LOCUS       CP017839             8304518 bp    DNA     circular BCT 30-JAN-2018
DEFINITION  Nocardia seriolae strain EM150506, complete genome.
ACCESSION   CP017839
VERSION     CP017839.1
DBLINK      BioProject: PRJNA325707
            BioSample: SAMN05225369
KEYWORDS    .
SOURCE      Nocardia seriolae
  ORGANISM  Nocardia seriolae
            Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae;
            Nocardia.
REFERENCE   1  (bases 1 to 8304518)
  AUTHORS   Han,H.-J.
  TITLE     Genome sequence of Nocardia seriolae strain EM150506, isolated from
            Anguila japonica
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 8304518)
  AUTHORS   Han,H.-J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-OCT-2016) Pathology Research Division, National
            Institute of Fisheries Science, #216, Gijanghaean-ro, Gijang-eup,
            Gijang-gun, Busan 46083, South Korea
COMMENT     DNA/bacteria available from National Institute of Fisheries Science
            (NIFS) in South Korea.
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: SMRT analysis v. 2.3.0
            Genome Coverage       :: 156x
            Sequencing Technology :: PacBio
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..8304518
                     /organism="Nocardia seriolae"
                     /mol_type="genomic DNA"
                     /strain="EM150506"
                     /host="Anguilla japonica"
                     /db_xref="taxon:37332"
                     /country="South Korea"
                     /collection_date="2015-05-06"
     gene            243..1175
                     /locus_tag="NS506_00001"
     CDS             243..1175
                     /locus_tag="NS506_00001"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94092.1"
                     /translation="MDDLVFLVRHVAVGAAVVQRGRQVVDDRVEHGLHALVLERGTAQ
                     HRVELGVDGHLANRALDLLDRELLAAEELLQQRLIGLGDGLQQLLAVLLGALLEVGRD
                     LDDLVLLAELGLALPDLGVHLDQVDDALELVLGADRQLDDQRLRAQAVDDGLDGEVEV
                     GAQLVHLVDEADARDVVLVGLAPDLLGLGLDAFLAIEHRDGAVEDAQRTLDLDREVHV
                     AGGVDDVDLVVFPETGRRGRRDGDAAFLLLRHPVHGGGAVVHLTDLVGDTGVEEDAFG
                     SRRLTGIDVGHDADVADLVQVGEHVLCHGNLPRS"
     gene            complement(1312..1782)
                     /locus_tag="NS506_00002"
     CDS             complement(1312..1782)
                     /locus_tag="NS506_00002"
                     /function="Ribonucleoprotein; Ribosomal protein;
                     RNA-binding; rRNA-binding; tRNA-binding."
                     /note="One of the primary rRNA binding proteins, it binds
                     directly to 16S rRNA where it nucleates assembly of the
                     head domain of the 30S subunit. Is located at the subunit
                     interface close to the decoding center, probably blocks
                     exit of the E-site tRNA; Belongs to the ribosomal protein
                     S7P family"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="APA94093.1"
                     /db_xref="UniProtKB/Swiss-Prot:A0LRL6"
                     /translation="MPRKGPAPKRPLINDPVYGSPLVTQLVNKILLDGKKSTAERIVY
                     GALEQAREKTGTDPVVTLKRALDNVKPALEVKPRRVGGATYQVPVEVRPGRANTLALR
                     WLVNYSRARREKTMIERLANELLDASNGLGASVKRREDTHKMAESNRAFAHYRW"
     gene            complement(1782..2156)
                     /locus_tag="NS506_00003"
     CDS             complement(1782..2156)
                     /locus_tag="NS506_00003"
                     /function="Chloroplast; Plastid; Ribonucleoprotein;
                     Ribosomal protein; RNA-binding; rRNA-binding."
                     /note="With S4 and S5 plays an important role in
                     translational accuracy. Located at the interface of the
                     30S and 50S subunits (By similarity); Belongs to the
                     ribosomal protein S12P family"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12, chloroplastic"
                     /protein_id="APA94094.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q1KVX0"
                     /translation="MPTINQLVRKGRRDKVAKTKTAALQGSPQRRGVCTRVYTTTPKK
                     PNSALRKVARVRLTSAVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSL
                     DTQGVKNRKQARSRYGAKKEKS"
     gene            complement(2634..2990)
                     /locus_tag="NS506_00004"
     CDS             complement(2634..2990)
                     /locus_tag="NS506_00004"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94095.1"
                     /translation="MRSRTALALTVLALTVTLAGCGKTVPGTALPAGGTAGTGGTTRI
                     NTNFDKLLRECTVVAIDDIGKSVGDNMYVEPSFNGAVCMWNLTGGAAGSGMVTLSWYE
                     EGSLGNEKQNNDRLKM"
     gene            complement(3002..3640)
                     /locus_tag="NS506_00005"
     CDS             complement(3002..3640)
                     /locus_tag="NS506_00005"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94096.1"
                     /translation="MVRGRLDSGLTERGSEAEEGRIETSGPRTRPGAKRRGKSGTAIV
                     TGLSLALLLSACGGSNDSSDQPGFKPPAKVATLGPFVGECGHLTDDEVRDLGGLGSLT
                     TVFKNSVGCNWQAGGISSSSVTFASYRGSPIDREKAWVASVGRAPDTIEVGGKKGFQA
                     LDPSNAVCDLAVQLDDDFFEWSISYGAFSSGGLGNPCDRTRKMAELTVQRLG"
     gene            complement(3688..4908)
                     /gene="hppD"
                     /locus_tag="NS506_00006"
     CDS             complement(3688..4908)
                     /gene="hppD"
                     /locus_tag="NS506_00006"
                     /EC_number="1.13.11.27"
                     /function="Dioxygenase; Iron; Metal-binding;
                     Oxidoreductase; Phenylalanine catabolism; Tyrosine
                     catabolism."
                     /note="Belongs to the 4HPPD family; KEGG: nfa:nfa50810
                     4-hydroxyphenylpyruvate dioxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylpyruvate dioxygenase"
                     /protein_id="APA94097.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q53586"
                     /translation="MSIDAAHQRIDGHPPARSGDLPGDDELRRLVGLVDHDAAADPFP
                     VLGWDAVVWAVGNATQTAHFLQSAFGMRLEAYSGPETGNRDHKAFVLRSGGARFVVKG
                     AVDPASPLVAHHDRHGDGVVDIALEVPDVDRCIRRARAQGATVLAEPHDETDDYGTVR
                     TAAIATYGDTRHTLVDRSRYYGPYLPGYVPRHSAYAPRAGQPKRIFQAIDHVVGNVEL
                     GRMDEWVEFYRRVMGFENMAEFVGDDIATEYSALMSKVVANGNHRVKFPLNEPAPAAS
                     APRSTNTWSSIRGRASSTSPWPPATSSPPSTCCAARASNSSTRPTATTRTQSCAPASA
                     TSACPSPNSSAAASWSTATRTATCCRSSATHHRPTHGVLRTHRTPRLAGFRQGQLQAL
                     FQAIEREQEARGNL"
     gene            5287..5565
                     /locus_tag="NS506_00007"
     CDS             5287..5565
                     /locus_tag="NS506_00007"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94098.1"
                     /translation="MRWTRSSAELDAIPGVLEAYATTGSGDVLCRIGADSHAGLQAVL
                     LSIDKTSSVVRSHSVVVLSTVVAHRTLPLLRTLAPSGSSKAPAYRAAH"
     gene            complement(5562..6674)
                     /locus_tag="NS506_00008"
     CDS             complement(5562..6674)
                     /locus_tag="NS506_00008"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94099.1"
                     /translation="MKLSNRILNRTLLARQHLLERTTLGPHELCDHLIGLQAQDTLPP
                     FIALWSRAVDFDPATVSKALEDRSLVRITLMRGTIHLVTPPDALRIAPHIQPELEKIP
                     FRKGFNYGALVGLDPEAVRAHGESVLGEEPMPAATLREHAAELYPDRDPGAVVQAWLY
                     QLPVLQTPPRGRWGDSSRPVWSRVQPWLGAPLDPDYPLAELLLRYLRAFGPATTMDMQ
                     TWSKLTGIKRAVDELGDRVVTHTDERGRTLYDAADAVLADPDLPAPVRLLGWYDNAIL
                     SHQDRTRIVPDGNAPPLRAFANQVAPILVDGYLAAVYKVFAKGDTARLRITPHTWLSR
                     TDRTAVESEAHALLAFLEPDRTPAVEILDPGADLRP"
     gene            complement(6717..7691)
                     /gene="cryZ"
                     /locus_tag="NS506_00009"
     CDS             complement(6717..7691)
                     /gene="cryZ"
                     /locus_tag="NS506_00009"
                     /EC_number="1.6.5.5"
                     /function="Acetylation; Alternative splicing;
                     Oxidoreductase."
                     /note="Belongs to the zinc-containing alcohol
                     dehydrogenase family. Quinone oxidoreductase subfamily;
                     KEGG: rha:RHA1_ro01618 NADPH2:quinone reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH:quinone reductase"
                     /protein_id="APA94100.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q3UNZ8"
                     /translation="MRAAVVSKLEGPESIEVVQVPEPAVYPGGVLIDVHAAGIAFPDV
                     LMTRGLYQMKPPLPYVVGCEVAGIVREAPADAHVRAGDRVVALTLLGNAAAEVAVAPV
                     DMVFKLPDNVSLEAGAGVLFNDLTVHFCLRNRGRLAEGETVLVHGAAGGIGTSTLRMA
                     QALGAGRVIAVVSTEEKAEVARANGATDVVLTDGWLDAVKELTAGRGVDIVLDPVGGD
                     RFTDSIRSLASAGRLLVVGFTAGDIPTVKVNRLLLKNVEVVGAAWGEWAMSHPGYLAE
                     QWAEVEPLLANGKIAPPDPVLYTLDHTAEAVSALDRRTATGKVVVTLR"
     gene            complement(7802..9610)
                     /locus_tag="NS506_00010"
     CDS             complement(7802..9610)
                     /locus_tag="NS506_00010"
                     /EC_number="2.7.11.1"
                     /function="Alternative splicing; ATP-binding; Kinase;
                     Nucleotide-binding; Serine/threonine-protein kinase;
                     Transferase."
                     /note="Probably does not act as a sensor that couples
                     lifespan to information about energy levels and
                     insulin-like signals (PubMed:15574588). Together with
                     aak-2, involved in the establishment of germline stem cell
                     (GSC) quiescence during dauer development
                     (PubMed:20110331); Belongs to the protein kinase
                     superfamily. CAMK Ser/Thr protein kinase family. SNF1
                     subfamily; Contains 1 protein kinase domain; KEGG:
                     mjd:JDM601_3024 serine/threonine protein kinase,
                     bacterial"
                     /codon_start=1
                     /transl_table=11
                     /product="Non-specific serine/threonine protein kinase"
                     /protein_id="APA94101.1"
                     /db_xref="UniProtKB/Swiss-Prot:P45894"
                     /translation="MAAGDRAGSRFGQYELRRLLGVGGMGEVYEAYDTVRDRVVAVKL
                     LDVDLARQPSYVERFRRESRTAAKLQEPHVIPVHDWGEVDGVLFIDMRLVRGRDLKAY
                     LHDEGPLPPEQAVTVVEQIAAALDAAHESGLVHRDVKPANVLLTGEMFAYLVDFGIAH
                     TESDVQLTQTGNAIGSFAYMAPERFEHSATVSASADIYALACVLYESLTGGPPFRTDG
                     NLATIRAHMLTPPPRPSVRAGVPVGFDQVVAIGMAKDPSRRYAGAGQLARAARAALLR
                     AGHGEPTRTTVPPAPPTSGNPAVPPSHSGPQYLDHPSGPAQPYGGGAPPRGTDPSGPV
                     DHPRGPQRPGPEDPSGPQRLSGPAQYFSGPAEHSSGERVAGPPVYSGPGNNDPTVLRR
                     YAAGPPGYLPGRADPAAPREHPSAPLPLPPEPRNRLPLLVGALIGVVLVLGGVLGWVL
                     LAGGNGGTDDNSLGTTTVTGGATTTSGYRATTAAPTTTLVPFTGSVSGTDAGGFTGQR
                     PHCNSDDPAMAIGRTDKSRLVVCRTSGGRFYYVGLRISDGAGIQLDDPVPDGTGGYTV
                     TNPTDGTQYRITAYSLVISNGGQVAANESMREYAHR"
     gene            9895..10668
                     /locus_tag="NS506_00011"
     CDS             9895..10668
                     /locus_tag="NS506_00011"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94102.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WLN4"
                     /translation="MSLDEPLAPLPEEGMGFASAWPVRAGDVDPYHRLRFDAAARYLQ
                     DIAWEEMQSGFFHRTDPAWIVRRTVVDVVRPIHWPDGVELRRWCSAMSTRWTNMRVRI
                     TSENGGLIETEGFWININEFTNMPTRISDEGLAELGRTTDEHRLRWRPWLTDPTPPES
                     DVDLPFPVRATDIDQYNHVNNAAYWQVLEQYLVDYPKLVAGPHRAVIEYIAPVLARQH
                     ISVRSRYEPGDRTGHPSLRLWFVVGGVTTTAVRIGPLPG"
     gene            10776..11552
                     /locus_tag="NS506_00012"
     CDS             10776..11552
                     /locus_tag="NS506_00012"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94103.1"
                     /translation="MRFAHFALLAAAPVLVVAVTACSHSKDSAKNTTSTTVAASGTTA
                     PATATTPPVSPKPLPPNPTRPPVPTTPSAADVNCGPVTGANGQSADVIAYASSAGVPG
                     CTEAITVATHYVMGTSSGEAVQIDGWTCEAQPDTAVPRICFKDGFLIGLRGGAAPKPP
                     APPTTTPPPTTTSAAPAGNVNCGTVTDAGGGTRTVIAVATPAGTVGCTEAINVATQYV
                     QTISDTDVATSNGWSCNAQPDTAYPSMCAKDGLLINLGAQ"
     gene            complement(11616..13283)
                     /locus_tag="NS506_00013"
     CDS             complement(11616..13283)
                     /locus_tag="NS506_00013"
                     /EC_number="1.18.1.2"
                     /function="4Fe-4S; Electron transport; FAD; Flavoprotein;
                     Iron; Iron-sulfur; Metal-binding; NADP; Oxidoreductase;
                     Repeat; Transport."
                     /note="In the C-terminal sectio; belongs to the
                     ferredoxin-- NADP reductase family; Contains 2 4Fe-4S
                     ferredoxin-type domains; KEGG: nfa:nfa25880
                     ferredoxin--NADP+ reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="Ferredoxin--NADP(+) reductase"
                     /protein_id="APA94104.1"
                     /db_xref="UniProtKB/Swiss-Prot:P65529"
                     /translation="MAYVITPRCCNDASCVPECPVDCIRPTPEQREFATTEQLYIDPD
                     TCIDCGACVDACPVDAIFSEDDLTASLARFRDINAAYFGRHPLESNFEPLVAPSRAPK
                     ELGTLRVAIIGAGPAACYAAEELLRRADVEVELFDRLPTPYGLVRAGVAPDHPGTKNV
                     AGLFESAFRREALAYRLNVEVGKHISHAELLGHHHAVIYAVGAATDRHLGVPGEDLPG
                     SHSAPEFVAWYNGHPDFADREFDLSGERAVIVGNGNVALDVARVLTVNPDELAKTDIA
                     DHALDALRRSNIKEVVVLGRRGPLQAAYTSPEFLALGYLKGVDIIVDPEDLVLDPASQ
                     AELDDPQVEPSLQLKYTLAQEYAAGTRNLDNRRIVFRYLVSPTAITGDGKVEGIEYVH
                     NELVEENGRTVARACDRTGALEASLVLRSIGYKGEPVADVPFDESRGVIPNDKGRVLA
                     DGNPVQGVYVSGWIKRGPRGVIGSNRVDSQETVDALIEDFTNGKLAAPQGDRAALDAL
                     LAERQPDQIGRDGWKAIDTAEKTAGKAGGRPRVKFTKIEDLLKAAKG"
     gene            13504..14001
                     /locus_tag="NS506_00014"
     CDS             13504..14001
                     /locus_tag="NS506_00014"
                     /EC_number="3.1.3.-"
                     /function="Hydrolase."
                     /note="Belongs to the SixA phosphatase family; KEGG:
                     nno:NONO_c69030 phosphohistidine phosphatase; Phosphoric
                     monoester hydrolases"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94105.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WGF8"
                     /translation="MPMVRTLILMRHGKSGYPDGVPDHERPLAPRGRREAALAGDWLR
                     ATQPPIDAVLCSSSTRTRETLAATGIAAPVSYEQSIYEASPHTLIELIQLTEDAIGTL
                     LLVGHSPGMPWTAWELAANRDSGPAEELSAKFPTSALAVIEFDRPWAAADPGTGELVR
                     FHVPR"
     gene            complement(14038..14226)
                     /locus_tag="NS506_00015"
     CDS             complement(14038..14226)
                     /locus_tag="NS506_00015"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94106.1"
                     /translation="MDRIRARSALEAAKEQPVITAIAALPVVAVLAVVWWLLGFWPAL
                     LLLLVFGGVVVWRGKLLG"
     gene            14387..14851
                     /locus_tag="NS506_00016"
     CDS             14387..14851
                     /locus_tag="NS506_00016"
                     /function="Activator; DNA-binding; Mercuric resistance;
                     Mercury; Metal-binding; Repressor; Transcription;
                     Transcription regulation; Transposable element."
                     /note="Mediates the mercuric-dependent induction of
                     mercury resistance operon. In the absence of mercury MerR
                     represses transcription by binding tightly to the mer
                     operator regio; when mercury is present the dimeric
                     complex binds a single ion and becomes a potent
                     transcriptional activator, while remaining bound to the
                     mer site; Contains 1 HTH merR-type DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Mercuric resistance operon regulatory protein"
                     /protein_id="APA94107.1"
                     /db_xref="UniProtKB/Swiss-Prot:P22853"
                     /translation="MSAPPVQRPNAARDAVEFERPRYSIGEVSERCGLTRDTLRWYER
                     IGLMDYVGRDHSGQRRFSDRDLEWLAFIGKLRLTGMSVADMVKYAELVRAGQHTYPER
                     LEMFRRTRAEVLDQIEELRSTLVVLDYKIALYENGPSCEPPTLSSNAARREN"
     gene            complement(14879..15682)
                     /locus_tag="NS506_00017"
     CDS             complement(14879..15682)
                     /locus_tag="NS506_00017"
                     /function="Dioxygenase; Metal-binding; Oxidoreductase;
                     Zinc."
                     /note="Opens the cyclic ring of dihydroxy-phenylalanine
                     (DOPA) between carbons 4 and 5, thus producing an unstable
                     seco-DOPA that rearranges nonenzymatically to betalamic
                     acid; Belongs to the DODA-type extradiol aromatic ring-
                     opening dioxygenase family"
                     /codon_start=1
                     /transl_table=11
                     /product="4,5-DOPA dioxygenase extradiol"
                     /protein_id="APA94108.1"
                     /db_xref="UniProtKB/Swiss-Prot:I3PFJ3"
                     /translation="MSANETRERVDRMPVLYLSHGAPPLAEDPIWPGQLAAWSAELPR
                     PTAILVVSAHWEDAPVTLGATTTVPLLYDFWGFPEHYYRVRYAAPGAPELAAKVRALL
                     GRPGQPVHEAPTRGLDHGAYVPLVEMYPDADIPVLQLSLPTLDPVGLFDLGRRLAPLR
                     DEGILILGSGFFTHNLREANFGMPSDFAPDWSKEFDHWGDEALTAGDIDALLNFERAA
                     PDARRAHPRTEHFAPLFVTLGAGAEELSSQRTAIDGFWYGMAKRSIQIG"
     gene            complement(15699..16316)
                     /gene="ribA"
                     /locus_tag="NS506_00018"
     CDS             complement(15699..16316)
                     /gene="ribA"
                     /locus_tag="NS506_00018"
                     /EC_number="3.5.4.25"
                     /function="GTP-binding; Hydrolase; Lyase; Magnesium;
                     Manganese; Metal-binding; Multifunctional enzyme;
                     Nucleotide-binding; Riboflavin biosynthesis; Zinc."
                     /note="Catalyzes the conversion of D-ribulose 5-phosphate
                     to formate and 3,4-dihydroxy-2-butanone 4-phosphate;
                     Catalyzes the conversion of GTP to 2,5-diamino-6-
                     ribosylamino-4(3H)-pyrimidinone 5'-phosphate (DARP),
                     formate and pyrophosphate; In the N-terminal sectio;
                     belongs to the DHBP synthase family; In the C-terminal
                     sectio; belongs to the GTP cyclohydrolase II family; KEGG:
                     ksk:KSE_64690 GTP cyclohydrolase II"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase II"
                     /protein_id="APA94109.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9X2E6"
                     /translation="MSSTLVDAGIRTRVRIPLAFADGYSTTAQAVTFDGLADGREHVA
                     LVLGEPGATPLVRLHSECLTGDVFGSARCDCGPQLREAVERIAGVGGILLYLRQEGRD
                     IGLYNKLDAYALQDAGLDTYQANTELGFDEDARDYSAAAQMLTALGVGEFDLLTNNPD
                     KVRQLRALGMTVRDTLPTGVHANPANLRYLRAKADHTGHTIRLVG"
     gene            16430..16891
                     /locus_tag="NS506_00019"
     CDS             16430..16891
                     /locus_tag="NS506_00019"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94110.1"
                     /translation="MSPRWLNDEERAAWLAFLNAAGPLERRIDRQLERDSGLSHLQYE
                     ILVRLDDAPGGELRMTELAALLLNSKSKLTYQIDQLERAGLVDRRGCATDLRAVYARL
                     TAAGRERLEQAAPGHVETVREFFVDAFTPDQLAAVTAGFSEINRRLRQPPA"
     gene            16976..18070
                     /locus_tag="NS506_00020"
     CDS             16976..18070
                     /locus_tag="NS506_00020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94111.1"
                     /translation="MSRIGGRFARSEPRERVREYVSGLLAGLERKNGWTLAERAGETG
                     PQGMQRLLRAADWDVEAVRDDVRDYVVERLGDPEAVLAGDETGFLKKGVKSAGVQRQY
                     SGTAGRTENCQIGVFLAYASTHGHALIDRELYVPQSWTSDRERCREAGIPDEVAFATK
                     PRQMIAMLERAVAAKVPFRWFTADEAYGQAGYLREWCEDHDVFYVLATRCDQQVATRA
                     DRIARADELVGEFTASTWQRFSVGAGAHGPREYDWARRQIEGRWASGRGHWLLARRSI
                     AKPTEIAYYLCYGPATARLVDLAWTAGSRWHVEEAFQQAKGEAGLDHYQVRNWRAWYA
                     HITLSMLALAWLAASKAVAAKGDSPIPAKA"
     gene            complement(18252..18617)
                     /locus_tag="NS506_00021"
     CDS             complement(18252..18617)
                     /locus_tag="NS506_00021"
                     /function="Activator; Copper; Cytoplasm; DNA-binding;
                     Repressor; Transcription; Transcription regulation."
                     /note="Regulates the transcription of actP. It detects
                     cytoplasmic copper stress and activates transcription in
                     response to increasing copper concentrations. In the
                     absence of copper, it negatively regulates the
                     transcription of actP; Contains 1 HTH merR-type
                     DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator HmrR"
                     /protein_id="APA94112.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9X5V4"
                     /translation="MLIGELSRATGVPPRLLRYYEEQGLLVPHRDSNGYRGYPDSAPA
                     RVARIRELLAAGLPTRDIRELLPCATDSGLQHCDHSRKVVGDGLNRLDDQIAELTRRR
                     ELLAKQRDAVLAAPFDPAP"
     gene            18678..19451
                     /gene="bioH"
                     /locus_tag="NS506_00022"
     CDS             18678..19451
                     /gene="bioH"
                     /locus_tag="NS506_00022"
                     /EC_number="3.1.1.85"
                     /note="KEGG: ade:Adeh_3732 pimeloyl-(acyl-carrier protein)
                     methyl ester esterase"
                     /codon_start=1
                     /transl_table=11
                     /product="Pimeloyl-[acyl-carrier protein] methyl ester
                     esterase"
                     /protein_id="APA94113.1"
                     /translation="MTNISLTTRITGSGPAVVLAHGGGGGIDANFGGLIPLLAQDHLV
                     IGSDYPADDTPLTLDSLADALVAEAVANGAETFDIVAFSLGTAVAVRAAVRHPERVRG
                     LVLTGGFARIDNRGRMNVELWQQALAAGDRESFARYVLLAAFSKEFVNSLPAEQLSEI
                     LTQTAANIPGGTAAQAALVAAADVRADLARITVPALVIGLAGDLLADPANAREQAAGI
                     PGAEYTELPGGHVVMIEQPDRWHATVLEFLARQRVGTAG"
     gene            19537..20019
                     /locus_tag="NS506_00023"
     CDS             19537..20019
                     /locus_tag="NS506_00023"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94114.1"
                     /db_xref="UniProtKB/Swiss-Prot:P96684"
                     /translation="MQSPVTHDRIWIDKQTPEVFHALNSVAFAIRNAAAAADLDRAVM
                     ELVNVRVSQLTGCPFCLDLHMRAARDAGVTQQQLDVLTAWRRSPYLFTELEQAALAVA
                     ETVTSLPDEESMQREYAAARQHLSDDQMSVLIWAATTIGAFNRVSILSKHPVRVRKEN
                     "
     gene            20023..20337
                     /locus_tag="NS506_00024"
     CDS             20023..20337
                     /locus_tag="NS506_00024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94115.1"
                     /translation="MSEQAVAAAVVRNDAQHRYEVWYGNSLAGFSEYRERDDNDTTFI
                     HTEVDQEFSGKGLANLLAQEAIKDVIARGRAIVPRCPFIKSWLDKHPEYDEYVVGKGI
                     KR"
     gene            20354..21343
                     /locus_tag="NS506_00025"
     CDS             20354..21343
                     /locus_tag="NS506_00025"
                     /function="Dioxygenase; Metal-binding; Oxidoreductase."
                     /note="Putative quercetin 2,3-dioxygenase; Belongs to the
                     pirin family"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative quercetin 2,3-dioxygenase"
                     /protein_id="APA94116.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9I4D3"
                     /translation="MSDLEPHPEETRCESSGRPGPRAEFFPAREVPLGGVRGVTVFRT
                     LPQRDLPTVGAWCFLDHFGSGSAINPEGHDIDPHPHIGLQTVTWPLDGRIRHRDSVGS
                     DVEIAPGQLNIMTSGHGIAHSEYRVPGHVSGHGLQLWVALPGESRDIAPHFEQHRELP
                     EFTVADAVTGTVLIGSLGGVTSPATAYTPIVGADLAIRAGADAVLALNPEFEHAVLVI
                     EGAVAVDGTRAEPGSLFYLGSDRESIRLHDTAGAHVLLLGGEPFGEDLVMWWNFVARS
                     HEEIEQARNDWEKHELGRFADIAGHSPEQRIPAPPLPGLHLKPRKRRCGVPHN"
     gene            complement(21348..22187)
                     /locus_tag="NS506_00026"
     CDS             complement(21348..22187)
                     /locus_tag="NS506_00026"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94117.1"
                     /translation="MDRNELADFLRRRREQLQPSTVGLPQGARRRTPGLRRDEVAMLA
                     GMSTDYYTRLERARGPRPSVQVLAALARALRLTDTERDHLYHLVGQQAPARGGDGHVG
                     PGILHVLSKLDDTPAVVISDLGEVLVQNRMHTLLGGDYSQRRGLDRCIPWRWFTEPGA
                     RAILPEEDWDVMSHKHVADLRATAARRAGEADVTELVARLRTASPEFERLWNEHEVGS
                     DGGLGKRMIHPEVGVLDLICEPLLTPSATRHVLIYYPAPNTDTQEKLDLLRVIGTQSM
                     TSH"
     gene            complement(22279..22692)
                     /locus_tag="NS506_00027"
     CDS             complement(22279..22692)
                     /locus_tag="NS506_00027"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94118.1"
                     /translation="MPGSGSGQKDTEQSHDELHLELTKLRIRHVANMDLGGAVAAARL
                     VGATWEQVGGACGASKQAAYERWHKVVKEFELARLKAEQRPVDALDQYDPDGLVMGEA
                     LYNMAPLEAVLQRLGRVNRDMAQGDAAEGTRPRLD"
     gene            complement(22910..23995)
                     /locus_tag="NS506_00028"
     CDS             complement(22910..23995)
                     /locus_tag="NS506_00028"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94119.1"
                     /translation="MPPKVEPLKLSDTERQVLVGWSRRRKTAQALALRSRIVLACAES
                     GSNSEVARQLGVSRETVRKWRTRFERDRLEGLSDEPRPGAPRKITDEQVEHVITTTLE
                     TSPPQRDTHWSTRSMAQATGMSQSAVSRIWRAFGLKPHLVETWKLSTDPLFVDKVRDV
                     VGLYMNPPQNALVLCVDEKSQMQALDRTAPTLPIMPTTPARMTHDYVRNGTTNLFAAL
                     DVASGSVIAEHYARHRHQEFLRFLKTIDTAVPAEFDLHLVCDNYGTHKTPAVKKWLLR
                     HPRFHVHFTPTSASWLNLVERWFAELTNRKLRRSAHRSVTELKADVQAWINAWNADPK
                     PFVWTKTADEILETLAAYCQRINDSRH"
     gene            complement(24420..25505)
                     /locus_tag="NS506_00029"
     CDS             complement(24420..25505)
                     /locus_tag="NS506_00029"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94120.1"
                     /translation="MPPKVEPLKLSDTERQVLVGWSRRRKTAQALALRSRIVLACAES
                     GSNSEVARQLGVSRETVRKWRTRFERDRLEGLSDEPRPGAPRKITDEQVEHVITTTLE
                     TSPPQRDTHWSTRSMAQATGMSQSAVSRIWRAFGLKPHLVETWKLSTDPLFVDKVRDV
                     VGLYMNPPQNALVLCVDEKSQMQALDRTAPTLPIMPTTPARMTHDYVRNGTTNLFAAL
                     DVASGSVIAEHYARHRHQEFLRFLKTIDTAVPAEFDLHLVCDNYGTHKTPAVKKWLLR
                     HPRFHVHFTPTSASWLNLVERWFAELTNRKLRRSAHRSVTELKADVQAWINAWNADPK
                     PFVWTKTADEILETLAAYCQRINDSRH"
     gene            25874..26068
                     /locus_tag="NS506_00030"
     CDS             25874..26068
                     /locus_tag="NS506_00030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94121.1"
                     /translation="MSFAFIVVLAMEVGVDPKVAVPLTILLVSCIVMCIAPSKQGGSV
                     GRRVCRALLAYYNDGPPDQP"
     gene            26195..27202
                     /locus_tag="NS506_00031"
     CDS             26195..27202
                     /locus_tag="NS506_00031"
                     /EC_number="1.1.1.65"
                     /function="NADP; Oxidoreductase."
                     /note="Belongs to the aldo/keto reductase family; KEGG:
                     bur:Bcep18194_B1236 pyridoxine 4-dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Pyridoxine 4-dehydrogenase"
                     /protein_id="APA94122.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9C5B9"
                     /translation="MTKNLDTVQLGKTGPAVSRLALGAMGMSGMYGQADEAVSIATVH
                     AAIDSGANLIDTGDFYGMGHNELLIRQALAERKREDVLLSVKYGALRGPDGSFGGVDT
                     RPAATKNFLAYTLERLGTDYIDIYRPARLDPNVPIEETIGGLADMVRAGYIRHIGLSE
                     VGAETLRRAAAVHPIVDLQIEYSLISRGIEAEILPVARELGIGITAYGVLSRGLLGGS
                     LRPGQQFAPNDFRAHSPRFQGENFTANLRLVDALAEIAADHDVSVAQLAIAWVLSRGT
                     DIVPLIGARKPQRWAEALAAVDIRLTDAELATIEAAVPADRVAGGRYAPEQMAMLDSE
                     R"
     gene            complement(27205..27696)
                     /locus_tag="NS506_00032"
     CDS             complement(27205..27696)
                     /locus_tag="NS506_00032"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94123.1"
                     /translation="MDSATKDEQSATMGEMVMAGFRKLGFIQFTGIESVDYAPGRSVV
                     SMAAGPEHFNHNGDIHAALLFGLAETAAMGASISGIVDLLGDTYIVARNGRIEYLARA
                     KGEAGPFSATSELTPEAIATTRANIESRTEIELEVPVTITDVTGKPVAGAAFTAVIRP
                     RRK"
     gene            complement(27744..29252)
                     /locus_tag="NS506_00033"
     CDS             complement(27744..29252)
                     /locus_tag="NS506_00033"
                     /EC_number="1.1.5.4"
                     /function="FAD; Flavoprotein; Oxidoreductase;
                     Tricarboxylic acid cycle."
                     /note="Belongs to the MQO family; KEGG: sgl:SG1751 malate
                     dehydrogenase (quinone)"
                     /codon_start=1
                     /transl_table=11
                     /product="Malate dehydrogenase (quinone)"
                     /protein_id="APA94124.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9HYF4"
                     /translation="MTTRTQPLRPYDVVLIGGGIMSATLAVMLKHLEPSWTIAVYERL
                     PEVGREASAAWNNAGTGHSGLCELDYTVENPDGSIDIGPAVELNEQFQLTRQLWASLV
                     QNGILRDPSTFINPVPHMTLARGDAEVDFLRRRHETLSAHHLFASMRFSDDPKVIGEW
                     APLLTAGRADGEPIAATRDITGSDIDFGELTVQLFHWLRWRDVEIHRNCEVRGLRRNN
                     DGTWQLRVDWRTDNDRLTRKVDARFVFAGAGGWALKVLQKAGIPEAHGYGLLPVSGRF
                     LRCDNPEVIAAHDAKVYGRGPVGAPSISMPHLDTRLVNGRRSLLFGPYPGANPRFLKG
                     GSLFDAPASLRPDNLAPLGAMLRQNRDLAWLLVSQLASTRKKKLAALREFVPEARAAD
                     WTMITAGQRAQIVKPDPERGGVLEFGTEVVASHDGSIAAVLGATPGASTAPVVLLEVL
                     ERCFPRYSHLWEPRLRSLMPTLGRSLAKDPRLARQTMADTAEALGLEGRVVG"
     gene            29505..30026
                     /locus_tag="NS506_00034"
     CDS             29505..30026
                     /locus_tag="NS506_00034"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94125.1"
                     /translation="MHIGLGLPISDPTALLDWAGKPFGTDCGPIGPAPLSPAGPELLF
                     GGFQPAALDRVGRWGGGFLAAAAPAWAGGLFETVRRSWTDHGRPGAPRIVAQVNAALG
                     SDDVVADARASMGAYYEFTGMAEKMVSGMFTTPGEIRHAIAQFADLGADEVMLYCYSR
                     DADQVDRLAEVLS"
     gene            complement(30019..30525)
                     /locus_tag="NS506_00035"
     CDS             complement(30019..30525)
                     /locus_tag="NS506_00035"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94126.1"
                     /translation="MAAAVELVNSAVAPDSLTEIAQLDAFFVKHRYTGAHNRTAAELA
                     AVRAQRAPLRRLLTADRDTAVELVNAILAEHRAVPRLVRHDDLDYHIHAVPAQAPLDV
                     RIAVETAVAMIDLIRADELSRLALCADETCAGIVLDMSRNRSRRYCSTACTNRNAVAA
                     YRARKAVS"
     gene            30595..31548
                     /locus_tag="NS506_00036"
     CDS             30595..31548
                     /locus_tag="NS506_00036"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94127.1"
                     /translation="MATLTHDRAAVSHRLRSGLLCAALSAAAFGLSGPLARGLMDAGW
                     SPASVVIVRVLLGAAVLLPAAVMQLRGDWNLLRRNTSLLAGYGLLAVASAQLAYFNAV
                     AHMAVGVALLIEYTAPIAVVVWLWLRHAQKPGRATVLGAIIGATGLILVLNLRSGTQT
                     SWVGIAWALGAMVGAAAYFILSAHAGDAVPGTVLATGGLLIGGLGILAAGLVGIVPLH
                     ATTAPVVFQGFTVPWWVPLLALGVVTASIAYVTGIAATRLLGSRLASFAALGEVLAAI
                     LFSWALLGQTPAPIQLLGGALILVGVVFVRLGEPRDDLSAP"
     gene            31626..32336
                     /locus_tag="NS506_00037"
     CDS             31626..32336
                     /locus_tag="NS506_00037"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94128.1"
                     /translation="MGITKYVAPALLCLTATTVAGTATAEPVQAPAQPALQIKGTDHN
                     VGYDVALSADHRAAVSTVQAGHFLATWDGEAVIVTDDDGVLVSTIPLKYDIDGKTAEF
                     AAKIDQDNHRLTLAPVAESDTPVRNIDAQQHFFDVVQANLPAVATGAAIGATIGFIAG
                     FPLGLFVVDFITTPLLAVVGGVIGGAIGLQMSGGQEASDAALNYLDSMVPGTGNVFRP
                     VFAALPTELPALPTLPAN"
     gene            complement(32401..32955)
                     /locus_tag="NS506_00038"
     CDS             complement(32401..32955)
                     /locus_tag="NS506_00038"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94129.1"
                     /translation="MVLLPTTPPGGFTAADLPRLIEVVDGSFELLDGEVVMMAPATHW
                     HNEVIDILKHALRAIAPRDFVVGSEQGINIGSSVPVPDVLVVSREVVGPSSLVFEPED
                     VFLAVEVMSPGTKTKDRKLRPAQYADVGIKCFWRVENEDDAIVVYTFELLPEGGYSPT
                     GVHRGRVKVDRPFPIDIELPEVTW"
     gene            complement(33077..37030)
                     /gene="rpoC"
                     /locus_tag="NS506_00039"
     CDS             complement(33077..37030)
                     /gene="rpoC"
                     /locus_tag="NS506_00039"
                     /EC_number="2.7.7.6"
                     /function="DNA-directed RNA polymerase;
                     Nucleotidyltransferase; Transcription; Transferase."
