synthase"
                     /protein_id="AUB34613.1"
                     /translation="MADKQMHTQSRKINLLTPSRELPLYGKRILVTAPRNYAYRLSEQ
                     IIKKGGLPVLMPTIETCYLSNYTKLDTTLNHIGEFDWIVFTSRNGITAFFHRMNDLKI
                     PVSVLQKCRLCALGKDAESLLSFCGKVDLIPTESSPAGIVVELAKLPQIHDKKVLIPA
                     PEVVGLPEPDIVPNLITDLQQLGIEVTRVPIYITQGLNTSIYSIELNLIRQGMIDVIA
                     FSSTAEVESFLTMVNSQSDYESCIIACFGPYTTANARKLGVNVSIVAKDYSSFEGFAK
                     AIAEFFTLTSNSH"
     gene            430943..431242
                     /locus_tag="COO91_00443"
                     /note="Nfsy_F00443"
     CDS             430943..431242
                     /locus_tag="COO91_00443"
                     /codon_start=1
                     /transl_table=11
                     /product="petF, ferredoxin"
                     /protein_id="AUB34614.1"
                     /translation="MATYKVTLKTPDEEKTIQVSDDEYILEIANEENDMDLPYSCNAG
                     SCSTCTGKLISGTVDQSDQNFLDDDQIDAGWVLTCVAKPTSDCVIQTHQEDELNG"
     gene            complement(431525..431974)
                     /locus_tag="COO91_00444"
                     /note="Nfsy_R00444"
     CDS             complement(431525..431974)
                     /locus_tag="COO91_00444"
                     /codon_start=1
                     /transl_table=11
                     /product="HSP20, HSP20 family protein"
                     /protein_id="AUB34615.1"
                     /translation="MALVRLNSWQEFNTIQRQINRLFDEDTLPSAFLDKGLSRVPAAE
                     LKETEDAIFLKLELPGIETKDLDLQVTEKAVYLSGERKSEAKSEDKGVIKSEFHYGKF
                     QRVIPLPARIQNTNVTADYKDGILNLTLPKAEEEKNKVVKVNLASSG"
     gene            432819..432974
                     /locus_tag="COO91_00445"
                     /note="Nfsy_F00445"
     CDS             432819..432974
                     /locus_tag="COO91_00445"
                     /codon_start=1
                     /transl_table=11
                     /product="Multidrug transporter EmrE and related cation
                     transporters"
                     /protein_id="AUB34616.1"
                     /translation="MSVAYSVWAGLGTVLIAIIGILWFRESVTLIKLISIALIIMGVI
                     GINASGA"
     gene            433118..433249
                     /locus_tag="COO91_00446"
                     /note="Nfsy_F00446"
     CDS             433118..433249
                     /locus_tag="COO91_00446"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34617.1"
                     /translation="MGARFGVISRLGLTHQVRNVEAIHELPLQEIKAFTAFLRKSYR"
     gene            complement(433301..435502)
                     /locus_tag="COO91_00447"
                     /note="Nfsy_R00447"
     CDS             complement(433301..435502)
                     /locus_tag="COO91_00447"
                     /codon_start=1
                     /transl_table=11
                     /product="Signal transduction histidine kinase regulating
                     C4-dicarboxylate transport system"
                     /protein_id="AUB34618.1"
                     /translation="MEGICGRKGDRMSKKWYRVQKLKAIFILALAVILTNAVVSYSNT
                     VKLISNQEWVTSSYKVVTQLEILQSTLKDTETAQRNYLITADANDLQTYLAAYQETNS
                     NIQILSNLTAQNHQKRQWISLLEPKISNRLNILQQEISLRQDQGFEAVRQQILSDKDR
                     QSSKEIQQLIHDSLEVEQNLLQQGMQQSQASSQKAIVTFFIAAVVDLVLVVLLYDLLW
                     RYIKQLQQTELALRQSENRLRAMIDAEPECIQLIARDGTLLEINAYGLAIMEVESADV
                     LIGKPIDAVIVPEYRAAFANLHKSVCQGNKGTLEFEIVGFKGTRRYMETHAVPLRNES
                     DGTFIHLALMRDITQQKQAEQKIREQGFLLDVSSDAILVRNIHNQILFWNQGAERLYG
                     WKTEEIVGKNVLQLLYKDISPQLEDAYLRVMNKGEWRGELHQLTREGKVIIVESRWIL
                     IRDDNGQPKSILSVNTEITQQKQLEAQLLRSQRLESIGTIAGGIVHDLNNILSPILMS
                     VQLLQKKLPDSQSQEILQTLENNVKRGANLLKQVLSFARGIEGKQTIVQIQPLMAEIE
                     QIITQTFPKSIICQADIPKNLWYVRGDATQLHQVLINLVVNARDAMPNGGILRIAAEN
                     LVIGEHSAQINIDAKVGSYIAIVVTDTGMGMSAEVQQRIFEPFFTTKEVGKGTGLGLS
                     TALGIIKNHGGFVNVYSQVSRGTQFTVYLPASTSRETHLLSPELESVTGDG"
     gene            complement(435938..436228)
                     /locus_tag="COO91_00448"
                     /note="Nfsy_R00448"
     CDS             complement(435938..436228)
                     /locus_tag="COO91_00448"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34619.1"
                     /translation="MRTNQQVSRLWQTLESTPTQQHFHVDMITLFPAPVQRYFLHAIA
                     LGTLLVTSIKLGGIFQAERTFEGITIPSRISAGWWFGTERYVESFVSEIEVL"
     gene            complement(436206..436367)
                     /locus_tag="COO91_00449"
                     /note="Nfsy_R00449"
     CDS             complement(436206..436367)
                     /locus_tag="COO91_00449"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34620.1"
                     /translation="MTFDFRFAVLAVFNLVTLDVTKYVCQNSCGYSYFNSGELLCFGD
                     YASENQSTG"
     gene            436524..437867
                     /locus_tag="COO91_00450"
                     /note="Nfsy_F00450"
     CDS             436524..437867
                     /locus_tag="COO91_00450"
                     /codon_start=1
                     /transl_table=11
                     /product="purA, adenylosuccinate synthase"
                     /protein_id="AUB34621.1"
                     /translation="MANVIVIGAQWGDEGKGKITDLLSRSADVVVRYQGGVNAGHTIV
                     VKGQTFKLHLIPSGILYPNTDCIIGCGTVIDPQILIAELDQLKELNISTDHLLISETA
                     HVTMPYHRLIDQASEERRGSHKIGTTGRGIGPTYADKSERTGIRVLDLMNPDELREQL
                     EWTINYKNVILEKLYNLPPLNAQEVIEEYLGYAERLRPYVIDTSLKISDAIGRRRNIL
                     FEGAQGTLLDLDHGTYPYVTSSNPVAGGACVGTGVGPTMIDRVIGVSKAYTTRVGEGP
                     FPTELDGELGEMLCDRGAEFGTTTGRKRRCGWFDAVIGRYAVRINGMDCMALTKLDVL
                     DELEEIQVCVAYDIDGQRSEHFPTSSRQFARCRPIYKTLPGWKVSTTDCRTLEDLPPQ
                     ALDYLKFLAELMEVPIAIVSLGASRDQTIIVEDPIHGPKRALLQADGTPATLLTA"
     gene            437958..438563
                     /locus_tag="COO91_00451"
                     /note="Nfsy_F00451"
     CDS             437958..438563
                     /locus_tag="COO91_00451"
                     /codon_start=1
                     /transl_table=11
                     /product="RP-L25, large subunit ribosomal protein L25"
                     /protein_id="AUB34622.1"
                     /translation="MAITVESQKRPEGSKPRALRRAGLIPANLYGHKGTESISLTIEA
                     KTVERLLKRASVNNTLIELNIADAPWRGKTLLRELQIHPAKGTPYHLSFFAVAGHGDT
                     TVEVRFRFVGTAVGVKQEGGVLDTVITELQVTCAPENIPDVIEINVSNLQIGDSLSIS
                     DIPFPEGVTPLAESERLVVSVLPPQISAEDAGTETETEAAS"
     gene            438663..440192
                     /locus_tag="COO91_00452"
                     /note="Nfsy_F00452"
     CDS             438663..440192
                     /locus_tag="COO91_00452"
                     /codon_start=1
                     /transl_table=11
                     /product="P-loop containing nucleoside triphosphate
                     hydrolase"
                     /protein_id="AUB34623.1"
                     /translation="MTEATLPAFIEQMLQPGFYPHSVTEPIQLIQTHISYVLLTGDYA
                     YKLKKPMNFGFLDFSTLEKRQHFSQEELRLNQRGAGELYLEVLPITLVGEQYQLGGTD
                     EPVEYALKMRQFPQESLLSTLFEQGKLNETHLDELGRVVAQYHAEAQTNDYIRSFGEV
                     PKVRAAFDENYQQTEKYIGGPQTQAQFTETKQYTDNFFAERPELFASRIHNNYIRECH
                     GDLHLRNIALWHDKILLFDCIEFNEPFRFVDVMYDVAFTVMDLEARQRKDLGNAFLNA
                     YIEQTGDWEGLQVLPLYLSRQAYVRAKVTSFLLDDPSVPATVKEEATKTAGEYYKQAW
                     DYTKPKLGEVILMSGLSGSGKSTTARHLARQLGAIHLRSDAVRKHLGGISLWEKGGDD
                     LYTPEMTEKTYTRLLELGIILAKQGFSVILDAKYDRQQLRQEAIAQATKHQLSLQIIQ
                     CTAPLEVIKERLNNRTGDIADATADLLASQIKQAEPFTEEEQPYVKILDTTLPQQAQL
                     K"
     gene            440302..440811
                     /locus_tag="COO91_00453"
                     /note="Nfsy_F00453"
     CDS             440302..440811
                     /locus_tag="COO91_00453"
                     /codon_start=1
                     /transl_table=11
                     /product="Xanthine/uracil permeases"
                     /protein_id="AUB34624.1"
                     /translation="MADKKNDLFSISPSFFSQLLFGAFLIFILIMTGSSPALSIFLGI
                     MGGFILSWITNITDNSPQAPTVASSDGVDTGLKYWLFFMLGFVYLGYPAPMSILLGGI
                     GALAGGWITAWWGSKEETRTQLQVEELEEGEIEPTNDRINKRQTRRTARRYRRTPGRS
                     INFRFWEKK"
     gene            441056..441787
                     /locus_tag="COO91_00454"
                     /note="Nfsy_F00454"
     CDS             441056..441787
                     /locus_tag="COO91_00454"
                     /codon_start=1
                     /transl_table=11
                     /product="putative SAM-binding protein YcdF, DUF218
                     family"
                     /protein_id="AUB34625.1"
                     /translation="MSLVVALVTLWKRPRTAAIAIAFALTLLLFCSNAWIAKSLVRSL
                     EWQNLTPAQIPVAEAIVVLGGATKSAFFPRTTVDLSESGDRVIYAAQLYRQKRAPIII
                     LSGGRIDWRGSGSPESADMATILTSIGIPSEAIIQEPESLNTYQNAVNVRKILESRGI
                     NQVLLVTSAMHMPRSLKIFQRQGINAIPAPTDFLVSEGELQELGNTPKAAILNLLPDT
                     DNLHQFTSALKEYIGSLIYRLRGWL"
     gene            441985..442182
                     /locus_tag="COO91_00455"
                     /note="Nfsy_F00455"
     CDS             441985..442182
                     /locus_tag="COO91_00455"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34626.1"
                     /translation="MPSPQPQVEEAFATYQTTHQFYHEVRSRSEFQRYCEWYYTTAEQ
                     NRQELKRMRGELNIFQWFRRR"
     gene            complement(442188..442409)
                     /locus_tag="COO91_00456"
                     /note="Nfsy_R00456"
     CDS             complement(442188..442409)
                     /locus_tag="COO91_00456"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin thioredoxin reductase, alpha chain"
                     /protein_id="AUB34627.1"
                     /translation="MKVGDRVRVKDSVVVYHHPEHRNQPFDIKGSEGDVVGIATQWRD
                     RPVSANLPIVVQFSKKFKAHLRENELEVI"
     gene            complement(442876..442989)
                     /locus_tag="COO91_00457"
                     /note="Nfsy_R00457"
     CDS             complement(442876..442989)
                     /locus_tag="COO91_00457"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34628.1"
                     /translation="MSKKYQHFISTQRQSIPPLTQENFNSASVSNKNLTPN"
     gene            complement(442982..445195)
                     /locus_tag="COO91_00458"
                     /note="Nfsy_R00458"
     CDS             complement(442982..445195)
                     /locus_tag="COO91_00458"
                     /codon_start=1
                     /transl_table=11
                     /product="WD40 repeat"
                     /protein_id="AUB34629.1"
                     /translation="MNSFAKKFAQLSLSNQRIFLIDPDVRAKRGKWKPFYKRLTDFNF
                     IDAKIKHSDFGVQSLIADYDLINDSELLKNPEYNPEQVKTLKLIQGALRLSAHILRKD
                     KKQLAGQLWGRMQHFAVPEIQAMLEVAKQQQVLPWLRPLTSNLVSPGGSLLLTFTGHS
                     DWVLALALTLDGKRVISASFDKTLKLWNLETGENERTFHGHSWSVNAVALTPDGRQVI
                     SASDDKTLKLWNLETGENERTFQGHSDFVTAVALTPDGKRVISGSDDTTLKLWNLQTG
                     ENERTFHGHSSSVNTVALTPDGKWVISGSDDTTLKLWNLETGENERTFQGHSDLVTGV
                     ALTPDGKRVISASDNNTLKLWNLQTGEDERTFQGHSKWVNAVALTPDGKRVISASDDK
                     TLKLWNLQTGENERTFQDHSDSVNAVALTPDGKRVISASDDTTLKLWNLQTGEDERIF
                     QGHNDLVNAVALTPDGKRVISASWDNTLKLWNLQTGEDERTFQGHSDCVNTLAFTPNG
                     KQVISASWDNTLKLWNLETGENERTFHGHSDSVTAVALTADGKQVISASWDNTLKLWN
                     LETGENERTFHGHSWGVRAVALTADGKRVISASFDNTLKLWNLETGENERTFHGHSDW
                     VNAVALTLDGKQVISASRDKTLKLWNLETGENERTFHGHSNCVNAVALTPDGKQVISG
                     SYDNTLKLWNLQTGKEIATFIEESPFICCAIAADGVTIVAGEESGRVYFLRLENV"
     gene            complement(445504..445764)
                     /locus_tag="COO91_00459"
                     /note="Nfsy_R00459"
     CDS             complement(445504..445764)
                     /locus_tag="COO91_00459"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34630.1"
                     /translation="MLMMNVVMLMMNVVMLMMNVVMLMMNVVMLMMNIVMLMMNVVML
                     MMNVVMLMMNIAMLRRYVAILLTTASTSKVTANEVAITSQPI"
     gene            complement(445805..447964)
                     /locus_tag="COO91_00460"
                     /note="Nfsy_R00460"
     CDS             complement(445805..447964)
                     /locus_tag="COO91_00460"
                     /codon_start=1
                     /transl_table=11
                     /product="Serine/threonine protein phosphatase PrpC"
                     /protein_id="AUB34631.1"
                     /translation="MISTQLIIYCINPRCNSPINPIGDSVCATCQTPLVHRYLWATGS
                     LSAKISPGTRVAQRYEVISPQIWLDTQPGLLPDIPEELPTEVIPYLRLYQERLHLPQA
                     YGFASNFEGDTTDILLLENVPIDERGNIYPTIVEAWEQATAVRQVYWLWQILQLWTPL
                     SELGLSRSLLVVDNLRVQGWCVRLLELYQTPADEKLSLRNLGECWQFWVASAKASVAK
                     GLQNIVQQMCDEVELETINIQLNNLLLASAAELPLVLKVAGSTDIGPIMAQNEDACYP
                     NALSNLDKKLHPQGDGVFGHGESGIGHEEEVTNAQSPMPHAAEQLSLSTDKGMEFPVA
                     FNELLLPHLSIVCDGIGGHEGGEVASKLAVESVKLQIRALLKEVTEQTVLVPPELLQE
                     QLEASLRVVNNLISARNNQQKRQGKERMATTIVMAVQVPQRVHTSTGWQSNNTHELYL
                     ANVGDSRAYWITRNYCQLLTVDDDVATREVRYAKSLYRKALLRADASALTQALGTRDA
                     EFMRLKVQRLIIEEDGILLLCSDGLSDNNWVEQSWQDYAIPVLTGELTVEDAVRNWID
                     LANEKNGRDNTSVVLTYCRVSPEYLVPVTPTLPEEIIEAEIQEEPEEPKEEKLEELEE
                     LEEPISFTESSQTLLDLDLDLDLSEEPVLSPEIPPTLITKPKRGKGLIMVGGVLALLL
                     GGTSLGLLAWWQFNPQGFQQVCRQLPQGVQQMCPPGK"
     gene            448198..448632
                     /locus_tag="COO91_00461"
                     /note="Nfsy_F00461"
     CDS             448198..448632
                     /locus_tag="COO91_00461"
                     /codon_start=1
                     /transl_table=11
                     /product="Membrane protein implicated in regulation of
                     membrane protease activity"
                     /protein_id="AUB34632.1"
                     /translation="MPSFTLIWLLAGAVLCLMELLLPSAFVAFMMGISALVVALLSGV
                     GLGSVWLQVVVWLLLSTLLIVLSRRFLQPRQRKSKIQDAVIAETLTEIPPGKTGRVLY
                     EGNSWQARCDDDKFTVPPNQRVYVVRREGTTLIVIPENLLSH"
     gene            complement(448640..448789)
                     /locus_tag="COO91_00462"
                     /note="Nfsy_R00462"
     CDS             complement(448640..448789)
                     /locus_tag="COO91_00462"
                     /codon_start=1
                     /transl_table=11
                     /product="Signal transduction histidine kinase"
                     /protein_id="AUB34633.1"