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates; Belongs to the
                     RNA polymerase beta' chain family; KEGG: ssdc:SSDC_00130
                     DNA-directed RNA polymerase subunit beta'"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase"
                     /protein_id="APA94130.1"
                     /db_xref="UniProtKB/Swiss-Prot:A0LRL4"
                     /translation="MLDVNFFDELRIGLASAEDIRNWSFGEVKKPETINYRTLKPEKD
                     GLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVT
                     HIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITAVDDELRHNELSTLEAEMEVEKK
                     TVADQRDADLEARAQKLEADLAELEAEGAKSDVRRKVKDGGEREMRQLRDRAQRELDR
                     LDEIWTTFTKLAKKQLIIDEVIYRELQDRYGEYFTGAMGAEAIQKLMETFDIDAEAEN
                     LRETIRTGKGQKKLRALKRLKVVAAFQTNGNSPMGMVLDAVPVIPPELRPMVQLDGGR
                     FATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVT
                     GPGNRPLKSLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALE
                     LFKPFVMKRLVDLNHAQNIKSAKRMVERQRPQVWDVLEEVIAEHPVLLNRAPTLHRLG
                     IQAFEPLLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILMLSSNNIL
                     SPASGRPLAMPRLDMVTGLYYLTRLEEGAKGEYRAATKDAPEFGVYSSPAEAQMAVDR
                     AELTVRSLIKIRLTNQRPPKDVEAELFPNGWQRGDAWITKTTLGRVLFNDLLPADYAF
                     IDEPMPKKRQAAIINDLAERYPMIVVAQTVDKLKDSGFYWATRSGVTVSMSDVLVPTE
                     KAEIMARYDAQADQIEKKYQRGALDHQERNNALVKIWQEATEEVGKALRAHYPADNPI
                     ITIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPQPIKSSFREGLTVLEYFINTHGAR
                     KGLADTALRTADSGYLTRRLVDVSQDVIVRETDCGTERGIVVPIAEKQADGSLIRDAH
                     VETSTYARTLATDAVDAKGNVIVEKGHDLGDPALEALLDAGITEVKVRSVLTCTTGTG
                     VCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVAGDDITGGLPR
                     VQELFEARVPKGKAPIAEVSGRVRLEDDDRFYKITIIPDDGSDEVLYDKLSKRQRLRV
                     FKHEDGSERLLADGDHVEVGQQLLEGSADPHEVLRVMGPRQVQIHLVHEVQEVYRSQG
                     VSIHDKHIEVIVRQMLRRVTIIDSGATEFLPGSLVERAEFESSNRRVVAEGGEPASGR
                     PVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLIGLKENVIIGKLIPAGT
                     GINRYRNIQVQPTEEARQAAYAVPSYDDSYYSPDGFGTSTGAAVPLDDYGFSDYR"
     gene            complement(37137..40628)
                     /gene="rpoB"
                     /locus_tag="NS506_00040"
     CDS             complement(37137..40628)
                     /gene="rpoB"
                     /locus_tag="NS506_00040"
                     /EC_number="2.7.7.6"
                     /function="DNA-directed RNA polymerase;
                     Nucleotidyltransferase; Transcription; Transferase."
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates; Belongs to the
                     RNA polymerase beta chain family; KEGG: mye:AB431_05390
                     DNA-directed RNA polymerase subunit beta"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase"
                     /protein_id="APA94131.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q5YQP4"
                     /translation="MAVSTQTEATTAGRGFYSVPGAPKRVSFAKIREPLEVPGLLDLQ
                     TESFAWLVGSADWRERAIARGDVENPVGGLEEVLEELSPIEDFSGSMSLSFSDPRFEE
                     VKASIEECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMTDKGTFIINGTE
                     RVVVSQLVRSPGVYFDESIDKSTEKTLHSVRVIPSRGAWLEFDVDKRDTVGVRIDRKR
                     RQPVTVLLKALGLTTEEITERFGFSEIMMSTLEKDSTPGQDEALLDIYRKLRPGEPPT
                     KESAQTLLENLFFKEKRYDLARVGRYKVNKKLGVNAGVPVTGSVLTKEDIVATIEYLV
                     RLHQGDKLMTVPGGVEVPVDVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERM
                     TTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGG
                     LSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYLKVI
                     DGRVTDEVKYLTADEEDRHIRAQANSPVDADGNFLEDRVLARHGNEEMEYVPAKDIDY
                     MDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLIRSESPLVGTGMELRAAV
                     DAGDVVVNQKAGVVEEVSADFITVMHDDGTRRSYRLRKFERSNQGTCANQRPIVDEGM
                     RVESGHVLADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSQRLVEDDVLTSIHI
                     EEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKG
                     ETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGVRVFSRDDDDLPPGVNELV
                     RVYVAQKRKIQDGDKLAGRHGNKGVIGKILPQEDMPFLPDGTPVDIILNTHGVPRRMN
                     IGQVLETHLGYIAKTGWQVDGSPDWAKNLPAEMIGQPADTNIATPVFDGAREEELTGL
                     LGSTLPNRDGEKMINDDGKAILLDGRSGEPFPYPVAVGYMYILKLHHLVDDKIHARST
                     GPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDVVGRVKVYE
                     AIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANL
                     GINLSRNEAATVDDLAQ"
     gene            complement(41202..41954)
                     /locus_tag="NS506_00041"
     CDS             complement(41202..41954)
                     /locus_tag="NS506_00041"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94132.1"
                     /translation="MANRKRPVNRVTPRRPAAQRGTASRTTAASTRSTTERLDRTVSA
                     DQTVESDRTTRRTTPPRGPSLSKNPAPQQYSKPSGQGGFWRNWGVATVCGALAVLLLA
                     FAVTGAVNHWVGKPNSDSGNLAYVDNTATDEVKAAADHALTTLYGYKAAEIDKWKTSV
                     NSVLTDKMQKDFAKYVDTTVDTIRQTQTDTQVKTDPIGVTLLTGDRAELLVNLNISAV
                     KDNKPEPLASGPIVLRMQKVDGHWLASEITDK"
     gene            complement(41968..42786)
                     /locus_tag="NS506_00042"
     CDS             complement(41968..42786)
                     /locus_tag="NS506_00042"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94133.1"
                     /translation="MSQQKDSDSGDNLEKPTSPSVPETTPDGSWADVAISESFRHAGS
                     KTESDTETAASEPVAAAEPTVVLDAPAGPTVAGPAATPPAGLDVRRFVTVGAAALLAV
                     SVVAAGIIGFLWFGDHKDENRAHARDAALTDARQAAINLMSINPDDIDGSLANIRSSM
                     TGELLKQQEEGQDQLKQTAQDSKTRIKADVEGLTLTSLNTELDHASAFAVLKITRSWP
                     GGQPATFRQLWTLDLVKVGDAWKAEKAQNLGEPVPLGTGTAQQPSSTPTPAPGN"
     gene            complement(42809..44050)
                     /locus_tag="NS506_00043"
     CDS             complement(42809..44050)
                     /locus_tag="NS506_00043"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94134.1"
                     /translation="MTRLVRNQLIAFAIIAVLGVVFVGAKYVHLDQMMGFGLYQVKIK
                     AKETGNLSKGAEVTYRGVPVGRVGNLDVTPDGVLITLDMSSSKPKVPANAKAVIANRS
                     AIGEQYVDLLPTSDTSPYLHDGSVIDGAAVPVHVEDLLTSVDHFASSTDLKALSTTIT
                     ELGKAFDGRRDDLKILVDSLNKFTATGIDNLPQTLALIRSARTVLGTQAEQSPAILQF
                     SDGLDKLTAQLKSNDPDIRRLIGTGTDAASSIQRLLTESGPALTKDLTNLRVLLLAIS
                     PKFYALGPVLQMLPLLPLGGSSTAPGDGTTHFGLVLETNNPPACTVGYEGTQRILDQM
                     KAQNPNFDDTRDDFPFNTQAGCTVPQGSETAVRGGARADLADPSVPQPWDDKPKYDPE
                     KLNLNPVATQLATLMGVTPKR"
     gene            complement(44047..45285)
                     /locus_tag="NS506_00044"
     CDS             complement(44047..45285)
                     /locus_tag="NS506_00044"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94135.1"
                     /translation="MSANRIRGGRVKRAALLATSLGAVTAVAAGCGADSIPLPGGPNI
                     GKHPMSIDIRFGDVLDLVPQSSVKVEGVAVGRVDKISIAPDNAWEASVQVLVNDDVKL
                     PHNAHAEVKQTNLLGEKYIELSAPKDADSAPLKSGDKIPRENTQTATEVEQVLGALSL
                     LLNGGGVAQLQPIVVELNKTLDGREGKVRDLLDQANILIKGLDDQVGNITRALDSLDT
                     LTSRVSQQTTQISKILDELPAGIKILNEQRPQLIQMLQQLERVGQAGFDVLNHSKDNL
                     ITDLSSLRPTLQALGDSAGDLVTAFPLIPTYPFPDEAIKSAFGGQVNTWLSVDLQIGT
                     LLSNLGVGKQDPVYLPPTGRQVNVDPTNPYYNGNGPRGGWPTVSLLPLPPTVARPTGQ
                     AGPTDPLGSILEQLGVGGPR"
     gene            complement(45282..46541)
                     /locus_tag="NS506_00045"
     CDS             complement(45282..46541)
                     /locus_tag="NS506_00045"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94136.1"
                     /translation="MAKNPLTALKGTSTKSKLIAAAAALAVVVAGVTWWGLDKLNTTT
                     ITAYFDKSIGIYEGSDVRVLGVPVGRVDSVTPQGEVVKVVMKVDRKYDIPADAKAAQI
                     TPSVVSDRYIQLAPVYKGGPKMGRDATIPKDRTATPVEVDRLYKSITELSNALGPNGA
                     NKDGALNQLVRTSADNLSGNGEALGNSFTQLSKAARALSDSRTDIFDTVKNLQTFVQT
                     LADNDTQVRTFNSQLASLAGFLSDERQTLGDALSLLSVALGDVARFIDDNRDLVQSNA
                     DALTKLTQTLADQRDDLAKALPLIPTALSNLINVHNGETGTLDMRPNFTDLQDPFGVI
                     CKMLDLGKLRPGDPKFDAISRQLQPILSNCKAITDQLTAGVKTPTLMLPFGILSGENE
                     QHNTVPGTVPGNPSDQQAPSQQEGGQR"
     gene            complement(46545..47552)
                     /locus_tag="NS506_00046"
     CDS             complement(46545..47552)
                     /locus_tag="NS506_00046"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94137.1"
                     /translation="MDDRVVLGKRSPVFMGGIGLLMVLLVTMSAFNLDKLPLLSAGTK
                     YTAEFSEAAGLKKGNEVRIAGVKVGAVSDVRLDGDKVLVDFHTQDAWVGNETSASIQI
                     KTLLGQKYLALDPKGTKVLDPSDRIPLSRTVSPYDVVDAFSDAAKNIEDTNTAQLAQS
                     FQVLSDAFSATPPELRGSIDGVARLSESLAKRDDQLKKLFAATKTTSKVLADRNQEFE
                     RLIANGGELLAELNVRQQAIHQLLTGAKTVAAELSALVKDNEEQIGPALTNLNKTIDL
                     LNDHQADISKTLTLAAPFYGLYANVLGTGRWFDAVITNLIPPALPDVPGNRDPIRKLG
                     G"
     gene            complement(47552..48640)
                     /locus_tag="NS506_00047"
     CDS             complement(47552..48640)
                     /locus_tag="NS506_00047"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94138.1"
                     /translation="MKDVLRGLGPTLTKLIAFILVTVFLTGVLALTIANYGGGGTKFN
                     ARFTDVTSLNKGDEVRIAGVRVGKVTNVSIVDKRLANVEFELTDRDWLPASTTATIKY
                     RNLVGQRYIALEQGTGQQGRKLNKGATIPLERTKPAVNLTELFNGFRPLFQTLTPDDV
                     NKLSSEIIQVFQGESGTIRDLVATTASLTNKVADKDAVIGELIKNLNLVLDSINSRGD
                     QLDQLIVNTEALVTGLNAERGTIGSAVTSLGNLASATADLLVPVRPNLQGAIAGLNQL
                     TSTLNQRKDEVDEGLTNLPIKMEKLGRAASYGSWFQFYLCGIDIVVGPGTKDAPQLNI
                     PPALQNMPTVNQPIYTNPAPRCHGKGGR"
     gene            complement(48637..49989)
                     /locus_tag="NS506_00048"
     CDS             complement(48637..49989)
                     /locus_tag="NS506_00048"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94139.1"
                     /translation="MSNPRNVELWRSTEKLRKRTLGILFFVVVALFLWTTIAVYNKQF
                     VETVRVNLITDTVGNALTRNADVKVRGVTVGELRSSKYDGKNVTLDLAIDPGKAKEIP
                     VNVTARLLPKTLFGERYIDLVWPEAPEGHLTEGVTLHQDTSGNAIEVSQLLDNILPLL
                     NAIPPQYLSSTLSALSNALQGQGEELGKTIDRLDTIFTQVNGEMPTLQQDLKSLADVA
                     TTYADAAPQLVDALDNLRTTNATIVAKRSQIDTLMATLTPSASTTADFLLANRDNIID
                     VAADSRPALEALAKYSPSYSCALAGFAELKPRIDQIFGKGTDLPGSRVSVSVVNPRGR
                     YVPNQDEPRWFDSRGPLCVPMYPPGTDPGQYTNGSANDGSYQPPTRNPGDQNIGRMPE
                     PQYKVYGPYTPTTAYSPQESQALGAIYGAAHGVSPDEVPSWITKIAAPAFRGSEVSVK
                     "
     gene            complement(49986..50852)
                     /locus_tag="NS506_00049"
     CDS             complement(49986..50852)
                     /locus_tag="NS506_00049"
                     /function="Cell inner membrane; Cell membrane; Membrane;
                     Transmembrane; Transmembrane helix; Transport."
                     /note="Part of the ABC transporter complex MlaFEDB that
                     actively prevents phospholipid accumulation at the cell
                     surface. Probably maintains lipid asymmetry in the outer
                     membrane by retrograde trafficking of phospholipids from
                     the outer membrane to the inner membrane (By similarity);
                     Belongs to the MlaE permease family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phospholipid ABC transporter permease
                     protein MlaE"
                     /protein_id="APA94140.1"
                     /db_xref="UniProtKB/Swiss-Prot:P64608"
                     /translation="MVVSQRSTVFSRSARRVKPVLEAPVNLVDKAGDQMSFYSRAIGA
                     IPKTIVHFRREVMRLLAEVTFGSGALAVIGGTIGVIVFMSASVGVVVGLQGFKALDAL
                     GSGVLTGFLTGYINTRELAPLVAALALSATVGCGFTAQLGAMRISEEIDALEVMAVPS
                     VPFLVTTRAIAGFLAVIPLYVVGLLGTYLASRMISIYFNGQSSGSYDHYFYLFLPPED
                     VLYSFVKVLVCAFVIILVHCYYGYNASGGPAGVGVAVGRAVRAAIVLINVLDFFLSLA
                     IWGTTTTVRVAG"
     gene            complement(50855..51649)
                     /locus_tag="NS506_00050"
     CDS             complement(50855..51649)
                     /locus_tag="NS506_00050"
                     /function="Cell inner membrane; Cell membrane; Membrane;
                     Transmembrane; Transmembrane helix; Transport."
                     /note="Could be part of an ABC transporter complex;
                     Belongs to the MlaE permease family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter permease protein"
                     /protein_id="APA94141.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q68XW4"
                     /translation="MNPTLTRLRTPVESGLAQAGNIFALFLDVLRKTFRRPFQWREFI
                     EQSWFIASVSILPAALVAIPFGAVVALQTGSLIKQLGAENFTGATSVLATVQQAAPVV
                     TALIIAGAAGSAVAADLGSRTIREEIDAMEVLGIDPIQRLVVPRVLGMMLVAFLLNGL
                     VSVVGICGGYFFNVGLQGGTPGAYLASFSALAQIPDLVIGEIKALIFGVVAGVIAAYK
                     GLHPKGGPKGVGDAVNQSVVITFLVLFFLNLVLTLIYLQVVPAKGA"
     gene            complement(51660..52721)
                     /locus_tag="NS506_00051"
     CDS             complement(51660..52721)
                     /locus_tag="NS506_00051"
                     /function="ATP-binding; Nucleotide-binding; Transport."
                     /note="Belongs to the ABC transporter superfamily;
                     Contains 1 ABC transporter domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter ATP-binding protein
                     YcbN"
                     /protein_id="APA94142.1"
                     /db_xref="UniProtKB/Swiss-Prot:P42246"
                     /translation="MGVEVRTEGITKSFGSQRIWQDVTLTLPPGEVSALLGPSGTGKS
                     VFLKALIGLLRPEKGSIYIDGTDITTCSNKELYEIRKLFGVLFQDGALFGSMNLFDNT
                     AFPLREHTKKSESEIKKIVMEKLELTGLLGAEGKLPGEISGGMRKRAGLARALVLDPQ
                     IILVDEPDSGLDPVRTTYLSQLLIDINAQIDATILIVTHNINLARSVPDNIGMLFRRN
                     LVMFGPREVLLTSEEPVVKQFLNGRMQGPIGMSEEKDEAQMAREQAMFDSGHHAGGAE
                     EIEGIIPQMRAQPGMPVRGAVARRRERVRQIMHTLPPAAQEAIRESMQQNGDDSDTQV
                     MPAYTGGYDTTVRQNLTNG"
     gene            complement(52995..53375)
                     /locus_tag="NS506_00052"
     CDS             complement(52995..53375)
                     /locus_tag="NS506_00052"
                     /function="Ribonucleoprotein; Ribosomal protein."
                     /note="Forms part of the ribosomal stalk which helps the
                     ribosome interact with GTP-bound translation factors. Is
                     thus essential for accurate translation; Belongs to the
                     ribosomal protein L7/L12P family"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="APA94143.1"
                     /db_xref="UniProtKB/Swiss-Prot:B8JB71"
                     /translation="MANVDELLETFAGMTLLELSEFVKAFEDKFEVTAAAPVAVAVAG
                     GAAAPAEAAEEQDEFDVILEGAGDKKIQVIKVVREIVSGLGLKEAKDLVEGAPKPILE
                     KVAKEAAEAAKAKLEEAGAKITVK"
     gene            complement(53439..54002)
                     /locus_tag="NS506_00053"
     CDS             complement(53439..54002)
                     /locus_tag="NS506_00053"
                     /function="Ribonucleoprotein; Ribosomal protein;
                     RNA-binding; rRNA-binding."
                     /note="Forms part of the ribosomal stalk, playing a
                     central role in the interaction of the ribosome with
                     GTP-bound translation factors; Belongs to the ribosomal
                     protein L10P family"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="APA94144.1"
                     /db_xref="UniProtKB/Swiss-Prot:A0QL54"
                     /translation="MANAEKITAVAEITEQFKESTATVVTEYRGLSVSKITELRRALG
                     ANATYSVAKNTLVKRAAAEAGVEGLDDLFVGPTAITFIKGEPVEAAKALKAFAKDNKA
                     LIIKGGYMDGAALSVSEVERIADLESREVLLAKLAGAMKGNLSKAAGLFAAPGNQVAR
                     LLAALQEKKQAESGAAAPAADAAADAE"
     gene            complement(54286..55059)
                     /locus_tag="NS506_00054"
     CDS             complement(54286..55059)
                     /locus_tag="NS506_00054"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94145.1"
                     /translation="MRIRKLDEGVTNRYRSAAVFFGVTLVAAMAVGGLAQAEEPRRVP
                     VGGGTGLALQWGVPVGSVSLVHFCTLTAIGSDAEGNLVGLTNAHCAYDSARQGAGDAV
                     FLQSAVEYGPEHDPALGRIGTVDYISGGNPIAPGPHGVGLDYAVIVFDRSKVNPVATV
                     GDTTIRSISPPPVEGTPVCKQGKTSGRTCGNTLTSMGPYLVTTVPEFPGDSGAPVVAG
                     EALIGNQWVWGGSSAMTAILEDLDRRGGVGAGFHLGFAG"
     gene            complement(55183..55893)
                     /locus_tag="NS506_00055"
     CDS             complement(55183..55893)
                     /locus_tag="NS506_00055"
                     /function="Repressor; Ribonucleoprotein; Ribosomal
                     protein; RNA-binding; rRNA-binding; Translation
                     regulation; tRNA-binding."
                     /note="Binds directly to 23S rRNA. The L1 stalk is quite
                     mobile in the ribosome, and is involved in E site tRNA
                     release; Protein L1 is also a translational repressor
                     protein, it controls the translation of the L11 operon by
                     binding to its mRNA; Belongs to the ribosomal protein L1P
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="APA94146.1"
                     /db_xref="UniProtKB/Swiss-Prot:A1R8W1"
                     /translation="MAKRSKAYLEAAAKVDRAALYSPLSAVRLAKETATTKTDATVEV
                     AVRLGVDPRKADQMVRGTVNLPHGTGKTARVIVFAVGDKAAEAEAAGADAVGAEDLIE
                     RIQGGWLDFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVTKAVQDIKGGK
                     INFRVDKQANLHFVIGKASFDEKKLAENYGAALDEILRVKPSTAKGRYVKKVTFSTNT
                     GPGIPVDPNRTRNFAEED"
     gene            complement(55988..56422)
                     /locus_tag="NS506_00056"
     CDS             complement(55988..56422)
                     /locus_tag="NS506_00056"
                     /function="Methylation; Ribonucleoprotein; Ribosomal
                     protein; RNA-binding; rRNA-binding."
                     /note="Forms part of the ribosomal stalk which helps the
                     ribosome interact with GTP-bound translation factors;
                     Belongs to the ribosomal protein L11P family"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="APA94147.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q8FSA7"
                     /translation="MPPKKKKVSGLITLQIQAGAANPAPPVGPALGQHGVNIMEFCKA
                     YNAATESQRGNVIPVEITVYEDRSFDFKLKTPPAARLLLKAAGIQKGSAEPHRNKVAQ
                     ITMDQVREIAKTKQEDLNANDIDAAAKIIAGTARSMGITIAE"
     gene            complement(56592..57443)
                     /locus_tag="NS506_00057"
     CDS             complement(56592..57443)
                     /locus_tag="NS506_00057"
                     /function="Transcription; Transcription antitermination;
                     Transcription regulation; Transcription termination."
                     /note="Participates in transcription elongation,
                     termination and antitermination; Belongs to the NusG
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="Transcription termination/antitermination
                     protein NusG"
                     /protein_id="APA94148.1"
                     /db_xref="UniProtKB/Swiss-Prot:P65590"
                     /translation="MTTKEASAPVSTPENGTTEEFPVDDVVIDETTADVEDVEDTEGF
                     ADEFAAGADEFAADAEEDEPAQPVAQITDEPADPVAEMTAALRRAPGDWYVVHSYAGY
                     ENKVKTNLETRVQNLGLEEYIFQVEVPTEEVTEIKNGQKKNVNRKVLPGYILVRMELN
                     DESWGAVRNTPGVTGFVGATSRPSPLTIPEVVKFLVPAAQQKKAAPATAAAAAAAPGE
                     TSIVKPVIEVDFEVGESVTVMDGPFATLPASISEVNAEQQKLKVLVSIFGRETPVELA
                     FTQVAKI"
     gene            complement(57551..57940)
                     /locus_tag="NS506_00058"
     CDS             complement(57551..57940)
                     /locus_tag="NS506_00058"
                     /function="Cell membrane; Membrane; Protein transport;
                     Translocation; Transmembrane; Transmembrane helix;
                     Transport."
                     /note="Essential subunit of the Sec protein translocation
                     channel SecYEG. Clamps together the 2 halves of SecY. May
                     contact the channel plug during translocation; Belongs to
                     the SecE/SEC61-gamma family"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein translocase subunit SecE"
                     /protein_id="APA94149.1"
                     /db_xref="UniProtKB/Swiss-Prot:P0A5Z1"
                     /translation="MSDERDIRHEDGDETAAVARPSGKRSARRARAASSSAVATIERP
                     SDSAKATTKKSGKDKKAGRGGMGNPFVRLLTFLKQVVAELRKVIWPNRKQMVTYTSVV
                     LVFVIFVIAYISGLDLAFIKGVNWLFG"
     gene            complement(58035..58110)
                     /locus_tag="NS506_00059"
     tRNA            complement(58035..58110)
                     /locus_tag="NS506_00059"
                     /product="tRNA-Trp"
     gene            complement(58350..59429)
                     /gene="phaJ"
                     /locus_tag="NS506_00060"
     CDS             complement(58350..59429)
                     /gene="phaJ"
                     /locus_tag="NS506_00060"
                     /EC_number="4.2.1.55"
                     /note="Belongs to the UPF0336 family; KEGG: azl:AZL_006240
                     3-hydroxybutyryl-CoA dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxybutyryl-CoA dehydratase"
                     /protein_id="APA94150.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WFK0"
                     /translation="MTINTEITEADMVESAETFDPAAHAAAMVGHHYRVEDYYEVGRE
                     KVREYARAVQDYHPVHWDEDVARAHGHDALVAPLTFISLVGILAQRKLFEQIVTGYDL
                     SQIMQTDQILEFHRPIKAGDQLSCIVYLHSFRQAFGGDIIVTRNDVVAQNDELVLTTY
                     TTLIGRSGGDIDPNIGDAVRNVLMHGVGPDAADADKPVAIDSPEQAVTVFPTGSVVAG
                     ARTRRFEDIAAGDELPARTVQLTRGDLVNYAGVSGDANPIHWSDDVVKLVGLENVVAH
                     GMLTMGLGGGFVTSWLGDPGAVKEYNVRFTSPVYVPIDRPAEIEYTGKVKSVDPETRT
                     AVIAIVAKSEGRKIFGRATATVQLG"
     gene            complement(59591..59761)
                     /locus_tag="NS506_00061"
     CDS             complement(59591..59761)
                     /locus_tag="NS506_00061"
                     /function="Ribonucleoprotein; Ribosomal protein."
                     /note="Belongs to the ribosomal protein L33P family"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="APA94151.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q5YPC0"
                     /translation="MAAKSTDIRPKITLACEQCKHRNYITKKNRRNDPDRLELKKFCP
                     NCGTHRAHRESR"
     gene            complement(59805..59877)
                     /locus_tag="NS506_00062"
     tRNA            complement(59805..59877)
                     /locus_tag="NS506_00062"
                     /product="tRNA-Met"
     gene            complement(59958..60030)
                     /locus_tag="NS506_00063"
     tRNA            complement(59958..60030)
                     /locus_tag="NS506_00063"
                     /product="tRNA-Thr"
     gene            complement(60250..60334)
                     /locus_tag="NS506_00064"
     tRNA            complement(60250..60334)
                     /locus_tag="NS506_00064"
                     /product="tRNA-Tyr"
     gene            60476..60967
                     /locus_tag="NS506_00065"
     CDS             60476..60967
                     /locus_tag="NS506_00065"
                     /note="Belongs to the UPF0234 family"
                     /codon_start=1
                     /transl_table=11
                     /product="UPF0234 protein"
                     /protein_id="APA94152.1"
                     /db_xref="UniProtKB/Swiss-Prot:A0QRM0"
                     /translation="MADSSFDVVSKIDRQEVDNALNQAAKELSQRYDFRGTGASIEWS
                     GEEKIILSAESEDRVKAALDVFKEKLIRRDISLKAFDAGDPQASGKVYKITGELVQGI
                     TTENAKKIAKKIRDEGPKSVKAQIQGEELRVSSKNRDDLQAVIALLRGGDFDIALQFV
                     NYR"
     gene            complement(60964..61845)
                     /gene="htpX"
                     /locus_tag="NS506_00066"
     CDS             complement(60964..61845)
                     /gene="htpX"
                     /locus_tag="NS506_00066"
                     /EC_number="3.4.24.-"
                     /function="Cell membrane; Hydrolase; Membrane;
                     Metal-binding; Metalloprotease; Protease; Transmembrane;
                     Transmembrane helix; Zinc."
                     /note="Belongs to the peptidase M48B family; KEGG:
                     ncy:NOCYR_4911 heat shock protein HtpX;
                     Metalloendopeptidases"
                     /codon_start=1
                     /transl_table=11
                     /product="Protease HtpX like protein"
                     /protein_id="APA94153.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q5YPB8"
                     /translation="MHGHGYANGLKTFGLLVGMSALIVFAGAMFRNPTILVFSILLAV
                     GMNAYAYFNSDKLALKAMHAQPVTELEAPAMYRIVRELATAARQPMPRLYISPTNAPN
                     AFATGRNPRNAAVCCTAGILQILDERELRAVLGHELSHVYNRDILISSVAGALASVIS
                     GLAQMAFFAGIFGGNRDGEGPNVIGILLVSLLGPIAASLIKLAVSRSREYQADQDGAE
                     LTGDPLALASALRKLERGTQAAPLPPEPQLTAQSHLMIANPFRNGEAMARWFSTHPPM
                     ADRIARLEEMAGGNRNY"
     gene            complement(61928..62950)
                     /locus_tag="NS506_00067"
     CDS             complement(61928..62950)
                     /locus_tag="NS506_00067"
                     /EC_number="2.5.1.30"
                     /function="Magnesium; Metal-binding; Transferase;
                     Ubiquinone biosynthesis."
                     /note="catalyzes the sequential condensation of
                     isopentenyl diphosphate (IPP) with the allylic substrate
                     to give solanesyl diphosphate. Could be important to
                     determine the side chain length of ubiquinone; Belongs to
                     the FPP/GGPP synthase family; KEGG: nno:NONO_c69630
                     heptaprenyl diphosphate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="Heptaprenyl diphosphate synthase"
                     /protein_id="APA94154.1"
                     /db_xref="UniProtKB/Swiss-Prot:O24743"
                     /translation="MSASAVSDESTVVAGVDLGDPELAATVRKGLIEVEDLLITELSD
                     GEEFLQEAALHLAKAGGKRFRPLFTILTGQLGPDPTSPDLVTAGTVVELVHLATLYHD
                     DVMDEASMRRGAPSVNSRWGNSVAILAGDYLFAHASRLVSTLGPDAVRIIAETFAELV
                     TGQMRETIGARQSQAPVEHYLRVVWEKTGSLIAAAGRFGGTFSGASTDHVERLARLGD
                     AVGTAFQIADDIIDISSVSEQSGKTPGTDLREGVHTLPVLYALRDEGAEGDRLRKLLA
                     HPLQTDAEVDEALYLLSRSRGLVLAKEKLHGYADIAHAELSALPGGPANEALEQLVRY
                     TIERVG"
     gene            63130..64404
                     /gene="sqlE"
                     /locus_tag="NS506_00068"
     CDS             63130..64404
                     /gene="sqlE"
                     /locus_tag="NS506_00068"
                     /EC_number="1.14.14.17"
                     /function="FAD; Flavoprotein; Oxidoreductase."
                     /note="Belongs to the geranylgeranyl reductase family;
                     KEGG: afm:AFUA_5G07780 squalene monooxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Squalene monooxygenase"
                     /protein_id="APA94155.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WNY8"
                     /translation="MGSPEVASEQGKSSDVLPSHADVLVVGAGPAGSAAAAWAARAGR
                     DVLLTDSAVFPRDKTCGDGLTPRATAELEHLGLGDWVRAHTVNRGLRMAGFGREALLP
                     WPDGSFPAYGSAVPRTELDDKLRETAVKSGARMVDGAKVVEVAREGDRVTGVTVKTDG
                     GLRAVSCKTLIVADGVRSPVGKMLGRTWHRQYAYGTAARAYIKSARSDDEWITSHMEL
                     RDAAGELIPGYGWVFPLGNGEVNIGVGSLATEKRPSHIALKPLLQHYVSQRRAEWGFE
                     GEARAVASALLPMGGAVSNLAGRNWALIGDAAGCVNPLNGEGIDYGLEGGHMLAGILD
                     HPDLTHIWPEMLRERYGRTYSVARRIAGLATHPRTVPLGGPPMMRSKLLQRTAVRVMG
                     NLVTDEDVDLTARLWRASGRASLRFDKIRPFT"
     gene            64401..64820
                     /locus_tag="NS506_00069"
     CDS             64401..64820
                     /locus_tag="NS506_00069"
                     /function="Activator; DNA-binding; Transcription;
                     Transcription regulation."
                     /note="ArgR could be a transcriptional activator of the
                     dauBAR operon in response to the presence of L-Arg"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator ArgR"
                     /protein_id="APA94156.1"
                     /db_xref="UniProtKB/Swiss-Prot:G3XCU2"
                     /translation="MTSRPVPEALLPHLRRARDLADRNYAEPLDLDALAAAAGVSKYH
                     FLRCFAATYGKTPAVYLAERRIERAQDLLRATNVTVTEACMLVGYSSLGSFSSKFTEL
                     VGMSPSEYQAKFAAEGAPHIPGCYVFMHGLSDRKPLT"
     gene            complement(64824..66467)
                     /locus_tag="NS506_00070"
     CDS             complement(64824..66467)
                     /locus_tag="NS506_00070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94157.1"
                     /translation="MVQVETPTANAVAASKETLEDYTLRFAPRSYRKWSPAVVGVSAL
                     GGIAYLADFSIGANIGIANGTGNALLGIGIFAIVVMLTGFPLAYYAARYNIDLDLITR
                     GSGFGYYGSVVTNIVFASFTFIFFALEGSIMAQGLKLGLHVPLPIGYLVSTVMIFPLV
                     IYGMNTLAKLQVWTTPLWLILMVAPFAFLLVRHPDSVGTFLSYGGQDGRGVSLSGALL
                     AAGVCLSLIAQIAEQIDYLRFMPPRTPENARKWWGWMLLAGPGWVLFGAVKQVVGLFL
                     AVYLIANLPGAQNIANQPVHQFLEIYRDMMPSWLAMTLAVALVVISQIKINVTNAYSG
                     SLAWTNSFTRVTKTYPGRIVFLGLNLAIALILMEANMFDFLNNILGFYANCGIAWIVT
                     VATDIVINKYVLKISPREPEFRRGMLYDFNPVGLVGFGLSAVLSIATFFGLFGETLKP
                     YSPIVAVVVSFVATPLTAILTKGKYYLRRDHDGIELDMFDEHGNPSGETLTCVVTGME
                     FERPDMIASAVPGPEGEIQYISSLALSTDKTGIHVLPSK"
     gene            66669..67118
                     /locus_tag="NS506_00071"
     CDS             66669..67118
                     /locus_tag="NS506_00071"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94158.1"
                     /translation="MTTITNVSLVTVYVTDQSAAKEWYIDKLGFVEHSDVTMGDNGFR
                     WVTVAHPNHPELEVTLMIPGPPLDDTLAEAIRRSMANGTHGALGLRTDNCQKTFEELT
                     AKGVEFVQPPAERPYGVEAIIRDNSGNWLVLIEPREFDPATAQFGPE"
     gene            complement(67178..67681)
                     /locus_tag="NS506_00072"
     CDS             complement(67178..67681)
                     /locus_tag="NS506_00072"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94159.1"
                     /translation="MSRKFSFTVQYSVPVEDLHRALTNDEMWQARFEGASTATLELTH
                     PDGPGTIQIHMTEKAPEDQIPGIVQKVLKSELMLERTDSWGPLSDGVAKGGCSGRSGG
                     ITTEMAGAFELRPTAEGSEIEATGTVDVKVPLVGGAIEPLVENLLKKVMNSERKSVES
                     WFAAQNA"
     gene            67796..68215
                     /locus_tag="NS506_00073"
     CDS             67796..68215
                     /locus_tag="NS506_00073"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94160.1"
                     /translation="MITAATFSFLAVLLVLAAWRDDHLINSDKGVTSAEVLSAGTLRS
                     AVIFVTPDGETHNPKTGVLYPTKLTVGERINVEYRRSDPDLVRVAGRDARVAIIPALS
                     VIVVAWAIALPLLWLLGSPPTLWLGALWTRARTRLRK"
     gene            68368..69081
                     /gene="ubiE"
                     /locus_tag="NS506_00074"
     CDS             68368..69081
                     /gene="ubiE"
                     /locus_tag="NS506_00074"
                     /EC_number="2.1.1.163"
                     /EC_number="2.1.1.201"
                     /function="Menaquinone biosynthesis; Methyltransferase;
                     S-adenosyl-L-methionine; Transferase."
                     /note="Methyltransferase required for the conversion of
                     demethylmenaquinol (DMKH2) to menaquinol (MKH2); Belongs
                     to the class I-like SAM-binding methyltransferase
                     superfamily. MenG/UbiE family; KEGG: nfa:nfa51290
                     demethylmenaquinone methyltransferase /
                     2-methoxy-6-polyprenyl-1,4-benzoquinol methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="Demethylmenaquinone methyltransferase"
                     /protein_id="APA94161.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q5YPB0"
                     /translation="MAKLRQRESFRAQLDKKPGEVASMFDGVAKRYDITNTVMTGGID
                     RYWRLMTRKALALRPGERVLDLAAGTGVSTVELAKSGAWCLAADFSQGMLAAGRWRNV
                     PMVAGDAMALPFADDSFDAVTISYGLRNVSDPDLALREMLRVTKPGGRLVVAEFSTPT
                     LAPFRTVYMEYLMKALPQVASAVSSNPDAYVYLAESIRAWPNQPQLAVRIADAGWSSV
                     KWRNLTGGIVALHRGYKLG"
     gene            69226..73734
                     /gene="nasA"
                     /locus_tag="NS506_00075"
     CDS             69226..73734
                     /gene="nasA"
                     /locus_tag="NS506_00075"
                     /EC_number="1.7.99.4"
                     /function="4Fe-4S; Electron transport; Iron; Iron-sulfur;
                     Metal-binding; Molybdenum; Nitrate assimilation;
                     Oxidoreductase; Periplasm; Signal; Transport."
                     /note="Catalytic subunit of the periplasmic nitrate
                     reductase (NAP). Only expressed at high levels during
                     aerobic growth. NapAB complex receives electrons from the
                     membrane-anchored tetraheme protein NapC, thus allowing
                     electron flow between membrane and periplasm. Essential
                     function for nitrate assimilation and may have a role in
                     anaerobic metabolism; Belongs to the prokaryotic
                     molybdopterin-containing oxidoreductase family.