                     /translation="MRKQGEQERIRGRGGRGGQGGIIEQVSSLSLLYAQCPMPNAQCP
                     IPNDK"
     gene            448835..449842
                     /locus_tag="COO91_00463"
                     /note="Nfsy_F00463"
     CDS             448835..449842
                     /locus_tag="COO91_00463"
                     /codon_start=1
                     /transl_table=11
                     /product="Regulator of protease activity HflC,
                     stomatin/prohibitin superfamily"
                     /protein_id="AUB34634.1"
                     /translation="MEQFFLLVFLALGGSAVAGSVKVVNQGNQALVERLGSYNKKLEP
                     GLNFVVPFLDRVVYRETIKEKVLDIPPQQCITRDNVGIEVDAVFYWRIVDMEKAWYKV
                     ENLQSAMVNMVLTQIRAEMGQLELDQTFTARSHISELLLQDLDVATDPWGVKVTRVEL
                     RDIIPSQAVRESMELQMSAERRKRAAILTSEGEREAAVNSARGKADAQILDAEARQKS
                     TILQAEAEQKALVLKAQAERQQQVLKAQAIAESAEIISQKLQNNPNANKAVEVLFALG
                     YLDMGATIGKSDSSKVIFIDPRSIPAALEGIRSVVSDGQANPNELFSKQIPGLENNRS
                     S"
     gene            complement(449819..449986)
                     /locus_tag="COO91_00464"
                     /note="Nfsy_R00464"
     CDS             complement(449819..449986)
                     /locus_tag="COO91_00464"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34635.1"
                     /translation="MITCSGLIIIIHWALGIGHGALGMGHWALGIGHWHCFSLISLIP
                     LIPLLTRTIIF"
     gene            449958..454424
                     /locus_tag="COO91_00465"
                     /note="Nfsy_F00465"
     CDS             449958..454424
                     /locus_tag="COO91_00465"
                     /codon_start=1
                     /transl_table=11
                     /product="WD40 repeat"
                     /protein_id="AUB34636.1"
                     /translation="MIINPEQVINAIIAIANPLIKEKIQRNETVIKLLQQFNLDPEHP
                     PADFSGVYAYTLVEYGVGKPKPFLELFRQEAIKQAFRKAFDHNNPSILLSEVDAWLDA
                     YSLGDDIRSLGIDIRREIAAFYIVFAEVAKRTRNPADTLMSQQIGSLQKRIVNIQELL
                     DRLPTLEGIRTEIARLAAQNSPALLEAETSTENKCRAIALAQQMRGWFETLGYRFEKY
                     EIWGDSYFEWIINVPTRRNRYDRILIRGIEGEVGLKDVAVLRSSVEQQRTDEGWLVTA
                     RRIARAARNEVEKEENRHLGCYTFDELIDQDADFSDYLDWLEAEIIRRQIDTKYVPLA
                     CTKEEIDPETKQRIGISHYSDRDGWIDGYIDMWLDDPAKEHISILGEFGTGKTWFAFH
                     YAWVALQRYRDAQKRGVERPRLPLVITLRDFAKAINVENVLAGFFFTQHNIRLTSEVF
                     DQLNRMGKLLLIFDGFDEMAAKVDRQQMINNFWELAKVVVPGAKVILTCRTEHFPDAK
                     EGRALLNAELQASTKQLTGETPQFEVLELEKFNDEQIRLVLSHQTEAATVEQVMGNPQ
                     LLDLARRPVMTELILEALPDIEAGKPVDMSRVYLYAVRRKMERDIKSDRTFTSLAEKL
                     YFLCELSWEMLSTDEMSLNYRLFPDRIRRLFGSVVQEEKDLDHWHYDMMGQTMLIRNA
                     DGDYTPAHRSLLEFFVAYKFAAELGALANDFTELARVRFQINHDVAPVDYSWSSYFSR
                     QVDASGEILPTAALKGFISESLEKLRVTFGKAPLTKAVMDLLVGMVDVEAKESVIKII
                     EETRGKSEDEVDYVGGNAATLAVKVDRTALEGKYLSGAVIKGADFSSVSLRGLTLTKA
                     SLNESFFTQVLGRVLSVAFSPDGKLFATGEVNCSIRLWQVENSKHISTLQDHTDWVRS
                     VAISNDGKILISGSDDKTVKIWDISKGKCLRTLQGHTSRVYSVAITSDASIVVSGSSD
                     KTLKVWNIHTGECLRTLQGHSKTVYSVAIHSDSSIVASGSYDETIKLWNFQTSECLKT
                     LHGHTGRILSVAITSNGRKLISGGDDTIIKLWNINTGECKKIFQGHTDKLLSITLSLD
                     NKTIVSGGIDRTVKVWNISTGECLKTLPGHNKPVWAVDISPDTNTIVSASSDSTIKFW
                     DTSTGECFNTVHGHTSMVYSVCLSTDNRILASSGDDGQIKIWDVKTGNYLRSLQGHNS
                     RVWSVAINSECTLLASGGGDSTVRLWDIHTGKCRTIVGEQKGQYNSSIYSVAISPDSR
                     LIAAGTGESTVKLWNILTGECIHNLQGHTGRVWSVAISYNNAVLASCSDDQTVRLWDI
                     HTGECLSILQAHDNSVNSILFSLDGKTLFSSSDDQTIKIWDIESRKCLKTLQGHSNRV
                     LSMAIVNDLVIVSSSSDQTIKLWDIYTGECLKTLQGHNNSVWSVTVSNDGATIISGSW
                     DETIKFWDVQSGNCFKTLDNKPYAGMNITDVKGLTTAEIATLKALGAVEDGE"
     gene            454549..455118
                     /locus_tag="COO91_00466"
                     /note="Nfsy_F00466"
     CDS             454549..455118
                     /locus_tag="COO91_00466"
                     /codon_start=1
                     /transl_table=11
                     /product="Endonuclease, Uma2 family"
                     /protein_id="AUB34637.1"
                     /translation="MTLSIQPTTALSVEEFLKLPETKPASEYFNGQVYQKPMPQGKYS
                     TLQIELASAINQVAKPQKLAYAFTELRCTFSGLSIVPDIAVFEWQRIPLDAKGSIANK
                     FDIPPDWIIEILSPEQSPNRVIRKITFSIQNGAKLGWLIDSADESIMIFEPNKLPELK
                     EQQDILPVLSVLENWQLTVADVFSWLTFV"
     gene            complement(455141..455296)
                     /locus_tag="COO91_00467"
                     /note="Nfsy_R00467"
     CDS             complement(455141..455296)
                     /locus_tag="COO91_00467"
                     /codon_start=1
                     /transl_table=11
                     /product="putative nucleic acid-binding protein,
                     containings PIN domain"
                     /protein_id="AUB34638.1"
                     /translation="MIYLDTSVIAPLYWTEALSVSDAVEQLLLNEAEVGLSQLVEVEL
                     VSDSEVH"
     gene            complement(455293..455529)
                     /locus_tag="COO91_00468"
                     /note="Nfsy_R00468"
     CDS             complement(455293..455529)
                     /locus_tag="COO91_00468"
                     /codon_start=1
                     /transl_table=11
                     /product="Antitoxin component of toxin-antitoxin stability
                     system, DNA-binding transcriptional repressor"
                     /protein_id="AUB34639.1"
                     /translation="MLRISVEEAAMNLKSLLERVATGEEVILLEQDKAVARLVPPLQK
                     EERLASMKQFRDSLAIKGESLSATVINARTEERR"
     gene            complement(455696..456091)
                     /locus_tag="COO91_00469"
                     /note="Nfsy_R00469"
     CDS             complement(455696..456091)
                     /locus_tag="COO91_00469"
                     /codon_start=1
                     /transl_table=11
                     /product="fur, Fur family transcriptional regulator,
                     ferric uptake regulator"
                     /protein_id="AUB34640.1"
                     /translation="MRTRSQERIFNLLKTSKKGISAQDIYVELRNTNQSMGLATVYRS
                     LEALKLEGIVQVRNLANGEALYSLAQQDKHHLTCLQCGVSIPINQCPVHDLENQLESS
                     HKFKVFYHTLEFFGLCSQCQVNQASEISH"
     gene            complement(456112..456231)
                     /locus_tag="COO91_00470"
                     /note="Nfsy_R00470"
     CDS             complement(456112..456231)
                     /locus_tag="COO91_00470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34641.1"
                     /translation="MLRSLYYNFLFQLSENKITKPLKLIDQLAHLTASTTVAY"
     gene            456245..456523
                     /locus_tag="COO91_00471"
                     /note="Nfsy_F00471"
     CDS             456245..456523
                     /locus_tag="COO91_00471"
                     /codon_start=1
                     /transl_table=11
                     /product="purL, phosphoribosylformylglycinamidine
                     synthase"
                     /protein_id="AUB34642.1"
                     /translation="MQTKYLAKIFVTLRPSVLDPAGVAVQSGLKQMGYENVDQVRIGK
                     YIELTITSSDEKKARQDLDRICDQMLANPVIENYRFDLIEVETQTGVF"
     gene            complement(456520..456666)
                     /locus_tag="COO91_00472"
                     /note="Nfsy_R00472"
     CDS             complement(456520..456666)
                     /locus_tag="COO91_00472"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34643.1"
                     /translation="MINQREWGQGEQGRQGEQGRQREQGRQGTRKTIDSYPMPNALSP
                     MPNP"
     gene            456665..457339
                     /locus_tag="COO91_00473"
                     /note="Nfsy_F00473"
     CDS             456665..457339
                     /locus_tag="COO91_00473"
                     /codon_start=1
                     /transl_table=11
                     /product="purL, phosphoribosylformylglycinamidine
                     synthase"
                     /protein_id="AUB34644.1"
                     /translation="MKFGVVVFPGSNCDRDVAYVTRDLLGQPTRMVWHQETDITDLDV
                     VIIPGGFSYGDYLRCGAIARFSPVMQQVIEHAQKGKFVIGICNGFQVLTEAGLLPGVL
                     TRNRDLHFICDRVPLKVERSNLPWTQAYTTGEVITLPIAHGEGQFYADAATLAKIEDN
                     GQVVFRYEGENPNGSLNNIAGICDRQGNVLGMMPHPERASDGMLGNSDGLRLFQGLLE
                     KVAALA"
     gene            457497..457667
                     /locus_tag="COO91_00474"
                     /note="Nfsy_F00474"
     CDS             457497..457667
                     /locus_tag="COO91_00474"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34645.1"
                     /translation="MGVLRSLSERWAKILLQTAIAPSYQVLAASSDRICLTNTVPLPR
                     SKLQVLNPCSLW"
     gene            complement(457740..459323)
                     /locus_tag="COO91_00475"
                     /note="Nfsy_R00475"
     CDS             complement(457740..459323)
                     /locus_tag="COO91_00475"
                     /codon_start=1
                     /transl_table=11
                     /product="Multidrug efflux pump subunit AcrA"
                     /protein_id="AUB34646.1"
                     /translation="MTQLNGNRVNGNQKNGNHKNGVKQDSLVLTKQQKAAQQSLINSS
                     SQEFEQSIVLRQSPIWSRTIMITLMALACFGIAWAYLAKIEQVVPATGQLKPEGTVKD
                     VQAPVSGVVKTVNVKDGQAVKPGDLLLTFDSIASVAELDSLKKIRVALNRENQIYRRL
                     MGASTATESELLYLRGNLPQEAAFLLKSRAALVGENELLRTQLKNSGVGTALGSDEQQ
                     LLQVAKKELDSRSSAARLEVEKIKKQLAQNKYKLEDSKASLAIQEGILAKLKILSEEG
                     GISQLQYLNQQQEVQNRTAEVAQLREEEKRLQFDIEKGQQELSNTVALSDKNILDKIA
                     DNKQRIAAIDSQFMKVILDNEQRLADINSKISQAQLNVKYQELRAPVAGTVFDLQAKN
                     PGFVATPTTKLLQIVPNENYIAEVFITNKDIGFVRKGMKVDIRIDSFPYSEFGDIKGE
                     LAGIGSDALPPDQTHQFYRFPAKLHLDKQSLVIRGKNVPLQSGMSISANIKVREERTV
                     LSLFTELFTKQIDTLKEVR"
     gene            complement(459445..459579)
                     /locus_tag="COO91_00476"
                     /note="Nfsy_R00476"
     CDS             complement(459445..459579)
                     /locus_tag="COO91_00476"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34647.1"
                     /translation="MGHWAWGIGHGALVINSCPSLPLPPHPPHSLPLFQRIFSLTNIL
                     "
     gene            complement(459604..462606)
                     /locus_tag="COO91_00477"
                     /note="Nfsy_R00477"
     CDS             complement(459604..462606)
                     /locus_tag="COO91_00477"
                     /codon_start=1
                     /transl_table=11
                     /product="ABCB-BAC, ATP-binding cassette, subfamily B,
                     bacterial"
                     /protein_id="AUB34648.1"
                     /translation="MTYIKNSFVEFVTTIEGFNHLPDGAIANLSEQLQAWRYRIGQKI
                     IGKESLPEHITIIYEGQVRLLGYDPHTQLPITLKLLQPGEIIGEIGLLRDVACETAIA
                     STEVVCLTLNASAYFSFLGLYPAFANVRKNRSYLVEVFDILSSYWKQQPLATLNFKEV
                     AEKALPQAITHYLPPGATPFNQLDSERVWFLSGGGTVTNFSPGDRLESDNDRDNIQVI
                     SQNPARLVGIHPSDLILEDSHEIVLAVSNTKSDRAEELDIPYASDEIVPQPAPPTSKS
                     SSKQKYPFFSGKGELNTAFACFQMIAKHLEIPFRREVVRRILTEQVKRQGVISFQVTA
                     YLAELIGLKAQLIELPIASVTRIPTPALIRYGDNFAVLYEVDANTVVVGVPSKGIVRC
                     KPAQLVEQLDVDPTDFPPKVKVLLLTATNQTPQERFSLRWFIPYLSRHRRVLIEVFIA
                     SFFVQLAALANPLVVQLIIDKVITQNSIGTLHILGILLLVVGLFEAVLTTLRTYLFVD
                     TTNRIDMGLGSQIIDHLLRLPLRYFERRPVGELSTRINELENIRQFLTGTALTVGLDA
                     LFSLVYIGVMLIYSWQLTLVGLSTIPVFVIITLVASPTISRQLRAKAERNAETQSYLV
                     EVMSGIQTVKAQNIELRSRFSWQERYARFVAAGFKTVVTSTLANSTSSFLNKLSSLLV
                     LWVGAYLVLQGELTLGELIAFRIISGYVTSPILRLAQLWQSFQETALSLERLSDIVDT
                     PQEGETDRYNIPLPAIKGAVKYENVSFRFGTSGPLQLSNVNLEFEPGKFVGIVGQSGS
                     GKSTMMKLLLRLYETESGRILIDGYDIAKVELYSLRRQIGVVPQETLLFDGSVQENIA
                     LTNPDATTEEIIEAAQVACAHEFIMNLPNGYNTRVGERGSALSGGQRQRIAIARSVLQ
                     RPKLLVLDEATSALDYPTERQICLNLAKAFKGDTVFFITHRLNTVSNADMIVVMDNSR
                     VIEQGSHQELMAAKGHYFYLYQQQDVNL"
     gene            complement(463820..466906)
                     /locus_tag="COO91_00478"
                     /note="Nfsy_R00478"
     CDS             complement(463820..466906)
                     /locus_tag="COO91_00478"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphoryl diester phosphodiesterase"
                     /protein_id="AUB34649.1"
                     /translation="MPIELVGFASLPADTYSDGPTSGEGISANGRTGPFPGQPIQGFS
                     GVQFANSNSFYFLSDNGYGSKDNSADFLLRINRLNPNFKGTENGDGTVKVLDYIQLSD
                     PNNKIPFQIVNEESSERLLTGADFDVESFVFDKDGTIWVGEEFGPYLLHFDATGKLLE
                     APIATPDQFKTLNGEAPKVIGHRGASGDLPEHTLQAYIRAIADGADFIEPDLVVTKDG
                     VLIARHEPALAILNADGSVNLSNTTTDVYDISKYPQFADRKKTVSLDGNTITGWFAED
                     FTLEEIKTLGAIQRLPFRDQSFNGQFEIPTLAEIIDLVKEVEAQTGKKIGIYPETKHP
                     TYFAEEATYVGTTEKINRNISDILIDTLKANNFTDPSRIFIQSFEVSNLKELNDSIMP
                     AAGVDIPLVQLLDASDIDINGKIIESQPYDLKVSGDSRTYGDLRTPEGLTEIATYADG
                     IGPWKRMIVSVKGTDANGDGKADDVNGDGTVNDADKTTLPPTTLIQDAHNAGLQVHPY
                     TFRNENQYLAADYKGNPELEFQQFFQLGVDALFTDFPDTGDKVRDFLSDPQNNLVRSP
                     QNPDVLSGDAFANLGGSKGFEGGAINASKTKLYMLLEGTVQGDPAGALRINEFDIASR
                     DYTGKKLYYKLEDPAYAIGDLAVINDNEYLVIERDGGQGTSAEFKKIFKIDLSKTDSN
                     SYVAKEEVGDLLNIQDPNDLNGDGKTTFDFPFVTIENVLVVDKNTILVANDNNYPFST
                     GRPGDDPQNPVIDNNEIILLKLENPLNLAPGLGQPQSEVIKFGSSTSDDITTEPNQTL
                     LTGDGADFVEGNKGNTIQTGNGDDTVLVGSDSSVSTGDGNDQIFIGQNGPAQNTSANG
                     GDGDDAIAAVEASGNNSLFGAAGADTLTVIEGSRQLSFGGFGNDSLTSKGSNNRLYGG
                     SGDDQLFSNVNDSLFGGDGDDVLFAGQVGGNRLSGGIGADQFWITNGSLPASKNIITD
                     FAIGIDKIGLGGIGLSNLRVLQQGADTLVKTGNTELVSLLQINLTSLTVNDFVGFS"
     gene            467328..467477
                     /locus_tag="COO91_00479"
                     /note="Nfsy_F00479"
     CDS             467328..467477
                     /locus_tag="COO91_00479"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34650.1"
                     /translation="MLKFIHISIEDDKVNIFIFLIQSVVDNYEKIKFEFLQFELASDR
                     MNFTH"
     gene            complement(468130..473553)
                     /locus_tag="COO91_00480"
                     /note="Nfsy_R00480"
     CDS             complement(468130..473553)
                     /locus_tag="COO91_00480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34651.1"
                     /translation="MVNNKTIRFSQFNASLNRSAQGQLVVDLSTPGNAQAKAVAEIIQ
                     RNNPDVLLINEFDYSQEAVQLFQQNYLAISQNGATPVDYPYFYIAPSNTGIASGFDLN
                     NNGAVVTTPGEPGYGDDAFGFGNFPGQFGMLLLSKYPIDTANVRTFQNFLWKDMPNAL
                     LPDDPTTLQPNDWYSQQELEVLRLSSKSHWDVPIQVNGETIHVLASHPTPPTFDGPED
                     RNGKRNHDEIRFWADYITPGKSNYIYDDQGKIGGIDAGSSFVIVGDQNADPLDGDSFD
                     NAIRQLLQNPNINTNVIPTSPGGPQQADLQGGANASQKGNPSFDTADFADTAPGNLRT
                     DYVLPSTDLTIANSGVFWPLNTDSTFPLVGTFPFPSSDHRLVFTDVQTGPTEPGKTIP
                     RLGFQGQSTFVTGFIPAGAAGTVNGVETPLGGLSGVTYDAANNRYYAISDDRSQFGPA
                     RFYTFTADTGVTFTNVTPLKDSNGNLFATNSLDPEGIALTNNGTVFISSEGEVNPTAG
                     RVTNPFIKEFSLTTGQEIASLLIPSKFLPVVEDTNSNGIVDAGDTQTSGIYNNLAFES
                     LTITPDQRTLFTATENALSQDGLRASLTSGSPSRILQYNLVSGQPKKEYLYITDAIAD
                     VPNPSSGSADNGLTDLLAINNRGTLLALERSFAQGVGNTIKIYEVSLQGSTDISFYDS
                     LNNLSTEQLAAIQPAQKRLLLNLNDLNLPNGTDNIEGITFGPKLADGRQSIVLVSDNN
                     FNQSQFTQILTLDADLVPTAAPTLETRPDLLDDETLPVDQRADADDPAIYVNATNSAD
                     SLVLTSVKNAGLRVYDLSGNLLQTVNPGGIRYNNIDLQYGFKLGNQSVDIAVASDRNN
                     DKLAIFKINPNPTTPGNYLEDITDSNIGTLFQGLPFAEPYSSSSRSAYGLALYRSPIT
                     NDYYVFANRRETGDVAQFKLIDKGNGKIGAERVREFTVPTISERDPQTEGMVVDQETG
                     FLYIGQENVGIWKFQAEPNGGTTGKLIDQVRDLGGSYLTDDVEGLTIYYGKNGTGYLL
                     ASSQGDNTFVAYTREGNNEYLGNFAVGNNGVIDSVQESDGADVINLPLGPNFPFGLFV
                     TQDGSNEPAKIVSDEGEEENISSNFKFVPWENIANAFPNSLTIDTTSYDPRNPVAQPK
                     LTIYEFENLPKLGTTSKGQDIFLGGFSGLYFQGFAANGNLKFVTHTDRGPNGESEGSN
                     RPFFLPDFQPEIVSFELNRTTGEISITNRTGLFRQDGTTPLTGLPNLQAGANGLAYTD
                     EIAVDLDNNILANDPLGADLEGIVIAENGDYWLVDEYRPAIYHFDVNGKLIDRFIPQG
                     TATAPNPDQPVGTFGTEVLPFVYAQRRNNRGFEAVALEGTKLYAFIQSPIDNPDVAND
                     ATSKASLNLRILEFDIVTKQVTGEYLYLLEGLPATDKIGDAVSLGNGKFAVVERDDNG
                     TSAGNKLIYQIDLAGATNINNPANFSLPAGKTIEQLSSAELVAANITPVTKSLIANAA
                     QLGYTGVEKLEGLALVAPNTLALINDNDFNITGNTAAEKLGILELPNNLTTVQPTFPN
                     GFGSSNSDTVSLQPGQFFSAGDGADFVEGNKNNTILAGNGDDTVLAGSDSSVSGNDGD
                     DQIFIGQNGPAQNTSADGGNGDDLIVVVEASNSNNLFGAAGDDRLTVIEGSRQSLFGG
                     SGNDTLSSGGSNNRLYGGSGDDKLFSNVNDSLFGSDGDDVLFAGQQGSNRLSGAAGAD
                     QFWIANGSLPISNNIVTDFTVGIDKIGLGGVGITQFCGLTLSQQGSDTLVKIGNTELV
                     SLLGIISTSLTANDFVFSASVVA"
     gene            complement(474150..475664)
                     /locus_tag="COO91_00481"
                     /note="Nfsy_R00481"
     CDS             complement(474150..475664)
                     /locus_tag="COO91_00481"
                     /codon_start=1
                     /transl_table=11
                     /product="4-amino-4-deoxy-L-arabinose transferase or
                     related glycosyltransferase of PMT family"
                     /protein_id="AUB34652.1"
                     /translation="MINIVKLNRMDILIMIIIVIIGLVHLPFPFDGDQAFFRLGALEM
                     QQGKVLYRDFWDVKQPGIFCFYFLAGTLFGFNEIGIHAFELIYMLFFSIILLLTLKSY
                     FRHQIIASLVPLLTVGVYYVVSGAWHLTQVEALVGFPLFLCLWLTFQSFKNEGKQRFI
                     LLLLSGLIGGIVLLFKLIFLLILFSFWLTILMYSVLIKQQGVQKIFIEICLPIFIGII
                     FPLVVVASYFAWYNSFSIVYQTFFIYPPLIIANSALNQKDFVSGIKWFIQNFYPLILI
                     AIIAIDASLRKSKNVLTLLLVVWCVFGLSVITLQYKALWEYHFLLLFVPLGILAAKGL
                     DVLWDYLKELRSQIPTVLLIFLLFFPLSSTLTKKSMTLVNNNFALTEDTRLKYQTVFR
                     KKYPSLHSEANFISLAGSLAGEIYVAGDPSIYYFSGRTQATILRGWALEYFLPEQWLT
                     LREQLDSSKPPYIFIDYGPQAIIKENFPKLLEFVEQKYKILRQSNNGIWYIIKS"
     gene            476699..476884
                     /locus_tag="COO91_00482"
                     /note="Nfsy_F00482"
     CDS             476699..476884
                     /locus_tag="COO91_00482"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34653.1"
                     /translation="MDRSKLVAIITGAISIILAIAYLILVQLLDYRDMKPAPISQFDQ
                     TPAIISVFSQVDKITET"
     gene            complement(477070..477249)
                     /locus_tag="COO91_00483"
                     /note="Nfsy_R00483"
     CDS             complement(477070..477249)
                     /locus_tag="COO91_00483"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34654.1"
                     /translation="MSQLALIPVNPDMSTTGYDARGLANASLLASQFRQIYLYLMLLE
                     TAYRYICQNGIKLSK"
     gene            477287..479164
                     /locus_tag="COO91_00484"
                     /note="Nfsy_F00484"
     CDS             477287..479164
                     /locus_tag="COO91_00484"
                     /codon_start=1
                     /transl_table=11
                     /product="ndhF, NAD"
                     /protein_id="AUB34655.1"
                     /translation="MAQFLLETVWLVPCYALIGGLLAVPWSPGIIRKTGPRPAGYVNL
                     VMTFLAFVHSAIALQATWNQPAQEVFIPWLSTAGLDLTIALEISSVSVGALVVIAGLN
                     LLAQIYAIGYMEMDWGWGRFYSLLGLFEAGLCALVLCNNLFFSYVILEVLTLGTYLLV
                     GLWFSQPLVVSGARDAFLTKRVGDLFLLMGVLALWPLAGTWSYPELAKWAATANVNPT
                     TMALVGLALIAGPMGKCAQFPLHLWLDEAMEGPVPSTILRNSVVVASGAWVLIKLEPV
                     LTISPIVSSAMVAIGVVTALGASLIAIAQIDLKRCQSYSVSAYMGLVFIAVGVQQYET
                     ALLLVLTHAISAALLVMSTGGIIWNSITQDVTQLGGLWTRRPISAIAFIVGTFGLIGF
                     PPLGSFWALIKLADGLWETQPWLVGVIITVNALTAVSLTREFGLIFGGKATQMSQRSP
                     EAHWPMILPMMILLGVSLHLPLVLQSLSLLPDWATLNKDVVLLLIWSSIFGCSITGVI
                     YLGNIPKPIRLPWQGLQDLIAYDFYTPKLYKITIIFGVAKISQLADMIDRFVVDGIVN
                     FVGLFSLLGGEGLKYSTSGQTQFYALTVLLGVGILGMWVTWQFWGIQFLNLIFQISTL
                     G"
     gene            479217..479933
                     /locus_tag="COO91_00485"
                     /note="Nfsy_F00485"
     CDS             479217..479933
                     /locus_tag="COO91_00485"
                     /codon_start=1
                     /transl_table=11
                     /product="cynT, carbonic anhydrase"
                     /protein_id="AUB34656.1"
                     /translation="MSRLHPQFNFSRRSLFKFGAGAIGTGVLTAGLSSNLLAAEKKAP
                     AEDEITPDKALQELLNGNERFVKRKRKNPNQTYSRLVEVAKGQNPFASVLGCADSRVP
                     SEIVFDQGLGDLFVCRVAGNIATPEEIGSLEFGSLVLGSKVIMVVGHERCGAVDAAIK
                     GAQVPGQIGSLLEAIKPSVESSKGKKGDKLENACKANVLAQIEKLKSSSVLSELIKAE
                     KLKIVGGYYDLDTGKISLVS"
     gene            480204..481532
                     /locus_tag="COO91_00486"
                     /note="Nfsy_F00486"
     CDS             480204..481532
                     /locus_tag="COO91_00486"
                     /codon_start=1
                     /transl_table=11
                     /product="ndhD, NAD"
                     /protein_id="AUB34657.1"
                     /translation="MQFKEYLPWNETLGLSYQIGVDGLSILMLVLNSLLTWISIYSSS
                     KETERPRLFYSMILLVSGGVAGAFLAENLLLFFLFYELELIPFYLLISIWGGEKRGYA
                     GIKFLIYTAVSGALILATFLGMVWLSGSTNFAFDAFSTENLSTAKQILLLAGIVLGFG
                     IKIPLVPFHTWLPDAYVEASAPIAILLGGVLAKLGTYGLLRFGLGMFPHAWSIIAPTL
                     ATWGAVSAIYGAVIAIAQKDIKRMVAYSSVGHMGYILLAGAASTPLALVGAVAQMFSH
                     GIILAILFHLVGVVEAKVGTRELDKLNGLMSPIRGLPLISALLVLGGMASAGIPGLTG
                     FIAEFIVFQGSFSAFPIPTILCVVASGLTAVYFVILLNRTCFGKLDNFAYYPKVLWSE
                     KIPALILAAFIIFLGVQPTWLVRWSESTTTTMVAAIPSLEKTVISEVALK"
     gene            481584..482891
                     /locus_tag="COO91_00487"
                     /note="Nfsy_F00487"
     CDS             481584..482891
                     /locus_tag="COO91_00487"
                     /codon_start=1
                     /transl_table=11
                     /product="CO2 hydration protein"
                     /protein_id="AUB34658.1"
                     /translation="MTAIKTAIKLPPSKHEFSEVIHRLEAGGAMLPDTPENLMQIIGL
                     YKAYAVPMDFYWRDLLYIAEREFLNPLPFFKYFLPKEYLELHNHYAGDDADLRIWRGE
                     ATAHPELLAFIEKGETFKMPKLLHHLFHDRINMEFAEACMRAMLWHRGMGGQFDPYLD
                     SDEYKANADKAIKAYFQGNPVMLGLYKLFPDMFLEQCRQMSYYANLGLFWEIMAPVFF
                     EMSDRYDEGTISSVPEAMSFLVNGIFAIAGRPIYHHVYIRGECYEIVPKSKGFMWLYE
                     AALPYVEAVFYRTAPFRGTKSYNAQARQVPEDQKDFHYGILYADVFPVGTAGIPPTLL
                     MQDMLHFLPSYLVDYYSQHCRGEEDMLIQLGVSFQRSMYCVTSAVIQALRTALLYPLD
                     DQNPKHLQANRDFFEMQLNRFTRSDYNIRDAARLGSIQKQDYR"
     gene            complement(483198..483353)
                     /locus_tag="COO91_00488"
                     /note="Nfsy_R00488"
     CDS             complement(483198..483353)
                     /locus_tag="COO91_00488"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34659.1"
                     /translation="MYLLLENNRAMPAAGGAIAGYTKALEFRNRKSFRRVTEEGYSSS
                     HSDAVQN"
     gene            complement(483562..483687)
                     /locus_tag="COO91_00489"
                     /note="Nfsy_R00489"
     CDS             complement(483562..483687)
                     /locus_tag="COO91_00489"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34660.1"
                     /translation="MNTSYTIRKKSVLYLLLGNNRAMPAAGGAIAGYTKALNLSH"
     gene            484194..484736
                     /locus_tag="COO91_00490"
                     /note="Nfsy_F00490"
     CDS             484194..484736
                     /locus_tag="COO91_00490"
                     /codon_start=1
                     /transl_table=11
                     /product="HSP20, HSP20 family protein"
                     /protein_id="AUB34661.1"
                     /translation="MALIRWEPFREMEILRRQMDQLFSELTAAERGNSEISPSPRTAW
                     VPAVELSDNGSEFVLRVEIPGVEAKNLDVQVTQDAVSIAGEHRYEKHSESNAKVHSEF
                     RYGNFTRVVPLPSKVQNQQVKADMKDGILILTLPKLEQEQNKVFKVNLGHSQSPTASI
                     EAGNGNAQPNIKSQETVQAT"
     gene            complement(484976..485335)
                     /locus_tag="COO91_00491"
                     /note="Nfsy_R00491"
     CDS             complement(484976..485335)
                     /locus_tag="COO91_00491"
                     /codon_start=1
                     /transl_table=11
                     /product="Ferredoxin subunit of nitrite reductase or a
                     ring-hydroxylating dioxygenase"
                     /protein_id="AUB34662.1"
                     /translation="MSWTKVLAVEALSPGTRQVVKVGNRKILVLNHENQLYAVDNNCP
                     HLKLPLKSGKITEDGAIVCTFHRSAFDLRTGEVQGWCAWPPGVGKVLSMVSPQKALPV
                     FPIRVEEGSIWVDVQEE"
     gene            485381..485509
                     /locus_tag="COO91_00492"
                     /note="Nfsy_F00492"
     CDS             485381..485509
                     /locus_tag="COO91_00492"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34663.1"
                     /translation="MTSAIAFQYWGMQKVNNSKLKIFQTKRSALRGLRALWQLRGI"
     gene            complement(485588..486139)
                     /locus_tag="COO91_00493"
                     /note="Nfsy_R00493"
     CDS             complement(485588..486139)
                     /locus_tag="COO91_00493"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34664.1"
                     /translation="MYSLPLIPEVRFQKDYFSEYPEEIRVGSDAYAGLRLRTVISYTR
                     KPGYYAIHYNQPKTLVTGAILQLNDGAIAVFPGEPNQSEQGTLSPIYTLQPNGSLAVP
                     TGLIFIRFAEGVDVKSQREVINRAGYEVAQSLDYAPHTAWLRAQSGNIADAIAGIPQL
                     EAIPKVENIEPQMLMERGFRLGR"
     gene            486535..488523
                     /locus_tag="COO91_00494"
                     /note="Nfsy_F00494"
     CDS             486535..488523
                     /locus_tag="COO91_00494"
                     /codon_start=1
                     /transl_table=11
                     /product="Serine protease, subtilisin family"
                     /protein_id="AUB34665.1"
                     /translation="MVQFRYGGQNGQQYELAISDEHLVVRTENRSALVGARPFEVAPV
                     SPTARSILNEFELATRFRQAGVEILRTKGPTEGVALRDRAREILNQEPEVQFAGRVLV
                     DPVSQQPIIYTENLFLKFHSEEELTVCQEVLRRYDLTIKRQLEYAPNAYFVSASANTG
                     IAIFDIAERLLNEESVDLCHPELVRELRQRQVFPQQWHLKQTTINGKVINAHANAEAA
                     WKLSDGTGTIIAIVDDGVDLDHEEFRSSGKIVAPRDVTRKTDNPRPGNDNNHGTGCAG
                     VACANGNFGASGVAPGAKLMPIRLASALGSQDEADAFVWAAQNGADVISCSWGPSDGV
                     WFERNDPVHNQKVPLPDSTRLAIEFAINKGRNGKGCVILFAAGNGNESVDNDGYASYQ
                     KVIAVAACNDYGTRSAYSDFGQAVWCAFPSNNGESSQTTGIWTTDRSGVVGYNSGSRN
                     LGDAPGNYTNQFGGTSSACPGAAGVAALIIARNPNLRWDEVRDIIKRSCDRIDQAGGK
                     YDANGRSPFYGYGRMNALKAVELAKPPETSPISRFQAVQDIPINDLQISTLSLAIAST
                     NLIKSIKVNVDIEHTFIGDLIVTLLPPVQTGIPPVILHDRQGGATDNIKTTYDEINTL
                     KLAAFKGKNPQGTWTLEVADKAEGDTGKIRRFTIEMGF"
     gene            488684..488830
                     /locus_tag="COO91_00495"
                     /note="Nfsy_F00495"
     CDS             488684..488830
                     /locus_tag="COO91_00495"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34666.1"
                     /translation="MSLFARQLNLFARQLSLFARQLSLFARQLSLFARQLSLFTRQLS
                     LFTR"
     gene            complement(489017..490390)
                     /locus_tag="COO91_00496"
                     /note="Nfsy_R00496"
     CDS             complement(489017..490390)
                     /locus_tag="COO91_00496"
                     /codon_start=1
                     /transl_table=11
                     /product="thiC, phosphomethylpyrimidine synthase"
                     /protein_id="AUB34667.1"
                     /translation="MRTEWVAKRRGQSNVSQMHYARQGVITEEMHYVAQRENLPADLI
                     REEVARGRMIIPANINHTNLEPMAIGIASKCKVNANIGASPNSSNLQEEVDKLNLAVK
                     YGADTVMDLSTGGGNLDEIRTAIIKASPVPIGTVPVYQALESVHGTIENLTADDFLHI
                     IEKHAQQGVDYQTIHAGILIEHLPLVRSRITGIVSRGGGILARWMLHHHKQNPLYTHF
                     QDIIEIFKRYDVSFSLGDSLRPGCTHDASDEAQLAELKTLGQLTRKAWEDDVQVMVEG
                     PGHVPMDQIEFNVRKQMEECSEAPFYVLGPLVTDIAPGYDHITSAIGAAMAGWYGTAM
                     LCYVTPKEHLGLPNAEDVRNGLIAYKIAAHAADIARHRPGARDRDDELSKARYNFDWN
                     RQFELSLDPERAKEYHDETLPADIYKTAEFCSMCGPKFCPMQTKVDADALTELEKFLA
                     KEAVTHG"
     gene            490529..490678
                     /locus_tag="COO91_00497"
                     /note="Nfsy_F00497"
     CDS             490529..490678
                     /locus_tag="COO91_00497"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34668.1"
                     /translation="MLTNYAVFSESGDRCCHGFAHDHQSTWKNFDSFSSEYKSVLNDL
                     LSSVV"
     gene            complement(491064..491540)
                     /locus_tag="COO91_00498"
                     /note="Nfsy_R00498"
     CDS             complement(491064..491540)
                     /locus_tag="COO91_00498"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34669.1"
                     /translation="MPLKVKRLVNAYEERMLEFLQTCVDDSYKIHTQVSLSQFCELDN