                     NasA/NapA/NarB subfamily; Contains 1 4Fe-4S Mo/W
                     bis-MGD-type domain; KEGG: xtn:FD63_02855 assimilatory
                     nitrate reductase catalytic subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="Nitrate reductase"
                     /protein_id="APA94162.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q7VJT5"
                     /translation="MPEQTTPPTSTRTACSYCGVGCGITVETEPDARGLPVITKVKGD
                     KAHPVNAGRLCTKGNTHAEMMAAPGRMETAYRRPERGQPPVPMPVDEAIHEAAERLRV
                     ILDIYGPDAIALYVSGQMSLEAQYLATKLAKGHLRTVHMEANSRLCMASAAGGYKLSL
                     GSDGPPGSYDDLDHADLFFVIGANMADCHPILFLRMADRLKAGAKLIVVDPRRTDTAA
                     RADLFLQIKPGTDLALLNGLLHLLIENGAIDAEFIAEHTEGFDAMPEFLSGYTPELVT
                     EVTGIPEADIRTAAEWIGAAGEWMSLWTMGINQSTHGTWSSNAIINLHLATGAICRTG
                     SGPFSLTGQPNAMGGREMGYMGPGLPGQRSVLSDADRAFVEAEWGLEPGTIRAEAGPG
                     SIEMFRGLADGRIKACGIVCSNPVASMANRRTVIAGLEAAELVIVQDVFTDTATNAYA
                     DLLLPATLWAEADGVQVNSERTLTLLRHSVEPVGDARPDWQLIAEMARTLGFPGFEYS
                     SSAEIFDELRRFANPATGYDLSGIDYELLADGPAQWPCPDPAVRRNPIRYLNDGVSQT
                     RYTDADGHTPRLAFATPSRRAVFWPRPHLLPDEMPDEDHPFVLNTGRLQHQWHTMTKT
                     GKVAKLNKLNGRPFLEVHPDDAAQLDVREGDQLEIASRRGRAVLPVQISDRVLPGTCF
                     APFHWNDEQGEYLTINAVTNDAVDPISLQPEFKACAVRLRKVAALRVDTPELGTVDGG
                     HPGTAADPLPAEHDPAASDAVPGATHSAGAHPLASMLGLDGSIAPTLSEVERIYLGGY
                     LAALQSLPVTGVPVLPVTAPISERSRLWIDGLLGGMYSRGAHLGAPALEAGGPDGSAA
                     AGDSTATRIVTVLWASQTGTAEDLAAALVTYLVDSGFIPRLLDMDSAELSDLAGDVLV
                     ISSTFGDGGPPDNGADFWERLNDSAIRLTGMRYAVFALGDSSYDDFCGHGRKLDELFA
                     QRGATRLLARVDSEPDHEDLSATWFDDVITSLAAAFDTAAPPEVPGIDGAPGSQEPRD
                     GSGGASSIPPGGPFGISNDVLADSSAARGRNPGPHTHPSAWAFPPSGPNSPGSSVPDT
                     RAGNGSTRQFGPGTGAPERVGAVTAPGFAPGRARTITAAPFTRNAPLLAKLVRNEPLS
                     SAGSEKEVRQFGFDLSDLEATYEVGDSLGIRPANCEALVSEWLEVTGLDGRRIIDVED
                     GELTLAQALRTHYDITRVSADLLSFVAERNASPRLGKLLRRDNRNELDGYLWDRQAVD
                     VLRDFPVRADLVEWLGALKKLQPRQYSISSSPLVSPREVQLTVGVVRYGDPVDIGSAA
                     RRGGVCSTFLADRAAVEVPIFLQRAPHFRPPLDPNAPMIMVGPGTGIAPFRGFLQERR
                     ALGCKGRNWLFFGDQHAADNFYYRSELEDMFRSGFLTRLDLAFSRDQRERIYVQHRMI
                     EHGAELWAWLRDGGHFYVCGDAARMAKDVDDTLLRIARIHGKLSEDGALAFKKQLVAE
                     KRYVRDVY"
     gene            73798..74856
                     /locus_tag="NS506_00076"
     CDS             73798..74856
                     /locus_tag="NS506_00076"
                     /EC_number="2.3.1.20"
                     /EC_number="2.3.1.122"
                     /function="Acyltransferase; Cell wall; Cytoplasm;
                     Disulfide bond; Secreted; Signal; Transferase."
                     /note="The antigen 85 proteins (FbpA, FbpB, FbpC) are
                     responsible for the high affinity of mycobacteria for
                     fibronectin, a large adhesive glycoprotein, which
                     facilitates the attachment of M. tuberculosis to murine
                     alveolar macrophages (AMs). They also help to maintain the
                     integrity of the cell wall by catalyzing the transfer of
                     mycolic acids to cell wall arabinogalactan, and through
                     the synthesis of alpha,alpha-trehalose dimycolate (TDM,
                     cord factor). They catalyze the transfer of a mycoloyl
                     residue from one molecule of alpha,alpha-trehalose
                     monomycolate (TMM) to another TMM, leading to the
                     formation of TDM. FbpA mediates triacylglycerol (TAG)
                     formation with long-chain acyl-CoA as the acyl donor and
                     1,2-dipalmitoyl-sn-glycerol (1,2-dipalmitin) as the acyl
                     acceptor. It has a preference for C26:0-CoA over C18:1-CoA
                     (By similarity); Belongs to the mycobacterial A85 antigen
                     family; KEGG: mle:ML0097 diacylglycerol O-acyltransferase
                     / trehalose O-mycolyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="Diacylglycerol O-acyltransferase"
                     /protein_id="APA94163.1"
                     /db_xref="UniProtKB/Swiss-Prot:O06052"
                     /translation="MSVRISRITARLAVAALVSAASPALGGVPAGADTPTLSGVTVPE
                     LKTDDGSYIQNVAARDDHTVTFTVYSAAMNQVFPVDVLRPADTSEARPTLYLLNGAGG
                     GVDQATWQLRTDALDFLADKNVNVVQPIGGAFSWYTDWLSPDKSLGVNKWSTYLGKEL
                     PPLMDAALGTDGVNAIAGISMAGLPVLNSVIFNPGLFRSAAVYSGFFQTTTPQGRESI
                     KMVTELYGGGKVENMWGPEGGPLWAANDPTLNAEKLRGTNLFISTGNGIPGAFDVPGA
                     RGRMERPADTAKAVAIGSFIEANVELSTFILQKRLESLNIPATFEFRDSGTHIWGYWQ
                     DDLKASWPVLAQGLYSNP"
     gene            complement(74861..75895)
                     /locus_tag="NS506_00077"
     CDS             complement(74861..75895)
                     /locus_tag="NS506_00077"
                     /EC_number="1.1.1.91"
                     /function="Cytoplasm; Nucleus; Oxidoreductase."
                     /note="Belongs to the aldo/keto reductase family; KEGG:
                     ret:RHE_CH02805 aryl-alcohol dehydrogenase (NADP+)"
                     /codon_start=1
                     /transl_table=11
                     /product="Aryl-alcohol dehydrogenase (NADP(+))"
                     /protein_id="APA94164.1"
                     /db_xref="UniProtKB/Swiss-Prot:O94315"
                     /translation="MEYRRLGASGLLVPALSFGAGTFGGRGELFSAWGDTDARQARRL
                     VDISLDAGVTMFDTADVYSDGASEEVLGEAIRGRRDQLLISTKATLPTGPGPFDAGSG
                     RSRLISAVEGSLRRLGTDRIDLFQLHAFDAGTPVEEVLSALDDLVRSGKIRYVGASNF
                     AGWQLMKSLAAADRYGFTRYVAHQVYYSLVGRDYEWELMPLGLDQGVGAVVWSPLGWG
                     RLTGRIRRGQPLPAGSRLHKTADAGPPVDDERLYDIVDVLEEIAAETGRSVPQIALNW
                     LLRRPTVATVIVGARDEEQLRQNLGAVGWSLDADQVARLDKASAVTPPYPYYPYYRQE
                     GFARVNPPVV"
     gene            75981..76613
                     /locus_tag="NS506_00078"
     CDS             75981..76613
                     /locus_tag="NS506_00078"
                     /function="DNA-binding; Repressor; Transcription;
                     Transcription regulation."
                     /note="Contains 1 HTH tetR-type DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative HTH-type transcriptional regulator
                     YdeS"
                     /protein_id="APA94165.1"
                     /db_xref="UniProtKB/Swiss-Prot:P96676"
                     /translation="MNQDTAGPGSVRPGGRTARVREAVLLAAGDLLAERGFATLDLAE
                     VAARAEVGKTTVYRRWRTPAGLVADLLLEMAETSLPHSDTGTLRGDLRENARLVGKTL
                     TDPRQGRLFRAVIAAATSDDTAAAALRAFYDTRLSEWSPCVEAAVSRGEIPPETDPRA
                     VLSAVSAPLYYRLLASGDPVDEAAITAAAEAAALAAEQGVFTTAALESAD"
     gene            complement(76700..77275)
                     /locus_tag="NS506_00079"
     CDS             complement(76700..77275)
                     /locus_tag="NS506_00079"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94166.1"
                     /translation="MTTPAFDLEAAAAAVEAVVAAVAEADCERPTPSGITVRDMVAHV
                     QGFTEAFRLGATKELLGRSQPPEPGSSLAQDWRDRIPAQLKSLVAAWREPDAWEGDTE
                     VGGAVAPAPQMAIFALDELVIHGWDLARAIGAPYAPAEPDLAILLGFLRDTPREGIPG
                     LFGPVIDIPAEAPLLDRVLGLTGRDPAWAAD"
     gene            77450..77683
                     /locus_tag="NS506_00080"
     CDS             77450..77683
                     /locus_tag="NS506_00080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94167.1"
                     /translation="MKGDRVEIVVDTGDGSRNYEIIATRAGRRVETRIARGIVEVSEV
                     TRTGSSVRTARFLAGRVLSLVEYPADDGALPGE"
     gene            77763..77978
                     /locus_tag="NS506_00081"
     CDS             77763..77978
                     /locus_tag="NS506_00081"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94168.1"
                     /translation="MIDRIDEVPEADSVEQSIPAYPADDALDSDSEITEVPAGDNGWT
                     ASEGDLVEQSIPVPLDDDRDESAGSDY"
     gene            complement(78020..79654)
                     /gene="menD"
                     /locus_tag="NS506_00082"
     CDS             complement(78020..79654)
                     /gene="menD"
                     /locus_tag="NS506_00082"
                     /EC_number="2.2.1.9"
                     /function="Magnesium; Manganese; Menaquinone biosynthesis;
                     Metal-binding; Thiamine pyrophosphate; Transferase."
                     /note="Catalyzes the thiamine diphosphate-dependent
                     decarboxylation of 2-oxoglutarate and the subsequent
                     addition of the resulting succinic semialdehyde-thiamine
                     pyrophosphate anion to isochorismate to yield
                     2-succinyl-5-enolpyruvyl-6-hydroxy-3-
                     cyclohexene-1-carboxylate (SEPHCHC); Belongs to the TPP
                     enzyme family. MenD subfamily; KEGG: mtu:Rv0555
                     2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-
                     carboxylate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-succinyl-5-enolpyruvyl-6-hydroxy-3-
                     cyclohexene-1-carboxylic-acidsynthase"
                     /protein_id="APA94169.1"
                     /db_xref="UniProtKB/Swiss-Prot:A0QLC9"
                     /translation="MNPSTAQAHVVVDELPRGGVRDVVLCPGSRNAPLAFALQAADQA
                     GRIRLHMRIDERTAGFLAVGLAAASGRPVPVVMTSGTAVANLGPAVLEANYARIPLIV
                     LSANRPYEMLGTGANQTVEQFGLFGSQVRAAIGLGLAEADGGDELYAKQNSVWRSAVC
                     RVLAAARGTRSGNAGPVQFDIPLREPLVPDLAAGDALPAGRDGERPWTATQYATLDVP
                     LDIDLTPDTVVISGHGAGHRPELAALPTVAEPTAPMHGPALHPLALPLLRPKQAIITG
                     RPTLHRQVSRVLADPEVTVFALTTGPRWPDVSGNVVGTGTRAVTHGAPRPEWLELCRD
                     LNEKAVTVVRAELAGHPKPTGLHVAAVVMDALREGDQLLLGASNPVRDAALVSHPRPG
                     IRVLSNRGVAGIDGTVSAAVGAALTHPGRTVALMGDLTFLHDASGLLIGPGEPRPEDL
                     TIVVANDDGGGIFELLEQGDPQYAGVFERVFGTPHGMDLAALCAAYRIPHRQVDPAQL
                     AAELSGSAHGIRVLEVATERSSLRELHATVRAGVSN"
     gene            79743..80570
                     /locus_tag="NS506_00083"
     CDS             79743..80570
                     /locus_tag="NS506_00083"
                     /EC_number="3.6.3.34"
                     /function="Cytoplasm; Ion transport; Iron; Iron transport;
                     Transport."
                     /note="Involved in intracellular removal of iron from
                     iron- vibriobactin complex. Vibriobactin is an
                     iron-chelating compound involved in the transport of iron
                     from the bacterial environment into the cell cytoplasm;
                     Belongs to the SIP oxidoreductase family; Contains 1
                     FAD-binding FR-type domain; KEGG: bfa:Bfae_26520 iron
                     complex transport system ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Iron-chelate-transporting ATPase"
                     /protein_id="APA94170.1"
                     /db_xref="UniProtKB/Swiss-Prot:A5F660"
                     /translation="MAKRSKHVKPEHREILTAEVLASKRISPNFVRVTLGGTGLANFT
                     AMGFDQWFRLFMPGRDGSLKLPTSSTNLGWFAQYLMMGKEHRPLARNYTVRDYRAAGF
                     GEFGSTAEIDVDFVSHGDGSPASAWANNATPGCQVGLLDEGITYQAPDHSDWTLLVGD
                     ESALPGIAGVLRSLPRGAKGAAYIEIPSAEDRQELGEPEGVQVNWLARTDAHVEVGAL
                     AAEAVRQAELPGTGVYAFIAGEQKLAAGVRRHLAQEREIPKADITFTGYWRVGKSQG"
     gene            complement(80697..81143)
                     /locus_tag="NS506_00084"
     CDS             complement(80697..81143)
                     /locus_tag="NS506_00084"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94171.1"
                     /translation="MVAALSESLLDDAKRPAFIADAVTVLDEEVSDKGGASGLVVKGG
                     YAAIKKVSPSIVGDALESFAPKFVEQLEPYWVEYQNGGSGSFADLLVSKQDEVADALL
                     SVTDARAEASSRPALTKVYNSMRSSAKKHVAEALPRLGDLVQKHAG"
     gene            81483..82388
                     /gene="menB"
                     /locus_tag="NS506_00085"
     CDS             81483..82388
                     /gene="menB"
                     /locus_tag="NS506_00085"
                     /EC_number="4.1.3.36"
                     /function="Lyase; Menaquinone biosynthesis."
                     /note="Converts o-succinylbenzoyl-CoA (OSB-CoA) to 1,4-
                     dihydroxy-2-naphthoyl-CoA (DHNA-CoA); Belongs to the
                     enoyl-CoA hydratase/isomerase family. MenB subfamily;
                     KEGG: mgi:Mflv_0025 naphthoate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoyl-CoA synthase"
                     /protein_id="APA94172.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WNP4"
                     /translation="MFTPVTFNATLWRPVPGFENLTDITYHRHIEQGTVRIAFDRPEV
                     RNAFRPHTVDELYRALDHARMTPDVGAVLLTGNGPSPKDGGWAFCSGGDQRIRGRSGY
                     QYASGETADTVDVARAGRLHILEVQRLIRFMPKVVIALVNGWAAGGGHSLHMVCDLTL
                     ASREHARFKQTDADVGSFDAGYGSAYLAKMVGQKFAREIFFRGRPYTAEEMHQMGAVN
                     AVVDHEQLEDVALEWSADILGKSPQAIRMLKYAFNLQDDGLVGQQLFAGEATRLAYMT
                     DEAVEGRDAFLEKRQPDWKPYPYYF"
     gene            82429..82818
                     /locus_tag="NS506_00086"
     CDS             82429..82818
                     /locus_tag="NS506_00086"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94173.1"
                     /translation="MEILSSRVILRPRDYERTLEFYRDALGLAIAREYPGGTVFFAGQ
                     SLIEVAGHGRGADAPSGFAGAIWLQVRDCDDTAAELALRGVAIDRAPEREPWGLVEMW
                     VRDPDGVPLVFVEVPANHPLRRDIRGD"
     gene            82915..84153
                     /locus_tag="NS506_00087"
     CDS             82915..84153
                     /locus_tag="NS506_00087"
                     /function="Cell membrane; Membrane; Phosphate transport;
                     Transmembrane; Transmembrane helix; Transport."
                     /note="Low-affinity inorganic phosphate transport; Belongs
                     to the inorganic phosphate transporter (PiT) (TC 2. A. 20)
                     family. Pit subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="putative low-affinity inorganic phosphate
                     transporter"
                     /protein_id="APA94174.1"
                     /db_xref="UniProtKB/Swiss-Prot:P59950"
                     /translation="MSAELLVLLIVVCTALAFDFTNGFHDTANAMATSIATGALRPRT
                     AVLLSGALNLIGAFLSVAVAATVAAGIVDLSEVSGRALLDIVFAGLVGGILWNLFTWL
                     LGLPSSSSHALFGGLIGSTIAALGWHGVIWSAGNKGVLAKIIIPALLSPIVAALVASI
                     ASWVVYRITKGSNEKTVSRGFRFGQIGTASLVSLAHGTNDAQKTMGIIFLALIAHGSA
                     KASDPLPLWVIVSCAVAMAAGTCLGGWRIIRTLGKGLVDIAPPQGFAAESTSAAIILT
                     SAHFGLPLSTTQVVTGSILGSGIGRPGAEVRWGVLGRMVTAWALTLPLAGAVGALCWA
                     ILHVIGGTAGVLVVFALLIVMAALIWFRSKRAEVNSHNVTDEWEPAPAATPQNRDDDP
                     AARGNDDTAARRNDDTVGIG"
     gene            84163..84432
                     /locus_tag="NS506_00088"
     CDS             84163..84432
                     /locus_tag="NS506_00088"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94175.1"
                     /translation="MHTLLNNLSDLWRVMLAALIFGAGLPTVFAVGIRCRAQVDDGAT
                     GTTRTVALVASTLCFAVVMIAVVVGVLFIAKGFLATRLGIHLLGA"
     gene            84458..84805
                     /locus_tag="NS506_00089"
     CDS             84458..84805
                     /locus_tag="NS506_00089"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94176.1"
                     /translation="MSTPAPSPEPTAVPPRTNVAQKVLDWLKAGYPQGIPQSDYVALL
                     AVLHRRLTDYEVHLVVEQLIRERVAPADIDRTDIEAAIARVAKEQPGEDDIARVASRL
                     AAGGWPLATPTSN"
     gene            84775..86052
                     /gene="menE"
                     /locus_tag="NS506_00090"
     CDS             84775..86052
                     /gene="menE"
                     /locus_tag="NS506_00090"
                     /EC_number="6.2.1.26"
                     /function="ATP-binding; Ligase; Menaquinone biosynthesis;
                     Nucleotide-binding."
                     /note="Converts 2-succinylbenzoate (OSB) to
                     2-succinylbenzoyl- CoA (OSB-CoA). May be involved in the
                     biosynthesis of menaquinone (By similarity); Belongs to
                     the ATP-dependent AMP-binding enzyme family. MenE
                     subfamily; KEGG: rop:ROP_16850 O-succinylbenzoic acid--CoA
                     ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="o-succinylbenzoate--CoA ligase"
                     /protein_id="APA94177.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WQ38"
                     /translation="MAAGDTDVQLTARDPAAIDYRAPTPPRAATRRNDTIANVSNTLR
                     ILPMPTGAAVGEVLPHLREALEGNGPAWLPVPTADRRETQRLSGSLRPGEEIDEDVAL
                     VVTTSGTTGNPKGAMLTPANLRASGDATHERLGGPGQWLLALPTHHIAGIQVLLRSIL
                     AGTEPTVLDVSGGFLPEALVGAIASMRGERRYTSLVPTQLIKALDEPAATDALASLDG
                     VLVGGAATPKPVLERARAAGITVFRTYGMSETCGGCVYEGVPLTGTEVRIEDGRVLLG
                     GAMVAKGYRNIPDHPAFAEPGWFRTEDAGHFDNGVLAITGRLDEAIMTGGLLVIPEVV
                     EAVLITHPSVSECVVLGLPDERLGQRVATAIVPAPGATAPTLDELRDHVVAELDAIAA
                     PRELAVLDELPLRGPGKPDRAKLRELLLAASPN"
     gene            complement(86150..86584)
                     /locus_tag="NS506_00091"
     CDS             complement(86150..86584)
                     /locus_tag="NS506_00091"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94178.1"
                     /translation="MSTTATLNPAIVGQAEKHHAAILSRVLSGTTLDEQRWITLNQTL
                     AAGAPVARAEHIVKIATMTRWTPESVADAVSALLETGLLASQGDRIEVTDAGRALVAR
                     VRADSGRIVDAAYGSVSPEDLATAARVLTVITARMAEELARA"
     gene            86713..87333
                     /locus_tag="NS506_00092"
     CDS             86713..87333
                     /locus_tag="NS506_00092"
                     /EC_number="1.6.99.3"
                     /function="Antibiotic biosynthesis; DNA-binding;
                     Repressor; Transcription; Transcription regulation."
                     /note="Represses transcription of the divergently oriented
                     tcmR and tcmA (tetracenomycin C resistance and export)
                     genes by binding to an intergenic operator region. This
                     binding is inhibited by tetracenomycin C; Contains 1 HTH
                     tetR-type DNA-binding domain; KEGG: bcl:ABC2937 NADH
                     dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase"
                     /protein_id="APA94179.1"
                     /db_xref="UniProtKB/Swiss-Prot:P39885"
                     /translation="MTSDDRALPLRERKRLRTRRALADAALRLFTEQGFDATTIEQLV
                     DEAEVSRSTFFRAFPAKEAVAIEAETELWSNYLAALADRELSGPTLTALRDTLTRSTA
                     DLPEDWDQRYIATRRLVLTAPALMGHVDYYRSGVEKQAVTLIRGKLGLAADDLRPHIL
                     TELTTTAWSIAGRAWMYDDGKGGRAALLDGLHRAFAAIPAALELSA"
     gene            87419..88426
                     /locus_tag="NS506_00093"
     CDS             87419..88426
                     /locus_tag="NS506_00093"
                     /function="ATP-binding; Hydrolase; Mitochondrion;
                     Nucleotide-binding; Plasmid; Sulfate transport;
                     Transport."
                     /note="Part of the ABC transporter complex involved in
                     sulfate/thiosulfate import. Responsible for energy
                     coupling to the transport system (By similarity); Belongs
                     to the ABC transporter superfamily. Sulfate/tungstate
                     importer (TC 3. A. 1. 6) family; Contains 1 ABC
                     transporter domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Sulfate/thiosulfate import ATP-binding protein
                     cysA"
                     /protein_id="APA94180.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9G4F5"
                     /translation="MTSYTPAEALAIEADGRVKVFGEQRAVDGVSLAVPRGAVYGVLG
                     PNGAGKTTTIRMLATLLRPDGGSARIFGHDVVAEPTAVRSLIGVTGQYASVDEKLSAT
                     ENLIIFSRLLGLSKTEARRKSAELLEEFGLTEAADKALENFSGGMRRRLDLAASLISR
                     PPLLFLDEPTTGLDPRTRAQMWDTIRRLVREGSTVLLTTQYLDEADQLADRIAVIDRG
                     RVIADGTSDELKSSVGLSALQLTLAERDRIEEARDLVGEMLSRAAGRIVEATITPEAG
                     RITAPLPDPSITTDILIRLREHDIRVDEINVAKPSLDEVFFALTGHAAEDDTETERSA
                     A"
     gene            88423..89265
                     /locus_tag="NS506_00094"
     CDS             88423..89265
                     /locus_tag="NS506_00094"
                     /function="Antibiotic resistance; Cell membrane; Membrane;
                     Transmembrane; Transmembrane helix; Transport."
                     /note="Part of the ABC transporter complex DrrAB involved
                     in daunorubicin and doxorubicin resistance. Probably
                     responsible for the translocation of the substrate across
                     the membrane; Belongs to the ABC-2 integral membrane
                     protein family; Contains 1 ABC transmembrane type-2
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Daunorubicin/doxorubicin resistance ABC
                     transporter permease protein DrrB"
                     /protein_id="APA94181.1"
                     /db_xref="UniProtKB/Swiss-Prot:P32011"
                     /translation="MTTTLTAPATGRHAAAAAPIPEVSNHIPLKQTVANSLTMAYRGI
                     LKIKHNPEQLFDVTVQPILFTALFAYIFGGAIGGNVHDYLPILIPGILVQTVVLTSVV
                     TGTQLREDMDKGVFDRFKSLPIARISALAGALIADMVRYALATTLTMGMGLLLGYRPA
                     GGVMGVVVAGLVVVFCSFAVSWIWALVGITGKSAAAVQGISMMIMFPLTFMSGAFAQV
                     STMPGWLQGINKANPIYYMVNAARELMNGNVYSSNLAWSLVGSIVVIAIFAPLAVKAY
                     MRRA"
     gene            89335..89778
                     /locus_tag="NS506_00095"
     CDS             89335..89778
                     /locus_tag="NS506_00095"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94182.1"
                     /translation="MVGAVNPAPASLRRRSIRLYWGVLFTSVAIVMGLTAAIAGWGSS
                     QRISLLESNAPTAVTADYAQATPDSGRGQAVDLVPSCRKQERPASDPTGTLAVPPRAI
                     GDQLVADCFAIAPEFTTPQRFSLGKQPRAPTLPVAAPHLTAVLII"
     gene            89840..90598
                     /locus_tag="NS506_00096"
     CDS             89840..90598
                     /locus_tag="NS506_00096"
                     /function="Competence; Disulfide bond; Oxidoreductase;
                     Redox-active center; Signal."
                     /note="Required for the stabilization, possibly via
                     formation of a disulfide bond, of the obligatory
                     competence protein ComGC. May be required for the
                     stability of secreted proteins with disulfide bonds. Not
                     required for sporulation; Belongs to the thioredoxin
                     family. DsbA subfamily; Contains 1 thioredoxin domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Disulfide bond formation protein D"
                     /protein_id="APA94183.1"
                     /db_xref="UniProtKB/Swiss-Prot:O32218"
                     /translation="MSRKLKNSTARKSFAGLAIVAAIGLLVIAAIQMLGDDKKSDGSS
                     TAATETNPMYAELAKTAKRDADDPLALGRADAPVVMVEYSDFQCQFCKVFATKIEPQL
                     IADYVDKGVLRIEWRSMAIFGPESEDAARAAWAAGQQGKFWEYHRALFDNAPEKKNTG
                     VFTRDKLVELAGAAGVPDIAKFRADLESPAATAAVQANVNEGIGIGVNSTPAFLINGR
                     PILGTQPIEQFRAAIEAARATAGQPTGAAGKATE"
     gene            90595..91482
                     /locus_tag="NS506_00097"
     CDS             90595..91482
                     /locus_tag="NS506_00097"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94184.1"
                     /translation="MTGGIGFFAAFLGGLLALLSPCSALLLPSFFAYSFESQGKLLAR
                     TGLFYLGLCTTLIPLGAAGSLAGRLLVGQRELLIAIGGWTIIALGVVQILGRGFAFGF
                     AQRAAAKQGRPEQAGAVYLLGLVYGLAGFCAGPILGSILAVAAVGGSPVHGGLLLAVY
                     ALGLAAPLFVLASLWDRFDLGKRKWLRGRTFHLGRVELHTTSVLSGLFFIALGALFLV
                     FDGTAALPGILSADTEFAMENKVRQLGDLVSNTAVLLILAAVALGVLAWRMLRTGPTE
                     PDQPGPHSPHTEDDRVETR"
     gene            complement(91516..95190)
                     /locus_tag="NS506_00098"
     CDS             complement(91516..95190)
                     /locus_tag="NS506_00098"
                     /EC_number="2.7.11.1"
                     /function="Activator; Antibiotic biosynthesis;
                     ATP-binding; DNA-binding; Nucleotide-binding;
                     Phosphoprotein; Pigment; Repeat; TPR repeat;
                     Transcription; Transcription regulation; Two-component
                     regulatory system."
                     /note="Global regulatory protein for secondary metabolite
                     formation. Belongs to the AfsR/DnrI/RedD regulatory
                     family; Contains 1 NB-ARC domain; Contains 1
                     OmpR/PhoB-type DNA-binding domain; Contains 3 TPR repeats;
                     KEGG: ret:RHE_PF00532 non-specific serine/threonine
                     protein kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="Non-specific serine/threonine protein kinase"
                     /protein_id="APA94185.1"
                     /db_xref="UniProtKB/Swiss-Prot:P25941"
                     /translation="MADVGDSTLVALLGEIALRRDGVLTAVPGARARLLVAALATHPG
                     RSRGAQALIDDVWGADPPRAPMNALHTQVSRLRSALPEGTLEIGPAGYRLVLAPEQVD
                     LALAQQLERQARQAHSAGDDRACLDLLSAARALWRGDPAADLPPGPVAEELATLAATR
                     RRALDVLELSAREAVGDLPAAIELAQHAVTADQFDEPAHATLMRLLAAAGRTNEALDV
                     FATLRTRLVDHLGADPGPALVALNTAILRGEPLPGPGGARGAGPTASPSDSGVARGYS
                     AAFTESGTADGAAGLPVNGGVSGRPDAAAGPARRGLSGVPGAGPAGWGGLGPADSSYP
                     VETASIDGRPYVISEAPGARGELSAAGRSPGSGDAGRVRSPGRVAGSAGMAGAAEARE
                     LLSENAIGLRAAPNPLLGRESDLAALEASLRSSRVVTVLGPGGTGKTRIANELGARLA
                     HENAVALVELASLRTDSDSAADTRLEIETAIAATLGVADIMRDPAILRPIHGRDIRQK
                     LREALAVRPTLLILDNCEHLIEPVAEVVADLVGVSNQLTVLTTSRAPLEITAETVYPL
                     PPLTIDAAGSPATDLFEARARAVRPSVRLDPEVVARLCRTLDGLPLAIELAAARVRTM
                     SVEEIDSRLDHRFALLRSGDRSSPQRHRTLHAVIEWSWNLLDESQRSALRRLCRFPAG
                     FTLPAAECLLAGPEIDDPATAVDGLVSQSLLTVLEDETGGTRYRMLETVREFGEEQLR
                     HTGEADLIMTRMSKWARDFALETARRYHTPEQVSVVLGVGAEMDNLIAVLRSALDRRD
                     VGTVHTVFPVLAGLWLQRGAHSELIGWLPRVLALPPDTFPSDPAETDLYIYGQLMIGL
                     HLTFGGTDMRPVARVRATLRRILASGAPMRPAARYVAELATRPRNTTQLGRMLSAGIR
                     SPEEQIQIAALLLRANLCENNGIVYRSIKDAEMAMRISGDGDAWGTTMTAQHLGSMYG
                     QSARYAEAVGYYRRAVDTVEELRAWDEAAEMRSFLAITLAGTGQPAAARQALEPALAV
                     IGELPVDAPVTRPNHRMAAVVAALAEIALVEGNIDTGLRRFQQLPALMDWPNDIGTPG
                     PATLIYVSATIDAHVLHRRADQVGRITSELVENVVGVLGEQFWDLPQIGAMSCAVGTH
                     LLATGCDLERGLELIVLAQRVFGRQDYPVMQWRRHLDLHRPLLGPERIAAAQAAVAGL
                     GRRPAADRIREHFRALAGPR"
     gene            95415..95870
                     /locus_tag="NS506_00099"
     CDS             95415..95870
                     /locus_tag="NS506_00099"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94186.1"
                     /translation="MAEFDIHRETVIKADPTQVQALIDDFHQWRKWSPWEDTDPAMER
                     VYSGADRGIGARYFWNGNRKAGRGDMEITSATSEEIGIQLHFEKPFKATNRVTFEFRP
                     EGDTTAVTWRMTGRQNSIMGIVGRLIPMDRLVGKDFEKGLAQLKATAEA"
     gene            95952..96824
                     /gene="menA"
                     /locus_tag="NS506_00100"
     CDS             95952..96824
                     /gene="menA"
                     /locus_tag="NS506_00100"
                     /EC_number="2.5.1.74"
                     /EC_number="2.5.1.-"
                     /function="Cell membrane; Membrane; Menaquinone
                     biosynthesis; Transferase; Transmembrane; Transmembrane
                     helix."
                     /note="Conversion of 1,4-dihydroxy-2-naphthoate (DHNA) to
                     demethylmenaquinone (DMK); Belongs to the MenA family.
                     Type 1 subfamily; KEGG: nfa:nfa51470
                     1,4-dihydroxy-2-naphthoate octaprenyltransferase;
                     1,4-dihydroxy-2-naphthoate polyprenyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoate
                     octaprenyltransferase"
                     /protein_id="APA94187.1"
                     /db_xref="UniProtKB/Swiss-Prot:P65651"
                     /translation="MATAAQWIEGARPRTLPNAIAPVLAGTGAAASIGGFVWWKAVLC
                     LLLSVALIIGVNYANDYSDGIRGTDDERVGPLRLVGSKLAAPAAVRNAAVACLAIGAV
                     LGLVLAVTSAWWLILVGAGCLAGAWFYTGGRNPYGYSGFGEIAVFVFFGLVAVLGTEF
                     VQAARVDWAGLVCAVSVGCFSSAVLVTNNLRDIPTDTESGKMTLAVRLGDKRTRTLHL
                     VLILIPFWALALLVWRSPWTLAALVALPLAIRANEPVRTGKNGPGLIPALAGTGQAML
                     AWSVVVAIALAVSA"
     gene            complement(96848..97258)
                     /locus_tag="NS506_00101"
     CDS             complement(96848..97258)
                     /locus_tag="NS506_00101"
                     /function="Cell membrane; Membrane; Transmembrane;
                     Transmembrane helix."
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94188.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q53868"
                     /translation="MVISPYDRGMTLLIRLLINGVAIWLASVWLHNDIQIKTPEDTTQ
                     SKILVIAAITVVFAVVNALVKPIVKFLSFPFIVVSLGLFLLVINALMLWLTAKITETT
                     QYGLRVEGFWAAVLGGIIITLVNWVLGVLVPDED"
     gene            complement(97294..97884)
                     /locus_tag="NS506_00102"
     CDS             complement(97294..97884)
                     /locus_tag="NS506_00102"
                     /function="ATP-binding; Chaperone; Nucleotide-binding;
                     Repeat."
                     /note="ATP-dependent specificity component of the Clp
                     protease. It directs the protease to specific substrates.
                     Can perform chaperone functions in the absence of ClpP (By
                     similarity). Degrades anti-sigma-E factor RseA in the
                     presence of ClpP2 (Probable); Belongs to the ClpA/ClpB
                     family. ClpC subfamily; Contains 1 UVR domain"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ATP-binding subunit
                     ClpC1"
                     /protein_id="APA94189.1"
                     /db_xref="UniProtKB/Swiss-Prot:A0R574"
                     /translation="MFERFDKAAKYAIVTAQEEARDLCSSTIEVEHVLLGLLGCPDPG
                     LREILAAHGLTAEGVRDAVARKRSGEPLGAEDAEALRSIGIDLDAVRESLEATFGENA
                     LERVDVPEEKSRWGKYWGSEGGPRGHIPFTRESKKVVELSLREALARKDDRIEAAHLM
                     LAVLRAPNDVTRRLLGDDDAMRTLREGVTDYLDRAA"
     gene            complement(97884..98105)
                     /locus_tag="NS506_00103"
     CDS             complement(97884..98105)
                     /locus_tag="NS506_00103"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94190.1"
                     /translation="MSEATTLAAAAGSPDPQVGLRAVLALRRLLERLEAIQVTNARKQ
                     GWSWQAIADALEVSRQAVHQKYNRKGGIR"
     gene            complement(98250..98534)
                     /locus_tag="NS506_00104"
     CDS             complement(98250..98534)
                     /locus_tag="NS506_00104"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94191.1"
                     /translation="MGQQPRPVLDVNVTVGPWVISTQRGLPAESARVAAGKAWEPVAF
                     GLYRDRDGDIWEKDLRGWRLCLQDGIPVDPDTVWDWTDSVREFAPFIPWS"
     gene            98676..99560
                     /locus_tag="NS506_00105"
     CDS             98676..99560
                     /locus_tag="NS506_00105"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94192.1"
                     /translation="MDGVPTFGEYIRRRRTTANLTRPQLAWLANLSAPYLTKIEGGAN
                     PSRRVIESLGTALKLPPAEFEYALVLAEGPLPRIEADHPTPADQEYLDLLEPALGAYV
                     TELWDIIAVNAAHREAFLELEPGTNYLEWLIFNPISRTVMVNWESETRMAASRFRLQL
                     ARSGEDERGGQILEKCLADSDFALLWRSDAVASERADLVKLVRNPRTLAITEMRINLW
                     RTQSSLQSWLLVLGTTVDQPTAVTRPVARRRPETSRAINASQGQKNRPVRPEHAVQAN
                     DKTSTKPLQQIDGNLVDG"
     gene            complement(99599..100684)
                     /gene="cysK"
                     /locus_tag="NS506_00106"
     CDS             complement(99599..100684)
                     /gene="cysK"
                     /locus_tag="NS506_00106"
                     /EC_number="2.5.1.47"
                     /function="Amino-acid biosynthesis; Cysteine biosynthesis;
                     Pyridoxal phosphate; Transferase."
                     /note="Belongs to the cysteine synthase/cystathionine
                     beta- synthase family; KEGG: rpy:Y013_09270 cysteine
                     synthase A"
                     /codon_start=1
                     /transl_table=11
                     /product="Cysteine synthase"
                     /protein_id="APA94193.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q5XAQ3"
                     /translation="MNRCDRSAPRDWVDNAVRLIDADTQRSADTHLLQYPLPSEWGVQ
                     LYLKDESTHPTGSLKHRLARSLFLYAICNGWVTEGTTVVEASSGSTAISEAYFARMLG
                     LDFVAVVPAKTSPEKLALIEAQGGRCHLVDRAPDIYAEAARLAAETDGHYMDQFTNAE
                     RATDWRGNNNIAESIFQQMTLEAHPVPEWVVVGAGTGGTSATIGRYLRYKRHATRLAV
                     VDPENSAFYGGYEVADLGYQTGMPSRIEGIGRPRVEPSFVPSVVDCMIEVPDAASVAT
                     ARHAGEVLGRRVGGSTGTNLWGAFALIADMIAADRTGSVVTLLCDGGDRYAGTYFNDD
                     WVADQGLSLSEPAAVLAEFIATGTWSG"
     gene            complement(100681..101067)
                     /locus_tag="NS506_00107"
     CDS             complement(100681..101067)
                     /locus_tag="NS506_00107"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94194.1"
                     /translation="MQRTSSDLRARVTGEHRDRVTYAVSVSDATPSRSAGRSLARNLA
                     LYTVARLGLVAVIAAVIVGVAALVKVSIPIVVALLFALLIAMPLSLVLFKKLRAQVNR
                     DIAAVDAKRRKDRDQLMSRLQGKDEQ"
     gene            101218..101451
                     /locus_tag="NS506_00108"
     CDS             101218..101451
                     /locus_tag="NS506_00108"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94195.1"
                     /translation="MTAFTAPSRALGSVSGQDTLLTPGQVAALFHVDPKTVTRWAHAG
                     RLGSLRTPGGHRRFRESEVMQLLRSLTTEATRV"
     gene            101523..101711
                     /locus_tag="NS506_00109"
     CDS             101523..101711
                     /locus_tag="NS506_00109"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94196.1"
                     /translation="MTYLLALIAVVAVAMLCWKAFGPQRSAGTGPAPARRNRVIGPED
                     DPDFLAKLSREHRDGEST"
     gene            101899..102993
                     /locus_tag="NS506_00110"
     CDS             101899..102993
                     /locus_tag="NS506_00110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94197.1"
                     /translation="MSRIGGRFARSEPRERVREYVSGLLAGLERKNGWTLAERAGETG
                     PQGMQRLLRAADWDVEAVRDDVRDYVVERLGDPEAVLAGDETGFLKKGVKSAGVQRQY
                     SGTAGRTENCQIGVFLAYASTHGHALIDRELYVPQSWTSDRERCREAGIPDEVAFATK
                     PRQMIAMLERAVAAKVPFRWFTADEAYGQAGYLREWCEDHDVFYVLATRCDQQVATRA
                     DRIARADELVGEFTASTWQRFSVGAGAHGPREYDWARRQIEGRWASGRGHWLLARRSI
                     AKPTEIAYYLCYGPATARLVDLAWTAGSRWHVEEAFQQAKGEAGLDHYQVRNWRAWYA
                     HITLSMLALAWLAASKAVAAKGDSPIPAKA"
     gene            complement(103761..105089)
                     /locus_tag="NS506_00111"
     CDS             complement(103761..105089)
                     /locus_tag="NS506_00111"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94198.1"
                     /translation="MLQPCTLPVALTRVLFPLRKCFTAPTFTTFTMLVAGLFAQPATR
                     TVCGMLTGAGLARVWHHTRAHRFFSAARWDPAQLGLVVAELIVAQLLPPGSAITVAVD
                     DTLCRRRGKRVHAAGWFHDGSAAGRAKLGFGNNWIVLAIVVRLPFTSRPVALPVAAAL
                     FVKGGPAKPDLAREMLDALAERFADRAIHLVADSAYGCGAFAGLGEAMTMTTRAKTNA
                     VFYAPAPPRTGKRGRPALKGDRIGTPAELAVTGGWTPVTVTRYGVTGQVRVIERVCLW
                     FGTWRTDPVRVILVEDPSRSTKTGKSQRYSIALITTDLTSPAAEIIARYADRWAIEVT
                     FFDAKNILGVGQARNRVAHAVTRTVPFGLFAHSILVLWYAAAGHDDNDAALRRIAAPW
                     YRTKTEPSTLDMLVKLRRQLIAARFIPESPRPATTQEIMEVQLAWAQAAA"
     gene            complement(105709..106137)
                     /locus_tag="NS506_00112"
     CDS             complement(105709..106137)
                     /locus_tag="NS506_00112"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94199.1"
                     /translation="MNGSNSLVSCSLASIGRGSSKVGDTTTGTVKFSPSFSRNSGVGR
                     NRPGGYWIASTAPEAAQHAIIAARPVADIAWVALATDGVTDLIDALKVDWQEIGSMDS
                     AKLSALLARIHRWEYEVDPDGILVPRSKRHDDKAIAVVRL"
     gene            complement(106516..107193)
                     /locus_tag="NS506_00113"
     CDS             complement(106516..107193)
                     /locus_tag="NS506_00113"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94200.1"
                     /translation="MNYTEIAAELGITKGRITQIRTSAPPPERAFFGVGPVAVGIPRR
                     YGFEEGRERSFFDAADTAAQAAMEATLGRLSLVSTKFAIEPDCEVVPEGDAVVICGPK
                     SAPVARTLLAGDPYLDFLQAEDRWWITDSRDGRRFDSPYRRPDSTIQSDVGYFGRHVI
                     GNRIVLHVAGIMSVGSLGVCQWIESNIAKLYDGNETHSISGVVHCDFDDNFAIVDTRL
                     IAGPYLW"
     gene            107605..108153
                     /locus_tag="NS506_00114"
     CDS             107605..108153
                     /locus_tag="NS506_00114"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94201.1"
                     /translation="MSIVVDQPRSSETGTVTPNVRLAVVMGGLRLTNHGLARRMRDAS
                     QLDGGKPLATSNTNIAKYLAGQHTPTPRVCQVMLNVLGQLANHHLTPADIGFPNVRLE
                     LDPRVSDLSGISFPPRFTFAGVCIWCHRRGCNDQRCRDRHRGAQWAICSLCDGAAIEC
                     TCTFGMIAITTSLTATIGEVTR"
     gene            108150..108695
                     /locus_tag="NS506_00115"
     CDS             108150..108695
                     /locus_tag="NS506_00115"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94202.1"
                     /translation="MTTVETTAGTWTPNTTLASVTSELGLSNKGFARLMREVSRQDGG
                     AAVSPDGSSLARYKSGEHQPSTRTLQVMVKVLEQITGHQFSTDELGYPDRDLTLPAIV
                     HRPHTLSSMFFPSRLTFAGVCIWCQRRGCTAVECIEEHRASRWLVCPICDGTAIGCEC
                     TFGMILTEPAASTKPDLKVVR"
     gene            108695..109435
                     /locus_tag="NS506_00116"
     CDS             108695..109435
                     /locus_tag="NS506_00116"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94203.1"
                     /translation="MKEVKGIRLQGYDSLWHEWLSQMYGVPVALISRMTGMRTDRVYR
                     MIKRWHLTEMCRVARVDYNMPGPWRRSSYDAPDAENSGPLWVWPDRESAWGMLDFDPG
                     DWEPKASTAAHLTAVAHLRYAINGLNTDPDIWTSERILRRRMEPGSHIHDGWLLDEHD
                     RDQIWGIEVELSRKREKGRLVATMAAALDSADQHDLAGVLYYVRGADLRRAVQRAAQT
                     LARERGQIQLSNLHVHDLDVILAGHEVP"
     gene            109435..109857
                     /locus_tag="NS506_00117"
     CDS             109435..109857
                     /locus_tag="NS506_00117"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94204.1"
                     /translation="MTMNLRLREALMAAHLTPETAATLLQVDPKTIERWISSGRTPFP
                     RHRYAMAALVGVSESDLWPEAGTLKPLRFSFAGICIWCDQRGCTDTECILRHEAARWE
                     ICPLCGGAPWTRPGSTCGCLNGLVQAVMTKFALPKAVA"
     gene            109857..110057
                     /locus_tag="NS506_00118"
     CDS             109857..110057
                     /locus_tag="NS506_00118"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94205.1"
                     /translation="MDHDRYLTAKDCEELTGIPESTWRYWAHIGSGPTSFKLGRRRVW
                     RESVILAWIAEQEAATSSDGAA"
     gene            110355..111194
                     /locus_tag="NS506_00119"
     CDS             110355..111194
                     /locus_tag="NS506_00119"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94206.1"
                     /translation="MPSTGILAKWHVKKIKAEFGDLKLSAVRPSAVKAWTAKLKAEGL
                     ADSYVYSLHSRLSQIFSDAVHDNLLSRNPCSRRTSPNAGHQKIYVATTEQIWALYEAM
                     PEHLRVAILLGAFVGLRISEAAALRIDEVDLEDGMVYPQRQWPDRPLKTKASDTPVPI
                     PQELTSLLKVAIRGRTGGHVVSDELAKPVSPWVIGWHVRSVRADIPGLPKGFSFQDLR
                     HFYASLLIRQGADIKTVQARVRHGSAVTTLRYYAHLWPDADATTRTAVATVLREHFGG
                     TAY"
     gene            complement(111265..112257)
                     /locus_tag="NS506_00120"
     CDS             complement(111265..112257)
                     /locus_tag="NS506_00120"
                     /function="Cytochrome c-type biogenesis; Membrane;
                     Thylakoid; Transmembrane; Transmembrane helix."
                     /note="Required during biogenesis of c-type cytochromes
                     (cytochrome c6 and cytochrome f) at the step of heme
                     attachment; Belongs to the CcmF/CycK/Ccl1/NrfE/CcsA
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytochrome c bioproteinis protein CcsA"
                     /protein_id="APA94207.1"
                     /db_xref="UniProtKB/Swiss-Prot:A3PCH3"
                     /translation="MPIDETIASYSDLGFKSAIVIYALVWIMLVWQFALTRTVPTTAR
                     RLVTVGGGSDTAGPAEPRADVPGKVAPRGAERPFPERLGNMAFAVLYVGFGVHAASIV
                     LRGFATHRFPLGNMFEFISMATAAAVGLGLVLLRDQRYRGMWSFLLTPVLILLFLAGT
                     KLHVDAAPVVPALKSYWLPVHVTVVSIGSGVFLVSGVASLLFLYRIWQPAGAESDNIF
                     GQLARLLPDAQLLDRLAYRTTIIGFPIFGAGVILGAIWAEAAWGRFWGWDPKETCSFI
                     AWVLYAAYLHARATSGWRDTKAAWINIAGFVAMLFNLFIINIVVSGLHSYAGLN"
     gene            complement(112257..113876)
                     /locus_tag="NS506_00121"
     CDS             complement(112257..113876)
                     /locus_tag="NS506_00121"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94208.1"
                     /translation="MTATIETPSAPALPPRQSPVRRLLALLRNAWRGLTSMRTALMLL
                     FLLALAAIPGALLPQRSLNAGKVDDYIRNRPTLGPWMDRLQLFDVFSSAWFTAVYVLL
                     FVSLVGCILPRCLDHYRALRTPPVKAPRNLSRLPHHYSGSDAATPEQAIERARAQMRG
                     WRTVVQPGNREGELTLSAEKGYTRELGNLVFHLALVGLLAAVAIGKLFGYEGNVVVLA
                     NDGPGFCTTSPAVFDSFRAGNVNDGTGLTPMCVRVKDFKADYLPNGQASMFTSNIRYQ
                     TGKDLNSDPWRDTTIQVNHPLRVAGDRVYLQGHGFAPKFTVTFPNGQTRTEAIQWKPD
                     DATTFLSSGVLRIDPPGGMYPSEEERRKHQVAIQGLFAPTALMHGQLLTSRYPAMKDP
                     AVAIDIYQGDTGLDTGRAQSLFALDPEMIKQGRLVKQQRVNLKPGESATLADGTKVTF
                     DGAEEFVNLQVSHDPAQQWVLVSALTMMAGLLVSLLVKRRRIWLRVYPGAETDGVRRT
                     VVEMGGLARTDQAGWGGEFDRLRERLLTGEK"
     gene            complement(113878..114711)
                     /locus_tag="NS506_00122"
     CDS             complement(113878..114711)
                     /locus_tag="NS506_00122"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94209.1"
                     /translation="MNHVTVLASVGDSFQQTAATGPLLLALGACLLAGLVSFASPCVV
                     PLVPGYLSYLAGVVGAEAPPVTVESAKSAKTAVANRNSARLRVAGAAGLFVAGFTVVF
                     VLASATVFGAIQALNVNRDLLQRIGGVVTIVMGLAFIGLIPALQRDTRMEPRRLSGLI
                     GAPLLGAVFALGWTPCLGPTLSGVMAVSAGTEGTTAVRGVALIVAYCLGLGLPFVILA
                     FGSATALRGVGWLRRNSRTIQVIGGLLLVAVGIALVTGAWDQFVSWVRDAFVSDVTLP
                     I"
     gene            complement(114708..115364)
                     /locus_tag="NS506_00123"
     CDS             complement(114708..115364)
                     /locus_tag="NS506_00123"
                     /function="Cell membrane; Cytochrome c-type biogenesis;
                     Disulfide bond; Membrane; Redox-active center;
                     Transmembrane; Transmembrane helix."
                     /note="Involved in cytochrome aa3 assembly. Belongs to the
                     thioredoxin family; Contains 1 thioredoxin domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Thiol:disulfide interchange protein TlpA"
                     /protein_id="APA94210.1"
                     /db_xref="UniProtKB/Swiss-Prot:P43221"
                     /translation="MRPAIVSESRPASPSRPARPFRRAVALLAGLCAAAVLAGCSTAG
                     KDAVAQGGTFDFVSPGGKTEIFYDPPSSRGTIGKLSGPDLMHDGKTTSVDDFPGKVVV
                     INIWGQWCGPCRAEAPALEQVYQASKDKGVAFLGINVRDNQKDKAQDFVTDNKVGYPS
                     IYDPSMRSLLALGGKFPTSVIPTTIVLDKQHRVAAVFLRALLAEDLQPVVDKLAQEQS
                     "
     gene            complement(115361..116968)
                     /locus_tag="NS506_00124"
     CDS             complement(115361..116968)
                     /locus_tag="NS506_00124"
                     /function="Cell wall; Glycoprotein; Peptidoglycan-anchor;
                     Secreted; Signal."
                     /note="Plays a role in virulence and host-pathogen
                     interactions. Mediates binding to human platelets via
                     interaction with the human cell surface glycoprotein
                     GP1BA; Belongs to the SraP family"
                     /codon_start=1
                     /transl_table=11
                     /product="Platelet binding protein GspB"
                     /protein_id="APA94211.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q939N5"
                     /translation="MSSAHPDSGLPAPAPHEAPLSAAEATRLLDSIRQAEHDLAVTGE
                     HIAVSPATESAATTPESDNSDAATEAEPAAQPAAAPAVNKAATAAPESAATTAAESAP
                     QTQVPGESGVAASAPSEIATGTADSLGGESATGVESATEGESATEGESADSVVAGAAA
                     VAAEFVADESASDVPIAAENASGAAESDESGVSGSAAGDFTAQAAEHGAEGVPVSSAA
                     EVFAAVAGAADEFAAGGNGSLAGVSEFVESAGFTAEVVVEVDPAADEAGESGAAQLIA
                     DNAADADGAADADGAADADADADAEDAADAGDEVVESNIAASGLILPGDVASDVETIV
                     HVLRHGEVHNPKGILYGRLSGFQLSVTGRAQAQAVARSLVDHDIALVVASPLQRAQET
                     ADPIAIGHGLTIRTDENLIEAGNTFEGLTVSPKALRKPRHWWKLRDPFTPSWGEPYLQ
                     IAHRMLAAVNKARVEAAGREAVLVSHQLPVWTLRRFLQGQRLWHDPRNRQCSLASLTS
                     LVYQGDTLIDIVYSEPAGASDPSVTGA"
     gene            complement(116965..118302)
                     /gene="hemL"
                     /locus_tag="NS506_00125"
     CDS             complement(116965..118302)
                     /gene="hemL"
                     /locus_tag="NS506_00125"
                     /EC_number="5.4.3.8"
                     /function="Cytoplasm; Isomerase; Porphyrin biosynthesis;
                     Pyridoxal phosphate."
                     /note="Belongs to the class-III
                     pyridoxal-phosphate-dependent aminotransferase family.
                     HemL subfamily; KEGG: nno:NONO_c70200
                     glutamate-1-semialdehyde 2,1-aminomutase"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutamate-1-semialdehyde 2,1-aminomutase"
                     /protein_id="APA94212.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q6MAC7"
                     /translation="MSSSPRVSQVSVPVSAQLFERAAAVIPGGVNSPVRAFKSVGGTP
                     RFIASARGCTLTDADGNEYVDLVCSWGPMILGHAHPAVVEAVQRAATGGLSFGAPTEA
                     EIELAETIAGRVAPVERVRLVNSGTEATMSAVRLARGFTGRGKIVKFSGCYHGHVDAL
                     LADAGSGVATLGLPTSPGVTGAQAADTIVLPYNDLEAVAAAFAANPGRIACVITEAAA
                     GNMGAVAPRPGFNEGLRKLTAENGALLIMDEVMTGFRVSHSGWFGLDGVAGDLYTFGK
                     VMSGGLPAAAFGGRADIMNHLAPMGPVYQAGTLSGNPVAVAAGLATLRAADEQVYATL
                     NKNAERLGALMTEALTAEGVGHHVQFAGNMVSVFFAENPVTDYAAAKASETWRFPAFF
                     HALLDAGVYAPPSAFEAWFVSAALDENAFDRIAAALPAAARAAAAATPEGSAA"
     gene            118666..119049
                     /locus_tag="NS506_00126"
     CDS             118666..119049
                     /locus_tag="NS506_00126"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94213.1"
                     /translation="MRVVLFGVGIAAITAGAVAAGGAASAGVPFAQIDQGRVGVALSH
                     DETVAIADGPIPAVISMFVPLSRMGAGLQPDTSIYKDDKGGVHASLRQVIMEAGDHPD
                     GSVVVFFNAPGTRGGRVLDIYQNWG"
     gene            complement(119167..119472)
                     /locus_tag="NS506_00127"
     CDS             complement(119167..119472)
                     /locus_tag="NS506_00127"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94214.1"
                     /translation="MSGRHSGGGGAKSSFVLGGFVRGRKIVFMKRIDLVKRIAATVLA
                     TGVVGAVAVAPAAAASVDAVPDLRAQPVASWEDLLPPQLNCLISTGWAVFCLGIPLS"
     gene            complement(119507..119764)
                     /locus_tag="NS506_00128"
     CDS             complement(119507..119764)
                     /locus_tag="NS506_00128"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94215.1"
                     /translation="MRWPTVFAEFVLVPVLVVAAVWCWRNGIQTTVFKPQGEAPTFGA
                     TRYVGPWLAGSAVFTIGAGLLFIDVVARAFSPSRGQRGRER"
     gene            complement(119764..120276)
                     /locus_tag="NS506_00129"
     CDS             complement(119764..120276)
                     /locus_tag="NS506_00129"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94216.1"
                     /translation="MSEAINAPGSVLFSEPGARWRAIAYGPALCTIILVIEVIRGGAI
                     HWFGLAFCALLLAGFVWLQVVAGRRHISVELTPESLREGTEVTSLRDIAEVLPEEDEE
                     SWDYEDWQSARALGELSGVPRRRRGFGLKLKDGRLVQAWARDHLTLRAELTAALERLN
                     GGTVEEKEAR"
     gene            complement(120305..120424)
                     /locus_tag="NS506_00130"
     CDS             complement(120305..120424)
                     /locus_tag="NS506_00130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94217.1"
                     /translation="MRVVIQQPHSLRRDVLVLSLLFLFGLLTLAVLLIPGLAR"
     gene            complement(120556..121059)
                     /locus_tag="NS506_00131"
     CDS             complement(120556..121059)
                     /locus_tag="NS506_00131"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94218.1"
                     /translation="MVPPGVSRPSPEDVRTACQLWYAALGVGVVQLVATLVAQYGQRH
                     ELAQQMFDQVKAQQPAVTLAQVQTWTVIVFFLVAVFWLVLTGAAVGVVYQLGRGKAWA
                     RALLTGFGVFLVLGAAGTLFGIGVKHSAAALVAGGANIVEAVLAGGAVFLCYRSESEA
                     YFRPGAQ"
     gene            complement(121091..122023)
                     /gene="hemB"
                     /locus_tag="NS506_00132"
     CDS             complement(121091..122023)
                     /gene="hemB"
                     /locus_tag="NS506_00132"
                     /EC_number="4.2.1.24"
                     /function="Heme biosynthesis; Lyase; Magnesium;
                     Metal-binding; Porphyrin biosynthesis; Zinc."
                     /note="Catalyzes an early step in the biosynthesis of
                     tetrapyrroles. Binds two molecules of 5-aminolevulinate
                     per subunit, each at a distinct site, and catalyzes their
                     condensation to form porphobilinogen (By similarity);
                     Belongs to the ALAD family; KEGG: gni:GNIT_0516
                     porphobilinogen synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="Porphobilinogen synthase"
                     /protein_id="APA94219.1"
                     /db_xref="UniProtKB/Swiss-Prot:O67876"
                     /translation="MRRLVAETSLEPRQLILPMFVADGLDEPREISSMPGVFQHTMDS
                     LRKAAVEAVAAGVGGLMLFGVPKAEDKDAQGSGASDPDGILNRGLRALVHEVGGSTVV
                     MADTCLDEFTDHGHCGVLDDDGAVDNDATLTRYVEMALAQAETGADLLGTSGMMDGQV
                     GAIREGLDAAGYADTGILAYAAKYASAFYGPFREAVGSSLQGDRRTYQQDPANRREAI
                     RELELDLLEGADIVMVKPAMSYLDILREVADRSTVPVAAYQISGEYAMITAAAQRGWI
                     DRKGAVLESLLGIRRAGADMVLTYWATEAAHWLR"
     gene            122268..122588
                     /locus_tag="NS506_00133"
     CDS             122268..122588
                     /locus_tag="NS506_00133"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94220.1"
                     /translation="MLAAVTSMSDKRNKPAGVPKKGDVIDHAWMPLAKQPLPAGRPRT
                     WYISHNRRLKAMRLAIALLDSGAFSPDQATNETIRETAEVIGVHWPSDATCRMVRRLM
                     AAQR"
     gene            complement(122665..122928)
                     /locus_tag="NS506_00134"
     CDS             complement(122665..122928)
                     /locus_tag="NS506_00134"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94221.1"
                     /translation="MKRTAIGLLAMTTIALGAGLSPAAASAPEQDSVAAAVADNPGVG
                     SSGSSGSDAVRFVPILINTIVKCLTAGSGGIVSPGSTQTGCLN"
     gene            complement(123330..124892)
                     /locus_tag="NS506_00135"
     CDS             complement(123330..124892)
                     /locus_tag="NS506_00135"
                     /EC_number="2.1.1.107"
                     /EC_number="4.2.1.75"
                     /function="Methyltransferase; Porphyrin biosynthesis;
                     S-adenosyl-L-methionine; Transferase."
                     /note="Belongs to the precorrin methyltransferase family;
                     KEGG: nfa:nfa51680 uroporphyrinogen III methyltransferase
                     / synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="Uroporphyrinogen-III C-methyltransferase"
                     /protein_id="APA94222.1"
                     /db_xref="UniProtKB/Swiss-Prot:P42437"
                     /translation="MSRVTKKNPGRILFVGSGPGDPALLTVRAREVIGRATLAFTDPD
                     VDKGVLALIGTAVEESPDGTRPVDVRPALGDAAEVAKTLIAEARNGFDVVRLVSGDPM
                     TTDSVIHEINAVTRSHLNFEVLPGLSAGTTVPAYAGIEIGSSHTEVDVRGEVDWAAVA
                     GAPGPLVLHATSGHLAETASALVEHGLAPQTPVAVTVRGTTRQQRTIDATLATLNNAA
                     SELVGSLVVTVGKEVDKRAKTSWWESRALYGWTVLVPRTKEQAGEMSEKLVNHGAIPM
                     EVPTIAVEPPRSPAQMERAVKGLVDGRYQWVVFTSTNAVRAVWEKFGEFGLDARAFSG
                     VKIACVGEATAEKVRSFGINPELVPSGEQSSEGLLADFPPYDDVFDPVNRVLLPRADI
                     ATETLAEGLRDRGWEIDDVTAYRTVRASPPPAETREMIKTGGFDAVLFTSSSTVRNLV
                     GIAGKPHARTIVACIGPKTAETAIEFGLRVDVQPEVAQVGPLVEALAEHAAHLRAEGL
                     LPPPRKKSRRSR"
     gene            complement(124889..125959)
                     /gene="hemC"
                     /locus_tag="NS506_00136"
     CDS             complement(124889..125959)
                     /gene="hemC"
                     /locus_tag="NS506_00136"
                     /EC_number="2.5.1.61"
                     /function="Porphyrin biosynthesis; Transferase."
                     /note="Tetrapolymerization of the monopyrrole PBG into the
                     hydroxymethylbilane pre-uroporphyrinogen in several
                     discrete steps; Belongs to the HMBS family; KEGG:
                     nbr:O3I_038840 hydroxymethylbilane synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="Hydroxymethylbilane synthase"
                     /protein_id="APA94223.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q5YP70"
                     /translation="MTGAMVHENETTVRGTVDSPWRIGTRGSLLALTQAGHVRDALIA
                     NGQQAELVIVKTAGDRNATDPVQKIGVGVFTAALREELAAGTVDIAVHSYKDLPTAQD
                     PLFDIAAIPGRQDPRDALVARDGLVLGELPAGAKVGTSAPRRSAQLKALGLGIEIVPL
                     RGNLDTRISKVVNGELDAVVVARAGLARIDRLDAVTESLEPVQMLPAPAQGALAVECR
                     SADTELVTILSALDDPGTRAAITAERMLLAELEAGCTAPIGALAEVVESLDDDGRVVE
                     ELSLRACAAAIDGSDVIRASVVGPVADAEELGRALARELLELGARELLSVTEGSNNEE
                     SNNVESAELTDDSNPSPMENQR"
     gene            complement(125956..127344)
                     /gene="hemA"
                     /locus_tag="NS506_00137"
     CDS             complement(125956..127344)
                     /gene="hemA"
                     /locus_tag="NS506_00137"
                     /EC_number="1.2.1.70"
                     /function="NADP; Oxidoreductase; Porphyrin biosynthesis."
                     /note="Catalyzes the NADPH-dependent reduction of
                     glutamyl- tRNA(Glu) to glutamate 1-semialdehyde (GSA);
                     Belongs to the glutamyl-tRNA reductase family; KEGG:
                     hpr:PARA_19220 glutamyl-tRNA reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutamyl-tRNA reductase"
                     /protein_id="APA94224.1"
                     /db_xref="UniProtKB/Swiss-Prot:A1SE01"
                     /translation="MSVLLVGISHRSAPVAVLEKVAITETDRPKLTDKMLASSHVSEA
                     MIVSTCNRIEVYAVVDAFHPALGEIGELLTRHSGLPLPELTKHAYVRYAEAAAEHLFA
                     VASGLDSMVVGEQQIRSQIRAAYAASDAQQASGRTLHELAQHALRVGKRVHSETGIDR
                     AGASVVSVALDRAAAVQGPLAGRTALVLGAGAMGGLAVAQLARGGAAKVIVVNRTLEK
                     AQRLANTATTMHGVAAEAIEIDRLDEAMASAEVVVTCTGAVGTVVTLADVHRALSAKA
                     GARELVICDLGLPRDVDHAVAGLPGVTVIDMETLQRDPSAGAAADDTAAARTIVADEL
                     SKYLAGQRMAEVTPTVAALRQMAADVVEAELLRLDSRLPGLESTERDEVARTVRRVVD
                     KLLHAPTVRVKQLASTPGGDSYAEALRELFELKPGAAQAVAAPMEISALQGELADDFT
                     AAHPGDEQGLTA"
     gene            complement(127341..128177)
                     /locus_tag="NS506_00138"
     CDS             complement(127341..128177)
                     /locus_tag="NS506_00138"
                     /function="Cytoplasm; DNA-binding; NAD; Repressor;
                     Transcription; Transcription regulation."
                     /note="Modulates transcription in response to changes in
                     cellular NADH/NAD(+) redox state; Belongs to the
                     transcriptional regulatory Rex family"
                     /codon_start=1
                     /transl_table=11
                     /product="Redox-sensing transcriptional repressor Rex"
                     /protein_id="APA94225.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q04E62"
                     /translation="MTEQHETPPTGVSKALQKDIPQATVARLATYLRVLAVLADDGVA
                     IVSSEELAVAAGVGSAKLRKDLSFLGPNGVRGVGYDVIKLRDRIEDVLGLSEGHRVVL
                     VGAGHLGRALVGYGGFRRRGFAMVGLFDNDPAVIDTVVCGLVVRDVAELADAVAALEP
                     TIAVLTVPDTAAQGVCDLLVDAGVQCILSFSALALDAPATVEVRRVDLAVEMQLLSFE
                     RARNAESAAEEAMSAAAAGGAANDVSVVSTPIRRVATIQMPAGGPAAGAETTSKGAVV
                     QP"
     gene            complement(128494..128763)
                     /locus_tag="NS506_00139"
     CDS             complement(128494..128763)
                     /locus_tag="NS506_00139"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94226.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WKS8"
                     /translation="MVAMSDSPHAVTLLTRNGCGLCHTALEQLRPICAEFGIEVATVD
                     VDEAAATDPGLRAEYGDRLPVVLLDGREHSYFDVDEPRLRADLAK"
     gene            128901..129938
                     /locus_tag="NS506_00140"
     CDS             128901..129938
                     /locus_tag="NS506_00140"
                     /EC_number="3.1.3.3"
                     /EC_number="2.3.1.51"
                     /function="Hydrolase; Magnesium; Metal-binding."
                     /note="Belongs to the SerB family; KEGG: req:REQ_16770
                     putative phosphoserine phosphatase /
                     1-acylglycerol-3-phosphate O-acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoserine phosphatase"
                     /protein_id="APA94227.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q49823"
                     /translation="MPERSKEQGTSFIAGHFGEFPARWGQSLADLQDQFTRITRSPFG
                     PSEEEVRANLAGEASADAALALHDAELALQAHDDDTPAPAVPRDLTAAAFFDVDNTMV
                     QGASIVHFARGLAARKYFKTSDLVDMAWKQVKFRVTGKESHSDMASGKEKALSFIAGR
                     PTAELAALGEEIYDEIIADKIWPGTRALAQMHLDAGQQVWLVTATPVELAQVIAKRLG
                     LTGALGTVAESENGVFTGRLVGDILHGLGKAHAVRTLAIREGLNLKRCTAYSDSHNDV
                     PMLSLVGTAVAINPDADLREVAKNRGWEIRDFRTGRKAAKVGVPTAIALGAAGGAAAA
                     VLSRKREARAS"
     gene            complement(130001..131023)
                     /locus_tag="NS506_00141"
     CDS             complement(130001..131023)
                     /locus_tag="NS506_00141"
                     /EC_number="2.3.1.22"
                     /note="To M. tuberculosis Rv0502; KEGG:
                     ehx:EMIHUDRAFT_108460 2-acylglycerol O-acyltransferase 2"
                     /codon_start=1
                     /transl_table=11
                     /product="2-acylglycerol O-acyltransferase"
                     /protein_id="APA94228.1"
                     /db_xref="UniProtKB/Swiss-Prot:P54878"
                     /translation="MSDVAKVIRLHDVDFEARHNRPSRVWPVGEPAALTPVTSLTDRL
                     AEAEARQPKSLGELIRGTVADGVRYTADFARRRLTGDYQVDEFGLDEHLLESVILPML
                     RPLSDLWFRVEVSGIENIPEVGGALVVANHAGTVPLDGLMLQLAVHDRHPKQRALRIL
                     AADLIFEAPLIGGLARKAGHTLACPSDAERLLRAGEVAGVFPEGYKGIGKPYSDRYKL
                     QRFGRGGFVSAAVRTGVPIIPCSIVGSEEIYPKLADLKPLARLLGIPYFPVTPLFPHL
                     GPLGAIPFPSKWYIEFGEPISTSGYEPADADDPMTMFEVTDQVRETIQGTLYKNLIKR
                     RNPFTG"
     gene            complement(131020..132051)
                     /gene="galE"
                     /locus_tag="NS506_00142"
     CDS             complement(131020..132051)
                     /gene="galE"
                     /locus_tag="NS506_00142"
                     /EC_number="5.1.3.2"
                     /note="Belongs to the NAD(P)-dependent
                     epimerase/dehydratase family; KEGG: mtu:Rv0501 UDP-glucose
                     4-epimerase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="APA94229.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WKT2"
                     /translation="MVTGASRFFGGNVVARLAADPAVERIIAVDAKQPSRELLRRMGR
                     AEFVRADIRNPLIRKVIDGNQVDTVVHPAALSRPPSGGGRAAMKDMNVLGAMQLFAVC
                     RKASSVRRVVVRSSSAVYGCSAKDPVKFTEEMSARTPPRGWFARDMVEVEGFVRGLAR
                     RRPDISAAILRFPPIVGPQLAKRGVQYFRSPITPTILGRDPRMQLLHEEDGIAALVHS
                     AMTAPGGTFNVAGDGAMALSQAIRRAGRVELPVPYAVFRTGGRTVMGPVMREFTAEQI
                     DYFHFGCGLDTTRMRTELGFQPRWTTVQAFDDFIGGAALRPVIDPAWIDAAEKKLLGL
                     LGAGTGAHQ"
     gene            complement(132274..132375)
                     /locus_tag="NS506_00143"
     CDS             complement(132274..132375)
                     /locus_tag="NS506_00143"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94230.1"
                     /db_xref="UniProtKB/Swiss-Prot:P0A5D0"
                     /translation="MGSVIKKRRKRMSKKKHRKLLRRTRVQRRKLGK"
     gene            complement(132572..132817)
                     /locus_tag="NS506_00144"
     CDS             complement(132572..132817)
                     /locus_tag="NS506_00144"
                     /function="DNA-binding."
                     /codon_start=1
                     /transl_table=11
                     /product="Putative DNA-binding protein"
                     /protein_id="APA94231.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WKT6"
                     /translation="MMSGNSQARSGNSPINAGSVIGGGTQFLTVAEVANLMRVSKMTV
                     YRLVHSGELPAVRVGRSFRVHAKAVHDYLETSYFDAG"
     gene            complement(133026..133844)
                     /gene="proC"
                     /locus_tag="NS506_00145"
     CDS             complement(133026..133844)
                     /gene="proC"
                     /locus_tag="NS506_00145"
                     /EC_number="1.5.1.2"
                     /function="Amino-acid biosynthesis; Cytoplasm; NADP;
                     Oxidoreductase; Proline biosynthesis."
                     /note="Catalyzes the reduction of
                     1-pyrroline-5-carboxylate (PCA) to L-proline; Belongs to
                     the pyrroline-5-carboxylate reductase family; KEGG:
                     xoo:XOO1416 pyrroline-5-carboxylate reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="Pyrroline-5-carboxylate reductase"
                     /protein_id="APA94232.1"
                     /db_xref="UniProtKB/Swiss-Prot:P46725"
                     /translation="MTRIAVIGGGRIGEALIAGLLESGRASKDLVVVEPVAARAELLA
                     DRFGIRVTDDIADAAESADLIVIAVKPNDVDGVVGELGKAELGDDHDQVLVSLAAGVP
                     TARMESRLPAGFPVVRVMSNTPMLVGQGMSAIAPGRYARKEQLTLVTEMLEAVGKVVT
                     VSESQMDAVTAVSGSGPAYFFLIVEAMIDASVGLGLNRDVATQLVTQTMLGSAALLEE
                     SGQSAPELRAAVTSPAGTTAAGLRELERGAVRSAFHDALHAAKRRSVELGAVAD"
     gene            complement(134011..134928)
                     /locus_tag="NS506_00146"
     CDS             complement(134011..134928)
                     /locus_tag="NS506_00146"
                     /note="Contains 1 DAGKc domain"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94233.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WKT8"
                     /translation="MTTESTVDLESASGLANAPFGRVCAMTELDSTTPEVGRFAGSID
                     PIWTIGPKVHGGTMVASSAAAATEWLRRTAPDHAAMFPISASTDFLGAPDPGEVSYEV
                     RTRKLGRQIGLVDASLIQNGRTLVHTAFTFSHLDDSDPHYADDHAGDMPAEPPADALA
                     YDERNPMGKLVHVARGSSVAIDPKWARFLSGEKSDPRLRLWIRPLEGDEADPDVSAFF
                     AMMSADMSPPVPMNLGHFGWAPTVQMTTYLRRRPASGWLRVIARAREVGHRMFDEDQL
                     VIDSTGAIVAQSRQLALIPTRLSEPSARG"
     gene            complement(135050..135730)
                     /gene="iolE"
                     /locus_tag="NS506_00147"
     CDS             complement(135050..135730)
                     /gene="iolE"
                     /locus_tag="NS506_00147"
                     /EC_number="4.2.1.44"
                     /function="Signal."
                     /note="To M. tuberculosis Rv0498 and S. coelicolor
                     SCO3347; KEGG: smq:SinmeB_5932 inosose dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="Myo-inosose-2 dehydratase"
                     /protein_id="APA94234.1"
                     /db_xref="UniProtKB/Swiss-Prot:P54581"
                     /translation="MSADLATGLGADPIAKLTRSVHTAEALGAATVVVHPPFRWQRRY
                     AEGFAKQVAELESSSPVAVAVENMFPMRADTLFRGSSIQRLERRGGPGPSITTFGPSY
                     DPTDVGFRHYTLDTSHTATAGMDPLVLAGRMGSGLTHLHLADGRGAATDEHLIPGDGT
                     QPVAELCEMLVHNGFDGQAVIEVNTQMARTTMDRAAMLNRALTFARTHLNDFTPAPAP
                     EPTAAHRG"
     gene            complement(135992..137830)
                     /locus_tag="NS506_00148"
     CDS             complement(135992..137830)
                     /locus_tag="NS506_00148"
                     /function="Cytoplasm; GTP-binding; Initiation factor;
                     Nucleotide-binding; Protein biosynthesis."
                     /note="One of the essential components for the initiation
                     of protein synthesis. Protects formylmethionyl-tRNA from
                     spontaneous hydrolysis and promotes its binding to the 30S
                     ribosomal subunits. Also involved in the hydrolysis of GTP
                     during the formation of the 70S ribosomal complex; Belongs
                     to the TRAFAC class translation factor GTPase superfamily.
                     Classic translation factor GTPase family. IF-2 subfamily;
                     Contains 1 tr-type G (guanine nucleotide-binding) domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Translation initiation factor IF-2"
                     /protein_id="APA94235.1"
                     /db_xref="UniProtKB/Swiss-Prot:C1B313"
                     /translation="MTEDASQLSVAELLARNGQQNGTPASGGGRRRRSGRGISVAELT
                     GDIPVVPRAGSSSHAAPDDEAAAPAPEHTPIESDYSNFSNFSNNSDYSNFSEYADLYA
                     AASSGRPETPSYSMPDSEPAYSPVSGPISYYDPLAPALQPPSLPEPSGQDWSAGLNWP
                     PTENPLQPDGRATGGGRRRKPDPLDSEVSLDRLQGTETPAPPREGGRRRRYDPDDENT
                     DEVRPFRGEAAPRPPLEEPARTQFNPAARAPFEDRTRFDPAAPAWPPAPGPEPLPRNP
                     RPDRPGYDADLPGFDANRPGFDGNRSGFEPTQAAPAAPPMSRSARRHAEAQRQSAPPA
                     ERRGGVDHGAANGLPAWSARRRPGPEPAPGAPVAGPGAPVAGPGAPERVDQAAVPTAA
                     WSSSLADDDQQLLSGQSVAGDLLRDAHDRDVERADRNSRNNGNRRGGGFRGRTAVAPE
                     PDPADHLTDFYEPLDDDYDDYDDEPETSMAGRLSAFTQKAGALGRKAAGGSRAKRTAG
                     AESAAARSRAKGRSDEDEHRRQWLMIAGQSVGAAVAGMLLFKGFERMWEMLPWVALTL
                     AMIVILGLVALVRVLRRTDDIFSTVIAVVVGVFVTLGPLAFLLSTN"
     gene            complement(137827..138741)
                     /locus_tag="NS506_00149"
     CDS             complement(137827..138741)
                     /locus_tag="NS506_00149"
                     /EC_number="3.6.1.11"
                     /EC_number="3.6.1.40"
                     /function="Hydrolase."