                     SIDWELKKFFFSSNVDALITDHDYKPCLVVDFQSSYHDSDEAKERDRKKATLLALAEV
                     PLLYSRVKDFGLLYLYSESEEVVCNLFTGKRRENAQALIRKYCEQSFSSDLRVTAC"
     gene            complement(491540..492304)
                     /locus_tag="COO91_00499"
                     /note="Nfsy_R00499"
     CDS             complement(491540..492304)
                     /locus_tag="COO91_00499"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34670.1"
                     /translation="MSKIIYDVIQRFEVENGVPRLVSTNIQVIEGGEDLMSLATNLLD
                     KLGFYDKFEEKRTSQYIGYKLKNPRKGAKRYQLILAQRKEGLSISIPQEILEPYLLKL
                     NFSINFLTKMPELKNVVTMFQEISKFYWIIPSQKNVFFDLSKEYRETFKGQIVGDFEL
                     NFDGIVYREAENAYSDSKTQNINNMQLIDIIQKKYISKHPLSNYLDNSDCCLKIGKGD
                     IGKDKLFNYAYQVAINSREVLEEFLTYFAKILMEQQ"
     gene            492752..493243
                     /locus_tag="COO91_00500"
                     /note="Nfsy_F00500"
     CDS             492752..493243
                     /locus_tag="COO91_00500"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34671.1"
                     /translation="MFRLLTAFAQRLLRSIAFVILLTLINSLILPTGAWAASSALGVN
                     NGHLSSCPASDNCVVSQDGDPKHAIDPIAYHIDRDAARKTLLKTLTVVPRTEVIEQTD
                     NYIHALSKSRIFKFIDDVEFYFPPNESVIHVRSAARVGESDLGVNRRRLEQIRLALRD
                     LNI"
     gene            493290..493433
                     /locus_tag="COO91_00501"
                     /note="Nfsy_F00501"
     CDS             493290..493433
                     /locus_tag="COO91_00501"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34672.1"
                     /translation="MINYLFYKYESSGDKLFSKCLMVDALSVAIAYFLLRKFAPGRSL
                     YYG"
     gene            complement(493501..494382)
                     /locus_tag="COO91_00502"
                     /note="Nfsy_R00502"
     CDS             complement(493501..494382)
                     /locus_tag="COO91_00502"
                     /codon_start=1
                     /transl_table=11
                     /product="sucD, succinyl-CoA synthetase alpha subunit"
                     /protein_id="AUB34673.1"
                     /translation="MNLTPDSKVLIQGFCEFISGTHVAQMKAYGTNLVAGVNPGCGGQ
                     ELHGLPVFDLVEEVIEQFGVIDTTIICVDPYDVLDAALEAIASHIRQIIIITAGVPPL
                     DMVQLLRKAEACETLVVGPNSPGIIVPGKILLGTQPSEFYTPGRVGIVSRSSTLTYEI
                     AYELTKAGLGQSISVSIGSDAIVGSSFLQWLQILDEDETTEAIVLVGQPGGGSEEVAA
                     RYITEAIDKPVIAYIAGRLAPPGKTWRQTGTLATVIGRDPNFGTAQSKLAALKEAEVP
                     VAERPSQIPELLRKEIN"
     gene            complement(494505..495731)
                     /locus_tag="COO91_00503"
                     /note="Nfsy_R00503"
     CDS             complement(494505..495731)
                     /locus_tag="COO91_00503"
                     /codon_start=1
                     /transl_table=11
                     /product="sucC, succinyl-CoA synthetase beta subunit"
                     /protein_id="AUB34674.1"
                     /translation="MDLLEYQVKEWFGKIGIPVLPSQRIDHPTDLKRLKIRFPIVLKS
                     QVHGAERAKAGGVRFAETTIDAIAAAQNIFSLPIWGELPEVVLAESQYDANQEFYLAV
                     VLDTAVCRPVLLGCKEADIDWESAGERMHHVVVEQEFSPFYARRLALKMGLQGTLMQS
                     VSSVIQKMYQLFVQKDLDLVEINPLAVSATGQVMALNGKVRVNERSIKRHPDLAEMAA
                     KIISRHTSTEINGILGDWDGVQMHGKIGILGNGTGSVMATLDLVANAGGNPGVCLNLR
                     HAYLTDTKPTTFCDRLETGLKILEADNSIQVILINFLGSIPQTEEVVEVIARVVQQDN
                     SELKSQVVHSNGSKTRREQNFSPLVVRLAGSEFDAARKYLATLKTHSNALLVVENLDE
                     AVAAAVRLAKPTANKR"
     gene            495893..496006
                     /locus_tag="COO91_00504"
                     /note="Nfsy_F00504"
     CDS             495893..496006
                     /locus_tag="COO91_00504"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34675.1"
                     /translation="MILTANLLVLKPQQVIHLFSKFLSIEDNHHFCQNPLT"
     gene            496390..498156
                     /locus_tag="COO91_00505"
                     /note="Nfsy_F00505"
     CDS             496390..498156
                     /locus_tag="COO91_00505"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase involved in DNA repair"
                     /protein_id="AUB34676.1"
                     /translation="MKVAVQQEDLQLLAKTLQEQLLVEVSTAEIFKIKCAVNKDELMI
                     LTQHESDVIVDAQIIFAVIEEVLLSLAPHREQRVQCFLRVFGEQLPYAKCFLALKQTG
                     GWGVGGVGGVGEAGGAEGQYFSTLSSSAITYSPSIDEAEEEEQFDPFADAPNLPTSKP
                     ASQIKLILLGVALVGIVVLGGGAYLLTRPCVMSECKEIQNAEQLKTKSPQLLRRAKSE
                     KELVAVQQQLTAASAALNTIPSWSPRYQVSEELKASLSGRSEKITQVVKALQTASLAT
                     QKVQTPAYSLEELQARQHLWRQAIAPLETISSSSELYELVQGKLLNYRVRLHAVNQQI
                     VTEEKWLKKLTAAKVVANAAEKREVTAKSLNDWQKVQSTWLVAINALNSIPLTSPGYQ
                     EAEKLLVDYKPKLVAARDRATKERLAVKAYQQAVSTAKQAKVYEQQNQWLAAATYWDQ
                     ALQTTKRISQDSLYYTQAQSLIEPYSIALKQAQEKLQVVSSLQQTRTDLDKTCINGIR
                     ICTFSIDNAGIIVRLTPEYDQIRQNNLANPYSENSETAVDVTNHLQILREALAVISDN
                     ASLSLFLYDSKGQVIYTRTLGG"
     gene            complement(498234..498353)
                     /locus_tag="COO91_00506"
                     /note="Nfsy_R00506"
     CDS             complement(498234..498353)
                     /locus_tag="COO91_00506"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34677.1"
                     /translation="MIADVFTRNRNLYVIQDLDKLFAAVNYIFQQCELKIQKE"
     gene            complement(498472..499296)
                     /locus_tag="COO91_00507"
                     /note="Nfsy_R00507"
     CDS             complement(498472..499296)
                     /locus_tag="COO91_00507"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC.X2.P, putative ABC transport system permease
                     protein"
                     /protein_id="AUB34678.1"
                     /translation="MGCFEKEIPGDGDREPMQELIKLDFVDLAIAVGLMAIGIGLSAW
                     EKLGLELNLALATGRTILQLLVLGYILDFILALDNAWAVLAILTIMLTITAIVARNRI
                     SQKIPYVLPLVWGAILISTALTVLYTNFLIIQPDRWYEPQYIIPLAGIVLGNATNAAA
                     IAGERLVSTINSSHLEIETHLSLGATPQQAVSQYRKDAIRAGLIPTLNQMILIGMAAI
                     PGITTGQLLAAVKPLDAVSYEILIMFMVAFANLLTTVLVTKGLCRQFFNSAAQLVR"
     gene            499583..500731
                     /locus_tag="COO91_00508"
                     /note="Nfsy_F00508"
     CDS             499583..500731
                     /locus_tag="COO91_00508"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-amino-4,6-dideoxygalactose transaminase"
                     /protein_id="AUB34679.1"
                     /translation="MIQSVNPIPAFDIKQQYTTIEAEVSAAVLEVLASGRYIGGPLVE
                     GFEQQFATYNTVSECVACNSGTDALYLALRVLEIGAGDEVITTPFTFIATSEVISAVG
                     AKPVFVDIDATTFNLDVEQVAAAITPKTKAIIPVHLFGQPVDMTSLMAIAQSHNLSII
                     EDCAQSTGARWADQKVGSIGHIGCFSFYPTKNLGGCGDGGAITTNDPAIATKLRILRD
                     HGSRIRYLHEEIGVNSRLDALQAAILQIKLRYLDIWNDRRRDIANYYYQFLSQVPGIV
                     PPQELPEGIGVWNQYTIRISGEARNGSSAKYRDWVRSQLQEQGVSSMIYYPHPLHLQP
                     VYQSLGYEIGDLPIAEQACHEVISLPMYPELTQQQQDQVIYALKEVMS"
     gene            complement(500921..501658)
                     /locus_tag="COO91_00509"
                     /note="Nfsy_R00509"
     CDS             complement(500921..501658)
                     /locus_tag="COO91_00509"
                     /codon_start=1
                     /transl_table=11
                     /product="Thiamine monophosphate synthase"
                     /protein_id="AUB34680.1"
                     /translation="MHSSLQRAFTNRRVLKVISGLNNFNAASVAATVKAAEFGGATFV
                     DIAADAALVQLAKSLTNLPICISAVEPEKFVQAVAAGADLIEIGNFDSFYAQGRRFEA
                     PEVLALTKQTRALLPEITLSVTVPHILELDQQVQLAEELVKAGADIIQTEGGTSSNPV
                     HPGTLGLIEKAAPTLAAAFEISRVVSVPVLCASGISNVTAPLAIAAGAAGVGVGSAIN
                     QLNSEIAMIAAVRGLVEALATANAVMR"
     gene            501910..502698
                     /locus_tag="COO91_00510"
                     /note="Nfsy_F00510"
     CDS             501910..502698
                     /locus_tag="COO91_00510"
                     /codon_start=1
                     /transl_table=11
                     /product="Ubiqui/menaqui biosynthesis C-methylase UbiE"
                     /protein_id="AUB34681.1"
                     /translation="MTEEIMANLDDKEILELWDNRARDWDIQVGEDGDSNRILNSDPV
                     LWSFAGNVAGLSVLDAGCGTGYLARQLCLKGASVTGIDFSPQMIEIAQFRASQNNLDI
                     DFHLDSCTELKSLPDEQFDMIVSNYVLMDLLDLEGAIRAFNRVLKPSGVAILVFSHPC
                     FPQGSPTTVNEDGTVFYGWASSYFERTQCNEQPWNHFTTPFIWFHRPLCDYWKAFKAA
                     GFSVDEFEEPRITPERYHLAENDRKLFKCKTLPYSVVFKLLKVK"
     gene            complement(502868..503410)
                     /locus_tag="COO91_00511"
                     /note="Nfsy_R00511"
     CDS             complement(502868..503410)
                     /locus_tag="COO91_00511"
                     /codon_start=1
                     /transl_table=11
                     /product="Endonuclease, Uma2 family"
                     /protein_id="AUB34682.1"
                     /translation="MSLTLEDLEQMQQQHPDYRMELVKGNIIVSSPSGYESDEVAAAM
                     IAELCNWVRPRKLGRTAASSAGFRLPNSDLRVPDASFVLAERLRRSPKSFAQLAPDLT
                     VEVKSPSDNLDDLRAKIQEFLSLGTKVGILLNPDERTVEVYNFGQEAIILRDGDILTV
                     PELLPGWEVPIADLWPPEFD"
     gene            503496..504119
                     /locus_tag="COO91_00512"
                     /note="Nfsy_F00512"
     CDS             503496..504119
                     /locus_tag="COO91_00512"
                     /codon_start=1
                     /transl_table=11
                     /product="Endonuclease, Uma2 family"
                     /protein_id="AUB34683.1"
                     /translation="MNSPVIAKPVTPKTSYVLLYNVSWDQLEKLDVDLEGTGARLTYL
                     DGILEIMSPLSDDHEDAKSTTSRLLEAYLRENKIRFYVRGSATLGKRKDGTRREPDES
                     YNFGAKKSIPDLIIEITVTSGGINKLEVYKRLKVPEVWFWEDGLLSVYCLRDEEYEKV
                     SQSFFFPDLDIELLAQYSRMADQYDAVNEFSQVIREQFLAAFDEGKI"
     gene            complement(504129..506507)
                     /locus_tag="COO91_00513"
                     /note="Nfsy_R00513"
     CDS             complement(504129..506507)
                     /locus_tag="COO91_00513"
                     /codon_start=1
                     /transl_table=11
                     /product="Tetratricopeptide"
                     /protein_id="AUB34684.1"
                     /translation="MGVEEALEFVDNLVFLKTGEHLDKTQRIILSHLWEDEKRTYQHI
                     ANSLRYTEAHLKAVGAELWHLLSDVLGEKVSKSTFQGVVERFRTTQQWQKIPDIPNLV
                     GNDAKPQDLDSNFVGRDRQIAELHTLVSRGEKVILIQGEGGVGKTRLARKYFKSQKFN
                     FVLELWMATEIQNLTPVESVVEEWLRRYFNEEPGGDFGISLERLRRKLREQTSKIGVF
                     IDNLETALDQNGKFLEYRRPYVELLRVLADSDVHSVTLVTSRERLRESSVEVHLYPLE
                     GLDDEAWREFFSSCHINCDCTILSEMCRAYGGNAKAMQILRGAILTDFSGDIHAYWQE
                     NRTDLLIERELKDLVASQFNRLQKNDLEAYRLLCRLGCYRYQDIPSLPIEGVLCLLWD
                     VPEQKRRGVIKALQDLSLIEAKKGQYWLHPVIQDEAIGRLRLVSEEWELVNRKAAECW
                     TQRVTAIKDITDALTALEAYYHYVEINDFEQAGDVILQGRGEQWTIGLPLGCSFYQLG
                     LLQKNFSVIKRIIDDIKSQERLIRLYNILGYTYRIIGCIREAIECYEKSEEVLGILDV
                     KQPKISILFNTGLCKLELWEIEAAEDCFNSVCSLAEGNSNLDDYMTYAQCCLALIKSR
                     FGSREDAFGLAEVALSAMSSSTRVTLWGRGHSLVTLCLTYKNLGNLKKSFELCQQAIF
                     HSEENNFTQIKGKAISCLAELFREQGEFARAIFHHSEAIAILDRIGAKSDLAEAYYQL
                     ALTHQKMSEIAQSRENFVQAISATGYAYALFNEMQAPKQVEKVQKAMECFEK"
     gene            506888..507157
                     /locus_tag="COO91_00514"
                     /note="Nfsy_F00514"
     CDS             506888..507157
                     /locus_tag="COO91_00514"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34685.1"
                     /translation="MLDRDCHHDCNQNQCPFAQDTRNPNRYVCLKCGIEREINKYSSG
                     FGSFLLLLLGLFISFQLLANYEKQNNPQRQQQSLNNSPNQVNMHG"
     gene            507271..507498
                     /locus_tag="COO91_00515"
                     /note="Nfsy_F00515"
     CDS             507271..507498
                     /locus_tag="COO91_00515"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34686.1"
                     /translation="MESNQDTLLFRFASKSLKYFLLVLVGIAIAYVLSSGLGILQIIP
                     ILLYLLQQFLLPLGIILLCLITTAVIIESLR"
     gene            complement(507655..508455)
                     /locus_tag="COO91_00516"
                     /note="Nfsy_R00516"
     CDS             complement(507655..508455)
                     /locus_tag="COO91_00516"
                     /codon_start=1
                     /transl_table=11
                     /product="Nitrous oxidase accessory protein NosD,
                     containings tandem CASH domains"
                     /protein_id="AUB34687.1"
                     /translation="MIPNNNVLLAQEAGEILPPPPIPFGQQPSPQLQPAEPLQDNQLE
                     QNFQPSQPLQNNQFEPNFQPPQPVQNNQFEPNFQPSQSPQFSQYNQNFERYLVYVDGS
                     DSRTLQAIRQIEPSAYIRQYQGRSVIQSGVFNRVSNAQQRVNELQSRGIYNARIISFG
                     NGQEIDVGNGNFRGDRNNINPPKQASRYYVVIPTTQEQLPAIAEQIRQNLARFSQGLG
                     QSGGVLERTQPRGPHVAVGPFPDRFQAGEWNKYLRNTGYGNARVYYGK"
     gene            509396..510451
                     /locus_tag="COO91_00517"
                     /note="Nfsy_F00517"
     CDS             509396..510451
                     /locus_tag="COO91_00517"
                     /codon_start=1
                     /transl_table=11
                     /product="mnmA, tRNA-specific 2-thiouridylase"
                     /protein_id="AUB34688.1"
                     /translation="MKKVVVGLSGGVDSSTAAAILHHQGYEVIGLTLWLMKGKGQCCS
                     EGMIDAADLCEQLGVPHEVVDIRDIFQTHIVDYLVTGYSAGITPLPCSQCNKTVKFGP
                     MVQYAREELGCDRIATGHYARISYDEATGRYQLLRAVDRNKDQSYFLYDLSQDLLAAT
                     IFPLGELEKTDTRRIATEYGLKTADKPESQDLCLVESNGSMRAFLDKYLAPKTGDIVD
                     ITGKVLGQHDGVHHYTIGQRKGLGIAAAEPLYVIELDAENNKVVVGDRTKVTQPECTV
                     GRVNWVSIAEPSTPIRAEVQIRYRSTPTAVTVIPLENSRVRLVFDEPQFSITPGQAAV
                     WYDGEKVLGGGIIEQFS"
     gene            complement(510454..510573)
                     /locus_tag="COO91_00518"
                     /note="Nfsy_R00518"
     CDS             complement(510454..510573)
                     /locus_tag="COO91_00518"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34689.1"
                     /translation="MILPMIPLSSTIETALSTFLQKSEKKIPLHKLGGAHKRV"
     gene            complement(510710..512407)
                     /locus_tag="COO91_00519"
                     /note="Nfsy_R00519"
     CDS             complement(510710..512407)
                     /locus_tag="COO91_00519"
                     /codon_start=1
                     /transl_table=11