                     /note="Belongs to the GppA/Ppx family; KEGG:
                     msm:MSMEG_0939 exopolyphosphatase /
                     guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="Exopolyphosphatase"
                     /protein_id="APA94236.1"
                     /db_xref="UniProtKB/Swiss-Prot:P54882"
                     /translation="MPMSSTKSALRLSESMDDQGRITPTGAARLTATVAEFASIAKTS
                     GCVELMAFATSAVREATNSEEVLARVRRETGVQLEVLSGVDEARHTFLAVRRWYGWSP
                     GRILNLDIGGGSLEMSNGADEDPDVALSLQLGAGRLTRDWLRHDPPGKRRVAVLRDWL
                     DAELVLPSKQLLEVGRPDLAVGTSKTFRSLARLTGAAPSVAGPRVRRTLTSSGLRQLI
                     AFISRITAADRAELEGVSSDRSQQLVAGALVAEASMRALSLDTLEICPWALREGLILR
                     KLDTDLDSEPITGGPEGGLSGPIETVSR"
     gene            138957..139871
                     /locus_tag="NS506_00150"
     CDS             138957..139871
                     /locus_tag="NS506_00150"
                     /note="To M. tuberculosis Rv0495c and S. coelicolor
                     SCO3349"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94237.1"
                     /db_xref="UniProtKB/Swiss-Prot:P54579"
                     /translation="MELDFPREWIEFVDPANDEHLIAADLTWLLSRWTCVFGTPACQG
                     IIDGRENDGCCSHGAFLSDAEDGKKLHEAVKMLTADDWQLMDRAVDDKGRVRKKLYLE
                     EDDLDDEPALRTRRVDGACIFLNRPGFSEGIGCALHTMALRKGLEPLTVKPEVCWQLP
                     IRRTQEWVDRPDGVEILRTAITEYDRRGWGPGGLDLNWYCTGSPDAHVGTRPVWEAYA
                     PELIELIGKPAYDELAQHCKRRQGLGIVAAHPATAIAEEKAAESRQAASAPAKTASAP
                     AKTASAPAKTGTAPAKAKAVKKAKPAKQ"
     gene            139979..140524
                     /locus_tag="NS506_00151"
     CDS             139979..140524
                     /locus_tag="NS506_00151"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94238.1"
                     /translation="MSKFPLGGRHLGIGLAGLAIATGAVAVVTTHEAPAAHASVDSVT
                     VSGSNWTVGNTYTLHASLSGASFGLLVYWSDNGNSLTPAGKVPWPPYNASLDWKPTTA
                     GQHIITASQGSSTNTLIVNVADGTTTPPTTTTTTPPTTTTSPTTTQPSGGGSGSSGSG
                     SATGSAGSLVGGLLRGLFGSS"
     gene            140694..141149
                     /locus_tag="NS506_00152"
     CDS             140694..141149
                     /locus_tag="NS506_00152"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94239.1"
                     /translation="MRNTSSRFGARRIGVGLTGFAALAATAVIAAPDALAAVDTVSID
                     QKNVVVDKAYTISATLSGASIGLLVYFSDNGNEIGPPRIPSPPGHASISWRPSTTGRH
                     IITASQGPNSQSIVVDVADAPFGSGSTSSGSGFGSAGPLGSGSSGTTPN"
     gene            141175..141645
                     /locus_tag="NS506_00153"
     CDS             141175..141645
                     /locus_tag="NS506_00153"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94240.1"
                     /translation="MSSISRRIGAGVAGLAATAAVAVLAAPQAAATVDSVSISGSAPY
                     TINTGYTLTANLSGAGIGLLVYWSDNGKSLTPAGKVPWPVGYSSIDWTPTTAGQHLLT
                     ASQGGNTKTIAVTVSDPSQPGGGTGAGGTGGGNTGSAGSALGGLLGGLTGSAGS"
     gene            141824..142180
                     /locus_tag="NS506_00154"
     CDS             141824..142180
                     /locus_tag="NS506_00154"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94241.1"
                     /translation="MIKKTLAVAALAAGAVVSIAPQAFADNADPNAYSDHTADFVVYN
                     DPAVLGAKDAGKQIIVSPYGTSHTIACKGNGVDVPLYDCMQQDNPGLGWIILDRQELP
                     GLGPAWVDTMKNDPNA"
     gene            complement(142420..143109)
                     /locus_tag="NS506_00155"
     CDS             complement(142420..143109)
                     /locus_tag="NS506_00155"
                     /function="Cytoplasm; DNA-binding; Phosphoprotein;
                     Transcription; Transcription regulation; Two-component
                     regulatory system."
                     /note="Forms part of a two-component regulatory system
                     AfsQ1/AfsQ2 involved in secondary metabolism. Contains 1
                     OmpR/PhoB-type DNA-binding domain; Contains 1 response
                     regulatory domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Transcriptional regulatory protein AfsQ1"
                     /protein_id="APA94242.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q04942"
                     /translation="MTSVLIVEDEESLADPLAFLLRKEGFEVTVVGDGPSALTEFDRA
                     GADIVLLDLMLPGMSGTDVCKQLRARGSVPVIMVTARDSEIDKVVGLELGADGYVTKP
                     YSSRELIARIRAVLRRGAGEEPDNGSETSVLEAGPVRMDVDRHTVQVNGKAVTLPLKE
                     FDLLEYLLRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEADPAKPEHLV
                     TVRGLGYKLEA"
     gene            complement(143106..144332)
                     /locus_tag="NS506_00156"
     CDS             complement(143106..144332)
                     /locus_tag="NS506_00156"
                     /EC_number="2.7.13.3"
                     /function="ATP-binding; Cell membrane; Kinase; Membrane;
                     Nucleotide-binding; Phosphoprotein; Transferase;
                     Transmembrane; Transmembrane helix; Two-component
                     regulatory system."
                     /note="Probably forms part of a two-component regulatory
                     system senX3/regX3. Phosphorylates regX3 (Probable);
                     Contains 1 histidine kinase domain; KEGG: coa:DR71_1352
                     two-component system, OmpR family, sensor histidine kinase
                     SenX3"
                     /codon_start=1
                     /transl_table=11
                     /product="Histidine kinase"
                     /protein_id="APA94243.1"
                     /db_xref="UniProtKB/Swiss-Prot:P0A601"
                     /translation="MAVLAAVVGLAVGGLLSPYVNARQERLRAATDTGLTMSQVLDLI
                     VLASESGIAVVDQYRDVVLVNPRAEELGVVHDRLLDERAWAAVEQVLAGGQDVEFELT
                     AKIPMPGRARLAVRGVARPLSQENPNFVVLFADDDSEQARMEATRRDFVANVSHELKT
                     PVGAMSLLAEALLESADDPDSVRHFGERLHGEARRMGKMVTELIALSRLQGAERLPEL
                     EAVDVDTVVTQAIERSRNVAEAAGITVSTDATSGLEVLGDQTLLVTALSNLVENAIAY
                     SPRGSHVSVSRALRGGYVNIAVTDRGIGISKEDQERVFERFFRADKARSRATGGTGLG
                     LAIVKHVAANHNGEITLWSKLGTGSTFTLRVPAHPADSNGQGDKKLATGVPVAKKENG
                     PSPLGRARTNGVEATR"
     gene            complement(144522..144698)
                     /locus_tag="NS506_00157"
     CDS             complement(144522..144698)
                     /locus_tag="NS506_00157"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94244.1"
                     /translation="MERMGLLERRRYVEAPPRVEYSLTAAGVDLLRPIFALGEWADRH
                     GDSVRTALYGDPED"
     gene            145011..145454
                     /locus_tag="NS506_00158"
     CDS             145011..145454
                     /locus_tag="NS506_00158"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94245.1"
                     /translation="MTAGISPAYVFKLFPSKVELFVAALDRCFERVEGALATGAARIP
                     GGDPEQVLHEVGGAYAELIVDKSLLMLQVHALSAADTPDIATAMRRGLQRITEFAQTR
                     SDATGEQVQHFMAYGQLCHLITTLGLDATEGPWAATLTAGIRHYN"
     gene            145537..146574
                     /locus_tag="NS506_00159"
     CDS             145537..146574
                     /locus_tag="NS506_00159"
                     /EC_number="1.6.5.5"
                     /function="Acetylation; NADP; Oxidoreductase; Peroxisome."
                     /note="Belongs to the zinc-containing alcohol
                     dehydrogenase family. Quinone oxidoreductase subfamily;
                     KEGG: nda:Ndas_1404 NADPH2:quinone reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH:quinone reductase"
                     /protein_id="APA94246.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q24K16"
                     /translation="MSTIIATEVALPGRVEPEGPTVTTRELPPTRPGEALVRMEATGV
                     SFAEQQMRRGKYYDQPAFPFVPGYDIVGEVVAVGAGVDPALIGRRVAALTKIGGWSSH
                     LTVPAGDLVPVPDGLGAEAAETFVVNGITAWQMLHRSAKVRAGQTILVHGANGGVGST
                     LVQLARAAGIRVIGTASARNADAVATLGATPVDYRGDVAAQVRALAPGGVDAVFDHVG
                     GPGIVDSFGLLAPGGTLVSYGSAATKNEEGDSRLPVLKLFARLLWWNALPNKRNASFY
                     NIWAGRRRLSRFRARLAADLAGVFELAERGVLHPQIAARIPLRETARALTLAESGTVT
                     GKVVLVGDRES"
     gene            complement(146648..148696)
                     /locus_tag="NS506_00160"
     CDS             complement(146648..148696)
                     /locus_tag="NS506_00160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94247.1"
                     /translation="MEHALRATVLATSAALLLPLTGITADADTPTGPDGGAAGAAWTA
                     AEDGPQQYPNVFIEWDVPITMSDGTILKANVYHPADAAGRPIAAPTPTVVNMTPYTKL
                     VSNVADSAISIPGLGDTLLNVFRNIRLDGTPITGFGELLNAAGNGELRNFSVDRQLIK
                     SGYTQVVVDVRGTGFSQGEWDMLRGREQQDTVEVIDWASKQGFSNGRIGMNGLSYSAI
                     NQVQAAEKQPPALKAIFPIVPGSDLIDDVLAPGGGFGFNFIPLWLGAINGLKWVPDLA
                     SIANGAFDFKWLQDRADDPFGYLDVLMSAYTSTSMDTIDPRVREMLNGLSQERGEWLG
                     DPSRIQIPTFVTGGWHDLFTYSESKIYNQIPLPTGQKQLLMGNTYHVTSGADVNRVGA
                     PPRLDVLQRAWFDKWLKGIDNGIDSYGPVTLKTQGGGWNTQGGFGPTAPVSEAADYRR
                     MYFSAQSSGTANSVHDGSLTAAANGDTDRLSIAPGLYTVCSNDAAQASAGALDLLDAC
                     AKDNRIAETNALTFTSAPVAEATTISGPIAVHLNTVQDAADGYWTVTVNDVAPDGQST
                     VLTSGSLMASLRQVDEANSTRSANGDYTDPRAFTSLDKRQETVPGEATTLDIALSGTQ
                     AVLQPGHRLRVDVFAGNFPKGLPILPMLIDTGLKPEHLQLDPDRPSFVNIPVRGNTGW
                     "
     gene            complement(148963..149700)
                     /gene="pgaM"
                     /locus_tag="NS506_00161"
     CDS             complement(148963..149700)
                     /gene="pgaM"
                     /locus_tag="NS506_00161"
                     /EC_number="5.4.2.11"
                     /function="Gluconeogenesis; Glycolysis; Isomerase."
                     /note="Catalyzes the interconversion of 2-phosphoglycerate
                     and 3-phosphoglycerate; Belongs to the phosphoglycerate
                     mutase family. BPG- dependent PGAM subfamily; KEGG:
                     nfa:nfa51890 2,3-bisphosphoglycerate-dependent
                     phosphoglycerate mutase"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoglycerate mutase
                     (2,3-diphosphoglycerate-dependent)"
                     /protein_id="APA94248.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q5YP50"
                     /translation="MTYTLVLLRHGESEWNALNLFTGWVDVRLTDKGVAEGKRAGELL
                     AEHGILPDIVYTSLLRRAISTANNALDACDRHWIPVVRDWRLNERHYGALQGKNKAEI
                     KEQYGNDQFMLWRRSYDTPPPPIELDSEYSQDGDPRYAGIEVPRTECLKDVVARMVPY
                     WEDTIATDVRAGKTVLVAAHGNSLRALVKHLENISDEEIAELNIPTGIPLKYELDENL
                     RPIGTGVYLDPEAAAAGAAAVANQGGK"
     gene            complement(149777..150664)
                     /locus_tag="NS506_00162"
     CDS             complement(149777..150664)
                     /locus_tag="NS506_00162"
                     /EC_number="2.7.1.2"
                     /function="ATP-binding; Cytoplasm; Glycolysis; Kinase;
                     Nucleotide-binding; Transferase."
                     /note="Belongs to the ROK (NagC/XylR) family; KEGG:
                     rha:RHA1_ro05185 glucokinase"
                     /codon_start=1
                     /transl_table=11
                     /product="Glucokinase"
                     /protein_id="APA94249.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q56198"
                     /translation="MTALALDIGATKFAAALVDPAGAVGESRRVGVPESGVWDACRGL
                     LAEVAGDMRIGAVGIGSAGPVDIDAGVCGPLNIPEWADGFPIVDSVRKLFPEAEIRLA
                     IDGVCLVLAEQRLGAARGFRNVLALTVSSGIGGGIISDDRVVMGRTGNGGHVGHIVVP
                     GQEEPCACGGFGCVEAVASGKSSVRWARRQGWAGISGVELAAAAHAGEAIAVAALERA
                     GTAIGTAVASAAALLDTDLVAIGGGFAQSGEPLWAPLRAAAAAHARLKFLRELRVVPS
                     ELTDQATLQGAAILALGRG"
     gene            complement(150716..151315)
                     /locus_tag="NS506_00163"
     CDS             complement(150716..151315)
                     /locus_tag="NS506_00163"
                     /note="To M. tuberculosis Rv0487"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94250.1"
                     /db_xref="UniProtKB/Swiss-Prot:P54139"
                     /translation="MAAADGSTTQMSEVERAADWTPRPHASTGGLNDETARATAQLID
                     ETLREREIEYTRDAPDLFVVVLPGERKLKTVIGVSVGKHGVRMESFVCRKPDENFEGV
                     YKFLLRRNRRLYGVAYTIDRVGDIYLVGRMSNDRVTPDELDRWLGQILEAVDADFNTL
                     LELGFAESIRKEWKWRVSRGESLKNLRAFEHLVDSADKQ"
     gene            complement(151282..152598)
                     /gene="mshA"
                     /locus_tag="NS506_00164"
     CDS             complement(151282..152598)
                     /gene="mshA"
                     /locus_tag="NS506_00164"
                     /EC_number="2.4.1.250"
                     /function="Glycosyltransferase; Magnesium; Metal-binding;
                     Transferase."
                     /note="Catalyzes the transfer of a N-acetyl-glucosamine
                     moiety to 1D-myo-inositol 3-phosphate to produce
                     1D-myo-inositol 2- acetamido-2-deoxy-glucopyranoside
                     3-phosphate in the mycothiol biosynthesis pathway; Belongs
                     to the glycosyltransferase group 1 family. MshA subfamily;
                     KEGG: mtu:Rv0486 D-inositol-3-phosphate
                     glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="D-inositol-3-phosphate glycosyltransferase"
                     /protein_id="APA94251.1"
                     /db_xref="UniProtKB/Swiss-Prot:C7Q4Y6"
                     /translation="MNVYVLQTAIELAKRGTQVEIFTRATSSNDEPVVEAAPGVLVRN
                     VVAGPFEGLDKHDLPTQLCPFAAEVLRTEARHPVGHYDLIHSHYWLSGQVGWLARDRW
                     RVPMVHTAHTLAAVKNAYLADGDCPEPAVREIGEKQIVAEADRLVANTGEEARQLVEL
                     YGADPDRIDVVLPGADLSRYRPGDKLAARAELGLPADERIVAFVGRIQPLKAPDVLVR
                     AAARLLADEAARPDPFRRPLRVVIVGGPSGSGLERPNALIELASALGISDRVTFLPPQ
                     LAHRLVQVYRAADVVAVPSYNESFGLVAIEAQASGTPVLAADVGGLGTAVRDGVSGLL
                     VPGHRTPDWADALSSLLDDPARLAVMGAAAVDHAANFSWAHTADGLLDSYTAALSQAR
                     ASRLRGGSLHTDGNQARSRTLTGSSPRTIRREVEPAWRRRTGALRR"
     gene            complement(152796..153602)
                     /gene="pcaD"
                     /locus_tag="NS506_00165"
     CDS             complement(152796..153602)
                     /gene="pcaD"
                     /locus_tag="NS506_00165"
                     /EC_number="3.1.1.24"
                     /function="Aromatic hydrocarbons catabolism; Cell
                     membrane; Cytoplasm; Hydrolase; Membrane."
                     /note="Involved in catabolic degradation of epoxides.
                     Shows highest activity towards C6 and C7 carbocyclic
                     epoxides. Also active towards linear 1,2-epoxyalkanes.
                     Belongs to the AB hydrolase superfamily. Epoxide hydrolase
                     family; KEGG: sth:STH807 3-oxoadipate enol-lactonase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate enol-lactonase"
                     /protein_id="APA94252.1"
                     /db_xref="UniProtKB/Swiss-Prot:O52866"
                     /translation="MSADGTTIVYRVTGAEGARPLVLLHGWAGNLLKWGRATDLLAEH
                     FRVIAVDLRGHGYSDAPETGYDDPKNWAADIAAVLAGEGITSGAILLGWSYGGIVLSD
                     YLTAYGTGALAGVVYTGSQANIGRGVPGAETGPGMGKAIPDVFDESAGKAMRGFAAFG
                     NANTGPGRDKGVEAQRLFGGSIATLPRVRKALFYRTVDNTETLRGLNVPVLVLHGTAD
                     PVVPIENGRHIAATAPDVRTSYWEGAQHGLCIEDPERFVSEVTVFASDLD"
     gene            153680..154414
                     /gene="fabG"
                     /locus_tag="NS506_00166"
     CDS             153680..154414
                     /gene="fabG"
                     /locus_tag="NS506_00166"
                     /EC_number="1.1.1.100"
                     /function="Oxidoreductase."
                     /note="Belongs to the short-chain
                     dehydrogenases/reductases (SDR) family; KEGG: bja:bll2747
                     3-oxoacyl-(acyl-carrier protein) reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-[acyl-carrier-protein] reductase"
                     /protein_id="APA94253.1"
                     /db_xref="UniProtKB/Swiss-Prot:P25970"
                     /translation="MSTRTAVVTGASSGIGEATARELAKQGYHVYVGARRVDRLEALA
                     AEIGGTALPLDVTDEESVRAFTDAVERCDVLVNNAGGAKGLAPVLEADLDDWRWMWET
                     NVLGTLRVTKALLPKLIDSGDGLIVTITSVAAMSVYDNGSGYTSAKHAQAVLHRTLRG
                     ELLGKPVRLTEIAPGAVETEFSLVRFGGDAERAANVYKGIDPLVAQDIAEIIGFVASR
                     PPHVNLDTIVVKPRDQAESGRFARRG"
     gene            154591..155460
                     /gene="fabH"
                     /locus_tag="NS506_00167"
     CDS             154591..155460
                     /gene="fabH"
                     /locus_tag="NS506_00167"
                     /EC_number="2.3.1.180"
                     /note="KEGG: ncy:NOCYR_2361
                     3-oxoacyl-(acyl-carrier-protein) synthase III"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-ketoacyl-[acyl-carrier-protein] synthase
                     III"
                     /protein_id="APA94254.1"
                     /translation="MGIVISSVATEIGGDSIEQAAAAARRVMADAGITPDQIDALINT
                     GGYRDSNMAEPAMSALIQQRAGIGLEYHSGDVPCLSFDLMNGACGILNAIQVSQALLE
                     APTVHRVLLVAGDARPSKSAGPQPGFPIEPVGAAMLLEKTPGTAGFGALHISATDGRP
                     AEGYPRPSEMGTTGRSSMLVNRSSSVEELLHHAISAAGEALEVADADLDRTVLICGRP
                     TADFPDLLARRLGITTVAADDTESHAQTSALPVAYLAARDSGKLARADVALFVAAGAG
                     PSAAAIAYRLPKP"
     gene            155491..155592
                     /locus_tag="NS506_00168"
     CDS             155491..155592
                     /locus_tag="NS506_00168"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94255.1"
                     /translation="MNERWVRVRAWGVRKTLPRYAEQRHKPELVDIR"
     gene            155589..156881
                     /locus_tag="NS506_00169"
     CDS             155589..156881
                     /locus_tag="NS506_00169"
                     /EC_number="6.2.1.26"
                     /note="KEGG: cga:Celgi_0726 O-succinylbenzoic acid--CoA
                     ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="o-succinylbenzoate--CoA ligase"
                     /protein_id="APA94256.1"
                     /translation="MSGEDFTALLREQVLRTPDAPALGMIGEPALSFAELDARIRLVV
                     KRLHSKGFEPGDRMLFAIRPYVDAVVLILGTVAAGGTIVFVDPGVGPELFARQMELVQ
                     PRWAATESLMYLLSGPLRRYGHRIGLSLPEFGLALPEFGVSLPEFGRLPMRHIHSGTR
                     LPGTPRGSIPLRQLVGSEPGWSGPASRSTVDTPVENPDAEALIVFTSGTTADPKAIVH
                     SRGSLGAGLAAMAGCTSLMPGSHLHTEHPMMGLPAVLEGARWSMPRYARFATHIDPIG
                     FARTLGTATHAYFTPADLAVVLDAIESGKLAAPTHIEEMSLGGAPVTTALLRRARAAL
                     PDTEFLAIYARTEILPVAVASGGDKLEFSGRGDLLGPPVDGVDARIADDGELILSGPN
                     LCRGYLGEPPMKEIATGDLARFEDGNLVLVGRKQDTAL"
     gene            157071..157367
                     /gene="tarS"
                     /locus_tag="NS506_00170"
     CDS             157071..157367
                     /gene="tarS"
                     /locus_tag="NS506_00170"
                     /EC_number="6.1.1.3"
                     /function="Aminoacyl-tRNA synthetase; ATP-binding;
                     Cytoplasm; Ligase; Metal-binding; Nucleotide-binding;
                     Protein biosynthesis; Zinc."
                     /note="Belongs to the class-II aminoacyl-tRNA synthetase
                     family; KEGG: xdo:XDD1_0100 threonyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="Threonine--tRNA ligase"
                     /protein_id="APA94257.1"
                     /db_xref="UniProtKB/Swiss-Prot:C5D639"
                     /translation="MWQRATELLTEVLDRSGLPYESTAGETAFYGPKIDVQVTDHAGR
                     EATLSTVQIDFHQPEQFDLHYIGPDANKHRPVMVHRSIIGSVDRAVAHLIESRT"
     gene            157421..157717
                     /locus_tag="NS506_00171"
     CDS             157421..157717
                     /locus_tag="NS506_00171"
                     /EC_number="6.1.1.3"
                     /note="KEGG: ncy:NOCYR_3006 threonyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="Threonine--tRNA ligase"
                     /protein_id="APA94258.1"
                     /translation="MLPVSEAEAGAAAELAERCLAADLRVDVIEAEAGSLGARIRENR
                     LVPYQFVLGPAETANGEVAVRLRDGRRLPAQPAERAVGRVRALIESHDTRLWTD"
     gene            complement(157729..158442)
                     /locus_tag="NS506_00172"
     CDS             complement(157729..158442)
                     /locus_tag="NS506_00172"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94259.1"
                     /translation="MSGNLTLADVLDDAALLSFEHQMHLSEVLGEHSFNVNLAERRFE
                     FRCAERTLVCTGMHMLGSAAPGPQSWRWSWANPTGYPAEVVAVAKAVPEFGAHHGITE
                     LAAAEVPFGAFGDDLEPHQVSWTMMELAKPISGHWTSYQGNVGNGTFVAFLVEHPELR
                     LPPPSGPRLLRVLSQGVAELALTDHRRAVHSYLTRRGLAVAFAPNGESLRFDSPAVNG
                     TVDFDEYGRMAGINGGMSA"
     gene            complement(158427..159524)
                     /locus_tag="NS506_00173"
     CDS             complement(158427..159524)
                     /locus_tag="NS506_00173"
                     /function="Acetylation; Alternative splicing; Cilium
                     biogenesis/degradation; Cytoplasm; Metal-binding;
                     Phosphoprotein; Repeat; Ribonucleoprotein; RNA-binding."
                     /note="RNA-binding protein that binds to misfolded
                     non-coding RNAs, pre-5S rRNA, and several small
                     cytoplasmic RNA molecules known as Y RNAs. May stabilize
                     some of these RNAs and protect them from degradation; May
                     play roles in cilia formation and/or maintenance; Belongs
                     to the Ro 60 kDa family; Contains 1 TROVE domain"
                     /codon_start=1
                     /transl_table=11
                     /product="60 kDa SS-A/Ro ribonucleoprotein"
                     /protein_id="APA94260.1"
                     /db_xref="UniProtKB/Swiss-Prot:P10155"
                     /translation="MLGWIHEASLDGLCLIEGHTDVDRHCGAHSDLVREYRLSWEMLP
                     DAALDDAGVWEALLDNGMPQTALMRQLPRLTRLGLLAPLGARTWAIAEQLADRDRLRR
                     ARVHPVNVFVAQRTYAKARSVRGESSWEPSRPIVDVLDAAFYAAFEAVEPTGKRHLFA
                     LAVSGSVTASVSGMPLSAREASAALALVTTSIESECQIVGFTSGSGYGSRRDTGLTPL
                     SISPRQRLEDAIRAVSDLPFGGTDCALPMLYALERKLHVDVFVVAIDNGDVGGPDASA
                     SGAGAVPARGQPAGEAGRDRHDGHELHDRSSGRRGKVRYRRFRFGGTGFAGGLRARAL
                     TAGSGRSLPPGGITGWQWPVSLDTVAACPEI"
     gene            complement(159688..160773)
                     /locus_tag="NS506_00174"
     CDS             complement(159688..160773)
                     /locus_tag="NS506_00174"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94261.1"
                     /translation="MPPKVEPLKLSDTERQVLVGWSRRRKTAQALALRSRIVLACAES
                     GSNSEVARQLGVSRETVRKWRTRFERDRLEGLSDEPRPGAPRKITDEQVEHVITTTLE
                     TSPPQRDTHWSTRSMAQATGMSQSAVSRIWRAFGLKPHLVETWKLSTDPLFVDKVRDV
                     VGLYMNPPQNALVLCVDEKSQMQALDRTAPTLPIMPTTPARMTHDYVRNGTTNLFAAL
                     DVASGSVIAEHYARHRHQEFLRFLKTIDTAVPAEFDLHLVCDNYGTHKTPAVKKWLLR
                     HPRFHVHFTPTSASWLNLVERWFAELTNRKLRRSAHRSVTELKADVQAWINAWNADPK
                     PFVWTKTADEILETLAAYCQRINDSRH"
     gene            161598..162683
                     /locus_tag="NS506_00175"
     CDS             161598..162683
                     /locus_tag="NS506_00175"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94262.1"
                     /translation="MPPKVEPLKLSDTERQVLVGWSRRRKTAQALALRSRIVLACAES
                     GSNSEVARQLGVSRETVRKWRTRFERDRLEGLSDEPRPGAPRKITDEQVEHVITTTLE
                     TSPPQRDTHWSTRSMAQATGMSQSAVSRIWRAFGLKPHLVETWKLSTDPLFVDKVRDV
                     VGLYMNPPQNALVLCVDEKSQMQALDRTAPTLPIMPTTPARMTHDYVRNGTTNLFAAL
                     DVASGSVIAEHYARHRHQEFLRFLKTIDTAVPAEFDLHLVCDNYGTHKTPAVKKWLLR
                     HPRFHVHFTPTSASWLNLVERWFAELTNRKLRRSAHRSVTELKADVQAWINAWNADPK
                     PFVWTKTADEILETLAAYCQRINDSRH"
     gene            complement(162806..164050)
                     /locus_tag="NS506_00176"
     CDS             complement(162806..164050)
                     /locus_tag="NS506_00176"
                     /function="Acyltransferase; Cell shape; Cell wall
                     biogenesis/degradation; Peptidoglycan synthesis;
                     Transferase."
                     /note="Generates 3->3 cross-links in peptidoglycan,
                     catalyzing the cleavage of the mDap(3)-D-Ala(4) bond of a
                     tetrapeptide donor stem and the formation of a bond
                     between the carbonyl of mDap(3) of the donor stem and the
                     side chain of mDap(3) of the acceptor stem. Is specific
                     for donor substrates containing a stem tetrapeptide since
                     it cannot use pentapeptide stems (By similarity); Contains
                     1 YkuD domain"
                     /codon_start=1
                     /transl_table=11
                     /product="L,D-transpeptidase"
                     /protein_id="APA94263.1"
                     /db_xref="UniProtKB/Swiss-Prot:P64704"
                     /translation="MSNRGLSRRAAIRAALVASTAVIAAACSSSNNGGGGGSAKPAEP
                     VATVKLEPGNGSENVSPTAAVTATVSNGRIDQLTLTNANGKQVTGTFDAARSKFTVNE
                     ALGYGATYTWAGTATGTDNKPVAIDGKFTTISPKNTAPATVNIGDGQEVGIAAPIMLQ
                     FKGHVANKAAVEKALTVTATPATEGSWAWLQDDNGGSRVHWRPREYWQPGTTVHVTAK
                     LYGLDMGSGLYGDSDLTSDFKIGRSQIVRGNAPTHRVQVIRDGQTVFDFPCSYGEGNQ
                     DRNVTRSGIHVVSEKYEDFLMSNPPFYTNVRERWAVRISNNGEFIHANPESAGAQGNS
                     NVTNGCINLSTADAQAYFPTALYGDPVEITGTRIQLSAADGDIYDWTIDWETWKSLSA
                     LQGEPKNQISATPVPPQPVGGR"
     gene            complement(164115..165230)
                     /gene="murB"
                     /locus_tag="NS506_00177"
     CDS             complement(164115..165230)
                     /gene="murB"
                     /locus_tag="NS506_00177"
                     /EC_number="1.3.1.98"
                     /function="Cell cycle; Cell division; Cell shape; Cell
                     wall biogenesis/degradation; Cytoplasm; FAD; Flavoprotein;
                     NADP; Oxidoreductase; Peptidoglycan synthesis."
                     /note="Cell wall formation; Belongs to the MurB family;
                     Contains 1 FAD-binding PCMH-type domain; KEGG:
                     nno:NONO_c70660 UDP-N-acetylmuramate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate dehydrogenase"
                     /protein_id="APA94264.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q5YP42"
                     /translation="MPVRTSRVVSFDDLRDRLAETGARLRADVRLAELTTLRVGGPAT
                     VAECASTDALVATVRELDAAGIPVLLIAGGSNLLIGDDGFDGVVVRIATRAVEFTADS
                     VIAEAGANWDAVVAASVEAGFGGLECLSGIPGSAGATPVQNVGAYGVEVASLLRRVRL
                     LDRATGEIRWVEPGELGFGYRTSVLKHSAAAVVLAVEFALRADGSSAPLGYRELANAL
                     GAAEGESRPAALVRAAVLRLRAGKGMVLDPDDHDTWSAGSFFTNPVIPDAQVAAVRAA
                     ISSRVGADVAVPTFPAAGGVKFSAGWLIERAGFAKGFPGDGSPARLSTKHTLALTNRG
                     AATATDLVTLARTVRDGVAERFGIRLEPEPVTVGVSL"
     gene            165251..165736
                     /locus_tag="NS506_00178"
     CDS             165251..165736
                     /locus_tag="NS506_00178"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94265.1"
                     /translation="MATPLAFTAHSTHPMAAVRAAFADEQYWKDRIESVGGPNARIEN
                     LVIDGEIVRVDMVQTIPAEELPAQITAIKPNGLVIPRTEIWHGSGGTVEARVDGAPAN
                     VNGTLTVTDDGSGSTFVVDASIDVKIPLFGKKIEAAIQEHLSALLEREAEFTDNWLSS
                     H"
     gene            165768..166283
                     /locus_tag="NS506_00179"
     CDS             165768..166283
                     /locus_tag="NS506_00179"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94266.1"
                     /translation="MARRLDYSARYPLHTTHEVYAAMMNREHWDARIEELRKHSPNDI
                     VSLTSDDDGITVELRHVLPRDTLPDMAQMVVHKDMVITRRETYGPFGTEVTGEYTAEI
                     PSAPGTLGGTMRLFPTDTGCTLRTSSHAQVNLPFFGRRLEQLMLVNLVDLFRAEAEVT
                     KNWLDQHYPVG"
     gene            166280..167053
                     /locus_tag="NS506_00180"
     CDS             166280..167053
                     /locus_tag="NS506_00180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94267.1"
                     /translation="MNKPIGTITRGTTGINRLRRSDRWLMHDPLVAQRLLDAADPLIV
                     DLGYGASPVTTLEMAARLRTVRPDLRVVGLEIDPERVVPARDGVSFARGGFELAGLRP
                     TLVRAFNVLRQYPESAVPEAWSTIQSGLAPDGLLLDGTCDELGRRCAWILLDRTSPLS
                     LTLAWDPFTVETPSDIAERLPKALIHRNIPGEPIHTLLTAADRAWAVAAPLAPYGPRV
                     RWRHAADLLRMQGFPLRPYRRRLRDNVLTVPWSAVAPLP"
     gene            complement(167163..168653)
                     /locus_tag="NS506_00181"
     CDS             complement(167163..168653)
                     /locus_tag="NS506_00181"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94268.1"
                     /translation="MAKVGAGVWDLVFPPGPPELIADMFSAAVVADAVRSYDADLAQS
                     VETCRDWRRGYHRVFRGMTALAIGSREVSLGMAGAGLDSVRHMLRFTVGHTVAALETV
                     DVDAEADAAVLETAEVVGEAAAVKRLEVPWHGLLLSEESLRLRLAEWQTRGILEADFV
                     AAIERVIEHPEWLALTDFRVTVTGAGAELGPLRPLLAWGADVLAVDRPGRARWEKLRA
                     VAKSGAGVLRFPLADGEPGVDISRSFPALAHWITANSDVRPVLGLYAGLPGAAGMRLA
                     AASDVLAETLLRRHPDAALALLGSPTDTYAVPASVVAAARDQLTLRGFRGSAQDLLHK
                     VAPHSLYRLNYTRPIFDADGGAWGLFDNLPALSGPDYALAQRLPRWRAVLARNAGHTV
                     SFTVAPPAWTRSITRETGWRSAAYRASSRFGIEVFDPATARTLLAAKLVADLHAEDES
                     PMSNPEALFATGAAHGGLWRQPFAPRSLLAPAAVSGTVQELLHKLQ"
     gene            complement(168728..169333)
                     /locus_tag="NS506_00182"
     CDS             complement(168728..169333)
                     /locus_tag="NS506_00182"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94269.1"
                     /translation="MAGNAAPEPEPEHGWLALRELAARHAGYFTTRQVLRTGCEVRIR
                     DGLREGSVLRSGVGLLRLADWPDGPLDEYAMWSAWFDGAAAVSHHSAAELHGLGRLRP
                     RFVHLSARVGRFPLSPRLVVLRRGFARKDVESAGAFLVTTPLRTVLDLAEAGIGQAAL
                     DEVVADAVAIHRCARAEIRSASAALDPATASRLHRALTHTR"
     gene            169444..170649
                     /locus_tag="NS506_00183"
     CDS             169444..170649
                     /locus_tag="NS506_00183"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94270.1"
                     /translation="MSSNPTSDDATTRDATPAQSADSAAQPVDLGEPDSTPTESLGAQ
                     QDSHAGVAEGRTEVLDAQTEVLDGHTEVLNGSESTGTAATEWWTDPAARIDEQHTAVL
                     GEHPTQALHPGEAAYAAAGAPTSGGYPLTDQPGYQTGGHQLPPGTPPPPMNVGGGQGG
                     SPGKPRNSRKTLLVVGLVVALLVAGGLAGGEAYARHKVESCISSQFQAQMGSKIDVSF
                     GWKPLLLTMFDNKVSSVTVDSDDTKFGPAQGMVVHATFNDVEVKDSGKQGGTIGSSTA
                     EVTWSNEGITKTLGGLVSGTTSDPNSGTLSFAVLGGLAQLQVKPKIVGDKIEVDTLQA
                     TLLGFGLPTDLVSGIVEVMSESLQSYPMGLQPTKVEVTKDGLHVSLRGGRTELQASTD
                     QNQQQPINC"
     gene            complement(170646..171323)
                     /gene="deoC"
                     /locus_tag="NS506_00184"
     CDS             complement(170646..171323)
                     /gene="deoC"
                     /locus_tag="NS506_00184"
                     /EC_number="4.1.2.4"
                     /function="Cytoplasm; Lyase; Schiff base."
                     /note="Catalyzes a reversible aldol reaction between
                     acetaldehyde and D-glyceraldehyde 3-phosphate to generate
                     2-deoxy- D-ribose 5-phosphate; Belongs to the DeoC/FbaB
                     aldolase family. DeoC type 1 subfamily; KEGG:
                     ncy:NOCYR_5010 deoxyribose-phosphate aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="Deoxyribose-phosphate aldolase"
                     /protein_id="APA94271.1"
                     /db_xref="UniProtKB/Swiss-Prot:B8ZT93"
                     /translation="MPNSVLMAQISRRDVAAMIDHTLLAPEATPADVAALIEEARELG
                     VFAICVSPSMLPVRAPGVVVATVAGFPSGKHHSLVKGAEARLAVDQGAAEVDMVIDVG
                     AARAGDYNAVLADIIAVREAVGDRALLKVILESAALSDEAIVECCRAAEKAGADFVKT
                     STGFHPAGGASAHAVRLMADTVGGRLGVKASGGIRTAAQAAEMIAAGATRLGLSRSRE
                     VLEGFPG"
     gene            171366..171926
                     /locus_tag="NS506_00185"
     CDS             171366..171926
                     /locus_tag="NS506_00185"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94272.1"
                     /translation="MLVGVLIRRERTGDAAAIDAVHRSAFQGAAAAEGDIPSPEPVGD
                     PVEVGLVHRLRDDGSAWIPTLSLVAEFQDQIVGHVCLTRAGVGPFPVLALGPLGVRAD
                     QQGKRIGSALMHAALGAADALDEPLVGLLGSLEFYPRFGFVPGARLGILPDVADWTSH
                     FQVRPLTAYELEIKGDFHYADAFYAL"
     gene            172084..172965
                     /gene="purU"
                     /locus_tag="NS506_00186"
     CDS             172084..172965
                     /gene="purU"
                     /locus_tag="NS506_00186"
                     /EC_number="3.5.1.10"
                     /function="Hydrolase; One-carbon metabolism; Purine
                     biosynthesis."
                     /note="Catalyzes the hydrolysis of
                     10-formyltetrahydrofolate (formyl-FH4) to formate and
                     tetrahydrofolate (FH4); Belongs to the PurU family;
                     Contains 1 ACT domain; KEGG: nfa:nfa52050
                     formyltetrahydrofolate deformylase"
                     /codon_start=1
                     /transl_table=11
                     /product="Formyltetrahydrofolate deformylase"
                     /protein_id="APA94273.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q46339"
                     /translation="MSSTPDDRRFVLTLGCPDRPGIIARITSFIADFGGSIVEAGYHS
                     DLDTGWFFTRQAIKAATVPFELTELRDRFAAVAAELGPETDWQLHDTGERRRAVLLVS
                     KDGHCLHDLLGRATSGELPATIEAVIGNHPDLAGMTEAHGIKFHYVPFPKDPAERGPA
                     FEQVRELVDVHDPHAVVLARFMQVLPAQLCEHWVGKAINIHHSFLPSFVGARPYHQAF
                     ARGVKLIGATCHYVTAELDAGPIIEQDVTRIDHSDTVHDMVRQGRDIERVVLARGLRW
                     HLEGRVLVHGRRTVVFE"
     gene            complement(173029..174030)
                     /locus_tag="NS506_00187"
     CDS             complement(173029..174030)
                     /locus_tag="NS506_00187"
                     /EC_number="3.1.1.24"
                     /function="Aromatic hydrocarbons catabolism; Hydrolase."