                     /product="putative dienelactone hydrolase"
                     /protein_id="AUB34690.1"
                     /translation="MKKFLRYLGLGLLSTFLTATPGLGAERLSFYYPPFGEFSLSVDS
                     LETFAKVGKIDQDFSFYASRATPQQLAQLRDLLQQRFNVTPTLVSQVTYSPIGEQVMQ
                     QLGEFLLTESRQNGFYAIRASLILAAADQEGLTVVNLLRKFPSNTIRVNFTEGLRIVD
                     DLSQLLKRRDEVVASLQKEAIAQAANSTVDFSQQPDLRSPGKFRWQKKSLELNDFSRN
                     RRLPVDIYLPEAGSQTTKELPSPPFPLIVISHGLASDRSSFVYLAEHLASYGFAVAVL
                     EHPGSNAERFQLYFAGLAGAPDPAEFINRPLDIKYLLDELQRLEKSDPTLQGKLNFQQ
                     VGAIGQSFGGYTVLALAGANINFEQLRQNCNRNNSSFNLSLLLQCEANKLPRRNYNLK
                     DDRIKAIIAINPINSLVLGEGGLSQIKSPVMLVAGSQDIFAPPVFEQIRPFTWLSDSN
                     KYLALIENATHFSAIGETTSQNNVLPVPPALLGPDRAPVYSYLNALSVAFLETHLLNR
                     PEYRSYLQPSYATFISKEPLNLSILQSLSADQFNQIWNGSTAQSAKPSNLQPTPTYP"
     gene            512707..512901
                     /locus_tag="COO91_00520"
                     /note="Nfsy_F00520"
     CDS             512707..512901
                     /locus_tag="COO91_00520"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34691.1"
                     /translation="MSFSSCPSCVVVLNQQQEQNISHQNQCQDMPVNPSKSMVKSCTV
                     VENGRVVVKPLQAPVNQTLE"
     gene            complement(512923..513837)
                     /locus_tag="COO91_00521"
                     /note="Nfsy_R00521"
     CDS             complement(512923..513837)
                     /locus_tag="COO91_00521"
                     /codon_start=1
                     /transl_table=11
                     /product="IRPC, inward rectifier potassium channel"
                     /protein_id="AUB34692.1"
                     /translation="MKFRLKRLSPKKKQRLIPSIQIQVRDGKFEIMGMGAWHSYWRDP
                     YHLLLTIPWTGFLILICTFYVTINALFALAYLIGGDCIANARPGSFLDVFFFSVQTLA
                     SIGYGAMYPKTTYANIIVTIEAMIGLVGIAVMTGLAFARFSRPTARVLFSRVAVITPH
                     NAMPTLIFRSANQRRNMILEAQMRVYLMRDDVTSEGQFMRRFYDLKLLRNQTPSFTLS
                     WSVMHVIDEFSPLYGMTPESLTQTNTILIVSLSGIDETVAQVVHARHTYAANEILWNN
                     QFVDIFHHTPDGHRYIDYNRFHDVLPLD"
     gene            complement(513749..513862)
                     /locus_tag="COO91_00522"
                     /note="Nfsy_R00522"
     CDS             complement(513749..513862)
                     /locus_tag="COO91_00522"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34693.1"
                     /translation="MPLFWLLANEISTEETFTEEKTASDPIYSDSSSRWKI"
     gene            complement(514288..515196)
                     /locus_tag="COO91_00523"
                     /note="Nfsy_R00523"
     CDS             complement(514288..515196)
                     /locus_tag="COO91_00523"
                     /codon_start=1
                     /transl_table=11
                     /product="Stress response protein YsnF"
                     /protein_id="AUB34694.1"
                     /translation="MNSQPMTKNIGQANPDSQTSTSLADLRKKVNNFAVFDQQGELVG
                     VVHDLIVDNNRRLNLVISNQANQETLEYGEQLADKHPSLFRLQSQRIKKIDKPTKSVF
                     IDLNKSEIEYMPEYLETETPGDRTLSENSTEQLANYQTTNSPVEPVNLEEATEEQIIR
                     LLEERLVVESSKRKVGEVIVRKEIETRMIQVPVRREKLIVEQISPEHKQLAEIDLGQE
                     EISGIDLTEVERLEVQHFGSGLMVSGEFSSPKTASLLLNAIALEQNHGCNQVRVTIAV
                     EDESHQKKYQEWFDRCSKGQQPNPEK"
     gene            complement(515441..516334)
                     /locus_tag="COO91_00524"
                     /note="Nfsy_R00524"
     CDS             complement(515441..516334)
                     /locus_tag="COO91_00524"
                     /codon_start=1
                     /transl_table=11
                     /product="Stress response protein YsnF"
                     /protein_id="AUB34695.1"
                     /translation="MVLYKLQDFEPNYRDTFEGRDLNGLGVYTQGTDEKVGTVSDVLV
                     DEEGHFRYLVVDLGFWIFGKKVLLPIGRARIDYNVDRVYTIGLTREQAEDLPEFSERQ
                     ALDYDYEERVRGVYRQPADYVQPLDASLPLEATAPVDTTYQQPVTPTYNRDSYNYEQE
                     PSLFGLNEQDHQTLRLYEERLIASKRRQKAGEVTIGKHVETDTARVTVPIETERVVIE
                     RVTPADAGTAVSGREADFREGEVVRVEIYEETPEVRTEAFLREEVRVRKVVDEDTVET
                     QKTVRREELDVNSGNLPIEER"
     gene            complement(516662..517504)
                     /locus_tag="COO91_00525"
                     /note="Nfsy_R00525"
     CDS             complement(516662..517504)
                     /locus_tag="COO91_00525"
                     /codon_start=1
                     /transl_table=11
                     /product="Stress response protein YsnF"
                     /protein_id="AUB34696.1"
                     /translation="MPLHKLEHFDPNYRETFGGDDVRALVLYTEGGDKVGSVADVLVD
                     DHGHFRYLVINTSSDFLGKKILLPIGLSRIDYPAKRVYVDGLSRHQVEGLVEYREDMV
                     VDHDYEENVRSVFRSPNSGVTYDRNTYNYETEPALYGLKNQDNQTFRLYEERLIASKN
                     RIKTGEVTVGKHIETDTASVTVPIQKERVLIERVVPTEAGKVVDPNELKFQEGEVARI
                     EVYEETPEIRKEAFVREEVRVKKVVERDTVETQGTIRREELDVDTEGNLQVQEHGTTT
                     HEAI"
     gene            517760..518041
                     /locus_tag="COO91_00526"
                     /note="Nfsy_F00526"
     CDS             517760..518041
                     /locus_tag="COO91_00526"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34697.1"
                     /translation="MPCQPLTITLSDTDQQALEKLVNRPSTPQQIAQRARIVLKAFGL
                     VFSHANSCLEVVFLLKRISNSRGLNFIDYFNQKLARPFQWTFKGKLLAA"
     gene            complement(518336..520441)
                     /locus_tag="COO91_00527"
                     /note="Nfsy_R00527"
     CDS             complement(518336..520441)
                     /locus_tag="COO91_00527"
                     /codon_start=1
                     /transl_table=11
                     /product="putative protein, containings caspase domain"
                     /protein_id="AUB34698.1"
                     /translation="MERRTFLHRIGSILAVLGVTEAEWLTLGNRYYQALAQPSPRKLA
                     LLIGINQYPQIPALSGCLTDVELQRELLIHRFGFQQSDIVTLTEEQASREFIEAAFLD
                     HLGKQAKPGDVVLFHFSGYGSRVKLETSPNTMQNALVAANVDQVIQDEKIVNYILEET
                     LLLLLRSLPTDRVTAVLDTSYYAPSTVLGLKIRALQESVAKLAVEELDFLKQLKTQKL
                     SSTPIVLAATSEPNQSAKEGLFSGFSAGLFTYALTQYLWEFTPATTIQVALWYVENSL
                     SKLGSKQQPGLLSSQKNADITSLQPDGIIGAEGVVSAIEEDGKTVHLWLAGLPPQVLL
                     YYGVNSRLTLATTEQLVLRSRTALTAKAQISKIEGANPLQVGQFVQEAVRVLPRNIHL
                     TIALDTGLERIERVDATSAFAGFSHVSTVVAGEKPADYVFAKLQEIPSRYGLFSLGGE
                     LIPNTSGEVGEAVKLTVQRLAPKLSTLFAAKLWRLTENQGSSRLPLKATLEIISGISP
                     QVVMQRKTIRTFKPETSIKKSLPTAIVPIGSRMQYRVENQSDRPVYLIMLGLNNNHTG
                     IAFYSWETPQEPNTTDTKPLLKQVVIAPGKTLTLPQTNSASEWLISGPAFFCEQQLIF
                     STAPFSETLAALSTVKYSTAEERPIGSLLNPLDVAQALLQDLHNASALKAEMNGTAAD
                     SYILDVNNWASISFSFQVV"
     gene            complement(520623..521801)
                     /locus_tag="COO91_00528"
                     /note="Nfsy_R00528"
     CDS             complement(520623..521801)
                     /locus_tag="COO91_00528"
                     /codon_start=1
                     /transl_table=11
                     /product="sat, sulfate adenylyltransferase"
                     /protein_id="AUB34699.1"
                     /translation="MSHNPDAIAPHGGQLVNRIATPEQRAEFLSKADFLPQVQLDDRA
                     VSDLEMIAIGAFSPLTGFMNQEDYDRTVTEMRLANGLVWSIPITLSVSEEVASPLQEG
                     GLIRLDNSKGEFIGVLQLTQKYHYDKTREAINVYRTDDVKHPGVQVLYNQGNVHLAGD
                     IWLLQREPHPQFPTYQIDPAASRQLFRDKGWKTIVGFQTRNPIHRAHEYIQKCALEIV
                     DGLFLHPLVGATKEDDIAADVRMRCYEILLEHYYPLDRVTLAINPAAMRYAGPREAIF
                     HALVRKNYGCTHFIVGRDHAGVGDYYGTYDAQYIFDEFAPSELGIVPMKFEHAFYCTR
                     TKQMATSKTSPSKPEERIHLSGTKVREMLRRGELPPPEFSRPEVAAELARAMRIEVSA
                     "
     gene            521769..521909
                     /locus_tag="COO91_00529"
                     /note="Nfsy_F00529"
     CDS             521769..521909
                     /locus_tag="COO91_00529"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34700.1"
                     /translation="MRGYGIWIVTQLNPLSAFTVIVSDYVLTYQMLVRRKKSLGIGHG
                     AN"
     gene            complement(522060..522182)
                     /locus_tag="COO91_00530"
                     /note="Nfsy_R00530"
     CDS             complement(522060..522182)
                     /locus_tag="COO91_00530"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34701.1"
                     /translation="MDSVVCVELSVAAHGFMQNQPILYKTLQTALQSAFFPYGW"
     gene            522326..522946
                     /locus_tag="COO91_00531"
                     /note="Nfsy_F00531"
     CDS             522326..522946
                     /locus_tag="COO91_00531"
                     /codon_start=1
                     /transl_table=11
                     /product="putative flavoprotein CzcO associated with the
                     cation diffusion facilitator CzcD"
                     /protein_id="AUB34702.1"
                     /translation="MKKVFALIEKESAKFAELPFFGFLINKSITFLQRLYFAPCFALF
                     VIGYADLNKFVCLEEATVNPIKYIVNKPIPEEENHWIWFLGYLEYLGFKLFLNFTESV
                     KFICGQIIYELYRQTFQVNPIYRVRQEESCSLPPALVDKIFELFTVLADMLVNFAEKY
                     NIKQLLTRNFYGSDFAQLSSGKKATVGGIKFPDVTLFSTRHCANNV"
     gene            complement(522996..524330)
                     /locus_tag="COO91_00532"
                     /note="Nfsy_R00532"
     CDS             complement(522996..524330)
                     /locus_tag="COO91_00532"
                     /codon_start=1
                     /transl_table=11
                     /product="Multidrug efflux pump subunit AcrA"
                     /protein_id="AUB34703.1"
                     /translation="MLIDPQPDFLRLVQNDEYLPSVSIWTRLGGIFLIGSVGAAFSLA
                     SVFQYNVIVKADATVRPTGEIRLVQAAAEGTVTSIKVKENQVVKKGDTIALIDNSQLQ
                     TKKSQLLGTIEQNQLQRAQIDAQLKALENQMAAESNAMRQAITSAKADLSRNKRDYQD
                     KQITSLAQVQEIEAGVELAREELKRYQQLGNTGAIAALQIKEKEQAFKAATARLDNAK
                     AGLNPSDANVAIAQERISQELTKGESTIAQLNKEKEELIRRQVEVQNQISSAQQELKQ
                     VFKELQKSVIRTSEGGTILKLELRNAGQVVRVGDAIAQIAPNNAPFVIKARVPSSEIS
                     KVQVCKVAQVAKCSEGEVQMRLSAYPYPDYGILKGAVRGISADAITSQGNGNIPIAPY
                     YEVTIEPEKLYLKKADKSYPIQAGMEVTAEIISKKETLLTFILRKARLLTDV"
     gene            complement(525265..525438)
                     /locus_tag="COO91_00533"
                     /note="Nfsy_R00533"
     CDS             complement(525265..525438)
                     /locus_tag="COO91_00533"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34704.1"
                     /translation="MGVGAGVVGAGVVGVVGVVGVVGACFLYLLRRPPDKVASSVTVN
                     VVNNVLSIILVLA"
     gene            complement(525677..525796)
                     /locus_tag="COO91_00534"
                     /note="Nfsy_R00534"
     CDS             complement(525677..525796)
                     /locus_tag="COO91_00534"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34705.1"
                     /translation="MVLGMFKVIVMGLGAGVGVGVVGAGVVGVVGRGARLYFL"
     gene            complement(525936..526094)
                     /locus_tag="COO91_00535"
                     /note="Nfsy_R00535"
     CDS             complement(525936..526094)
                     /locus_tag="COO91_00535"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34706.1"
                     /translation="MGLGAGVGVGVVGAGVVGVVGRGARLYFLEVPPDKLASSVTVNV
                     VNNVLCII"
     gene            complement(526267..526425)
                     /locus_tag="COO91_00536"
                     /note="Nfsy_R00536"
     CDS             complement(526267..526425)
                     /locus_tag="COO91_00536"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34707.1"
                     /translation="MGLGAGVGVGVVGAGVVGVVGRGACLYFLEVPPDKLASSVTVNV
                     VNNVLCII"
     gene            complement(526598..526756)
                     /locus_tag="COO91_00537"
                     /note="Nfsy_R00537"
     CDS             complement(526598..526756)
                     /locus_tag="COO91_00537"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34708.1"
                     /translation="MGLGAGVGVGVVGAGVVGVVGRGAGLCFLEVPPDKLASSVTVNV
                     VNNVLCII"
     gene            526933..527205
                     /locus_tag="COO91_00538"
                     /note="Nfsy_F00538"
     CDS             526933..527205
                     /locus_tag="COO91_00538"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34709.1"
                     /translation="MQSTLFTTLTATEEASLSGGQNKIHRLALRHATPATPATPATPA
                     TPATPATPTVNLTLNLPVVITQVAINVNTGNVKGNLIQTAANQIGV"
     gene            527976..530120
                     /locus_tag="COO91_00539"
                     /note="Nfsy_F00539"
     CDS             527976..530120
                     /locus_tag="COO91_00539"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type bacteriocin/lantibiotic exporters,
                     containing an N-terminal double-glycine peptidase domain"
                     /protein_id="AUB34710.1"
                     /translation="MKYQVVAQHSEEDCGAACLASVAKHYRRNFTLNRIREAVGTGQL
                     GTTLLGLRRGAEALGFNARSVRASKEILDRMNQAPLPAIIHWKGYHWVVLYGQKGKKY
                     VIADPAFNIRYVSRNELIEAWSDQVMLLLEPDSVRFYAQPDDKVNGLWRFARRTLPYG
                     GIIFEAFLCAIVIGLLSLTSPFLLQILTDDVLVRGDTQLLIGVIIAVVVMNLVSSSLQ
                     LVQSNLIANFAQRLELGLVLEFARAILRLPLAYYESRRSGEIVSRLQDIQQINQLVAQ
                     AVISLPSQLFIGLISLGFMVFYSWKLTFVAVVVAIVMSLSTVVFLPTLQQKIRSMLVL
                     DAENQGVLVESFKGALTLKSTTAAPQFWEEFQNRFGRLSNLTFRTVQIGIINSTFSGL
                     VYAIGSVSLIGFGSVLVISKELSIGQLLAFNGMNGNFLALIGAVLGFIDEFTRAKTAT
                     ERLTEVIDSTPETPSDSSKPFAKISSDADIICKNLNFHYAGRLELLEDFSLTIPGGKV
                     VALIGTSGCGKSSLAKLIAGLYTPNSGNIRFGIYNMQDLALDCLRQQVVLVPQDAHFW
                     SRTIIENFRLGSPHLTFDQIVKACQIAEADDFISKLPEKYQTVLGEFGSNISGGQRQR
                     LALARAIVNDPPVLILDESTAGLDPVSEAQVLDQLLLHRKDKTTILISHRPRVINRAD
                     WIVLLNQGKLQIQGTVEDLRAQPGNHLDFLTP"
     gene            complement(530614..530751)
                     /locus_tag="COO91_00540"
                     /note="Nfsy_R00540"
     CDS             complement(530614..530751)
                     /locus_tag="COO91_00540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34711.1"
                     /translation="MQIRTVYLYPKTLVKITTCLALALSSSKECLRLAWCMTIHAIWK
                     S"
     gene            531408..532235
                     /locus_tag="COO91_00541"
                     /note="Nfsy_F00541"
     CDS             531408..532235
                     /locus_tag="COO91_00541"
                     /codon_start=1
                     /transl_table=11