                     /note="KEGG: sfh:SFHH103_06748 3-oxoadipate
                     enol-lactonase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate enol-lactonase"
                     /protein_id="APA94274.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q59093"
                     /translation="MLVKLPEAGVVDALTAPFRPGLRSRRYRTAAFNTPRPADVIPVT
                     TRDGAKLRVHAYGPADGEVIVLAHGWSCAIEYWNPQINAFAGEHRVVAFDQRGHGESD
                     SGTRPFSPDQLADDFSDLLDAVLHPGQRAVLVGHSMGGMTIQAWAAKYPEQVQRRASA
                     VLLATTAARQIPNRATVIPLLNDVIPGPDWLAVALFGTPVPLPGGAAVNLIAKHRLTN
                     PGATRDEVDFGVSIVRSCRPSVRAAVARGLVKLDLHGAAANLTVPTTVIAGSHDKLLP
                     EVHSREIADTLADAGYLDRYTVLPTGHLVNIEARHAFNIELHRVIRAARRNPVAVAG"
     gene            174293..175621
                     /locus_tag="NS506_00188"
     CDS             174293..175621
                     /locus_tag="NS506_00188"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94275.1"
                     /translation="MLQPCTLPVALTRVLFPLRKCFTAPTFTTFTMLVAGLFAQPATR
                     TVCGMLTGAGLARVWHHTRAHRFFSAARWDPAQLGLVVAELIVAQLLPPGSAITVAVD
                     DTLCRRRGKRVHAAGWFHDGSAAGRAKLGFGNNWIVLAIVVRLPFTSRPVALPVAAAL
                     FVKGGPAKPDLAREMLDALAERFADRAIHLVADSAYGCGAFAGLGEAMTMTTRAKTNA
                     VFYAPAPPRTGKRGRPALKGDRIGTPAELAVTGGWTPVTVTRYGVTGQVRVIERVCLW
                     FGTWRTDPVRVILVEDPSRSTKTGKSQRYSIALITTDLTSPAAEIIARYADRWAIEVT
                     FFDAKNILGVGQARNRVAHAVTRTVPFGLFAHSILVLWYAAAGHDDNDAALRRIAAPW
                     YRTKTEPSTLDMLVKLRRQLIAARFIPESPRPATTQEIMEVQLAWAQAAA"
     gene            175732..176964
                     /gene="argE"
                     /locus_tag="NS506_00189"
     CDS             175732..176964
                     /gene="argE"
                     /locus_tag="NS506_00189"
                     /EC_number="3.5.1.16"
                     /function="Cobalt; Coiled coil; Hydrolase; Metal-binding;
                     Thiamine biosynthesis; Zinc."
                     /note="Catalyzes the deformylation of the
                     formylaminopyrimidine
                     N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine (FAMP)
                     to give the corresponding aminopyrimidine; Belongs to the
                     peptidase M20A family; KEGG: nbr:O3I_039215
                     acetylornithine deacetylase"
                     /codon_start=1
                     /transl_table=11
                     /product="Acetylornithine deacetylase"
                     /protein_id="APA94276.1"
                     /db_xref="UniProtKB/Swiss-Prot:O31724"
                     /translation="MTAELGQLDFERLLPEKLLLEIASGLTAIASPTGHETPLARHVR
                     KLLRHHGITRKKQVVRPGREQTIARLGPADGTPALLLNGHLDMDPLGRDAGPDRLIAR
                     RDGDRLCGAGRHNMKGGLAAMLGASIIVQRSGIPLRRALLLEFVVGELQGGIGTVFAL
                     EQGYRADAAVVPEPYSVRRVLTRTAGVQKCAIVVHGRRAHTSRHTEGVDAIAVLRRTL
                     DLLDSAHLGLRNPDFETLPRVQIAGLIAGRGETHTLSGISYLADKATALIDVRYPPPY
                     EPRDVIAALETILTQARTEHRDAEITLDHPPDPVFEVGGTDMPPMDESPESELVADIA
                     EILPLVSDYEVEKTGLDLPFSLCGNDTTHLSRAGIECCLFGPRGAGPDTEDHVLISEM
                     YACAKTRAVLALRRCAEL"
     gene            complement(176961..179837)
                     /locus_tag="NS506_00190"
     CDS             complement(176961..179837)
                     /locus_tag="NS506_00190"
                     /function="Acetylation; Cell cycle; Cell division;
                     Cytoplasm; Cytoskeleton; Mitosis; Phosphoprotein; Repeat;
                     TPR repeat."
                     /note="During mitosis, may be involved in the condensation
                     of spindle midzone microtubules, leading to the formation
                     of midbody; Contains 28 TPR repeats"
                     /codon_start=1
                     /transl_table=11
                     /product="Tetratricopeptide repeat protein"
                     /protein_id="APA94277.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q96AY4"
                     /translation="MTRAERRITKADRRRLRDRLAATGLSDAQLLPLLVGELRQQGLR
                     PRAAWRYAAGLARTCGRREIAALTLEDVAEAFNGHRAGRRRTVQGNQISHYERWPAVR
                     NGPRLTVEVLEVLAAIYGTTWEELVDTEDLAHLAAADVERFRDAVTRRTTLRADAPIA
                     DLPPREPNFIGRREAVREIERRVTAHRHDRSAPSVHVIHGHPGVGKTTLARFAEALFA
                     PRYPDGRIWVDLHGYTPGQEPRKPADVLEQLLLEIGVPRETIPADLVRRSDKWRNAMR
                     TKQMYLTFDNAADSDHVRDLLPLSAGSLVVVTSRTHLTKLAGADPLPLDAMNSVEAEQ
                     LLVRLAGLPPGYDRDAAQQIVRTAGNLPLAIKLIAGHIAYHGESMLAAFAADFAELTE
                     RNTSSDRAGDSPARHILDRFSAEDESVRAAFELSYRRLRDPDLQRLVRLLGSFPGSEI
                     TAEILGAMAAISVDEAKSLINRLSEAGLLDVVPGSNHPSRYRMHDLNRLCAQLRAEHE
                     NQPEDRRVAVERIIAHSLTVARQAATLRPFDSAGSPYPATSSLDAATHAREWLSRERE
                     LLLDCLPLAGITSDTADLARLLACHLCSVGHWSDADRLYDRALSIADQLTDPVGRAWA
                     LLGRGRIQRLRGNHERAEATFAAAHRIGVELSDRRIQVESLCERGQSEWITGDYELAR
                     EHFQEALAISREIGHRQTECDALEGLSQAERMASRYRRAEEYSLEALAIASELADLER
                     LGTAQWGYAEVVRLWGQFDVARQPYLMAQRIARSIEHRKMEGDALRGLGHVERMVGNA
                     DVAAKRYGAALEIGRRIGDQYSAEWSLWGLGNLARGRGDHEEARDCFREAYVIAKLID
                     DPLGRIDTLRGLGHTYRQGADRAGTEDYRLARLNYEESLQVAERIGDQLGKADGLRAL
                     GKLACRIGDRAAARELLDQAYALYAEIESPRAELLRSERAELGC"
     gene            180017..180367
                     /locus_tag="NS506_00191"
     CDS             180017..180367
                     /locus_tag="NS506_00191"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94278.1"
                     /translation="MAIQVTDWLITSDLVQEAAFRIDVPGPDRGWWVLSYLPTYRRLS
                     RDQALVGVRLAELILDDSIYRNAESDLLVARLHAEELELELTDAMCLLALRSGEFGES
                     ASEPRNCAEQQVIR"
     gene            180364..180612
                     /locus_tag="NS506_00192"
     CDS             180364..180612
                     /locus_tag="NS506_00192"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94279.1"
                     /translation="MNVQVVQFTELGVLAVLLLFRRRFPPDWFLICFGVVLAAGAAVL
                     LAVATTGGLHIATDPGAVPTQPSGVAGTCEPFCFGPTG"
     gene            180867..181505
                     /locus_tag="NS506_00193"
     CDS             180867..181505
                     /locus_tag="NS506_00193"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94280.1"
                     /translation="MKVKFLAISTGLLMVCSLGAGGASAELVRSPDHTVTKPTVDGWI
                     AEASLVGVLVNTVPNLAQSPWSREAFIDATAVGNVTGQGSTGVKSGVLRTGLQLGCNT
                     DVSSGLQTGSSGSIGPNASVTVSAQPGATLVGNASISPQIQTTIKPGAITTIPLGERV
                     LEGAVGASDLTGIQVNVDSCLGPVSVRVYTQFSISTHVADTTVTVYSDPSTI"
     gene            181505..182602
                     /locus_tag="NS506_00194"
     CDS             181505..182602
                     /locus_tag="NS506_00194"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94281.1"
                     /translation="MAASTDPRNPGFSARALVVGVVLAVLTTSGVLAIGEAGAETPAE
                     RCARETATYNAAWESSWRAANPGNPAPPPPPVPYVCADPGTPPTTTTTPPPTAPGLLP
                     TQAPGGGVQGNAGNAPGRLSDGDGTDIVPGPTTAAPQPQAPPGGRAPAQGRPQDVAGP
                     VEPQDPSCPAGGSGCAERVRPAEQECPSGYVARGNNLCFGVVSTQGKVVPPGSRPLAS
                     QANCTANPADLKKTTSWSSKTALTSTTSKMESTQNTVGGTLTLEGESSIPLLGGIKAS
                     MQAKYENQQKTDTTWLDSTTKEDTYTDTTENRWTVSPGSELEVSQRYTDVYWEVVRKH
                     SFTRVTDGHTYILEPNSYQAKERPAECSAPR"
     gene            182767..183144
                     /locus_tag="NS506_00195"
     CDS             182767..183144
                     /locus_tag="NS506_00195"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94282.1"
                     /translation="MAWPDQRLRPAPAVPGDTVITREQLIGMTMTQARALLDSGSWKP
                     QIREGTIIGYAPGEPVPDKSNIDTWRISMACFSPDYTAYLMAEAPEQFREQLMPRMYD
                     NQYSSPTPQCDGGWSSVNLSKKP"
     gene            complement(183170..183649)
                     /locus_tag="NS506_00196"
     CDS             complement(183170..183649)
                     /locus_tag="NS506_00196"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94283.1"
                     /translation="MLVLTGQFLAALAVLANAVVYGTDWSVALITRSVYRDRLDDATM
                     TISAGWGHHYGDKRMPIFGAGGVITALLTLVIAIAAGHLGAAIAAGIALAALLTWLAC
                     YVLIAKPINTAQTAAAQTGVIPANARALQTKWDSILNARVALQTIALSGLLTTLALF"
     gene            184167..185456
                     /gene="aceA"
                     /locus_tag="NS506_00197"
     CDS             184167..185456
                     /gene="aceA"
                     /locus_tag="NS506_00197"
                     /EC_number="4.1.3.1"
                     /function="Glyoxylate bypass; Lyase; Magnesium;
                     Metal-binding; Tricarboxylic acid cycle."
                     /note="Involved in the metabolic adaptation in response to
                     environmental changes. Catalyzes the reversible formation
                     of succinate and glyoxylate from isocitrate, a key step of
                     the glyoxylate cycle, which operates as an anaplerotic
                     route for replenishing the tricarboxylic acid cycle during
                     growth on fatty acid substrates; Belongs to the isocitrate
                     lyase/PEP mutase superfamily. Isocitrate lyase family;
                     KEGG: mab:MAB_4095c isocitrate lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="Isocitrate lyase"
                     /protein_id="APA94284.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q8RQN6"
                     /translation="MSNVGTPKTAAELQKDWDTNPRWKGVTRNYTADQVVKLQGTVVE
                     EHTLARRGAEILWDLVNNEDYINSLGALTGNQAVQQVRAGLKAIYLSGWQVAGDANLS
                     GHTYPDQSLYPANSVPAVVRRINNALLRADEIAKVEGDTSVANWLAPIVADAEAGFGG
                     ALNAYELQKAMIASGAAGVHWEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADV
                     ADVPSVIIARTDAEAATLITSDVDERDREFLDGTRTAEGFFGTRNGIDPCIARAKAYA
                     PYADLIWMETGVPDLEVARKFAESVRSEFPDQLLAYNCSPSFNWKAHLDDATIAKFQR
                     ELGAMGFKFQFITLAGFHSLNYGMFDLAYGYAREGMTAFVDLQEREFKAAAERGFTAV
                     KHQREVGAGYFDTIATTVDPNTSTAALKGSTEEGQFH"
     gene            185752..186639
                     /gene="paaH"
                     /locus_tag="NS506_00198"
     CDS             185752..186639
                     /gene="paaH"
                     /locus_tag="NS506_00198"
                     /EC_number="1.1.1.157"
                     /function="Fatty acid metabolism; Lipid metabolism; NADP;
                     Oxidoreductase."
                     /note="Belongs to the 3-hydroxyacyl-CoA dehydrogenase
                     family; KEGG: nfa:nfa52290 3-hydroxybutyryl-CoA
                     dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxybutyryl-CoA dehydrogenase"
                     /protein_id="APA94285.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WNP6"
                     /translation="MSSEKMQRVGIIGAGQMGAGIAEVCARAHVDVLVFEQTRELAAA
                     GRARILRSLDRGVSSGKITEREREQAAWRLRFTSDLGDFADRQLVVEAVVENEDVKTA
                     IFAELDKVVTDPNAVLASNTSSIPIMKIAVATNNPERVVGMHFFNPVPVLPLVELVTT
                     LKTTDTVTKRAEQFAADVLGKQVVRSADRSGFVVNALLVPYLLSSIRMVESGFATKED
                     VDKAMVLGCAHPMGPLALTDLVGLDTVKSIADSMYEEFKEPLYSAPPLLSRMVEAGLL
                     GKKAGAGFYQYSSPASPRT"
     gene            186917..189226
                     /gene="metE"
                     /locus_tag="NS506_00199"
     CDS             186917..189226
                     /gene="metE"
                     /locus_tag="NS506_00199"
                     /EC_number="2.1.1.14"
                     /function="Amino-acid biosynthesis; Cytoplasm; Isopeptide
                     bond; Metal-binding; Methionine biosynthesis;
                     Methyltransferase; Transferase; Ubl conjugation; Zinc."
                     /note="Catalyzes the transfer of a methyl group from 5-
                     methyltetrahydrofolate to homocysteine resulting in
                     methionine formation; Belongs to the vitamin-B12
                     independent methionine synthase family; KEGG: nfa:nfa52280
                     5-methyltetrahydropteroyltriglutamate--homocysteine
                     methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="5-methyltetrahydropteroyltriglutamate--
                     homocysteine S-methyltransferase"
                     /protein_id="APA94286.1"
                     /db_xref="UniProtKB/Swiss-Prot:O50008"
                     /translation="MVNVTGGFGSSILGYPRVGEHRQLKRALESYWHGALSRDELLAV
                     GREIQESQFLELAATGLTQVPGNTFSFYDHILDNALLFGAVPQRFEPYREGLDPLDFY
                     FLMARGRPDLPPLELVKLLNTPYHYRQPELETDTEFSLHPEALLDEFDRAKARGIELR
                     PVILGPLSLLLLSKTGHVPGETEFDKLVLLDKLLPVYEELFEILAKRGATCVQLDEPC
                     FTSDRSPSTMELFEKTYQRLSKAPLRPRMLVTGQYGDFGEATEILCRTAVEAIGLDLA
                     SHRVVPEDLAEIPGIKRKRLYAGVISGTNVWRADRYVTLEYLNKLAQVCPDMVVATGA
                     TLLHVPYDVLVEYELEGPVADRLAFAKQKVLEVVSLAKALTEGPSEKWRKKPTSVHFK
                     QKHAVRQRVYAVTPQMRVREPYETRKIAQQAKLRLPLVPATTLGSFPQTAAARQARHD
                     LDQGRLSQDDYRKLIEAEIESSIRLQEDIGLDVFVHGEHERNDMIQFFAEQLDGFATT
                     HFGWVQVYGSRCVRTPIVYGDVARPEAMSVSWTTYAQSLTDKPVKGMVTGPVTMLARS
                     FVRQDQPLYETADQVALAIRDEVVDLEKAGIAIIQVDEPSIRELLPLRKKGQAEYLRW
                     AVGAFKLATSGVKPETQIHTHIGYSSRGDVVAAIEELDADVTAIVATRSIEWVLEALK
                     EDCAEGRGLTHGVGPGVYESRSARIPDIDELDELLTAAAEAVTPERLWANPDGGLKTR
                     HHWQLDPSLRNLVAAARRVRRRAEAAETA"
     gene            189507..190217
                     /locus_tag="NS506_00200"
     CDS             189507..190217
                     /locus_tag="NS506_00200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94287.1"
                     /translation="MGVNRTDRLYAIVEELRAVSPRLRTARELAARHGVSVRTVERDI
                     SALQQSGVPIYADVGRRGGYALEKSMSLPPLNFTAAEAVALAVAVARAGDGPFAAAAQ
                     SALRKILAAMSKQNADTARELALRVRLLESPEFVAPMPVPPEVEQAVVARRVLRIEYL
                     DGAGVLSEREVEPVALLHGSNGWYLLAWCRLRDEPRNFRLDRMKGIELTEYVGPERSI
                     EMCSPKEPVHEVRMISLA"
     gene            190313..190693
                     /locus_tag="NS506_00201"
     CDS             190313..190693
                     /locus_tag="NS506_00201"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94288.1"
                     /translation="MTTPPFNTVAWFQVGSHEPEQVKAFYQELFGWNFAQDPNQDGNY
                     DLVTYPGSEMPVGGIAHLDDASGNHAIFYVLVQDVPEILAAAEKAGGKVFVQPVTAAN
                     GLVFSELLDTSGNRFGIFSPPPAN"
     gene            190804..191001
                     /locus_tag="NS506_00202"
     CDS             190804..191001
                     /locus_tag="NS506_00202"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94289.1"
                     /translation="MGMFDQLKDAAGKAAELAGQHTDKLEPLIDKAGDLLDKQTDGKF
                     EGAVDKVQDAAKQALREQAGQ"
     gene            complement(191125..192177)
                     /gene="yahK"
                     /locus_tag="NS506_00203"
     CDS             complement(191125..192177)
                     /gene="yahK"
                     /locus_tag="NS506_00203"
                     /EC_number="1.-.-.-"
                     /function="Metal-binding; NADP; Oxidoreductase; Zinc."
                     /note="Belongs to the zinc-containing alcohol
                     dehydrogenase family; KEGG: nbr:O3I_039130 uncharacterized
                     zinc-type alcohol dehydrogenase-like protein;
                     Oxidoreductases"
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent alcohol dehydrogenase"
                     /protein_id="APA94290.1"
                     /db_xref="UniProtKB/Swiss-Prot:P0A4X1"
                     /translation="MSTAAAYAVSAPDGAFEKIAIERRELGPHDVLIDVKYAGICHSD
                     IHTARNEWRGTTYPCVPGHEIAGIVAAVGSEVTRHRVGDRVGVGCMVDSCGECEPCLA
                     GEQQYCTRNLVWTYNSAVPTEQQAGGYTFGGYSTQIVVPEGFVLSIPEGIGLDEAAPL
                     LCAGITLFSPLRHWNAGPGKRVAIIGMGGLGHVGVKIAAAMGAEVTVLSHSLSKQEDG
                     VRFGAHHYYATGDRATFKQLRGSFDLIINTVSADLPIDDYLKLLKLDGTLVVLGLPEN
                     PYSVRASTLAGFRRSLSGSMIGGIPQTQEMLDFCAAHGIGAEIEVISADRIDEAYDRV
                     VASDVRYRFVIDTATM"
     gene            192285..193022
                     /locus_tag="NS506_00204"
     CDS             192285..193022
                     /locus_tag="NS506_00204"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94291.1"
                     /translation="MAILLSLISMCATLVGGLLAARIGDRKRLVLGLAAGVMLGVVAF
                     DLMPEALEADERIVLGVPVPLLAAVVGFFTVHIIERSMAIHTGYEDEYVAHRHDHDFS
                     ALGLLAAGGLVFHSTLDGLSIGFGFQAGAAVGAAVAIAVICHDFADGFNTFTITTLYG
                     NARKHALIMLILDALAPVVGAVIGTLVKVPTELVGLYLGYFAGFLLYLATADILPEAH
                     AGKPAKGPLVCTLTGVLFMLGVAALSH"
     gene            193139..194248
                     /gene="degP"
                     /locus_tag="NS506_00205"
     CDS             193139..194248
                     /gene="degP"
                     /locus_tag="NS506_00205"
                     /EC_number="3.4.21.107"
                     /function="Cell inner membrane; Cell membrane; Disulfide
                     bond; Hydrolase; Membrane; Protease; Repeat; Serine
                     protease; Signal; Stress response."
                     /note="DegP acts as a chaperone at low temperatures but
                     switches to a peptidase (heat shock protein) at higher
                     temperatures. It degrades transiently denatured and
                     unfolded proteins which accumulate in the periplasm
                     following heat shock or other stress conditions. DegP is
                     efficient with Val-Xaa and Ile- Xaa peptide bonds,
                     suggesting a preference for beta-branched side chain amino
                     acids. Only unfolded proteins devoid of disulfide bonds
                     appear capable of being cleaved, thereby preventing non-
                     specific proteolysis of folded proteins. Its proteolytic
                     activity is essential for the survival of cells at
                     elevated temperatures. It can degrade IciA, ada, casein,
                     globin and PapA. DegP shares specificity with DegQ. DegP
                     is also involved in the biogenesis of partially folded
                     outer-membrane proteins (OMP) (By similarity); Belongs to
                     the peptidase S1C family; Contains 2 PDZ (DHR) domains;
                     KEGG: eco:b0161 serine protease Do"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase Do"
                     /protein_id="APA94292.1"
                     /db_xref="UniProtKB/Swiss-Prot:P0C0V1"
                     /translation="MDDSRRRDSRRRGRGGRTLALLIAAVVGFAGFLGYRGELPRWSF
                     ADDATASSLVGPSLPPLDVDLVSKVAEPALVNITAGIRPYGLGAAGSGIVLSAEGEVL
                     TSHHVIKGADTVTVSDVGTGATYTATVAGYDSAADIALLELAGADGLPVARIGSSAPL
                     HLGDDVLAIGNAGGTGSPTAVGGPITNLDSTIVARNAADLSRKSLHGMIEVAAAVAAG
                     QSGGALVDRYGAVIGVVTAASGDVAKAMGKGPNGYAVPIDTAMNVVRQIRSGTPTDTV
                     HIGPTATLGILTSDAQPAGARIDVAVYGLPAYTAGLADGEIITALDDRPVTTSQMLKA
                     ALNAHKPDDVVRLGISDPTGGHRTVSVTLTVGPPN"
     gene            complement(194245..194811)
                     /locus_tag="NS506_00206"
     CDS             complement(194245..194811)
                     /locus_tag="NS506_00206"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94293.1"
                     /translation="MISAGPRSAWPLLLGALIGWGASVTLLVEKFKSLTEPGYKPMCS
                     IDATFSCTTVMESDSASLFGFPNPIIGVVGFSVFVTIALLLVVGISLPRWFFGGMWLG
                     LLVGVAAIGWLVWDATFEIHALCPWCMVVWTVTPAMFAIVTGLLFGRSRGLLQILVEW
                     RWTLVAVFYAVVVLIVYIQFQSYWNSKF"
     gene            complement(194808..195635)
                     /locus_tag="NS506_00207"
     CDS             complement(194808..195635)
                     /locus_tag="NS506_00207"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94294.1"
                     /translation="MSAEVSKKPTGQNPLAKAAQADRNRKIFIQVGVAAVLIGLVAAI
                     GITLALRHSDDNQNKSSATATSFAPVVKHDASAGPIPANVTAGGAIRVGDPNAATPGG
                     KKKVTVQVVADMQCPICATFEKANAQALATAATDGTAVVEYNVISFLDRMSKGNKFST
                     RAANAAYVVGSADPSKFQGWLAAMFSKQPAENGNGMSDDQLIQIATDAGYTDPSIAQD
                     IRDGKYTKYVENETQATFDAGVQGTPAVYVNGTQIQDPKVLMTPGGITPVIENAAKG"
     gene            complement(195786..196637)
                     /locus_tag="NS506_00208"
     CDS             complement(195786..196637)
                     /locus_tag="NS506_00208"
                     /EC_number="2.7.4.1"
                     /note="KEGG: bma:BMA0166 polyphosphate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="Polyphosphate kinase"
                     /protein_id="APA94295.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q04605"
                     /translation="MAKATSWSKPVTKALRADGVRVSDLNPSATPGFKGDKKAGELLL
                     EERRAVLSDLQEKLYANGRSGDTRSVLLVLQGMDTAGKGGIVRHVIGSVDPQGVDHAA
                     FGVPTAEERKHHYLWRIRKKLPRGGQIGVFDRSHYEDVLVVRVHDLVPPEVWGKRYDE
                     INKFERKLVDDGTTVVKVAMFVSLDEQKKRLMQRLERPDKYWKFNPGDIDERAYWPQY
                     QEAYQAVLERTNTDHAPWYVLPCDSKWYARLAVTELLIDALQGLKLDWPRADFDIAEQ
                     QKRLAQE"
     gene            complement(196723..197430)
                     /locus_tag="NS506_00209"
     CDS             complement(196723..197430)
                     /locus_tag="NS506_00209"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94296.1"
                     /translation="MKWILTPDEFAMIWTRETHLARRPYPLDTSPAGPESAEDAARFA
                     ITPPGGSPARFLRRTDPELAAALALCARTDTTTVTLYGERTIDPGARRILAFAAVAQQ
                     RAGILVSLPDAVSVSLCPAEQLGRELVEVIGSAPPGQLEPLREPQQAVLYPDAAGTGE
                     EADRFRRKLREPVDGRGFITVTVEPANPLSPPTRHRTWLDFSGDGRYLLTTAADLSLT
                     PVTDEELAAQLVHLARV"
     gene            complement(197533..200400)
                     /locus_tag="NS506_00210"
     CDS             complement(197533..200400)
                     /locus_tag="NS506_00210"
                     /function="Alternative splicing; ATP-binding; Chloroplast;
                     Kinase; Nucleotide-binding; Plastid; Transferase; Transit
                     peptide."
                     /note="Belongs to the protein kinase superfamily. ADCK
                     protein kinase family; Contains 1 protein kinase domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aarF domain-containing protein kinase
                     chloroplastic"
                     /protein_id="APA94297.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q8RWG1"
                     /translation="MAKELPTSRLARGTKLGIAVAGNALRAQKTRRSMRGRSEAVRAR
                     MAEESMIRATEQMVMVLGTMKGVAMKLGQMLSVLDLDLVPPEHRERFQRRLAVLRDSA
                     PSVSFDVMRAVIEEDFGQPLEAVFAEFNPEPVAAASIGQVYKGTLHDGREVAVKVQYP
                     GIDAAVRADLKNLAMFRRILQSAMPWVTPAVLDELRLNLESELDYVAEANTQKQISEL
                     FTGHPFIVVPTTYPELSTTRVLVSEYFAGRGFEEIRELPAAERNRIGEIIYRFYVGSL
                     FTFNEFCGDPHPGNLLLGPDGRVAFLDFGLYNRMDPEHVQFEAICIRAAAEERAEELR
                     DLMIKRGVIESAEEITPEECLEYVLAACEWALVDEELTITPELASGAFVLAVDPRATD
                     FAGMKQQNLPPEHLFSRRADFLTFGMLGQLEATGNWHRIAREWLYGEDPVTELGRAHH
                     EWLASRPAPTPTTGGRPRRPVSAPRRRKPHPMGKAMANREFDIVLFGATGFVGKLTAQ
                     YLAESAPAGARIALAGRSAEKLAAVRSELGAAAAEWPLVQADSTDQASLDALAARTKV
                     VVTTVGPYLRYGFPLVQACAENGTHYADLTGEPLFIRDCIDRFGEKAAETGAKIVNSC
                     GYDSIPSDLSVYQLYKRSVADNTGELTDVTLVASLKGGASGGTIDSGRAMMEAIAADP
                     KKGSIMSHPYSLSPDKSMEPDVGRQSDQALSRASAIDPRLDGWVATFIMGAHNTKIVR
                     RSKRPAGLALRQELPLPRGHERGLLGHRAPGRRGYRGRHRGHHGRGRGPVPSGHGPQA
                     HRPHRPQARHRPERTYPPQRLVHHAHLRPHHLRREIPLHLRRQGRPRLPGHLGHARPI
                     RPLPRLRHPPRIGGHPHPGLRHGRRPHRPPPRRGHHHRGHPRLTRALRPERVIRTQEP
                     ELEVHVRGAALPSPGSPITPGHSPIEGAAFGSDSKSVAGVR"
     gene            complement(200512..201243)
                     /locus_tag="NS506_00211"
     CDS             complement(200512..201243)
                     /locus_tag="NS506_00211"
                     /EC_number="1.3.3.6"
                     /function="DNA-binding; Transcription; Transcription
                     regulation."
                     /note="Contains 1 HTH tetR-type DNA-binding domain; KEGG:
                     cdo:CDOO_09020 acyl-CoA oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="Acyl-CoA oxidase"
                     /protein_id="APA94298.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WMD8"
                     /translation="MTTKGTVSAAMEAATGPRGGRVDGRKRRWQQHKIDRREELVDGT
                     LAAIRKRGGDAGMDEIAAEIGVSKTVLYRYFSDKQDLTRATMERFIETTLMPRIYEAI
                     SDDLDEYQLVRNTLAAYVHTVDSDTDVYRFIMGNGSATDTSTLADFEKLFAQVVSAVI
                     IDKSFDRGVQTEGSMLWSYVLVGGVQLATDWWISNRTMSSEEMLDYLTMMAWSAIEGM
                     VRAGGDRHYFNSKTHVLPDPENTAS"
     gene            201301..202743
                     /locus_tag="NS506_00212"
     CDS             201301..202743
                     /locus_tag="NS506_00212"
                     /function="Cell membrane; Membrane; Transmembrane;
                     Transmembrane helix."
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94299.1"
                     /db_xref="UniProtKB/Swiss-Prot:P39385"
                     /translation="MLWIGVDRDGPGDGEFVTPRARMEDMEQSTGSAGVLETTEPGPT
                     KTTPPAGRTTPPGGALADFLDEEGKKRELWRMKSIATGFLAAATIIYIFCAWTASRGA
                     GGEWVGYVKAASEAGMVGALADWFAVTALFRHPLGLPIPHTAIIRKKKDQVGAGLGEF
                     VRENFLSPDAVAAKVNSAQISLRLGRWMAEPEHAERISDESATILRAVIGVLRDEDVE
                     QIIDNTIVKRIAEPLWGPPIGKVLNELIADNRQAPLLDLLAERAHQWALDSQETLDRI
                     VHRDAPSWAPKFVNSLLAERIYRELVEFTWKVRTQPDHEVRLAANRFLEDFAHDLQYD
                     DAMIEKAEKIKTELMGRREVTGMAQATWRAAKRLIMESAEDPNSTLRRKVSENVQQLG
                     ERLSTDPEVRDKVDGWLERGVRYLVANYGAEFATLVSDTVARWDADEASRKIELAAGK
                     DLQFIRINGTVVGSLAGLVIYAVSHLLFNG"
     gene            202881..203411
                     /locus_tag="NS506_00213"
     CDS             202881..203411
                     /locus_tag="NS506_00213"
                     /function="DNA-binding; Transcription; Transcription
                     regulation."
                     /note="Contains 1 HTH cro/C1-type DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative HTH-type transcriptional regulator"
                     /protein_id="APA94300.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WMH8"
                     /translation="MKHDPEVPEPIEGDPETSAAADRSGRVANAAHDIGGFIRAQREA
                     AQVSLRQLAQLAGVSNPYLSQIERGLRNPSAEVLAQIAKGLRVSSEVLYMRAGYLEQR
                     PHGPVRDALLADVNLTERQKQVLLDIYESFCRENQANEDRGDATDLKGGVPGGNRDNE
                     VPHRTTEVPPRQENEP"
     gene            203408..204076
                     /locus_tag="NS506_00214"
     CDS             203408..204076
                     /locus_tag="NS506_00214"
                     /function="Cell adhesion; Glycoprotein; Hemagglutinin;
                     Heparin-binding; Virulence."
                     /note="Required for extrapulmonary dissemination. Mediates
                     adherence to epithelial cells by binding to sulfated
                     glycoconjugates present at the surface of these cell;
                     binds heparin, dextran sulfate, fucoidan and chondroitin
                     sulfate. Promotes hemagglutination of erythrocytes of
                     certain host species. Induces mycobacterial aggregation;
                     To M. leprae HbhA"
                     /codon_start=1
                     /transl_table=11
                     /product="Heparin-binding hemagglutinin"
                     /protein_id="APA94301.1"
                     /db_xref="UniProtKB/Swiss-Prot:P0C2T3"
                     /translation="MTEPKLTATVTKPIYATVGAGDAIYAAVLDAVSQIRERANSADV
                     PGRIEEARERFANLPADLQGQAETLRQRVQALPSELPEDLAELREKATPEELRKLVDQ
                     YYHQLLDLYADLAARGEETVEKLRSNPAFEERFEQVETRYNDLLAQTQDIIGKVSEQV
                     GPYIGLAKEEAPVEEAVDAEVVDVTTETAPVEDEAPVKKAAPAKKAPAKKAAPAKKAA
                     PAKK"
     gene            204222..204506
                     /locus_tag="NS506_00215"
     CDS             204222..204506
                     /locus_tag="NS506_00215"
                     /function="Membrane; Signal; Transmembrane; Transmembrane
                     helix."
                     /note="To M. tuberculosis Rv0476"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94302.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9CB43"
                     /translation="MGIPSLILTVLQLCALGMTVFALVHAIRQRPDAFTAVDKLTKPV
                     WIAILAASLGALLLVGTPVGILGIAAVVATGVYLADVRPKVDEIQRGPRW"
     gene            204705..205727
                     /gene="pcaL"
                     /locus_tag="NS506_00216"
     CDS             204705..205727
                     /gene="pcaL"
                     /locus_tag="NS506_00216"
                     /EC_number="3.1.1.24"
                     /EC_number="4.1.1.44"
                     /note="KEGG: met:M446_4655 3-oxoadipate enol-lactonase /
                     4-carboxymuconolactone decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate enol-lactonase"
                     /protein_id="APA94303.1"
                     /translation="MRAMLPHSSDLSRKVRDLVRAHRAELRTRTYGNADLNPPAGPCE
                     VVPVVAADGARLRVHAYGPADGDVIVLVHGWTCCLEYWNPQINAFAGEYRVIAYDVRG
                     HGESELGTAPLTTDRLADDLADVLDTVLQRGQRAVLVGHRLGGMTIQAWAGRYPHRVQ
                     RQLLAVLLTNTAAGDLIAETTVIPFLNRGLARLPFRAGLLGLSAPILFPPIAPVRWIF
                     RRQIMSLATVGHLAAFGLNIVRSCPARVRGRFGTLLSHLDVGRGAAKLTVPTTVIAGS
                     ADDMTPPVHSERIVEMLTEAGSLDGYKILPTGHLGNVEAYQEFNVELARVAKSAFGIP
                     ARVVGA"
     gene            complement(205808..207136)
                     /locus_tag="NS506_00217"
     CDS             complement(205808..207136)
                     /locus_tag="NS506_00217"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94304.1"
                     /translation="MLQPCTLPVALTRVLFPLRKCFTAPTFTTFTMLVAGLFAQPATR
                     TVCGMLTGAGLARVWHHTRAHRFFSAARWDPAQLGLVVAELIVAQLLPPGSAITVAVD
                     DTLCRRRGKRVHAAGWFHDGSAAGRAKLGFGNNWIVLAIVVRLPFTSRPVALPVAAAL
                     FVKGGPAKPDLAREMLDALAERFADRAIHLVADSAYGCGAFAGLGEAMTMTTRAKTNA
                     VFYAPAPPRTGKRGRPALKGDRIGTPAELAVTGGWTPVTVTRYGVTGQVRVIERVCLW
                     FGTWRTDPVRVILVEDPSRSTKTGKSQRYSIALITTDLTSPAAEIIARYADRWAIEVT
                     FFDAKNILGVGQARNRVAHAVTRTVPFGLFAHSILVLWYAAAGHDDNDAALRRIAAPW
                     YRTKTEPSTLDMLVKLRRQLIAARFIPESPRPATTQEIMEVQLAWAQAAA"
     gene            complement(207275..207874)
                     /locus_tag="NS506_00218"
     CDS             complement(207275..207874)
                     /locus_tag="NS506_00218"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94305.1"
                     /translation="MTGADLGVTAAEHAILAAAFRDDTRPDAWMPPGEDYRHRAYQCF
                     ELSIPRVDLRIVADPPPYWQSTEVNPLLGGIARRFHLIPEAHPATAVVAKIVDGVTRS
                     LLSARVLDPRRNPSCLVDAHYIRILAPGRPAPEGIHRDGLLAGSAHLVGRENITGGVS
                     EVFDGETRDLLHRFILDDPLDSYVFDDELDFRIFRRWSR"
     gene            complement(208263..208685)
                     /locus_tag="NS506_00219"
     CDS             complement(208263..208685)
                     /locus_tag="NS506_00219"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94306.1"
                     /translation="MAVTDSQWLFTSDVVREVAFRIDVPEQHRGRWVLSYLPTYRRLS
                     KEEAFAGLVLAEMIFIGLLRPGGEFDTEVAALHAGMIGLTVTDAMCLLALREARRDRE
                     PRPDEEDESTGSRHRSLGRCHPTTPTREPKRPGRESIR"
     gene            208873..211659
                     /locus_tag="NS506_00220"
     CDS             208873..211659
                     /locus_tag="NS506_00220"
                     /function="Activator; Antibiotic biosynthesis;
                     ATP-binding; DNA-binding; Nucleotide-binding;
                     Phosphoprotein; Pigment; Repeat; TPR repeat;
                     Transcription; Transcription regulation; Two-component
                     regulatory system."
                     /note="Global regulatory protein for secondary metabolite
                     formation. Belongs to the AfsR/DnrI/RedD regulatory
                     family; Contains 1 NB-ARC domain; Contains 1
                     OmpR/PhoB-type DNA-binding domain; Contains 3 TPR repeats"
                     /codon_start=1
                     /transl_table=11
                     /product="Regulatory protein AfsR"
                     /protein_id="APA94307.1"
                     /db_xref="UniProtKB/Swiss-Prot:P25941"
                     /translation="MADAGVWRRIVSQKSTVSQKSTVSQKSTVSRNGDTDVVGAEARK
                     ELRRILLGIGLRENELLEPLVAELRYRGCRPRRAWRLANEFTQQQVADEFNRLTGKAS
                     APMKAARISEYESWPGPRGAAAEGSRARAHPRPTLEVLKNLAAIYRTSWDQLVDTADL
                     AHMPGTEVAAYRAVVSRRTTALPAASDTGFPSGLVPFVGRSEQQRMLRERVEAHLSAG
                     GPRVHVVNGLAGVGKTALARWLVETFEDRYPDGVIWEDLHGHTDGRKAREPAGVLEQV
                     LLKIGVAPETIENDTSRRAARWRLEMRDRRSLVVLDNALDSKQVRALLPEARDGFVLI
                     TSRHKLTGLTGAMPLQLDAMGPAEAEQLLVELGHLPTNYDVDAARLVLRTAGGLPLAI
                     RLIAGQIAYQGPDLLGTAAAEFTKLADRMRAGPGDGAEDSLPERALDLFSAEGETLSA
                     AFELSYQRLPDPVLRRAVRLLGWFPGTEITAETLAPMVDVPQAQAFGLIRQIFEVGLL
                     DPAEGGPTGQRYRIHDVTRLFARVKADAEDPPTEHPAAVGRLVRQCLLVARQAGVQRP
                     YEAVGGFSAPPAPDPTGATERARDWLNRERELLLGCVSVTGTDPDTGELARLLGAHLS
                     ELGHLSDAEGLLFRALDIAKEGGDRLTCCDIYFELGTLYRRACRYETASTAFQEAHDI
                     ATALGDSRLIAASLWGFAEVVRTIGDYDRARSAYSDVLGMARQLENPKFEGDALRGLG
                     HMERTGGDRAIAHRCYLDALTIASEIGDRYSLGWSLWGLGSVSRESGRFGTARGQLDE
                     AYRIGTEIGDHLLRADCLRGLGHLERDAGDLDAAQEYYADSLEITRRTRDPHGEADVL
                     RALAYIAIRSGGAHWRPCDLLHKSLLLYEGMGIKLADQVRAELTQALDRCRRESVTLP
                     DRVQEDLRRLGFDC"
     gene            211758..212495
                     /gene="nboR"
                     /locus_tag="NS506_00221"
     CDS             211758..212495
                     /gene="nboR"
                     /locus_tag="NS506_00221"
                     /EC_number="1.1.1.328"
                     /note="KEGG: nbr:O3I_039250 nicotine blue oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="Nicotine blue oxidoreductase"
                     /protein_id="APA94308.1"
                     /translation="MNPERCDGILLAAGAGRRYGMPKVLAEDGVWLRSAVEALRAGGC
                     SRIFVVLGATGPAHRTAAGAWLVSQTSGIPLPPGVHPVWAADWKIGVSASMRAGLAAA
                     ATPRLSAAGREFAGRTADSSLAARTIPAGNIATGNSGPGKVDDGPAGYAAIMPVDTPD
                     VGGAVVARVIAAAQVSESRLARAVFGGVPGHPVVLGRAHWAGACASAAGNSGAGTYLR
                     QRADMVCVTCDDLATGIDRDYPAGGAR"
     gene            212509..213534
                     /locus_tag="NS506_00222"
     CDS             212509..213534
                     /locus_tag="NS506_00222"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94309.1"
                     /translation="MREIIEDLLRVWHSGRTGGLATLVRTQGATSVPVGSAMVVDADG
                     RAFGSISAGCAEAAAYEAAMESARTGRRGLQRFGPGSGLDAQMDCVGTLDVFTEPFSR
                     RHFPEFPDVAADIAAQRQVTVFTVVWHSDPDVIGQHLITDRKHGTELVSLPDSDVFVS
                     SFARPPHLILVGANTFAGALATQAKLLGYRITIVDARPTFANAAAYPGCEVVVDWPHR
                     YLNTQASAGEIDSNTAMVVLSHDPKFEIPLLTVALRLPELGYLAALGTPASHAHRLEA
                     LQAGGFTDDTLARLHSPAGLDVGARTPAETAVAIAAELLAVRNGTSAEPLSTSPGRGK
                     RHVQLVR"
     gene            complement(213556..214662)
                     /locus_tag="NS506_00223"
     CDS             complement(213556..214662)
                     /locus_tag="NS506_00223"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94310.1"
                     /translation="MSGLFRPGPASQLSQSSLGRRSFLRYAGLAGVAVGGAGVLAACG
                     GSSSSGGGSSADGSKFGTVAVQLSWLKNIEFAGEYFADSKGYYKNAGFGSVNLVAGGA
                     ASTSVEAGLGTGKIWIGMSAPQTTAPAVLEGLNAKIVGTTYQKNPFCIVSSAKKPILN
                     PKDMKGRKIGVQDTNQLIFNALLTANGMTPSDVTIVPAQFDPTPLANGEVDGWVSYAT
                     NEPITLASKGFQNMNFLFADYGLPLVAETLTVSQKTIDSERDKLKAFLVAEIKGWKDA
                     VASPEESARLAVEVYGKDQQLELKEQTMEASAQNGLVVSADSKANGLFTMTDALIEQN
                     IAALGKAKIDIKASQLFDLSVLKEVYAEHPELKA"
     gene            complement(214742..215545)
                     /locus_tag="NS506_00224"
     CDS             complement(214742..215545)
                     /locus_tag="NS506_00224"
                     /function="Cell membrane; Membrane; Nitrate assimilation;
                     Transmembrane; Transmembrane helix; Transport."
                     /note="Probably part of a high-affinity binding-protein-
                     dependent transport system for nitrat; probably
                     responsible for the translocation of the substrate across
                     the membrane; Belongs to the binding-protein-dependent
                     transport system permease family. CysTW subfamily;
                     Contains 1 ABC transmembrane type-1 domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Nitrate transport permease protein NrtB"
                     /protein_id="APA94311.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q51881"
                     /translation="MKTLNVLRPIGKFLLPLLVSLILLVALWYGFLKLYPQVGLVGKS
                     PGDVWHYLVTGPTSEGARRVIFDEMRITLRDALIGFGVGLGAALVVAALFIGVPAVAQ
                     AFMPVAMLLRSVPLVAITPIIVLVFGRGLLGVTVMAAIVVFFPALVMIMTGLRSAPRQ
                     ATELVVAYGGSNWTAMRMVAIPAALPSVFAAARVSVPGALIGALLGEWLGSGTGLGAG
                     LIRAIPTFQYNRLWASIALVTVVSVFAYAVVGVLANLVLARFAPEQSRD"
     gene            complement(215545..216306)
                     /locus_tag="NS506_00225"
     CDS             complement(215545..216306)
                     /locus_tag="NS506_00225"
                     /function="Cell membrane; Membrane; Transmembrane;
                     Transmembrane helix; Transport."
                     /note="Participates in a thiamine pyrimidine salvage
                     pathway as part of the ABC transporter complex ThiXYZ
                     involved in the import of thiamine degradation products
                     such as the formylaminopyrimidine
                     N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine (FAMP).
                     Is probably responsible for the translocation of the
                     substrate across the membrane; Belongs to the
                     binding-protein-dependent transport system permease
                     family; Contains 1 ABC transmembrane type-1 domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Formylaminopyrimidine transport permease protein
                     ThiX"
                     /protein_id="APA94312.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9K9G6"
                     /translation="MRERFRITRLGGAAGILALLALWTVLAEIRVANGTVPSPWTVVH
                     TMYTDGWALYGPNFRVTAWGALQGFAWGNGLAIALAVLVVLIPPIEMLVTQLAILSYC
                     TPLLALGPIILVVFGGRTPTVFLAAMYCFFTTMVGTVSGLRSADRTSLDLVRAYGGGR
                     WERLRRVQLIAALPNTLAALKIAAPSAVLGAIIGEYLGGVDSGIGVALTAAQTAYLVP
                     RTWGMALAAAALAGLGYAIVALVARVAVPWTRAEA"
     gene            complement(216303..217175)
                     /locus_tag="NS506_00226"
     CDS             complement(216303..217175)
                     /locus_tag="NS506_00226"
                     /function="Antibiotic resistance; ATP-binding; Cell inner
                     membrane; Cell membrane; Hydrolase; Membrane;
                     Nucleotide-binding; Transmembrane; Transmembrane helix;
                     Transport."
                     /note="Part of the tripartite efflux system MacAB-TolC.
                     MacB is a non-canonical ABC transporter that contains
                     transmembrane domains (TMD), which form a pore in the
                     inner membrane, and an ATP-binding domain (NBD), which is
                     responsible for energy generation. Confers resistance
                     against macrolides; Belongs to the ABC transporter
                     superfamily. Macrolide exporter (TC 3. A. 1. 122) family;
                     Contains 1 ABC transporter domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Macrolide export ATP-binding/permease protein
                     MacB"
                     /protein_id="APA94313.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q4KES7"
                     /translation="MSSEVAAGTGIHISGLSKTFRSGRRVVQALDAVDLHTAQGAFLS
                     LLGPSGCGKSTILRILADLDSPSAGTAKINGETPAELRRRHEFGIAFQDSALLPWRSV
                     ESNIRLPLQVAGLPVDKELITDLIRLVGLEGFEKAKPAQLSGGMRQRVSIARALVVKP
                     TVLLLDEPFGALDDMTRQRLNLELLRIWTEKPATTLMVTHGIAEAVFLSDVVAVMSPR
                     PGRVVEVVNIDLPRPRTPEMMRSPEFHKLHDYLQELLFGRSGQGGVASDSGGAAEIGG
                     PSEIAGVSEGGAAE"
     gene            complement(217241..217651)
                     /locus_tag="NS506_00227"
     CDS             complement(217241..217651)
                     /locus_tag="NS506_00227"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94314.1"
                     /translation="MSDLDTQPDPGSGVGDRFRMPRVVRAAQVLALGLAGLGIACVAS
                     SGWLLGARAAIPTVVPFVPAFVLGLIALTFNSEGQGVRIGAILVAVMNMLWTVPSITE
                     GRPPGPLGPLVSLAVIVLLFRKEARDWFEPDAWW"
     gene            complement(217723..218667)
                     /gene="lacC"
                     /locus_tag="NS506_00228"
     CDS             complement(217723..218667)
                     /gene="lacC"
                     /locus_tag="NS506_00228"
                     /EC_number="2.7.1.144"
                     /function="ATP-binding; Kinase; Lactose metabolism;
                     Nucleotide-binding; Transferase."
                     /note="Belongs to the carbohydrate kinase PfkB family.
                     LacC subfamily; KEGG: bcr:BCAH187_A2110 tagatose
                     6-phosphate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="Tagatose-6-phosphate kinase"
                     /protein_id="APA94315.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q8E4R7"
                     /translation="MILTVTMNPAYDMTYRVEHFERGRAQRVRSVDQRLGGRGINVTR
                     VLNQLGKYARATGFADHSFAAAAELEIPVDFVHALPWVRRTVVISESDDGTATALWEP
                     GPRVTEPHAVDQLRVRVAGLLSDMNGLVIAGSLPGGVSPGLPAELARTAIAAGVPTIC
                     DFDGQALELAARVPGVVLTPNTDELERLTGRPAGTIAEILAAVEPLIADGVGAVVVTR
                     GGAGMVAVTATRAWTASLPKPLAGNPTGAGDAAVAAIIAAFATEPVPDWPAILADAVA
                     TSAAAVVIPVAGEIDRVLRDRLLPTVQVRELESVAVRP"
     gene            218763..219212
                     /locus_tag="NS506_00229"
     CDS             218763..219212
                     /locus_tag="NS506_00229"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94316.1"
                     /translation="MSAVHPLPPKHLLLQACRGLPPDDHPVLRCAGLLADLHEQRLTS
                     PAGTDRIDHDRARLVHDIDSWVAAELPKAARDAHLHTETVGTVVDRLAQLSALAYLTL
                     AMSPDDAMHEAAQRLTELAIAYEDLAGELAAGRRRLPNLTGTPDYDS"
     gene            complement(219490..220971)
                     /gene="lig1"
                     /locus_tag="NS506_00230"
     CDS             complement(219490..220971)
                     /gene="lig1"
                     /locus_tag="NS506_00230"
                     /EC_number="6.5.1.1"
                     /EC_number="6.5.1.6"
                     /EC_number="6.5.1.7"
                     /function="ATP-binding; Cell cycle; Cell division; DNA
                     damage; DNA recombination; DNA repair; DNA replication;
                     Ligase; Magnesium; Metal-binding; Nucleotide-binding."
                     /note="DNA ligase that seals nicks in double-stranded DNA
                     during DNA replication, DNA recombination and DNA repair;
                     Belongs to the ATP-dependent DNA ligase family; KEGG:
                     asd:AS9A_2748 DNA ligase 1"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA ligase (ATP)"
                     /protein_id="APA94317.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q5YNY7"
                     /translation="MRATSSRKNKINIFAELLKTAGPPQLAQVVAWLSGDPVQGRIGT
                     GWRTLMSLEVESATEPTLTVAEVDRVFDELAAVGGAGSAARRQQLLTALFAAATEAEH
                     EFLLRLLTGEMRQGALTAIVAEAVAVAFDVPIAAVRRAHMLSGQLPVTALAALTGGAE
                     ALAEFRLEVGRPIQPMLASPGASLDEALDEFDGEATVEHKMDGARIQVHRDGDRVWVF
                     TRTLRDITASVPELVDLVRKLACTSLVLDGETLALNDSGRPRPFQETMSRFGAATAQE
                     LLLHPYFFDCLHLDGVDLLDRPLRERRAALTGVAGGLSIPALIAPDAEAAAEYFDGAL
                     AAGHEGIMIKSLAAPYAAGRRGRAWQKIKPTHTLDLIVLGAEWGYGRRTGYLSNLHLG
                     ARDPEGGEPIMVGKTFKGLTDALLQWQTAEFPRHERDRDASTVYLYPELVVEIALDGV
                     QVSPRYPGGAALRFARVVRYRPDKEPAQADTIDTIRALLPGAR"
     gene            221114..222523
                     /locus_tag="NS506_00231"
     CDS             221114..222523
                     /locus_tag="NS506_00231"
                     /function="DNA-binding; Repressor; Transcription;
                     Transcription regulation."
                     /note="During growth on glucose, RamB negatively controls
                     the expression of aceA, aceB, ack and pta genes which are
                     involved in acetate metabolism (PubMed:15090522,
                     PubMed:17114251). RamB is also a negative regulator of
                     rpf2 gene expression during growth on acetate as the sole
                     carbon source (PubMed:18355281); Belongs to the
                     short-chain fatty acyl-CoA assimilation regulator (ScfR)
                     family; Contains 1 HTH cro/C1-type DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator RamB"
                     /protein_id="APA94318.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q8NTD8"
                     /translation="MAKTYVGARLRQLRTERGLSQVSLAKKLEISASYLNQIEHDVRP
                     LTVPVLLRISEVFGVDAGFFSSQDDTRLIAELQEVVMDQELGVEADAQEIAEMVSAHP
                     GLARAMVNMHRRYRNTTAQLAAATEDRFADGSGSAAISKPHEEVRDYFYQRQNYIHEL
                     DTAAEELTHRMRFHGGDLKREIPRRLADAHGVQIVERIDLGDGLLHRFDPEQRRLEIA
                     PHLSGGQRVFKLAAELAYLECGDLIEKLVAEGNFSGHDSVVLAKLGLANYFAAATVLP
                     YSHFHEVAEDFRYDIERLSAFFTQSYETICHRLSTLQRPKLRGVPFSFVRVDRAGNMS
                     KRQSATGFHFSSSGGTCPLWNVYETFAYPAKIMTQIAQMPDGRKYLWVARTVERRATR
                     YGEPSKTFAIGLGCELRHAGRTVYADGLDLNEPKATPIGAGCRVCERSSCPQRAFPPL
                     GKTLDISEHRSSISPYVIQ"
     gene            complement(222534..223529)
                     /locus_tag="NS506_00232"
     CDS             complement(222534..223529)
                     /locus_tag="NS506_00232"
                     /EC_number="2.7.11.1"
                     /function="ATP-binding; Cell membrane; Kinase; Membrane;
                     Nucleotide-binding; Serine/threonine-protein kinase;
                     Transferase; Transmembrane; Transmembrane helix."
                     /note="Belongs to the protein kinase superfamily. Ser/Thr
                     protein kinase family; Contains 1 protein kinase domain;
                     KEGG: mtu:Rv2088 serine/threonine protein kinase,
                     bacterial"
                     /codon_start=1
                     /transl_table=11
                     /product="Non-specific serine/threonine protein kinase"
                     /protein_id="APA94319.1"
                     /db_xref="UniProtKB/Swiss-Prot:P65733"
                     /translation="MGELLATLAYAAPEQVSDQPVDHRADQYALGCTLFALLTGHAPF
                     TASNAGAMVAAHLTRPVPSASTAAPGVPPELDAVIARAMAKDPAGRFATCAEFAAAAR
                     RALAGARPVPPTVVRIPQPPAPAPPPTVRWNPAVPPVNPGAGQVSSRWRTASVLLMVA
                     GLVAVAGIGAAGVYWKFLRPTGPRPLPWGAHHALAVNYPRLVPVDPAGTGWRDARCSA
                     VGTVAALAGDPAPVRQIICNQPDGITIWYTQYDRADDVKNYLAAHTVRVEGEHEIANS
                     FGEMVLQRPKDPAAPFTLATYGWISPGLSESLVEVSWPGHTFEDVRDQWWQPAPF"
     gene            223591..223896
                     /locus_tag="NS506_00233"
     CDS             223591..223896
                     /locus_tag="NS506_00233"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94320.1"
                     /translation="MQSIRYSAQTPNDLGYSIVRSDADKTVTTTLTGGTFQLAADSVH
                     ILDASGAVVSSPPLAMSAEGTDLVVSMNPSIEDNGAKLVAHPAAAEASASSRCRSRP"
     gene            223893..224030
                     /locus_tag="NS506_00234"
     CDS             223893..224030
                     /locus_tag="NS506_00234"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94321.1"
                     /translation="MIGAMIGGGTGSAAGAGTTNDDRQDGWTWQQDCHTDYYTHTQYC
                     Y"
     gene            224320..225594
                     /locus_tag="NS506_00235"
     CDS             224320..225594
                     /locus_tag="NS506_00235"
                     /function="Kinase; Repressor; Transferase."
                     /codon_start=1
                     /transl_table=11
                     /product="Aliphatic amidase expression-regulating protein"
                     /protein_id="APA94322.1"
                     /db_xref="UniProtKB/Swiss-Prot:P27017"
                     /translation="MHDSPRRDRATRLMKAITIPTALALSAVMLAGCGSRDSDTASGS
                     NAKSCVDTSKDTIKIGSLHSLTGTMAISEVTVANATKLAVDQINAAGGVMGKKLEVVL
                     EDGASDPKTFAEKAEKLISSDCVAAVFGGWTSASRKAMKPKFESLNSLLYYPVQYEGL
                     EDSKNIFYTGATTNQQIIPALDYLKQKGVTSLYLVGSDYVFPQTANREIKAYAKANGI
                     EIKGEDYAPLGSTDFSTIVNKVRSSKAGAVFNTLNGDSNVAFFREYANAGLKAADMPV
                     VSVSIAEEEVGGVGVQNVAGQLTAWNYYQTVDSPANKAFVSAYKAAYGAGKPTSDPME
                     AAYASVFLWKNTVEKAKSFAVADIQASADGVSFDAPEGTVVIDGSNHHITKTARIGEI
                     HPDGLIYTVWDSGKPVSPDPYLKNYDWAKGLK"
     gene            225686..226570
                     /locus_tag="NS506_00236"
     CDS             225686..226570
                     /locus_tag="NS506_00236"
                     /function="Amino-acid transport; Cell inner membrane; Cell
                     membrane; Membrane; Transmembrane; Transmembrane helix;
                     Transport."
                     /note="Part of the binding-protein-dependent transport
                     system for branched-chain amino acids. Probably
                     responsible for the translocation of the substrates across
                     the membrane (By similarity); Belongs to the
                     binding-protein-dependent transport system permease
                     family. LivHM subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="High-affinity branched-chain amino acid
                     transport system permease protein"
                     /protein_id="APA94323.1"
                     /db_xref="UniProtKB/Swiss-Prot:P0AEX8"
                     /translation="MDVAVGQLFTGLSLGSILLLAALGLSLTFGQMGVINMAHGEFIM
                     AGCYTTYVVEQLISATGVALIVSLLVGFLVGGLLGAALEMGLIRWMYDRPLDTLLVTF
                     GVGLVLQQAVRDIFGAPAKNVVAPDWLTGGITIAGTVVPKTRIFIMVLAVVAVIALAT
                     ALKTTPLGRRIRAVVQNRSLAETSGVSSRLTDVSTFFIGSGLAAVAGVALTLIGSTSP
                     TIGQSYLVDAFLVVVIGGLGQIKGTVIAAFAMGLLNSFVEYSTTATVAKVIVFIVVVI
                     FLQVRPQGLFTVRTRSLA"
     gene            226567..227745
                     /locus_tag="NS506_00237"
     CDS             226567..227745
                     /locus_tag="NS506_00237"
                     /function="Amino-acid transport; Cell inner membrane; Cell
                     membrane; Membrane; Transmembrane; Transmembrane helix;
                     Transport."
                     /note="Component of the high affinity leucine, isoleucine,
                     valine, transport system (LIV-I), which is operative
                     without Na(+) and is specific for alanine and threonine,
                     in addition to branched-chain amino acids. Belongs to the
                     binding-protein-dependent transport system permease
                     family. LivHM subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="High-affinity branched-chain amino acid
                     transport system permease protein BraE"
                     /protein_id="APA94324.1"
                     /db_xref="UniProtKB/Swiss-Prot:P21628"
                     /translation="MTIVQRLRANSSLKALGGFAIAAIVLFGIAPAMLTDFRLSLLAK
                     FLCFAIVAVGIGLAWGRGGMLTLGQGVFFGIGAYIMAMHMQMADTAKAHEDVPEFMTI
                     AGVDKLPSYWQPFESAPVAILAILVLPALIAAVLGFGVFKRRVKGAYFAILSQALAAA
                     LAILLTGQQTIGGFTGLSDFRSFFGFRLDDPVNRRMLFFIAAATLLIVVAVARQLMRS
                     RYGELLVAVRDQEERVRFLGYDPANIKIVAYVVAAFFAGIAGALFTPIVGIISPADIG
                     VVPSIAFLIGVAIGGRTTLLGPVLGAVGVAWAQTTFSEHFPSAWTYFQGALFIVVVGF
                     IPAGLAGFGPMAKQLLERLRPAPTAVVEPAPVVPAEPVETAASAVEENAPAVEEKVEA
                     "
     gene            227745..228536
                     /locus_tag="NS506_00238"
     CDS             227745..228536
                     /locus_tag="NS506_00238"
                     /function="ATP-binding; Cell inner membrane; Cell
                     membrane; Hydrolase; Ion transport; Membrane;
                     Nucleotide-binding; Transport; Zinc; Zinc transport."
                     /note="Part of the ABC transporter complex ZnuABC involved
                     in zinc import. Responsible for energy coupling to the
                     transport system; Belongs to the ABC transporter
                     superfamily. Zinc importer (TC 3. A. 1. 15. 5) family;
                     Contains 1 ABC transporter domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Zinc import ATP-binding protein ZnuC"
                     /protein_id="APA94325.1"
                     /db_xref="UniProtKB/Swiss-Prot:A1JRI2"
                     /translation="MAEYLEISKLSVSFDGFKAVSDVDLTVLQGDLRFLIGPNGAGKT
                     TLIDAITGLTPATGSARKSGTELVGRKVHQIARLGVGRTFQTASVFEQLTVLQNLDIA
                     AGAGRSALTLLRRRKSVLPAIDEALEITGLTELRDKPAGVLAHGQKQWLEIGMLLVQN
                     ASVLLLDEPVAGMSAEEREETGNLLRRIGDNRVIIVVEHDMDFMRAFANSVTVLAGGR
                     VLSEGSVEAVQADPKVQEVYLGTAAAGELPPTTDQEAEAADAGAH"
     gene            228520..229212
                     /locus_tag="NS506_00239"
     CDS             228520..229212
                     /locus_tag="NS506_00239"
                     /function="ATP-binding; Cell membrane; Hydrolase;
                     Membrane; Nucleotide-binding; Repeat; Sugar transport;
                     Transport."
                     /note="Part of the ABC transporter complex RbsABCD
                     involved in ribose import. Responsible for energy coupling
                     to the transport system; Belongs to the ABC transporter
                     superfamily. Ribose importer (TC 3. A. 1. 2. 1) family;
                     Contains 2 ABC transporter domains"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribose import ATP-binding protein RbsA"
                     /protein_id="APA94326.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9K6J9"
                     /translation="MLELTDLHTGYGRTEVIHGVSLTVPENGVAAIMGHNGAGQTSLL
                     RAAVGLLPAKSGKIHFDGEDITKMSPSRRVKRGLAYVPQGQQSFPQLSTMENLQVVAD
                     GRARGKELIAESLDLFPALRELLSRKAGLLSGGQRQQLAIARALITEPKLLILDEPTE
                     GIQPSVVAEIERTIIELTNRGGLSVLLVEQHIGFALQAAQQFYVLRSGRVTSSGAGGA
                     GAESAVRLAMAI"
     gene            229252..229998
                     /locus_tag="NS506_00240"
     CDS             229252..229998
                     /locus_tag="NS506_00240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94327.1"
                     /translation="MSERVYRALQRDLAAGVLVPTERLGEERLAETYGVSRTPVREAL
                     ARLYADGLLERHTDGLYPYRPRVDELGDLYELRIVLEARGIQRLQTTPSSPPESPTTA
                     TREAPATSIAAALPRGGAPDTTAVREELEAWRRIREHPPEPGAALIAADEQFHTTLLR
                     AAGNTALADALSTVHARVRPVRALDMPTPGRIAAMADDHIAIAEHLLTGDLDTALRTL
                     LAHLTSSRAHVLTRARRALELTKLAQAVRE"
     gene            230108..230593
                     /gene="pcaC"
                     /locus_tag="NS506_00241"
     CDS             230108..230593
                     /gene="pcaC"
                     /locus_tag="NS506_00241"
                     /EC_number="4.1.1.44"
                     /note="KEGG: rge:RGE_32800 4-carboxymuconolactone
                     decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="4-carboxymuconolactone decarboxylase"
                     /protein_id="APA94328.1"
                     /translation="MNWVVWQALSRAAGTEDAHLFSTLGRTGGLFRGWLHFSGRLMPG
                     GKLRRYESELVILRVAHLRQCDYEMDHHIRLGRRAGVTAEILDRLREGPAAEGWTDKE
                     RALLTAVDQLVTTRDLDDPTWQALASHYDERHLIEIVLLTNQYEGLASTITALRIQTD
                     H"
     gene            complement(230594..231256)
                     /gene="rimJ"
                     /locus_tag="NS506_00242"
     CDS             complement(230594..231256)
                     /gene="rimJ"
                     /locus_tag="NS506_00242"
                     /EC_number="2.3.1.128"
                     /function="Acyltransferase; Cytoplasm; Transferase."
                     /note="This enzyme acetylates the N-terminal serine of
                     ribosomal protein L7/L12. Belongs to the acetyltransferase
                     family. RimL subfamily; Contains 1 N-acetyltransferase
                     domain; KEGG: ptq:P700755_003964 ribosomal-protein-alanine
                     N-acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribosomal-protein-alanine N-acetyltransferase"
                     /protein_id="APA94329.1"
                     /db_xref="UniProtKB/Swiss-Prot:P13857"
                     /translation="MPRATPAIVAAETFTRAAQPVLPVGDRLVLRPWLRRDGPEVYSA
                     FQDPAIRRWHVRTADTVEEAGDWVDSWARSWHGGTAANWAVADSCTGRLMGRASLHHM
                     ELWHGEAEVAYWVVPAARGCGIAPRAVDALVGWAFEVAGFHRLELRHSIHNGQSCRVA
                     HKSGFVLEGINRSAGLHADGWHDMHLHARVAHPVEPVHSHRLPAEAIPEAATQPVYRL
                     RR"
     gene            complement(231359..232138)
                     /locus_tag="NS506_00243"
     CDS             complement(231359..232138)
                     /locus_tag="NS506_00243"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94330.1"
                     /translation="MAGKGGERSSAGDPVRTLELLWREPGSGGSTRGPKQRTTLDAVI
                     AAALEIADAEGIGALTMRSVAAKLGITPMATYTYVPGKAELVDLMLDTVYQHMPRHDL
                     DGMPWRERVSAIAAENRALLAEHPWVAYLPTTRPPLGPGVVAKYDHELRAFDGLGLGD
                     LEMDAALTYLLGFVTSTAQLAIDTAAAAAASGQSDHEWWERAAPLLERVFDTDRYPLA
                     ARVGTVAGQAHDSAYSADHAYEFGLARVLDGLAVLIENRRP"
     gene            232262..232639
                     /gene="glo1"
                     /locus_tag="NS506_00244"
     CDS             232262..232639
                     /gene="glo1"
                     /locus_tag="NS506_00244"
                     /EC_number="4.4.1.5"
                     /note="KEGG: mit:OCO_36100 lactoylglutathione lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="Lactoylglutathione lyase"
                     /protein_id="APA94331.1"
                     /translation="MNITASVISLNVPDPIASAKFLVDHFGFTEKMSADGFVNVTRDD
                     AGFDVVYLRTGLGSFKPERIAGSAGEGLLVAFVVDDIDAEYDRVRNEGVPIVTPIETE
                     PWGERYFQALDPNGIVIQLVQWV"
     gene            232762..233337
                     /gene="folA"
                     /locus_tag="NS506_00245"
     CDS             232762..233337
                     /gene="folA"
                     /locus_tag="NS506_00245"
                     /EC_number="1.5.1.3"
                     /function="Membrane; Transmembrane; Transmembrane helix."
                     /note="To B. subtilis YwjB; KEGG: chu:CHU_0402
                     dihydrofolate reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="Dihydrofolate reductase"
                     /protein_id="APA94332.1"
                     /db_xref="UniProtKB/Swiss-Prot:P37508"
                     /translation="MRKVVAFEHMTLDGFAASNTELGLEWTFRSYSPELAAFHDEHIR
                     ADVGTVIYGRKTFAGMRDHWSSVSDSPEATAHDLEHAQWVTAIDKLAFSTTLESPEWN
                     NTRIIGTDGAARINELKSEDGGALVIYGSPTLVHWFAEAGLIDEYRIVIHPVTIGAGT
                     PLFRDKTELNLNLLESKVFDNGVLYTRYGIA"
     gene            233354..233710
                     /locus_tag="NS506_00246"
     CDS             233354..233710
                     /locus_tag="NS506_00246"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94333.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q52996"
                     /translation="MRHLMLIRLDPAKAPEGGPDEKMIADINEVIEEMTKAGVLLDTA
                     GLRPLEEGVRLRQSGGVQSVVDGPYTESKEIVGGYCLLQTRTTEEAVEWSRRFLNVHG
                     PEWELELEIRPLDGQN"
     gene            233783..235153
                     /locus_tag="NS506_00247"
     CDS             233783..235153
                     /locus_tag="NS506_00247"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94334.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q52997"
                     /translation="MPDPLAVSEPSMVPEPSAVSERSTVPEPSAAARPERARRAIEAA
                     WRIEWPRLVAGLTRLVGDIATAEELAQDAHVAALEQWPRAGVPPNPGGWLMLTAKHRA
                     VDRIRRDANFARKLELLGRQTPLEEQPVFDEPGAEQPVIADDLLRMIFTACHPVLTPP
                     ARTALTLRMVGGLSTAEIARAYLVPESTVAQRIVRAKRTIADKKVPYEVPEGPELAER
                     LDSVLEVIYLIFNEGYAATSGDSWMRAELCDDALRLARILTGLLPGEPEAHSLAALLE
                     LQASRTRARTGPDGGLILLADQDRSRWNGLYIRRGFAALARAHTLNRTLGREPGRYAL
                     QAAIATVHAMSTTTEDTDWRRIAGLYAVLAQRFPSPIVELNRAVAVSRLHGPAAGLEL
                     ADAVAATGALADYHLLHAVRGDLLARLGNAEQARAAFTRAAELTGNATERELLLDRAR
                     QSGNPL"
     gene            235295..235804
                     /locus_tag="NS506_00248"
     CDS             235295..235804
                     /locus_tag="NS506_00248"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94335.1"
                     /translation="MPVFDDPEIRKRSLRVTLLGLLLAALTPLTVAVGTADARTAVAD
                     PIARSAEIPVALPVDPASLIQMIGSAQRYSKPTLQTLSRFMVPGEQWESFNQIISHES
                     DWQVFAINPTSGAYGLAQALPAHKMFSEGPDWMFNPLTQLRWAYRYMVARYGSPNAAW
                     DFWQAHNWY"
     gene            complement(235826..236677)
                     /gene="qorB"
                     /locus_tag="NS506_00249"
     CDS             complement(235826..236677)
                     /gene="qorB"
                     /locus_tag="NS506_00249"
                     /EC_number="1.6.5.2"
                     /function="NADP; Oxidoreductase."
                     /note="Quinone oxidoreductase that may play some
                     additional role beyond quinone reduction. Potential redox
                     sensor protein. Overexpression induces retardation of
                     growth; Belongs to the NmrA-type oxidoreductase family;
                     KEGG: nno:NONO_c71230 NAD(P)H dehydrogenase (quinone)"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H dehydrogenase (quinone)"
                     /protein_id="APA94336.1"
                     /db_xref="UniProtKB/Swiss-Prot:P39315"
                     /translation="MTVAVTGASGQLGRLVVEALLKDGSQPVVAVVRDAAKVADLAER
                     GAEVRVASYDDPEALERAFQGVDRVLLVSGNEFSKRVAQHTNVIRAAENAGVKLLAYT
                     SIPKAEVNPLILAQEHIGTEAALAGASIPTTLLRNSWYWENYTGGLAHAVETGTLYGA
                     ARDGKVSGASRADYAEAAARVLTTDGHEGKVYELGGDEALSYDELAQVISEVSGKPVR
                     YQDLPQADYAAALEGAGLEAGYAAVLADADAGIANGILTVDSGDLQRLLGRPSTPVAE
                     VFRAALS"
     gene            236789..237187
                     /locus_tag="NS506_00250"
     CDS             236789..237187
                     /locus_tag="NS506_00250"
                     /function="DNA-binding; Transcription; Transcription
                     regulation."
                     /note="Contains 1 HTH hxlR-type DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative HTH-type transcriptional regulator
                     YtfH"
                     /protein_id="APA94337.1"
                     /db_xref="UniProtKB/Swiss-Prot:P0ACN2"
                     /translation="MTSQPPDQAFAVDPTLEADVFARNCSSRPVLQDVASRWGVLTLA
                     ALREGPYRFSALRRRVDGISERMLSHTLQTLERDGMVNREVQQAIPPVVEYTLTDLGA
                     QVADQLVGLIEILESNITAITEAQNAYHRQ"
     gene            237209..237688
                     /gene="tadA"
                     /locus_tag="NS506_00251"
     CDS             237209..237688
                     /gene="tadA"
                     /locus_tag="NS506_00251"
                     /EC_number="3.5.4.33"
                     /function="Cytoplasm; Hydrolase; Metal-binding; Nucleus;
                     Zinc."
                     /note="Converts cytosine to uracil or 5-methylcytosine to
                     thymine by deaminating carbon number 4; Belongs to the
                     cytidine and deoxycytidylate deaminase family; Contains 1
                     CMP/dCMP-type deaminase domain; KEGG: afn:Acfer_1730
                     tRNA(adenine34) deaminase"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(adenine(34)) deaminase"
                     /protein_id="APA94338.1"
                     /db_xref="UniProtKB/Swiss-Prot:O59834"
                     /translation="MPADTDLHYLERCVELAEEALNSGDEPFGSLLVDANGKVLAEDR
                     NRVSGGDQTRHPEFDLARWAGENLTPEERAAATVYTSGEHCPMCSAAHAWVGLGRIVY
                     AASTAQLLEWLNEFGVPAGPVRPLSIREVAPSIPTSGPFPELSDRVYALHRRLHLAD"
     gene            complement(237764..238033)
                     /locus_tag="NS506_00252"
     CDS             complement(237764..238033)
                     /locus_tag="NS506_00252"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94339.1"
                     /translation="MPGGVIHVDAPADGSAWTCKGMSLVPFVSLTTQVAKNRTSTGSA
                     MADSVPWTASVDLQFPPNTMVLWECDSAGSGHTTYKSEGTLQTLP"
     gene            complement(238342..239745)
                     /gene="pdhD"
                     /locus_tag="NS506_00253"
     CDS             complement(238342..239745)
                     /gene="pdhD"
                     /locus_tag="NS506_00253"
                     /EC_number="1.8.1.4"
                     /function="Cytoplasm; Disulfide bond; FAD; Flavoprotein;
                     Glycolysis; NAD; Oxidoreductase; Redox-active center;
                     Tricarboxylic acid cycle."
                     /note="Lipoamide dehydrogenase is an essential component
                     of the pyruvate dehydrogenase (PDH) and 2-oxoglutarate
                     dehydrogenase (ODH) complexes. Catalyzes the reoxidation
                     of dihydrolipoyl groups which are covalently attached to
                     the lipoate acyltransferase components (E2) of the
                     complexes. Also catalyzes a reversible NADH:NAD(+)
                     transhydrogenation, and is able to transfer electrons from
                     NADH to various redox-active compounds and quinones. May
                     be involved in quinone redox cycling in C. glutamicum;
                     Belongs to the class-I pyridine nucleotide-disulfide
                     oxidoreductase family; KEGG: mpa:MAP3956 dihydrolipoamide
                     dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Dihydrolipoyl dehydrogenase"
                     /protein_id="APA94340.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q8NTE1"
                     /translation="MTSHYDVVVLGAGPGGYVAAIRAAQLGLRTAIVEQKYWGGVCLN
                     VGCIPSKALLRNAELAHIFTKEAKTFGISGTASFDFGAAFDRSRKVADGRVKGVHFLM
                     KKNKIDEFDGKGTFTGPKSLSVALTKGGTEDITFDNVIIAAGTETKLLPGTSLSANVV
                     TYEEQILTRDLPGSILIVGAGAIGMEFGYVLKNYGVDVRIVEFLDRALPNEDADVSKE
                     ITKAYKKLGVTITTGAAVQSIDDDGSKVTVAIKDNKSGAIETVTVDKVLQAVGFAPRV
                     QGYGLENTGVALTDRGAIAIDDFMRTNVPGIYAIGDVTAKLQLAHVAEAQGVVAAETI
                     AGAETQALGDYRMMPRATFCQPQVASFGLTEEQARAEGYDVKVANFPFTANGKAHGLG
                     DAQGFVKLISDAKYGELLGGHLIGPDVSELLPELTLAQKWDLTVNEVARNVHTHPTLS
                     EAIQEAIHGLAGHMINF"
     gene            complement(239909..240214)
                     /locus_tag="NS506_00254"
     CDS             complement(239909..240214)
                     /locus_tag="NS506_00254"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94341.1"
                     /translation="MTELDPTVRKFVDAVNAGDANAFFATLTPDASMTDDGQERNLAQ
                     WTESEIFATNGRMKVESVGGPTEFVADYSNDRWGAMRTAWRFTLRDGLISRFETGQA"
     gene            complement(240268..241290)
                     /gene="dpeP"
                     /locus_tag="NS506_00255"
     CDS             complement(240268..241290)
                     /gene="dpeP"
                     /locus_tag="NS506_00255"
                     /EC_number="3.4.13.19"
                     /function="Aminopeptidase; Dipeptidase; Hydrolase;
                     Metal-binding; Metalloprotease; Protease; Signal; Zinc."