                     /product="fabG"
                     /protein_id="AUB34712.1"
                     /translation="MEIQGKVALITGASRGIGRAIALELAQIGIKRLILVARDRQKLV
                     EVANEIEAIGTETAIVALDLTQTIEVNIAVAQLWRNYGQIHLLVNCAGVAYQSSFLQS
                     KLPQVQEELSVNLLGMYNLTSLIARRMASQRQGTIVNVSSLMGKVAAPTMATYSATKF
                     AILGFTQALRQELADYNIRVIALLPSLTDTDMVRDLKLFRWVIPMTPQQVAKGLVTGM
                     QNDSPEILVGWQSHLAVWCQRLAPWLLELILRITTPPAPTKQQPSQKLKKLMPKLNF"
     gene            532825..534321
                     /locus_tag="COO91_00542"
                     /note="Nfsy_F00542"
     CDS             532825..534321
                     /locus_tag="COO91_00542"
                     /codon_start=1
                     /transl_table=11
                     /product="Alpha-amylase/alpha-mannosidase, GH57 family"
                     /protein_id="AUB34713.1"
                     /translation="MLSFPTTLTPLPETIDGLPNISGWETEVLSVVNHNQPVFLPTTN
                     IRLEDVNAVFAIALHMHQPTIPAGNGGTLISNLQYMFEHPHEGDNHNADPFAHCYSRM
                     GDLIPELVSQGCNPRVMLDYSGNLLWGLRQMGRGDVLDNLKRITCDRTYQPYVEWLGT
                     MWGHAVIPSTPIADIKLHIIAWQHHFAAIFGWEALARVKGFSPPEMHLPNHPDALFEF
                     VKALKECGYRWLLVQEHSVETISGQSLNHKHLPHRLVARNSQGETISITALIKTQGSD
                     TKLVAQMQPYYEAKTLSKQQIGSVFVPPIVSQIGDGENGGVMMNEFPSAFKQAWWDMV
                     NNGGGKSSVVGLCGTEYLELIEAAGCKPEDYPTCQPVGQHQIWERVSSDNCQPEAVEN
                     AIQELKQINSNFHLDGASWTNHISWVKGYENVLSPMYQLSSLFHRKFDPLQQVDSAEP
                     VTRESHYRNVLLHNLLLQTSCFRYWGQGAWTDYAREIYQRGENLLHIN"
     gene            complement(534871..536229)
                     /locus_tag="COO91_00543"
                     /note="Nfsy_R00543"
     CDS             complement(534871..536229)
                     /locus_tag="COO91_00543"
                     /codon_start=1
                     /transl_table=11
                     /product="Signal transduction histidine kinase"
                     /protein_id="AUB34714.1"
                     /translation="MSEEFSCQISPPFVSLGSDRDLDLNSTLQELPMYNFPVEINHTG
                     MEVASFLEKYPQLPGVILVEQGKFIGMISRRRLLEFLIRPLGQELFVQQPLAVLYSYA
                     RIPMLLLADTTSILTAMQLSLKRSPELLAEPIVVETESGAYRLLDVQELNIISWQIRG
                     IENLVRYERSQAQMIQNDKMANLGRLVDGVAHEILDPVGFIWGNITYVSTYSQDLLKL
                     IAAYDKELPSASQAINQIKEEIEFDFLEQDLSRSLASIRTGAERLKKLVTSLQNFCYI
                     DELYPKPVDLHACIDSIILLINSRLQGEIEIVKYYGQLPPVYCFMGQINQVLMNIFSE
                     VVDTLLNEAVRQQLHREDTKTVQKPRIEITTEVISQEASNPNAPDSRWILIRIADNGP
                     GMSQELQQQIMESFSLETKNSKNTSLAVSYRIITVRHGGKLSFHSQIGIGTKFEILLP
                     LV"
     gene            536418..536576
                     /locus_tag="COO91_00544"
                     /note="Nfsy_F00544"
     CDS             536418..536576
                     /locus_tag="COO91_00544"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34715.1"
                     /translation="MTSATNQSTLSGDERAKQERQRAEQERQRAEQESQRADRLAAQL
                     RRRKAACR"
     gene            complement(536633..536749)
                     /locus_tag="COO91_00545"
                     /note="Nfsy_R00545"
     CDS             complement(536633..536749)
                     /locus_tag="COO91_00545"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34716.1"
                     /translation="MITLVAVKFVSKQIKPQMTLLHHPFLIRNGAPTSLPLR"
     gene            536751..537878
                     /locus_tag="COO91_00546"
                     /note="Nfsy_F00546"
     CDS             536751..537878
                     /locus_tag="COO91_00546"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein YddW, UPF0748 family"
                     /protein_id="AUB34717.1"
                     /translation="MTNRPPSEPESSQKTALGFDEFIAILVAFATIGAILFWSLSRRD
                     SSWNLNGLLSPSPTPSRSVQPNQVLPFPTPKVEPNAAPNNVLPSSPPEAVVEPKTPAF
                     PTSSRAVLPSAQVIPTQSPQPQTPISSSAGLESSITSSALPLVTPAKQKSIIPPPIAF
                     NDVPNNFWGRRFIDVLSSRGILKGFPDYSFRPNQPVNRAEFAAILQKAFDQEPSKTAI
                     AFQDVPAKFWATPAIDRAISAGFLKGYPKKTFKPQQNITRVQVLVALVSGLNLKAPTS
                     QNKILSVYKDSKNIPTYATSKIAAATANGLVVNYPNPQILAPNKVATRAEVAAMIHQA
                     LVKRGKLEGISSQNIVRAGSVSPKVSPTRKQNLKGNLSTGG"
     gene            complement(538671..539108)
                     /locus_tag="COO91_00547"
                     /note="Nfsy_R00547"
     CDS             complement(538671..539108)
                     /locus_tag="COO91_00547"
                     /codon_start=1
                     /transl_table=11
                     /product="Valyl-tRNA synthetase"
                     /protein_id="AUB34718.1"
                     /translation="MPEQEFTETASKETTVAEINSQTGTITKLQPPAQSQDEWQKYGE
                     QISSFLATLPEYLGSFFNQYKQPLITVGLIVGSIVGVKVLLAILDALNDIPLVAPTFE
                     LIGIGYSAWFVYRYLLKASTRKELTSEITTLKSQVVGEQIPEA"
     gene            540494..542167
                     /locus_tag="COO91_00548"
                     /note="Nfsy_F00548"
     CDS             540494..542167
                     /locus_tag="COO91_00548"
                     /codon_start=1
                     /transl_table=11
                     /product="Signal transduction histidine kinase"
                     /protein_id="AUB34719.1"
                     /translation="MSAEERSTDELPTIEFPSRGKLKASSWRIHQKIGYGYFVAIGIG
                     FFGSLTGLVIANYYRGREVRQFNQAYEQGQLLSNYKDAVVGAQLHSSNLVAVLENSQQ
                     LQTKKADFLKNVEKAKQLESRIGGFIDSKPKRLAATSSTLQTLLLDYKTNLKAYVDKI
                     EVVLQKIDSQQVQPQQISSARSQLLTIMRGQTAMRLDQLSQSLTNILQTAQEQEQERQ
                     KAVEQAKIVERLIVIVSMLVSVAIAAIVAWRTSRAIAEPVITVTQVAEQVARKHNFDL
                     RAPVTTEDEIGLLAKSLNRLIERVSERTKELQQAKELAEAASKAKSVFLANVSHELRT
                     PLNAVIGLSQLLEDDATDLGLSADFITDLETINAAGKHLLHLINEILDLSKIEAGKMT
                     LYPETFEIATLIHNVVLTVKPAIEKNANVLEVHFDEQLGMMYADQTRMRQVLLNLLSN
                     ASKFTTNGKVTLTVNREKDEFRPEAPLGMITFTVTDTGIGMSQGQQQQLFKPFTQGDT
                     STTKKYGGTGLGLAISRHFCQMMGGEIIVKSQPGVGSTFTIRLPMTVQD"
     gene            complement(542133..542285)
                     /locus_tag="COO91_00549"
                     /note="Nfsy_R00549"
     CDS             complement(542133..542285)
                     /locus_tag="COO91_00549"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34720.1"
                     /translation="MDLSASIERLVLSVVEVSRDARHESLSTSKCPMPHAPSSFNPAQ
                     SLADEW"
     gene            complement(542649..543350)
                     /locus_tag="COO91_00550"
                     /note="Nfsy_R00550"
     CDS             complement(542649..543350)
                     /locus_tag="COO91_00550"
                     /codon_start=1
                     /transl_table=11
                     /product="cynT, carbonic anhydrase"
                     /protein_id="AUB34721.1"
                     /translation="MERRDFLKLGMTGAFGMMLSASDLLWRVEQAKAANIPSTSSESL
                     NPDAALQKLMEGNQRFVAHQPQYPDQSALRLQEVAQAQHPFATILSCADSRVPAEIVF
                     DQGIGDIFDIRIAGNIATHEAIGSIEYAVVLLTSPLLMVMGHERCGAVTAAVQNESLL
                     GDISTFVKAIKPAVEKVKSQPGDAVENAVVANVQYQIEQLERSQLLTEQVRSGKLKIV
                     GGRYDLDTGRVTIIT"
     gene            complement(543376..543687)
                     /locus_tag="COO91_00551"
                     /note="Nfsy_R00551"
     CDS             complement(543376..543687)
                     /locus_tag="COO91_00551"
                     /codon_start=1
                     /transl_table=11
                     /product="Nitrogen regulatory protein PII"
                     /protein_id="AUB34722.1"
                     /translation="MHVVKKIEIIANSFELAKILDSLDKSGVHNHAVIRNVAGKGLLG
                     TTEDLDMTMLDNVYILAFCMPEELKRVVENIKPLLNKFGGTCYVSDVMEVRSVRCVAS
                     M"
     gene            complement(543692..544660)
                     /locus_tag="COO91_00552"
                     /note="Nfsy_R00552"
     CDS             complement(543692..544660)
                     /locus_tag="COO91_00552"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+-dependent bicarbonate transporter
                     superfamily"
                     /protein_id="AUB34723.1"
                     /translation="MDISLIVSNILNPPILFFFLGMTAVFVKSDLEIPAPMPKLFSLY
                     LLFAIGFKGGVELIKSGVTQEVVLTLAAAMMMACVVPIYTFFILKWKLDTYDAAAIAA
                     TYGSISAVTFITASAFLTELGIPFDGYMVAALALMESPAIIVGLILVNIFTVDGKRDL
                     SWPEVLQEAFLNSSVFLLVGSLLIGVLTGERGWHVLEPFTQGLFYGVLTFFLLDMGLV
                     AARRIKDLQKTGVFLILFAILIPILNAGIGLVIAKLIGMPRGDSLLFAVLCASASYIA
                     VPAAMRMTVPEANPSLYVSTALAVTFPFNIIVGIPLYLYGINLFWR"
     gene            complement(545131..545538)
                     /locus_tag="COO91_00553"
                     /note="Nfsy_R00553"
     CDS             complement(545131..545538)
                     /locus_tag="COO91_00553"
                     /codon_start=1
                     /transl_table=11
                     /product="putative nucleic acid-binding protein,
                     containings PIN domain"
                     /protein_id="AUB34724.1"
                     /translation="MTKVFVDTAAWIALLNVRDNLHHQASEVMDRLLRLETLLVTTEF
                     VLLEVADALCTPVSRIQTVAFINSLRVLKSVQIIPFDQKLLDEGWMLYSQRPDKDWGL
                     TDCISFAVMTQEGITQAFTSDRHFEQAGFTKLL"
     gene            complement(545541..545792)
                     /locus_tag="COO91_00554"
                     /note="Nfsy_R00554"
     CDS             complement(545541..545792)
                     /locus_tag="COO91_00554"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34725.1"
                     /translation="MLSVKGTFQNGVVHPNEPIEGHEGQSVIIVFVEENHTPEPATPE
                     DSDWDKLRQLIKNCAVDTDINDLAHQHDHYLYGMPKRES"
     gene            545920..548274
                     /locus_tag="COO91_00555"
                     /note="Nfsy_F00555"
     CDS             545920..548274
                     /locus_tag="COO91_00555"
                     /codon_start=1
                     /transl_table=11
                     /product="uvrD, DNA helicase II / ATP-dependent DNA
                     helicase PcrA"
                     /protein_id="AUB34726.1"
                     /translation="MTPGNRFFTSMTTTIDFLSHLNPSQRQAVEHYCGPLLVVAGAGS
                     GKTRALTYRIANLILKHRVDPENILAVTFTNKAAREMKDRIQRLFAEQLAMKQHGQRF
                     DLLTEYQQTLLRSQVYKDTIKDLWCGTFHSLFSRILRFDIEKYVDEKGRRWNRNFSIF
                     DESDVMTLIKEIVNKKLNLDDKKFDARSVRYAISNAKNQGLSPQEFEQDQPNYRGRVI
                     AQVYNLYQDKLAENNALDFDDLILVPTRLFQQNEQVLGYWHRKFCHILVDEYQDTNRT
                     QYQLIHLLVTNGETRKSEWEWQNRSVFVVGDADQSIYSFRMADFTILLGFQEDFGDGL
                     VDDDTRTMVKLEENYRSCENILQAANELIENNTQRIDKVLKPTRGPGEQITCHKADEE
                     LAEAAFVINQISTLENQNPELSWGSFAILYRTNAQSRPFEELLVKYQIPYTVVGGMRF
                     YDRKEIKDVIAYLRAIANPSDTVSLLRVINTPRRGIGKTTIDALVNASQQLGTTLWEI
                     LSDETSVNTLAGRATKAVNSFAEMISRWQGQIGTLPVTEVLQGILEDSGYVQDLMSQG
                     TDEATDRVQNVQELYNAALQFQEENEEVSLRDFLNSAALSSDLDNLKEGQTAVSLMTL
                     HASKGLEFPVVFLVGLEQGLFPGYRSLGDPASLEEERRLCYVGITRAQERLYISHARE
                     RRLYGSREPAMRSQFLDELPEELLTTQRLSRQSYTKSASTSNGKQDTKQNWQVGDRVL
                     HKTFGLGEITHVFGTGNKMSVAIKFTSLGQKIVDPRVAQLQRVE"
     gene            548334..548519
                     /locus_tag="COO91_00556"
                     /note="Nfsy_F00556"
     CDS             548334..548519
                     /locus_tag="COO91_00556"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34727.1"
                     /translation="MSTTEEAFVTPERAGLTKTCSFVTPERAVVTKTCSLISKIGVLV
                     NKTPILLIIYGLFIIND"
     gene            complement(548825..549100)
                     /locus_tag="COO91_00557"
                     /note="Nfsy_R00557"
     CDS             complement(548825..549100)
                     /locus_tag="COO91_00557"
                     /codon_start=1
                     /transl_table=11
                     /product="Heme-degrading monooxygenase HmoA and related
                     ABM domain proteins"
                     /protein_id="AUB34728.1"
                     /translation="MLHVKSGLESDFEAAFKKASKFISSMDGYLSHELHKCIEVQGKY
                     LLLARWETLESHTVGFRSSAEYQEWKKLLHHFYEPFPTVEHFEEIEI"
     gene            complement(549185..550534)
                     /locus_tag="COO91_00558"
                     /note="Nfsy_R00558"
     CDS             complement(549185..550534)
                     /locus_tag="COO91_00558"
                     /codon_start=1
                     /transl_table=11
                     /product="TC.MATE, multidrug resistance protein, MATE
                     family"
                     /protein_id="AUB34729.1"
                     /translation="MFSEVKKCLVLAVPLAAAQLAQSATGFMDTVMMGWLGSQTIASG
                     ALGVTIFSFCLLIVTGIVSAISPLAAQAYGAGNREKVGTIVRVGLGISLVLGIPVTLL
                     IYNGGALLLLGQDANAVALAEIYLRAIALGFIPALGFAVLKSFLSALLQPQLVMVTVV
                     LGTLLDITANYVLMFGKLGFPALGLAGIGWASTFSLWSTFIALTVYICNQPRFAVYGI
                     FRPLSRKDFPLEHRRIIGEIFHVGLPIGGLIAVEAGLFTVVTFIIGKLGTNALAAHQI
                     ALQTISISFQIALGISLSTTVRVGQLVGQNDLLATRLAGYVGIAIAGLSMGVVGITFW
                     LVPKSIISLYIDISDPNNADVVALAVKLLGVAAIFQIVDGVQVTAGGALRGLKDTRIP
                     MLIGIFAYWCVGLFTGYTFGISSGYGAIGLWWGLAIGLAIAAIIMTWRFSKKTTNHG"
     gene            complement(550692..551225)
                     /locus_tag="COO91_00559"
                     /note="Nfsy_R00559"
     CDS             complement(550692..551225)
                     /locus_tag="COO91_00559"
                     /codon_start=1
                     /transl_table=11
                     /product="GAF domain-like"
                     /protein_id="AUB34730.1"
                     /translation="MTQQELPSTFNKILESSQTLDTLFSALLPAVGDFLQSDRCFLYL
                     HNPQNDLGRVAFCWIRTPDVPTVYNEDWAPQPPSVTDEDPMFAAALRAEPSIFVEDVE
                     TAEPKVLNREFEQKNFGHRALIHAHIRQDGQLWGILQPCIFGHSRIWTEYERGVINNL
                     VEKITPFAVDYVKSAFD"
     gene            complement(551230..552147)
                     /locus_tag="COO91_00560"
                     /note="Nfsy_R00560"
     CDS             complement(551230..552147)
                     /locus_tag="COO91_00560"
                     /codon_start=1
                     /transl_table=11
                     /product="3',5'-cyclic AMP phosphodiesterase CpdA"
                     /protein_id="AUB34731.1"
                     /translation="MNLKRRQFLFLSSFSAIGTGFLGWMLAHQNHQTADITDSTTAIA
                     ANPAKKDLLLRFVSVADTGTGAKGQYAVARAMNAYHKRNPYDLVVLAGDNIYNNGEIE
                     KIGAVFERPYQALLKLGVKFQACLGNHDIRTENGDPQVKYAGFNMKGRYYTFKRNQVQ
                     FFALDTNSNADWKNQLSWLEKELSLSKAPWKVVFGHHPIYSSGHYGVNQSFIKIFTPL
                     FQKYGVQLYINGHDHTYERTRAINGTTYLVTGAGAGTRPIGRSEWTEYSAEKLSFASY
                     EVYKDRIEVSAIATDNRVFDKGIIQLKSA"
     gene            552284..553189
                     /locus_tag="COO91_00561"
                     /note="Nfsy_F00561"
     CDS             552284..553189
                     /locus_tag="COO91_00561"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA segregation ATPase FtsK/SpoIIIE"
                     /protein_id="AUB34732.1"
                     /translation="MSQDNQSKPTDEQVTQPPQKPYQRVQPFWKAKIIQLLQGTIGVL
                     EVTVEKLETAPPPGTEEKPGFFQQFQLWWGGLLRTIRLFLPSNLSTKLSDTVLTAIVT
                     GIAVIIVWTTASVFTGKPTEIATVPPVEEVPARTPAPTITTPPESVTPEPQPPLPPEE
                     ITPPEVQTPPPTPEAEPEPEPIPTPTPTPTPTIELTPEQALIAAIENQVAEISDRIAS
                     GLIKSIQANFRTSNLTVKISDDWYTLKESQQDKLAAEILQRSQELDFTHLEIIDSQDR
                     LIARNPVVGTEIVIFKRQTANENNS"
     gene            553340..554173
                     /locus_tag="COO91_00562"
                     /note="Nfsy_F00562"
     CDS             553340..554173
                     /locus_tag="COO91_00562"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutathione synthase/RimK-type ligase, ATP-grasp
                     superfamily"
                     /protein_id="AUB34733.1"
                     /translation="MLDNVLLLLQACKNLNISYEIIHPAENLLKIKLNNKQHYFCNYS
                     TPLINQAVAQIIKDKEYTYHILKQKIKLPRTVGFLSPFCELKYKMYLKFPSFQDIILE
                     IKDKFETPVIVKRNSGAGGHNVFLCQNRDEIETALKEIFNINYKNYDYVAIAQEFIHI
                     KSEYRAVFLNKELVLLYEKDISNAEFAGNLSPLHWNGAKAKYINEPQILLEIANFVQP
                     IFEELDLDYAGLDIVLDRDNQYWLIEVNSHPNYTIFTRDNGEEPVLKVFEKMLISLAS
                     K"
     gene            554326..554463
                     /locus_tag="COO91_00563"
                     /note="Nfsy_F00563"
     CDS             554326..554463
                     /locus_tag="COO91_00563"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34734.1"
                     /translation="MTRLKWRKLVPELVVRPDLLSRYFLCLSTLQWKAIYNNQITAYL
                     L"
     gene            complement(554665..556689)
                     /locus_tag="COO91_00564"
                     /note="Nfsy_R00564"
     CDS             complement(554665..556689)
                     /locus_tag="COO91_00564"
                     /codon_start=1
                     /transl_table=11
                     /product="cikA, two-component system, sensor histidine
                     kinase and response regulator"
                     /protein_id="AUB34735.1"
                     /translation="MLSSPDLSFSRTLPIVVFNQLGELLEQMAQTVGSAALILTEAVL
                     MRICIPVEWQRQRFTLVVSEQFSALLIGNLAQGEQGEQEINSALNAKLTFNLEAIATF
                     VYELRDLFECDSSTHQNLEGYRQIIRPNDATLQSQFSLLLLEYLLTQPSQEIITPLSS
                     TAPTVYICQPVEDALKKQISQERLLNQVTTQIRKSLDLPVIMATAITQVREFLELDRL
                     VIYKFAGSKVKAQYQSDNIPFNGTALVTDMELSVREPAKIPFSIHESNGKHSPPVSVN
                     NQPLLEDCQQYGGYIVYEVRATDAITSVLNYTEKNCFIRTSQCWEKYRQGFTLAVDDV
                     EKTYALEECLLNFLRESQVRAKLAAPIIFEDKLWGLLIAHQCDKPHQWNDSEKNLLIA
                     IAEQLAIAIHQAELMQTLTQEKQTLEQRVIERTIGLRDALLAAEAASRLRSEFLATIS
                     HELLTPLTYVIGMSSTLLRWPLGELSQRQRGYLQTIHDSGEHLLEMINDILDLSQIEA
                     GKTALNISEFSLVNVAENAVESLRKKATSEQINLQLDLQIDPRRDRFTADAERVEQIL
                     WNLLTNAIKFTPESGSVTLRLWVEDDTAIFQVEDTGIGIHEEQLPLLFEKFQQLDTPY
                     RRRYEGTGLGLALTKQLVELHRGRIEVESTVSIGSIFTVWIPTQAMRVVS"
     gene            556784..560854
                     /locus_tag="COO91_00565"
                     /note="Nfsy_F00565"
     CDS             556784..560854
                     /locus_tag="COO91_00565"
                     /codon_start=1
                     /transl_table=11
                     /product="cobN, cobaltochelatase CobN"
                     /protein_id="AUB34736.1"
                     /translation="MHRISSTSGGWNQSEGLIFLEQTPAPFVLITAADTDIQTLAAAV
                     TKLPASFPALRVANLLQLQQQLSIDTYGEQVLELAQVIILRLLGGRSYWGYGLEVVQE
                     IVQRNGRTLIVMPGDDAFDPDLISQSTVPLAIVNQVWQYFSEGGVENFVNALQFISDT
                     CLLTAYNPPLPRPIPRVGLYEWGVGSGEWGVRAGEAGEQGSRGELELDSSTSELRSPT
                     SDTQGFQCPMPNAPCPMPKIGILFYRAHYLAGNTKVIDALCQALAKKNLQPVPVFVSS
                     LREPDVQVELSEFFQPKEAESIAVLLNTTSFSLARLESETPQTELWEKLDVPVLQVIL
                     SGGSIEQWESQFQGLSPRDIGMNVALPEVDGRIITRAVSFKAVQTRNPHLETDVVIYE
                     PVSDRIEFVAKLAANWAHLRSKPPQERRIALILANYPNRNGRLANGVGLDTPASCVEI
                     LQALHQAGYEVENPPAQGDELIQRLTDGVTNDPEGREWLPVHQSVSWEDYQQYFASLP
                     PAVQQGISERWGIGHGAWGMGHGKKGDEGNNQCPMPNAQCPIPISGIQLGNVFVGIQP
                     ARGYDNDPSLNYHAPDLEPTHAYLAFYYWVRECFGADAVVHVGKHGNLEWLPGKSVAL
                     SSNCYPEVAFGALPHLYPFIVNDPGEGSQAKRRAQAVIIDHLTPPMTRAELYGSLQQL
                     ENLIDEYYEADSLDPSRLPVIRDRIHELVIKENLHLDLGIQNETEIFNSESLILNSIG
                     GYLCELKEAQIRDGLHIFGQCPQGRQLRDLIVAIARIPNRHSSGITRAIAQDWGLDFD
                     PLTADLSMTSGEYSIVNGTECRTLGDIVEVLEEHAALLVEQLIIENSELRTQNSEFRT
                     PHSSLLTPNSPLPTPHSPLPIVLNWIRDRLLPALQKTHEEITHLLHGLDGGYVPSAPS
                     GAPTRGRPEVLPTGRNFYSVDIRAIPTETAWDIGRKAAETLVEYYTQEHGEYPKTLGL
                     SLWGTATMRTGGDDIAEALALLGVQPVWDGAARRVVDFEILPLAILGRPRVDVTLRIS
                     GFFRDAFPNLIDLFAQAVSAVADLDEPPEQNPLADAVRQETDLWTNQGLTLEEAVVRS
                     RYRIFGSRPGAYGAGLQGLIESQNWTDDEDLARAYINWSSYAYSSGNFAGEQGSRGAG
                     EQGSRGAEILPNSQCPMPNTEAFKQRLSQMQVVLHNQDNREHDLLDSDDYYQFQGGLT
                     AAVLSLQGKNPQTYFGDNSIPAKPRVRQLKEEIARVYRSRVVNPKWIAGVMRHGYKGA
                     FEMAATVDFLFAYDATAKCVEDYMYQGIVEAYLLDPVVSEFIQEKNPYALRDIAEKLL
                     EAHKRNLWEDVNIGTLEALRNLVHQAEAVIEEKSMV"
     gene            560864..562012
                     /locus_tag="COO91_00566"
                     /note="Nfsy_F00566"
     CDS             560864..562012
                     /locus_tag="COO91_00566"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidoglycan-binding"
                     /protein_id="AUB34737.1"
                     /translation="MENLAYLHLAFAYEDSTPSELVSLSSLFNKAAAPDWKRLSGRAW
                     KYMLPLALSLSILGAVTSVMALEKGDQGPSVRNLQQKLKTAGFYQSSVTQVYDASTQE
                     AVRRFQKAAGLPVDGIVGASTLQKLESWQAKKSTTTATQTKKTTAVRSAQAKKPSTTS
                     SASSATSQRRNPNYLAKGDEGEDVRALQERLRVAGFYYGNATGIFGPITEEAVKRFQD
                     SYKLSVDGVVGPATLAKLPGVGIGDGEEAPKNQKVVNRDKFRIGDRGEPVRVLQEQLI
                     QAGYLEGEPNGYYGPYTADAVRRFQAANYLAASGVAGPTTRAKLYSSVNTTSKSEFNT
                     LEIQTRLRERGFYKGKLNGVMAADTKKAIKQAQEFYGISLKDLKSGRF"
     gene            complement(562144..562599)
                     /locus_tag="COO91_00567"
                     /note="Nfsy_R00567"
     CDS             complement(562144..562599)
                     /locus_tag="COO91_00567"
                     /codon_start=1
                     /transl_table=11
                     /product="fur, Fur family transcriptional regulator,
                     ferric uptake regulator"
                     /protein_id="AUB34738.1"
                     /translation="MTVYTTTSLKAELNERGWRLTPQRETILHIFQELPQGEHLSAED
                     LYHRLETDGEGISLSTIYRTLKLMARMGILRELELGEGHKHYEINQPYPHHHHHLICV
                     RCNSTIEFKNDSILKIGSKTAQKEGFHLLDCQMTIHAVCPKCQRALMPL"
     gene            complement(562767..562904)
                     /locus_tag="COO91_00568"
                     /note="Nfsy_R00568"
     CDS             complement(562767..562904)
                     /locus_tag="COO91_00568"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34739.1"
                     /translation="MHLIVQDFPRPLLKYLEGRGQLSNSKLTYSKFKVKGCNRYKYPN
                     Y"
     gene            complement(563017..564297)
                     /locus_tag="COO91_00569"
                     /note="Nfsy_R00569"
     CDS             complement(563017..564297)
                     /locus_tag="COO91_00569"
                     /codon_start=1
                     /transl_table=11
                     /product="SIG2, RNA polymerase ssential primary-like sigma
                     factor"
                     /protein_id="AUB34740.1"
                     /translation="MLPGAIETIFMPATSFYADAPYNTKKSSQALDSDLTVDESELSV
                     DDLQELEIASADNANFAANTNRRSTDLVRLYLQEIGRVRLLGRDEEVSEAQKVQRYLR
                     MRIVLAKAAKEGDEVITPYLRLIEVQERLTSELGHRPSLERWAATADIVLSDLRPTLA
                     EGKRRWAEIAKLTVEELEQVQSQGLQAKEHMIKANLRLVVSVAKKYQNRGLELLDLVQ
                     EGTLGLERAVEKFDPTKGYRFSTYAYWWIRQGITRAIATSSRTIRLPVHITEKLNKIK
                     KAQRKIAQEKGRTPTLEDLATELEMTPTQVREVLLRVPRSVSLETKVGKDKDTELGEL
                     LETDSVTPEEMLMRESLQRDLHHLLSDLTSRERDVILMRFGLADGHPYSLAEIGRALD
                     LSRERVRQIESKALQKLRQPKRRNLIRDYLESLS"
     gene            564713..564850
                     /locus_tag="COO91_00570"
                     /note="Nfsy_F00570"
     CDS             564713..564850
                     /locus_tag="COO91_00570"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34741.1"
                     /translation="MISINGKNSLDTEIEEVAIRFGLLKLSVEVSRGSRGRRGAGGEK
                     I"
     gene            complement(565250..565924)
                     /locus_tag="COO91_00571"
                     /note="Nfsy_R00571"
     CDS             complement(565250..565924)
                     /locus_tag="COO91_00571"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34742.1"
                     /translation="MDAEYVLRMEDLLDLYGEAYDPKRPVVCFDECPYQLLEDVREPL
                     PAEPEQPLRYDYEYKRKGSVNIFAFFQPLAGWRHLEVTQQRTKVDFALQMKNLVDIYH
                     RDADVIRLVVDNLNTHNPASLYEVFSPEEARRIVQKLEFHYTPKHASWLNQVEIEFSV
                     LSRQCLERRIKDVQTLSSEIATWEQQRNDASASVNWRFKTTDARRKMERLYPTMSPSK
                     VELTEY"
     gene            complement(565974..566450)
                     /locus_tag="COO91_00572"
                     /note="Nfsy_R00572"
     CDS             complement(565974..566450)
                     /locus_tag="COO91_00572"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34743.1"
                     /translation="MRQVFGKLIEVLATVSIMAKKYTVNLSNEEVEKLRSLIKTGKSK
                     ARTITRAHILLMASEGETDATIADRLRVSVSTVERTRAKLIKSGIEGTLNDRPHPPKP
                     RKLDGFKEAFLIATACSKPPNGRTRWTLKLLADRIVRIEIVDSMWILLVMKLCVPI"
     gene            complement(566451..566576)
                     /locus_tag="COO91_00573"
                     /note="Nfsy_R00573"
     CDS             complement(566451..566576)
                     /locus_tag="COO91_00573"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34744.1"
                     /translation="MVEAGGEEKQGERELLNNKPLSSPAYPNRIATTSTLSTQKC"
     gene            complement(566597..567541)
                     /locus_tag="COO91_00574"
                     /note="Nfsy_R00574"
     CDS             complement(566597..567541)
                     /locus_tag="COO91_00574"
                     /codon_start=1
                     /transl_table=11
                     /product="gpsA, glycerol-3-phosphate dehydrogenase"
                     /protein_id="AUB34745.1"
                     /translation="MSEQMYSNSKLSVAILGAGAWGASLANLAAANGHQVRVWSRQGS
                     QIQAVLKDVQIVLSAISMIGVRDVASQVQSFPLSPETIFVTATKGLDPQTTCTPSQIW
                     QTVFPNHAVVVLSGPNLSKEIQMELPAATVVASNIPTAAEIVQLVFSSGRFRVYTNPD
                     PLGVELGGTLKNVIAIAAGVCDGLQLGTNAKAALVTRGLTEMVRIGNNWGAKTETFYG
                     LSGLGDLLATCNSPLSRNYQVGYQLAGGKSLTETLANLQGTAEGVNTCQVLMQRAKQQ
                     NIPVPITEQVYRLLQGEVTPRQALDELMLRDIKPEYNY"
     gene            complement(567554..568438)
                     /locus_tag="COO91_00575"
                     /note="Nfsy_R00575"
     CDS             complement(567554..568438)
                     /locus_tag="COO91_00575"
                     /codon_start=1
                     /transl_table=11
                     /product="lipA, lipoyl synthase"
                     /protein_id="AUB34746.1"
                     /translation="MTVKPDWLRVKAPGRERIGNVKDILRDLALNTVCEEASCPNIGE
                     CFNAGTATFLIMGPACTRACPYCDIDFEKKPKPLDPTEPARLAEAVRRMKLNHVVITS
                     VNRDDLADGGASQFIACINAVRTVSPNTTIEVLIPDLCGNWNALELILQAAPEVLNHN
                     TETVPRLYRRVRPQGNYDRTLELLHRSRQVSPSTYTKSGIMVGLGETDAEIRQVMQDL
                     RTVDCDILTIGQYLQPSQRHLQVNEFINPEQFAAWKAFGEEIGFLQVVSSPLTRSSYH
                     AEQVRELMERYPRSKVRS"
     gene            568577..568650
                     /locus_tag="COO91_t03"
     tRNA            568577..568650
                     /locus_tag="COO91_t03"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro-CGG"
     gene            complement(568713..569495)
                     /locus_tag="COO91_00576"
                     /note="Nfsy_R00576"
     CDS             complement(568713..569495)
                     /locus_tag="COO91_00576"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-2.P, ABC-2 type transport system permease
                     protein"
                     /protein_id="AUB34747.1"
                     /translation="MQRYLKVLRLFWGAAIAAELEYRINFFIATLSSLGNLAGSLFGL
                     FLFYRTGYTFSGWSWEAALVVLGIFTLLQGFSATFLASNLNRIVRHVQEGTLDFILLK
                     PIRSQFWLSTHTLSPWGLPDIIFGSIIIGYAGKRLGVGIDDYLLGVLPLLFSFVILYS
                     LWFMLGAMSIWFVKIYNATEVLRGLLEAGRYPIAAYPTAYRFFFTFVMPVAFLTTVPA
                     QALLGRSEISWLIGAAILAVALFFASTWFWRFALRFYTSASS"
     gene            569801..570391
                     /locus_tag="COO91_00577"
                     /note="Nfsy_F00577"
     CDS             569801..570391
                     /locus_tag="COO91_00577"
                     /codon_start=1
                     /transl_table=11
                     /product="Thiol-disulfide isomerase or thioredoxin"
                     /protein_id="AUB34748.1"
                     /translation="MSTDSPVNSPDKSESNLGKRLRNFLIVMVAIALSVALVLGLRTE
                     TTSATLAKLSDTSTPLEVAISNGKPSLVEFYADWCTVCQKMAPDITQLETEYADKMNF
                     VMLNVDNTKWLPEMLKYRVDGIPHFVFLSQQGETIAQAIGDQPRTIMASNLEALVTGS
                     SLPYAQASGKVSKFSAPVAPTANQDDPRSHGSQVVN"
     gene            complement(570452..570991)
                     /locus_tag="COO91_00578"
                     /note="Nfsy_R00578"
     CDS             complement(570452..570991)
                     /locus_tag="COO91_00578"
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain, diguanylate cyclase"
                     /protein_id="AUB34749.1"
                     /translation="MELLQEVRNRKQAEIEGRQLSLTDELTGLHNRRGFFLMAEQQLK
                     IAHLTRVLCWVIFIDLDGLKQINDTLGHDIGDALIVDAAQLLKQSFRNSDIVARLGGD
                     EFVVFISSYFKDADSIQACLQTNIANFNQQQNRNYELSMSMGIERYSPGSNMSLEQLI
                     AKSDELMYAHKRLKQQSIA"
     gene            complement(571213..571698)
                     /locus_tag="COO91_00579"
                     /note="Nfsy_R00579"
     CDS             complement(571213..571698)
                     /locus_tag="COO91_00579"
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain, diguanylate cyclase"
                     /protein_id="AUB34750.1"
                     /translation="MKTQAVPLPDNEAERLKVLADYNILDTLPEEAFDDLTALAAYIC
                     KTPIALISLVDSDRQWFKSKVGLKARETPREWAFCSHAILQPDDILVVPNAIKDDRFT
                     NNPLVKGNPKIRFYAGVPLITPDGLPIGTLCVMDTIPHHPSYQQLDALRRPGQTHLNY
                     S"
     gene            complement(572192..573169)
                     /locus_tag="COO91_00580"
                     /note="Nfsy_R00580"
     CDS             complement(572192..573169)
                     /locus_tag="COO91_00580"
                     /codon_start=1
                     /transl_table=11
                     /product="nifH, nitrogenase iron protein NifH"
                     /protein_id="AUB34751.1"
                     /translation="MSDNKIRQIAFYGKGGIGKSTTSQNTLAAMAEVGKRILIVGCDP
                     KADSTRLILHCKAQTTVLHLAAERGAVEDIELEEVVITGFRNIRCVESGGPEPGVGCA
                     GRGIITAINFLEENGAYQDVDFISYDVLGDVVCGGFAMPIREGKAQEIYIVTSGEMMA
                     MFAANNIARGVLKYAHTGGVRLAGLICNSRKTDREDELISTLAARLSTQMIHFVPRDN
                     IVQHAELRRMTVNEYAPDSGQANEYRTLADKIINNQFFAVPTPIEMDELEDLLIEFGI
                     LESEENAAKLTNAAIAQADGEKRQEDAQGEALEALAKGNVEIVAGSEKK"
     gene            complement(573455..574105)
                     /locus_tag="COO91_00581"
                     /note="Nfsy_R00581"
     CDS             complement(573455..574105)
                     /locus_tag="COO91_00581"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator,
                     XRE-family HTH domain"
                     /protein_id="AUB34752.1"
                     /translation="MSQRWHPQLRVQYNFANSMAALHSLCRGEAHIAGMHLYHPETGE
                     YNIPFVRDVLSGREAVVITLGFWEEGLMVQSGNPMGIRTVADLVQAGGVIVNREPGSG
                     SRLLLEQTLQQEQVPFHAVQGFDCIVQSHQDVAQAVALGAADAGISTASVATTFGLGF
                     IPLHQSRYDLVILKEYLEEAPVQQLLSTLGHRLVHSQFEVLGGYDTSKIGEVVATI"
     gene            574088..574258
                     /locus_tag="COO91_00582"
                     /note="Nfsy_F00582"
     CDS             574088..574258
                     /locus_tag="COO91_00582"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34753.1"
                     /translation="MPTLRQAKIFALIHLPLAQELFWLLNSFFSNFALYQLIWLKAAI
                     DTVLVIGFSFDA"
     gene            574448..574801
                     /locus_tag="COO91_00583"
                     /note="Nfsy_F00583"
     CDS             574448..574801
                     /locus_tag="COO91_00583"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34754.1"
                     /translation="MITEEDLAQQFTLIIEQAHPRAWKLLQYCYIKVLNSKSKGACIP
                     HAKYIRIYCPDRLIAAVVAEKNLLIEVAEYLGIVEVVCVNATNLLHDPKSQIKKIYPK
                     LWLDLQWIVTQKPEL"
     gene            574873..575247
                     /locus_tag="COO91_00584"
                     /note="Nfsy_F00584"
     CDS             574873..575247
                     /locus_tag="COO91_00584"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34755.1"
                     /translation="MNQPYLSPDDLPSNLTIQLSEILFRQLEEATKKNFFLAGDRITR
                     ILLSSCHWYFKINSGILILIMICPDLESYQNIMRTVPQFTDMLKRFTNRGRITVSPPA
                     DKGIPWVLSIDEILPEEDSPTT"
     gene            575259..575387
                     /locus_tag="COO91_00585"
                     /note="Nfsy_F00585"
     CDS             575259..575387
                     /locus_tag="COO91_00585"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34756.1"
                     /translation="MENNSLGFGVPDGNSALITTIMTLLNSTNLLRNQDLRSTIIR"
     gene            575789..577255
                     /locus_tag="COO91_00586"
                     /note="Nfsy_F00586"
     CDS             575789..577255
                     /locus_tag="COO91_00586"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF541"
                     /protein_id="AUB34757.1"
                     /translation="MANTNNLTIATEQALVIIAPQTSSTNPNAAQILEVTGQGEVNVP
                     TTLTEVQLGIQVEGKTATEVQEEVAQRSTAVVDVLQNLGAQELQTTSIQLNPVFSFEN
                     NTQTLTGFRGLNTLQFELPTDQAGGAIDTAIQAGANLIQNINFTASDEALQQARLQVL
                     SEAVKDAQAQAGAVFSTLQLTPGKIIDIDINSAPNPSPSPLVFEAANRASFAADTTTP
                     IIGSPQTIEASVSLDIGYSPNSAGTVASATDNLTGAIKQALAIVDPLTVRTNPNTTQI
                     LEVTGQGRVTVPTTLTEVQLGIQVEGKTATEVQEEVAQRSTAVVDVLQNLGAQELQTT
                     SIQLNPVFSFENNTQTLTGFRGLNTLQFELPTDQAGGAIDTAIQAGANLIQNISFTAS
                     DEALQQARLQVLSEAVKDAQAQAGAVFSTLQLTPGKIIDIDINSAPNPSPSPLVFNLG
                     ADRAFAASSTPLIGGPQTIEASVSLDIAYSSAPAGTPI"
     gene            577417..577827
                     /locus_tag="COO91_00587"
                     /note="Nfsy_F00587"
     CDS             577417..577827
                     /locus_tag="COO91_00587"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34758.1"
                     /translation="MLDSMPVSYSGDLRRRVIKAWEAKEGSQRQLAERFKVSLSFVRN
                     LLRHYRQDGQIEAKRRGGYQKPTIQTEHLSWLQSLVEEKNDLLLRELCARYQEKTGIR
                     VSIPTMHRAIEKLSLRCKKKVFMPASKIRPECKS"
     gene            577815..578378
                     /locus_tag="COO91_00588"
                     /note="Nfsy_F00588"
     CDS             577815..578378
                     /locus_tag="COO91_00588"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="AUB34759.1"
                     /translation="MQELRHDYRRWLDQIDVKNLIFVDEAGINLSMSRLFARAVDGER
                     AVGSIPKSKSGNVSLIGALNIDGLIASMTVPGSTNTEVFLTYVTQVLLPQLWKGAIVV
                     MDNLKVHHAERVRIAIESVGAKVKFLPPYSPDLSPIELCWSKLKQFLRSCEARTPDSL
                     DQAMALAVNYITEDDAFGWFNHCGLFT"
     gene            complement(578587..578817)
                     /locus_tag="COO91_00589"
                     /note="Nfsy_R00589"
     CDS             complement(578587..578817)
                     /locus_tag="COO91_00589"
                     /codon_start=1
                     /transl_table=11
                     /product="Cation transport ATPase"
                     /protein_id="AUB34760.1"
                     /translation="MSEQKPINPWNYKPWWCQPWSIVLTGVTLIGGSWLLFKTIWLTV
                     LISIPVVTWMGFFVLFWPQLMIRSGILESYKD"
     gene            complement(578905..579093)
                     /locus_tag="COO91_00590"
                     /note="Nfsy_R00590"
     CDS             complement(578905..579093)
                     /locus_tag="COO91_00590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34761.1"
                     /translation="MQEYKFGLHCYISHEFYQYLDNIDSDACGGQNQRVQLCNPSTAR
                     QKSKVTPALILRFLAVMK"
     gene            complement(579284..580252)
                     /locus_tag="COO91_00591"
                     /note="Nfsy_R00591"
     CDS             complement(579284..580252)
                     /locus_tag="COO91_00591"
                     /codon_start=1
                     /transl_table=11
                     /product="tauD, taurine dioxygenase"
                     /protein_id="AUB34762.1"
                     /translation="MSNKHIEVKQVAGFIGAEISGVDLSRPLHDDAVKEIRQALLKWK
                     VVFFRGQNIDHAAQVAFTARFGEVTYAHPHEDEPIEGFSEILPIDRSRYERRNGLRRS
                     SYESRWHTDVTAVVNPPAASILRAVNVPSFGGDTQWTNLVAAYEGLSAPLRSLADGLK
                     AEHRFNARLNLPSNSKIAQRIAANPLVSIHPVVRVHPETGERALYVNPGFTSHILDVS
                     RQESDLLLELFFNQITKPAYTTRFRWNNGDIAFWDNRATSHLAPQDLDHLEVERVLYR
                     TTITGDVPVGPDGFRSQVVEGEAFNSQLPTVLKNQSDKLEAEPVLS"
     gene            complement(580601..582637)
                     /locus_tag="COO91_00592"
                     /note="Nfsy_R00592"
     CDS             complement(580601..582637)
                     /locus_tag="COO91_00592"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA ligase"
                     /protein_id="AUB34763.1"
                     /translation="MTQIKPEVKRTEELRQLLQQASFAYYVLDAPIMEDAVYDQLYRE
                     LQQLEIQYPELATPDSPTQRVGERPATQFTSVRHNIPLYSLENAFNIDELQAWDQRWR
                     RQVPKIDSVEYVCELKIDGSALALTYQNGILVRGATRGDGVTGEDITQNVRTIRSIPL
                     RLNFEGLEILERVEVRGEAFLPLEVFKQINEERQKAGEQLFANPRNAAAGTLRQLDSR
                     IVAKRRLDFFGYTLHIPGRDDASIANTQWEALELLEKMGFRVNPNHKLCASIAEVAKY
                     YEYWDTERLNLPYMTDGVVVKLNSFKLQEQLGFTQKFPRWAIALKYPAEEAPTRVENI
                     AVNVGRTGALTPLAEMRPVQLAGTTVSRATLHNSDRITQLDIRIGDTVIVRKAGEIIP
                     EVLRVLKELRPSDTEPFVMPTHCPVCGQPVVRESGEAVTRCVNASCAAILKGSIEHWV
                     SRDALDIKGLGEKLVHQLVDKGLVHSVADLYELTQSNLCALERMGEKSAEKLVDAIAQ
                     SKNQPWSRVLYGLGIRHVGSVNAQLLTQKYFTVDQLATAKQSDIEGIYGIGAEIAQSV
                     YQWFRIDANQKLIERLQAEGLQLAATEETQTVGDVNQKLAGKTFVITGTLPTLKRDEA
                     KALIQKAGGKVTESVSKKTDYLVVGEDAGSKLEKALSLGITQLSEPQLLEMLED"
     gene            complement(582723..584007)
                     /locus_tag="COO91_00593"
                     /note="pseudogene"
     gene            584067..584387
                     /locus_tag="COO91_00595"
                     /note="Nfsy_F00595"
     CDS             584067..584387
                     /locus_tag="COO91_00595"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphoryl diester phosphodiesterase"
                     /protein_id="AUB34764.1"
                     /translation="MVKNFTVKPPIIIAHRGASGYRPEHTLAAYELAIPAAGCAYALG
                     ADYIEPDLVSTKDSVLIARHENKISETTDVASHAEFAHRRTTKIIDGESKIGWFTKYF
                     FTPP"
     gene            complement(584992..585768)
                     /locus_tag="COO91_00596"
                     /note="Nfsy_R00596"
     CDS             complement(584992..585768)
                     /locus_tag="COO91_00596"
                     /codon_start=1
                     /transl_table=11
                     /product="IS4 transposase"
                     /protein_id="AUB34765.1"
                     /translation="MVSYVEQTTFWSMLRKERFFSLTMTLDQLKQFRSGVYTILGNGK
                     DALFDLMDAVLVTRSVYSFVELSLSPVFRRRWSSIYEALEDSNPPREELMQLYIKQLP
                     QTEQLVLAGDHTAWPRLEAVTLKERTYEHQTQPMSGTKPVTLGQGYSTISIIPETKGS
                     WALPLLHERITSFSNPIEKAASQLRLVCQHLPTRPMTLWDAEYGCASFVKQTADIAAD
                     PKPRGKSPGWPQGQPRNRRIRYPTVKKGTLKQKKQLSKSA"
     gene            586378..586740
                     /locus_tag="COO91_00597"
                     /note="Nfsy_F00597"
     CDS             586378..586740
                     /locus_tag="COO91_00597"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase involved in DNA repair"
                     /protein_id="AUB34766.1"
                     /translation="MSRPKRGSKVIDKAQRRIAGLKSINPTLDLGNGVTIDSFATVIK
                     TTQDKLEAYNSSLSTVDMTQGALEFAEKSLMELTEHMLLSVAAKYGKNSDEYKMAGGV
                     RRSDRKRPVRKSKQDAVA"
     gene            complement(586770..586901)
                     /locus_tag="COO91_00598"
                     /note="Nfsy_R00598"
     CDS             complement(586770..586901)
                     /locus_tag="COO91_00598"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34767.1"
                     /translation="MILIELLPPLIPLIKGETGNPVPSPIHRGATAVLGFPQVEQVA"
     gene            complement(587372..587494)
                     /locus_tag="COO91_00599"
                     /note="Nfsy_R00599"
     CDS             complement(587372..587494)
                     /locus_tag="COO91_00599"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AUB34768.1"
                     /translation="MPLRKIWFLTLIHIWYFLSMRKSYKDVGDRNLNFTLVVMD"
     gene            588049..589128
                     /locus_tag="COO91_00600"
                     /note="Nfsy_F00600"
     CDS             588049..589128
                     /locus_tag="COO91_00600"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AUB34769.1"
                     /translation="MAVSLYSVTDLGSLTGETFSFATDINDSGEVAINSLTSSFFYSN
                     GSLQKISPLPGDNQLSVTGINNLGQVVGNSVASNNFTGNNPFLYSNGITQRLPIQNAI
                     PYAINDRTQIVGGASGFGPFLYSDGITTSIGTPANVAYSLNNLGQVVGFLSSNTAFLY
                     QNGLTTNLGALPVYQYSVANDINDLGQVVGSSGFSAVDDGRAFLYSSSTGIQDLGRLR
                     PTDLFSFGTGINNLGQVVGFSGTNSNFFAPDGNGLRAFLYSDNTLYDLNDLIAPGSDA
                     GFTLTAASAINNNGQIVGRGAVNGQLRAFLLTPTSSVSVPEPTSGVPILSFGVVVTLF
                     AALKGKRNSSSAAIQQKLQVNKAIT"
     gene            complement(589653..590348)
                     /locus_tag="COO91_00601"
                     /note="Nfsy_R00601"
     CDS             complement(589653..590348)
                     /locus_tag="COO91_00601"
                     /codon_start=1
                     /transl_table=11
                     /product="Methylase of polypeptide chain release factors"
                     /protein_id="AUB34770.1"
                     /translation="MKDIFFCPEESNFYSNCLENFVFRNCKNYESIVEFGSGDGSPVI
                     NSLLRNNFDGVIQGFELNTSAWKVANSTIDEYNLTNKYIIHNLSLFNSSQPDAEYLVA
                     NPPYLPAPDDDIYMPLLFGGVDGATITNDLLSLGYENVLVLISSFSNPTSTLNLAKEN
                     GYCVQNFMVLPLQFGYYSSDPKVKNHIEELRKNNMAFYSGDYYFLAGVLFNKCQDSVV
                     DLSNQLAQVMTSL"
     gene            complement(590566..591672)
                     /locus_tag="COO91_00602"
                     /note="Nfsy_R00602"
     CDS             complement(590566..591672)
                     /locus_tag="COO91_00602"
                     /codon_start=1
                     /transl_table=11
                     /product="Cupin domain protein related to quercetin
                     dioxygenase"
                     /protein_id="AUB34771.1"
                     /translation="MQSNLVIFPNAGAAKKSTQTEERTITKYDRAEEQFIELLAMEDL
                     DHQLDVKPEIATEFEQALSRAIRAAYKNDRSDEQAHRFLQRILYRINRLKLFWYDDLQ
                     NYTNERSLYLCSCRDQIEAAWQKWELAQIDVAALQRLDVKQALIERTSADLDPVLSES
                     SRYIREEMTESGYRHLLAIGSFDGLVEASHLSRILGGVANEVQCTLMRVLIEEYGNGR
                     LSRKHSTFFAQMLAEFGMNTQPEAYLDLVPWEVLASTNHNFLVTERKRYFLRYGGGLT
                     YFEVAGPAVYKNYMVAAQRLGLSEVAVGYWELHIREDERHGRWMLDDVALPLAERYPN
                     DAWELVLGYDQQKLMSDRAGSAVVRSIREAKQSA"
     gene            complement(591716..591883)
                     /locus_tag="COO91_00603"
                     /note="Nfsy_R00603"
     CDS             complement(591716..591883)
                     /locus_tag="COO91_00603"
                     /codon_start=1
                     /transl_table=11
                     /product="CheY chemotaxis protein or a CheY-like REC"
                     /protein_id="AUB34772.1"
                     /translation="MGENYCIAQCPMPNAQCPMPNAQCPMPLSCVPLDLIFLYNQGKR
                     YRKLLVWEVKY"
     gene            complement(591942..593615)
                     /locus_tag="COO91_00604"
                     /note="Nfsy_R00604"
     CDS             complement(591942..593615)
                     /locus_tag="COO91_00604"
                     /codon_start=1
                     /transl_table=11
                     /