                     /note="Belongs to the peptidase M19 family; KEGG:
                     nfa:nfa52680 membrane dipeptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="Membrane dipeptidase"
                     /protein_id="APA94342.1"
                     /db_xref="UniProtKB/Swiss-Prot:O14124"
                     /translation="MSPQQRSQTAPPRLWEQHCCLPLLPTADLTELLRYPAGSYLSVN
                     IGYSPQSTRESLELVTQFRRDALTDGRFRLVHSIEDAWPETPTAETEETLALAFDLED
                     SGPLEGDLDNVELFYELGLRSLLPSYNYANAAGCGCLDTEDTGLTGHGRDLIRKLNEV
                     GVFADGSHCSRRTGLDIAETTSVPMIYSHSNFAALWAHPRNITDDQAKACAATGGVIG
                     INGVGIFLGHNDAPARAERVAAMADHLAYGAQLLGIEHVGVGSDFSFDGDEFNEVIAA
                     SPETFSPEYTRYGPLQWTPPEDLLGVSGTPGLDAELAARGFSESDRAAVFGGNFARVA
                     RQVWRD"
     gene            241306..242163
                     /locus_tag="NS506_00256"
     CDS             241306..242163
                     /locus_tag="NS506_00256"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94343.1"
                     /translation="MGLEAAILPIGVSPAITSVEQVDPLDRTVSTPLVRLVRDAARRA
                     GATPEQQAGLHGLDEHTLSDELNRIPLDALIRLWEFIAHLRPGPGAGLAVATAAPLGT
                     LTPWDYLVTTGSTLAESLRAAQPYHRVVTAAGEVFDLDAGDDLTVGYRTTAGDPAVSA
                     VVNEYVLAYYLRRAREATGRPVRTARVTFGHPAPQRHSILTEAFGTDRIEFGAPADSI
                     TFHAADAAAPLRRADPALGALLRGHADLVLANSRARFPVRWSRSGPPSTRPSPTGTSA
                     STAWPGGCR"
     gene            242160..242426
                     /locus_tag="NS506_00257"
     CDS             242160..242426
                     /locus_tag="NS506_00257"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94344.1"
                     /translation="MSRRTLQRHLAEHGTTWRNEVDLRRAERAETLLAQGRSTAAVAA
                     RLGFADDRALRKAYRRWHGTSPTGLAHADRSVASRDLGADPHRP"
     gene            242484..243497
                     /locus_tag="NS506_00258"
     CDS             242484..243497
                     /locus_tag="NS506_00258"
                     /function="Aromatic hydrocarbons catabolism;
                     Detoxification; NADP; Oxidoreductase."
                     /note="Putative quinone oxidoreductase that may contribute
                     to the degradation of aromatic compounds; Belongs to the
                     NADP-dependent oxidoreductase L4BD family"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative NADP-dependent oxidoreductase YfmJ"
                     /protein_id="APA94345.1"
                     /db_xref="UniProtKB/Swiss-Prot:O34812"
                     /translation="MTTQLRTGREIRLAARPQGVPTTADFVAAERPLPELRDGQLLVR
                     NTWMSVDPYMRGRMDDKPSYVPPFRLGEPLEGAAVGEVIESRSAAIPLGATVTHFRGW
                     RDLAVVDADTATVVDTTLADPRHYLGALGTTGLTAYAALTSIAPVRPGDVVFVSAAAG
                     AVGSVAGQIARKPGASRVVGSAGGPAKNRVLLDEFGFDAAIDHRAGDLRGQLAAAAPE
                     GIDVYLDGVGSEHLAAAIEAMRPGGRIAMVGAISGYDGAPPEFTPDLYLAATKEITLR
                     GMLVTSRFPVFGEYIGRAAGWLADGSLRTRETVYEGLDRAPAAFLGVLSGANTGKMLV
                     RLA"
     gene            243578..245608
                     /gene="preP"
                     /locus_tag="NS506_00259"
     CDS             243578..245608
                     /gene="preP"
                     /locus_tag="NS506_00259"
                     /EC_number="3.4.21.26"
                     /function="Hydrolase; Protease; Serine protease."
                     /note="Belongs to the peptidase S9B family; KEGG:
                     spe:Spro_2232 prolyl oligopeptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="Prolyl oligopeptidase"
                     /protein_id="APA94346.1"
                     /db_xref="UniProtKB/Swiss-Prot:P81171"
                     /translation="MTDQFLWLEEVEGERALGWAEARNAVAKERFASSERFAELEARV
                     LAMLDTDTRIAYPGRRGPWLYNYWRDRDHPKGLWRRTTFAEYAKDEPDWEILIDLDAL
                     AAAEDENWVWGSAAVLRPAQQRALISLSRGGADAKVVREFDIEAKAFIAPEDGGFRLP
                     EAKSDFAWIDDDTLYVGTDFGPGSLTDSGYPRVVKRWRRGTPLAAAEFVYEGEVTDVA
                     VSAGYDRTPGYERHFLGRATDFFNEEVYLLEDDGALRFIDVPSDASESWYKELLLVRL
                     KSPWEVNGTTYPAGSLLATNFEEFLSGARDFEVLFTPDRHTALHGYGWTENHLLLITL
                     RDVQTDLHVLTPGPDGWTREPLADTPRMATTSVMNLDRLEGGDEFMLSTSGFTRPTTL
                     MAGSVGGPIEVLKKEPEFFDADGVETEQFFATSDDGTEIPYFVIRHRDRRGVPGPTVM
                     SGYGGFEVSRTPGYFGAVGMGWLERGGTYVMTNIRGGGEYGPEWHTSVLKANRHKAYE
                     DFAAVARDLVARGITTHEQLGAVGGSNGGLLMGVMLTRYPELFGAIVCQVPLLDMKRY
                     HLLLAGASWIAEYGDPDKPEEWEYISKYSPYQNTSADRRYPPILLTTSTRDDRVHPGH
                     ARKMAALLESEGHDVWYYENIEGGHGGAADNKQSAFQAGLIYEFFAQQLMER"
     gene            complement(245612..246940)
                     /locus_tag="NS506_00260"
     CDS             complement(245612..246940)
                     /locus_tag="NS506_00260"
                     /function="Cell inner membrane; Cell membrane; Membrane;
                     Transmembrane; Transmembrane helix; Transport."
                     /note="Responsible for the transport of C4-dicarboxylates
                     from the periplasm across the inner membrane; Belongs to
                     the DcuA/DcuB transporter (TC 2. A. 13. 1) family"
                     /codon_start=1
                     /transl_table=11
                     /product="Anaerobic C4-dicarboxylate transporter DcuA"
                     /protein_id="APA94347.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9ZLC0"
                     /translation="MVKMLLELAVMLAIIMIGSRVGGIGLGVWGGIGVFALATIFGVE
                     PTVPPVDVLLIILSVVVAAATMEAAGGVDYMVRIAERIIRSNPKRITFVAPLVTYAFT
                     VGAGTGHLLYPLLPVIHEVAREGGIRPERPISIATIANQIAIVASPFSASTAAAVVIF
                     GPDGWSIVKILAITVPSTLIGSMVGALSVLKLGKDLDDDPEYQRRLAAGEIPPIDPSH
                     ADRPPLPPRASWSAGIFLLGVLAIVISGAFPSLRPDVHGADGKVDALAMPYAIEVLML
                     ATAALIMVVCKVNAAVVPGTPVAKAGLVALVGVFGLAWLGDSFVEANKTLIVDKLGNV
                     AKDYPWTFAIIVTVVAALILSQAATTKTMMPLGMALGIPSAQLVAMLPAVAALFILPV
                     YPTSIAAVNFDLSGTTHFGKYVLNHSFMRPGLVTLVASIAIGYGLAAIIG"
     gene            247073..248938
                     /locus_tag="NS506_00261"
     CDS             247073..248938
                     /locus_tag="NS506_00261"
                     /function="Lyase."
                     /note="Belongs to the class-II fumarase/aspartase family.
                     Aspartase subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="Aspartate ammonia-lyase"
                     /protein_id="APA94348.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9ZLI5"
                     /translation="MGQLDELIKSTAAATGLDPDDVRALTATAERREYPAGTILFHES
                     TPREWAGIVVEGEVQIISGLTGHETELARLGPGSLVSEISLIDDTPHTATGRTPKGAV
                     VLTVPRATLREMAVLHPDRYYRMVSRVAQLIAHRMRSVSEQLSAAISAQQQLGGIRTE
                     HDSLGTREIPSEAYYGVQTLRAIENFQISGIKLRKFGHLVHALAYVKKAAALANAELG
                     SITAAKRDAIVGACDEILDGKLRDDFVVDMVQGGAGTSTNMNANEVIANRGLELMGHE
                     KGEYQYLHPNDDVNCSQSTNDVYPTSVKLGVYLSLMDATAALGELRNALKAKALEFSD
                     VIKMGRTQLQDAVPMTLGQEFGAYAVMIGEAIAHLQRISTDLLAMNMGATAIGTGITS
                     PPGYAELVSKKLVEVTGLPICQAENLVEATQDSGDFVAISATLKRAAVQLSKICNDLR
                     LLSSGPRAGLGEINLPAMQPGSSIMPGKVNPVIPEVVSQVCFQLIGYDMTVTMAAEAS
                     QLELNMAEPIMAYDLMMGTMMLRNAAITLTSRCVTGITANREHCRELVNHSIGLVTAL
                     VPKLGYEQSASIAKEALKTGGSVYDLVLERGAMTKDELDELLSPEKMTAPRSRSI"
     gene            complement(248946..249812)
                     /locus_tag="NS506_00262"
     CDS             complement(248946..249812)
                     /locus_tag="NS506_00262"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94349.1"
                     /translation="METVPIQMPDGTTVPVRMIPAKGPHRHPITADTPRPVVVVVPGL
                     GVPGEFYSLFGKPLADRGFDVALLEIRGNGAAPPPRACRPKPGAASQYGYQELVAVDF
                     PAMFEAVRERFPDSTPYLLGHSMGGQLGVMYASRIRGRLGGLILVASGTPHRRGYSGL
                     AALGSTALSLTANLAGFWPGDTVTAGGFGRQSKLLIADWARLARTGRFQPAGADIDYE
                     ERIGRLKLPVLSITMTGDELTPRGSARQLLAKLPNADITIWHNPDPLGHNGWISDPAS
                     TLDRVEKWLRDR"
     gene            complement(249893..250129)
                     /locus_tag="NS506_00263"
     CDS             complement(249893..250129)
                     /locus_tag="NS506_00263"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94350.1"
                     /translation="MEKFRLELRRAWGALLASAAEDAALHGEIPPGDYEMRVLAIIGA
                     VNYVVDAWSGSEPRQPLDDVIRVLRRVIMGAVTA"
     gene            complement(250202..250498)
                     /locus_tag="NS506_00264"
     CDS             complement(250202..250498)
                     /locus_tag="NS506_00264"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94351.1"
                     /translation="MYAGQPVEDRQRQRRARFLESGLTVFARDGYANSSVGAICKDAG
                     LSSRQFYEEFTGRESLLLELYEQIDRESREAVAATIAEHSDASAIDIIDAAVRA"
     gene            complement(251532..252131)
                     /locus_tag="NS506_00265"
     CDS             complement(251532..252131)
                     /locus_tag="NS506_00265"
                     /EC_number="3.1.3.18"
                     /note="KEGG: salb:XNR_2337 phosphoglycolate phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoglycolate phosphatase"
                     /protein_id="APA94352.1"
                     /translation="MVGFDLDMTLIDSRPGIAAVWDAVAARTGVAIDSELVVSRLGPP
                     LAHEAAQWFPEHEVPRIVDLYRELYPDLAVHPSEHLPGVIDALAAVHRAGGRVLVITA
                     KNGPHARLHLDHLGLEVDELVGGAWAEEKGEVLRERGAAIYVGDHLGDVRAARVAAAV
                     SVAVTTGPYAAEELSAAGADVVLRDLTEFPDWLAAHIAG"
     gene            252238..253086
                     /locus_tag="NS506_00266"
     CDS             252238..253086
                     /locus_tag="NS506_00266"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94353.1"
                     /translation="MRSEQETFFCGTELAARLERVEAELITRSSGAAAARLGAGAGFV
                     IPIAGGVASFAEVGSPLNKVAGLGFAGIPDIAELDEIERLFTERKTPVQAEVSQLGDP
                     GIGELLTARGYRLVSFENVLGLELADERPAVVADGVDVGHSTDDEFAPWLDVVAEGFA
                     HPDAQGVASHEEFPADVIAAAVRDMAVAAGVRRYIARRGDTVAGGASMRMSQGIAQLT
                     GAATHPAHRRHGVQSSLLSVRLAEATEAGCDIAVVTTQPGSKSQQNVQRRGFSLLYTR
                     AILIKG"
     gene            complement(253112..253552)
                     /locus_tag="NS506_00267"
     CDS             complement(253112..253552)
                     /locus_tag="NS506_00267"
                     /function="DNA-binding; Transcription; Transcription
                     regulation."
                     /note="Contains 1 HTH marR-type DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative HTH-type transcriptional regulator
                     YdcH"
                     /protein_id="APA94354.1"
                     /db_xref="UniProtKB/Swiss-Prot:P96625"
                     /translation="MAEKPRGPLMSPGFWLHNAALEWRATLERNLRPLGLTPTQFNLL
                     ASAGWLGRAGELPTQQQVADMSGSDRMMASKVIRGLEERGLLIRRPDPADARVLRVEL
                     TAAGRELASKGVRTAVDTDAQLFGADGDLLREHLKPIAAHRLPG"
     gene            complement(253545..253970)
                     /locus_tag="NS506_00268"
     CDS             complement(253545..253970)
                     /locus_tag="NS506_00268"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94355.1"
                     /translation="MMYSFTEEAVIKGDIDKIWAVATDVARWSEWDPHEEKSRIDGEF
                     AAGTKVWVKPKGAPAGPFTIVAVEPGKSWTSEAGIPFGKLRGHRTYEALGDGTVRVAE
                     NVEIHGVFGPLFKLVWEKAMRADMPLTFAALEEEALRRG"
     gene            complement(254119..256134)
                     /locus_tag="NS506_00269"
     CDS             complement(254119..256134)
                     /locus_tag="NS506_00269"
                     /function="Cytoplasm; Elongation factor; GTP-binding;
                     Nucleotide-binding; Protein biosynthesis."
                     /note="Catalyzes the GTP-dependent ribosomal translocation
                     step during translation elongation. During this step, the
                     ribosome changes from the pre-translocational (PRE) to the
                     post- translocational (POST) state as the newly formed
                     A-site-bound peptidyl-tRNA and P-site-bound deacylated
                     tRNA move to the P and E sites, respectively. Catalyzes
                     the coordinated movement of the two tRNA molecules, the
                     mRNA and conformational changes in the ribosome; Belongs
                     to the TRAFAC class translation factor GTPase superfamily.
                     Classic translation factor GTPase family. EF-G/EF-2
                     subfamily; Contains 1 tr-type G (guanine
                     nucleotide-binding) domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Elongation factor"
                     /protein_id="APA94356.1"
                     /db_xref="UniProtKB/Swiss-Prot:A7GZJ4"
                     /translation="MRTNVSRQDLAVVRNLGILAHVDAGKTTVTERMLFLTGITHKRG
                     EVHDGTTVTDFDPQERDRGITIFAAAVSCRWAGHRLTVIDTPGHVDFSDEVERSLRVL
                     DGAVAVFDAVAGVEPQSESVWRRADRYGVPRIAFVNKMDRAGADLTAAVASIRVRLHP
                     VPLPVYSGETFAGVVDLVRLRALHWDGGLVEGAVPEHLAAEVTRARRELEEAVAERNS
                     AALEEFVEASGLSDDTLAAALRELTLAGEVVPVLCGAAYRDIGIEPLLDAVVAYLPSP
                     LDRPPVGAQDGCRAADPAEPLAALAFKVHATPTGRLTFVRVYAGVLANGDTVLDAGGG
                     RRERVARILRVQADRHEEVAAAVAGDIVALVGPKAVRVGATLCAPDAPVQLEPPAPTE
                     PVVSVAVEARSSAETEKLAVALARLADEDPSLSVRTDPETGQTLLAGLGELHLEVVVE
                     KLRRDRGLSVTVGKPQVAYRETVVRGVRGLVYRHVKQDGGAGQWAHIVLDVQPVNESD
                     TGATGFEFESTVVGGRVPAEFVRAVEAGCRDALAEGPLAGHPVTGVRVTLTDGATHSK
                     DSSDLAFRTAGRLGMRDALRASAMAILEPLVELTVTVPEDHVGAVLGDLAARRGRVTG
                     SLTRTGTVVLTATVPLAELFGYATRLRSRTQGRGTFTTRPLGYAPAP"
     gene            complement(256415..256762)
                     /locus_tag="NS506_00270"
     CDS             complement(256415..256762)
                     /locus_tag="NS506_00270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94357.1"
                     /translation="MISTAWATLNLTLAFVLELVAVGALAYWGVRTGRGRMAKVLLGV
                     GMAVAAMVLWGLFAAPQASFSIPVAAVGTKILVFGGASAGLWQLGHRTAAIGFPLLVV
                     ANLAVIHLGHLSM"
     gene            complement(256824..256940)
                     /locus_tag="NS506_00271"
     rRNA            complement(256824..256940)
                     /locus_tag="NS506_00271"
                     /product="5S ribosomal RNA"
     gene            complement(257044..260148)
                     /locus_tag="NS506_00272"
     rRNA            complement(257044..260148)
                     /locus_tag="NS506_00272"
                     /product="23S ribosomal RNA"
     gene            complement(260471..261988)
                     /locus_tag="NS506_00273"
     rRNA            complement(260471..261988)
                     /locus_tag="NS506_00273"
                     /product="16S ribosomal RNA"
     gene            262444..262725
                     /locus_tag="NS506_00274"
     CDS             262444..262725
                     /locus_tag="NS506_00274"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94358.1"
                     /translation="MYVCDWSITSALVDEFAERLPGHKETDWRVSWLPGRLVTRAQAI
                     AAMELAELLHDTTATDHAPIQATIAATAEQLGIRPIDVAIAFSARYPYR"
     gene            complement(262736..263350)
                     /locus_tag="NS506_00275"
     CDS             complement(262736..263350)
                     /locus_tag="NS506_00275"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94359.1"
                     /translation="MLIAGGLVLLLLVVGLVFAIRGDDSGSTGAAASTSITTQSRTGA
                     PSTTRTSAKPTTTTKTPAPVPPAVQPIVDALPAPLRKALLQNDIRPKPADDMFGYDAA
                     AAFTLSAHDPQLKGLMHWPDNDYYPLAYISTQPDNLRHIWGSQHPEWTSDEGTRLVRI
                     DPGDQYTNGAATLEVFVPGSGLYLELSGFASADAAKQFVQRAGF"
     gene            263955..264488
                     /locus_tag="NS506_00276"
     CDS             263955..264488
                     /locus_tag="NS506_00276"
                     /function="Cell membrane; Glycosyltransferase; Membrane;
                     Transferase; Transmembrane; Transmembrane helix."
                     /note="Belongs to the glycosyltransferase 39 family"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative mannosyltransferase YycA"
                     /protein_id="APA94360.1"
                     /db_xref="UniProtKB/Swiss-Prot:P37483"
                     /translation="MTGAIALPIGARTDWSQWLRGPEDQPRWARPALLATATLAGVLY
                     VWGIGAQTPHLYYAAVARSMSMSWHNFFFAAFDPAATISIDKLPGAIWLQALSTRIFG
                     PHLWAYLLPQVIEGVLTVLVLHRAVRRLSGPGAALVAAAVAAVIPATVTLNRGNIPSR
                     ARTRWLAWSSPARSGWS"
     gene            264639..265511
                     /locus_tag="NS506_00277"
     CDS             264639..265511
                     /locus_tag="NS506_00277"
                     /EC_number="1.1.1.100"
                     /function="Oxidoreductase."
                     /note="Belongs to the short-chain
                     dehydrogenases/reductases (SDR) family; KEGG:
                     ppro:PPC_3248 3-oxoacyl-(acyl-carrier protein) reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-[acyl-carrier-protein] reductase"
                     /protein_id="APA94361.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WGS0"
                     /translation="MQELSGLLHKIRHGLDTQVSLSRLRRNRTLADAVGGRTVLITGA
                     SSGIGRAAALELGAAGATVLLVARRADELDRVVGEIETAGGRAAAYPCDLNDFDALDA
                     VTANVLADHGRADILVNNAGRSIRRRLDESYDRFHDYERTMRLNYFAAVRLILAFAPA
                     MRANGGGQIVNILSLANLYGGPGYAAYVASKAALDSLATNLQAETHTENLRFTSIYLP
                     LVRTDMITANPVYQQATANALTPAEGGRIICDAIIDRPRRLAPVMGRIAALVDSTFPE
                     RADAIRNARFATGM"
     gene            complement(265620..267242)
                     /locus_tag="NS506_00278"
     CDS             complement(265620..267242)
                     /locus_tag="NS506_00278"
                     /function="ATP-binding; Chaperone; Cytoplasm;
                     Nucleotide-binding."
                     /note="Prevents misfolding and promotes the refolding and
                     proper assembly of unfolded polypeptides generated under
                     stress conditions; Belongs to the chaperonin (HSP60)
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="60 kDa chaperonin"
                     /protein_id="APA94362.1"
                     /db_xref="UniProtKB/Swiss-Prot:A1KFR2"
                     /translation="MAKTIAYDEEARRGLERGLNSLADAVKVTLGPKGRNVVLEKKWG
                     APTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREG
                     LRNVAAGANPLGLKRGIEKAVEAVTASLLDTAKEVETKEQIAATAGISAGDSSIGELI
                     AEAMDKVGKEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPYI
                     LLVGSKISTVKDLLPLLEKVIQAGKPLLIIAEDVEGEALSTLVVNKIRGTFKSIAVKA
                     PGFGDRRKAMLADIAILTGGEVISEEVGLSLETAGLELLGTARKVVITKDETTIVEGA
                     GDPEAIKGRVAQIRTEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKH
                     RIEDAVRNAKAAVEEGIVAGGGVALLQASPALDALSLTGDEATGANIVRVALSAPLKQ
                     IAFNAGLEPGVVAEKVSNLPAGHGLNAESGEYVDLLAAGVADPVKVTRSALQNAASIA
                     ALFLTTEAVVADKPEKAAPAGDPTGGMGGMDF"
     gene            complement(267480..267782)
                     /locus_tag="NS506_00279"
     CDS             complement(267480..267782)
                     /locus_tag="NS506_00279"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94363.1"
                     /translation="MAGDEGSDLVAGEKRADLLRALSYVSTEDTPDGGYIVNGDLPPE
                     VAPPFIRAIMRIEAELLLQDAELVTVEHGEPRTPEERRTDALIALLLRVDDRSHFS"
     gene            complement(267928..268674)
                     /locus_tag="NS506_00280"
     CDS             complement(267928..268674)
                     /locus_tag="NS506_00280"
                     /note="Belongs to the ClpA/ClpB family. ClpC subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94364.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WPC6"
                     /translation="MTNSIRLDDLIDGIKKARPDDILEQLSDAVVLGNHIGEVADHLI
                     GHFVDQARRFGASWTEIGQSMGVTKQAAQKRFVPKAPADPAALDPNAGFARFTPRARH
                     VVMAAQEEARAVGNLETSPEHLVLGLLAEPESLAVKVIEAKGVSTDAVRRVAAAALPA
                     ATGDPVPALIPFDAQARKILELTFREALRLGHNYIGTEHLLLALLEVENGTGVLSGLG
                     LDKDSVQADIAALLGSLPVPGVTAPAPDAR"
     gene            complement(268742..269827)
                     /locus_tag="NS506_00281"
     CDS             complement(268742..269827)
                     /locus_tag="NS506_00281"
                     /EC_number="1.6.99.3"
                     /function="FAD; Flavoprotein; NAD; Oxidoreductase."
                     /note="Belongs to the NADH dehydrogenase family; KEGG:
                     dra:DR_0950 NADH dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase"
                     /protein_id="APA94365.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q55CD9"
                     /translation="MTGQQRIVVLGAGYAGLSAARQVAKDKGARVTVVDARAEFVDRV
                     RLHQALAGQRVPRADLRKMLAGKGIEFVQAHVERIDAANRRVELAGGQALGYDTLVYA
                     LGSAGDRSAVPGASEFAHSVAVPEDIRAMPQLSGRIAVVGGGATGIEVASELAESRPD
                     LVVTLVSADEPGGWLAPKAHNHIRAVLDRLGVRVRTDAKVAAVTAEGLELIDGDRIPA
                     ETVLWTTGFKVPQVAARSGIAVDGRGRILVDDELRSRSNPGIYAIGDAAVIAGPDGRD
                     LRMACATAIPAGQYAATAIAARLHGKEPAERKYRYVFQCISLGRRDGVIQFVHADDSP
                     ARMVLTGRTAAWFKEQIVRMVAKVAQD"
     gene            complement(269967..270869)
                     /locus_tag="NS506_00282"
     CDS             complement(269967..270869)
                     /locus_tag="NS506_00282"
                     /function="DNA-binding; Sigma factor; Stress response;
                     Transcription; Transcription regulation."
                     /note="Sigma factors are initiation factors that promote
                     the attachment of RNA polymerase to specific initiation
                     sites and are then released. Extracytoplasmic function
                     (ECF) sigma factors are held in an inactive form by an
                     anti-sigma factor until released, although no anti-sigma
                     factor is known for this protein (By similarity).
                     Regulates the promoter of SigI, may not be autoregulated;
                     Belongs to the sigma-70 factor family. ECF subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="ECF RNA polymerase sigma factor SigJ"
                     /protein_id="APA94366.1"
                     /db_xref="UniProtKB/Swiss-Prot:L0TCG5"
                     /translation="MDADGLVEFERHRPRLFALAYRMMGSAAEAEDAVQETYLRWDTS
                     DRTGIRSAEAWLTTILVNLCRSWLDSARARREAYVGPWLPEPVPTGRGELGPLESAEQ
                     RELVSIAFLTLAERLSPTERAVFVLREAFGYAHREIADMLDLTEANAQQVYRRATHRV
                     HEERPRFEPAPAHARELVEKFLDAAQSGDLAALEAMFTADIVAVADGGTRINAAKVPI
                     VGAAKVARYLVGLFTKVPGVDFAIEEVNGAPAFVARLRGTVMGIVSAGFDGGSIDSVR
                     LMVNPDKLVYFGRGDRALADKAAG"
     gene            complement(271014..271445)
                     /locus_tag="NS506_00283"
     CDS             complement(271014..271445)
                     /locus_tag="NS506_00283"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94367.1"
                     /translation="MKRLSIVALAAAAMALGLAGCGSDKSGDANGLKQASSTTARTTG
                     AVASTTAAGAPIEPPTGAPAGTTVAKKTSAPNGAQTTCGDFRDLTDDVEKQVIDQILA
                     AHPGSFLEGNANMALGTAKLACLSTTYTNTPVAVAIRVAAK"
     gene            complement(271548..271901)
                     /locus_tag="NS506_00284"
     CDS             complement(271548..271901)
                     /locus_tag="NS506_00284"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94368.1"
                     /translation="MTEQIEGIDPSMVPSGSGCVECDAAGGWWVHLRRCAQCGHVGCC
                     DMSPNQHGTKHFENTGHPFIQSFEPGEDWYYNFTNKEMYEGGPELAPPHAHPADQPVP
                     GPRGRVPADWQQHLH"
     gene            complement(271901..273376)
                     /gene="glnL"
                     /locus_tag="NS506_00285"
     CDS             complement(271901..273376)
                     /gene="glnL"
                     /locus_tag="NS506_00285"
                     /EC_number="2.7.13.3"
                     /function="ATP-binding; Kinase; Nitrogen fixation;
                     Nucleotide-binding; Phosphoprotein; Transferase;
                     Two-component regulatory system."
                     /note="NtrB acts as a signal transducer which responds to
                     the nitrogen level of cell and modulates the activity of
                     NtrC. In nitrogen limitation NtrB activates NtrC by
                     phosphorylating it, while in nitrogen excess NtrC is
                     dephosphorylated and consequently inactivated by NtrB.
                     Contains 1 histidine kinase domain; Contains 1 PAS
                     (PER-ARNT-SIM) domain; KEGG: apb:SAR116_0215 two-component
                     system, NtrC family, nitrogen regulation sensor histidine
                     kinase GlnL"
                     /codon_start=1
                     /transl_table=11
                     /product="Histidine kinase"
                     /protein_id="APA94369.1"
                     /db_xref="UniProtKB/Swiss-Prot:P09431"
                     /translation="MGNTRLICDPNELRQLFLFEKLDDEQLAWLCRDGRVEMFEPGLV
                     FREGDPATCFYILMDGEVVLTKMSGGEEIELVRTEHVGSYSGAWTAYMGDKVEQTYTA
                     SFYVTRPSKFFVLDAGTFAKMMQEWFPMALHLLEGVFFGNRNANERIGQRERLLALGS
                     LSAGLTHELNNPAAAAVRATSSLRERVAGMRHKLKMMAHGKFDSETLEALVQLQEEAA
                     AQVAKAPKLTSLEAADREDELGDWLEAHDIANGWDLAPNFVQAGFDTDWLEKVHGTLS
                     GCGGDVFEGAIRWLNYTVETELLMNEITDSTTRISSLVNAAKQYSQMDRAPFQVVDLH
                     ELLDSTLVMLARKIGDDITVVKEYDPALPQVPCYAAELNQVWTNLIDNAVAAMAGRGT
                     LTIRTYREGDCAAVEIGDTGPGVPDEIRTRIFEPFFTTKPVGEGTGLGLDISFRIVVN
                     KHHGDIRVESEPGNTRFIVRLPLEAAAPTETEAAQSTTEGQ"
     gene            complement(273389..275062)
                     /gene="trxB"
                     /locus_tag="NS506_00286"
     CDS             complement(273389..275062)
                     /gene="trxB"
                     /locus_tag="NS506_00286"
                     /EC_number="1.8.1.9"
                     /function="Activator; ATP-binding; Cytoplasm; DNA-binding;
                     Nucleotide-binding; Phosphoprotein; Plasmid;
                     Transcription; Transcription regulation; Two-component
                     regulatory system."
                     /note="Probable member of the two-component regulatory
                     system involved in the regulation of the hydrogenase
                     activity. HoxA is probably phosphorylated by a sensory
                     component (which could be HoxX) and then acts in
                     conjunction with sigma-54 as a transcriptional activator.
                     Contains 1 response regulatory domain; Contains 1 sigma-54
                     factor interaction domain; KEGG: ncy:NOCYR_5110
                     thioredoxin reductase (NADPH)"
                     /codon_start=1
                     /transl_table=11
                     /product="Thioredoxin-disulfide reductase"
                     /protein_id="APA94370.1"
                     /db_xref="UniProtKB/Swiss-Prot:P29267"
                     /translation="MTSPAAAKPAILSVDDDPGVSRAVVRDLRRRYGADYRILRAESG
                     ADALEALREMKLRGQPVAVLIADYRMPGMNGVEFLEQAMDLHPYARRVLLTAYADTNA
                     AIEAINVVDLDHYLLKPWDPPEEKLYPVVDALLEAWRGDDHKPVTETKVVGHRWSARC
                     SEVREFLARNQLPYRWYQVDEPEGARLLSAANATEDQCPVIINPSGDVLIMPTDAQLA
                     EGVGLNTDASSDFYDLIVVGGGPAGLGAAVYGASEGLRTVLVERTATGGQAGQSSRIE
                     NYLGFPDGLSGAQLADRARRQAVKFGAELITAREVVALEACGSARVVRFADGGTVSAH
                     SVLIATGVNYRHHPAPGVDEYTGRGVYYGSAMTEASDCADKDVYIVGGANSAGQAAVF
                     LSRRARNVHILVRGESLEASMSHYLIQQIEQIPNIKVHTRTEVVSADGDDHLERIVLR
                     DNATGTEEKVDAERLFLFIGAAPETDWLDGIVKRDDAGYVLAGPDLMVDGERPAGWEL
                     SRPPQHLETSVPGVFVAGDVRSESAKRVASAVGEGAMAVMLVHRWLAKQ"
     gene            complement(275085..275288)
                     /locus_tag="NS506_00287"
     CDS             complement(275085..275288)
                     /locus_tag="NS506_00287"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94371.1"
                     /translation="MNLRSLLHLETKTVPVLPADEPATDAETTTSDKPTKRFRRKANG
                     ALEERLERLLTPSEMDLLHHHRI"
     gene            275466..276008
                     /locus_tag="NS506_00288"
     CDS             275466..276008
                     /locus_tag="NS506_00288"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94372.1"
                     /translation="MIHATETWVIQDTRIRIPIPTISSPEAMLPNTLEASIDIAAAPE
                     QVWSVVSDLKRIPEFSPQTLRMQPLGRTVHTGTWTVNLNKASGYVYPTTSRVVRFEPN
                     KSIAFRMTENRTVWSYTLEPGPDGGTRLVQRRDVPSGKLPWWLQKTIDTVFGGEQPFE
                     GALVDGMNETLGKIKRTVES"
     gene            276024..276728
                     /locus_tag="NS506_00289"
     CDS             276024..276728
                     /locus_tag="NS506_00289"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94373.1"
                     /translation="MRRLTAICAAAAGVALLLTGCGSSDSGGDRTVTVSGTGKVQGTP
                     DVLNADLGTEVAAGDVSAAVDQANAKAKAITDAMVTAGAKREDITTSDLSVQPTYGPE
                     GRSISGYRATNSMHVKVRDLPKASAILSAAVQAGGNDTRISSVAFGLEDNTKLLSDAR
                     SRAFEDAKSRAQQYADLSGLKLKKVKTISENGSGPMPTQVPMYKDAVPGAAPNISLEP
                     GQQTVTFTVTVAWDLG"
     gene            276813..277907
                     /locus_tag="NS506_00290"
     CDS             276813..277907
                     /locus_tag="NS506_00290"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94374.1"
                     /translation="MSRIGGRFARSEPRERVREYVSGLLAGLERKNGWTLAERAGETG
                     PQGMQRLLRAADWDVEAVRDDVRDYVVERLGDPEAVLAGDETGFLKKGVKSAGVQRQY
                     SGTAGRTENCQIGVFLAYASTHGHALIDRELYVPQSWTSDRERCREAGIPDEVAFATK
                     PRQMIAMLERAVAAKVPFRWFTADEAYGQAGYLREWCEDHDVFYVLATRCDQQVATRA
                     DRIARADELVGEFTASTWQRFSVGAGAHGPREYDWARRQIEGRWASGRGHWLLARRSI
                     AKPTEIAYYLCYGPATARLVDLAWTAGSRWHVEEAFQQAKGEAGLDHYQVRNWRAWYA
                     HITLSMLALAWLAASKAVAAKGDSPIPAKA"
     gene            complement(278102..279133)
                     /locus_tag="NS506_00291"
     CDS             complement(278102..279133)
                     /locus_tag="NS506_00291"
                     /EC_number="2.3.1.-"
                     /function="Acyltransferase; Cytoplasm; Fatty acid
                     biosynthesis; Fatty acid metabolism; Lipid biosynthesis;
                     Lipid metabolism; Multifunctional enzyme; Transferase."
                     /note="Catalyzes the condensation reaction of fatty acid
                     synthesis by the addition to an acyl acceptor of two
                     carbons from malonyl-ACP. Catalyzes the first condensation
                     reaction which initiates fatty acid synthesis and may
                     therefore play a role in governing the total rate of fatty
                     acid production. Possesses both acetoacetyl-ACP synthase
                     and acetyl transacylase activities. Its substrate
                     specificity determines the biosynthesis of branched- chain
                     and/or straight-chain of fatty acids; Belongs to the FabH
                     family; KEGG: nno:NONO_c71510 beta-ketoacyl ACP synthase;
                     Transferring groups other than amino-acyl groups"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-(acyl-carrier-protein) synthase"
                     /protein_id="APA94375.1"
                     /db_xref="UniProtKB/Swiss-Prot:O67185"
                     /translation="MAARIASISGVEHTAMLGLGVYRPARVVTNDEVAGPIASSDEWI
                     RTRSGIRTRRFASPEETIIAMSAAAARDAIEAAEIDPALIDCVIVATSTWLLLTPAAG
                     PQIATELGLNNVAAFDVSAGCAGFCHGVAMASDLVKGGTARNVLVIGVERLTDTINTA
                     DRGTAFLFADGAGAVVIGPSDEPGIGPTVWGSDGTQHHAIRQDKDWMEFFREIDERGL
                     DAVRPYLAMEGTAVFRWAAHSLEKVCRDAIERAGLTPEELDAMVPHQANGRIIEIMAR
                     VLKLPESCALANDIEETGNTSAASIPLAMEAMMRKGDAKPGGTALLIAFGAGLSYAAQ
                     VVQLPNWKS"
     gene            279369..280133
                     /gene="pisD"
                     /locus_tag="NS506_00292"
     CDS             279369..280133
                     /gene="pisD"
                     /locus_tag="NS506_00292"
                     /EC_number="4.1.1.65"
                     /function="Decarboxylase; Lipid biosynthesis; Lipid
                     metabolism; Lyase; Phospholipid biosynthesis; Phospholipid
                     metabolism; Pyruvate; Zymogen."
                     /note="Belongs to the phosphatidylserine decarboxylase
                     family. Type 3 subfamily; KEGG: rha:RHA1_ro02159
                     phosphatidylserine decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphatidylserine decarboxylase"
                     /protein_id="APA94376.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q5YNV8"
                     /translation="MIAVNDRTYPRMKEELVARRPTPPGTPEQTGLGHVVDLVRSSIP
                     PLHPAGLPFVAAPLAVATLGYRRKWLRRTGLLAAAACATFFRHPHRVPPNRSGVVVAP
                     ADGEVALVDTAVPPAELALGDAPLPRVSIFLSVLDVHVQRVPVSGLVEQIAYQKGQFL
                     SADLPEASDRNERNSMVIETASGQRVVVVQIAGLLARRIICEAKAGDKVSIGDTYGLI
                     RFGSRVDTYFPAGTELLVTPGQRTIGAETVLAELDS"
     gene            280133..281047
                     /gene="cho1"
                     /locus_tag="NS506_00293"
     CDS             280133..281047
                     /gene="cho1"
                     /locus_tag="NS506_00293"
                     /EC_number="2.7.8.8"
                     /function="Cell membrane; Lipid biosynthesis; Lipid
                     metabolism; Membrane; Phospholipid biosynthesis;
                     Phospholipid metabolism; Transferase; Transmembrane;
                     Transmembrane helix."
                     /note="Belongs to the CDP-alcohol phosphatidyltransferase
                     class-I family; KEGG: xcc:XCC0641
                     CDP-diacylglycerol---serine O-phosphatidyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol--serine
                     O-phosphatidyltransferase"
                     /protein_id="APA94377.1"
                     /db_xref="UniProtKB/Swiss-Prot:P59949"
                     /translation="MEQLAPAPNQQRRRNRTVMLLPSMVTILGLCSGLSSVKFAMEGK
                     LGIALALVGAAAVFDMLDGRIARMLDATTRMGAELDSLSDAIAFGVAPALVLYVTFLH
                     ADSIGWILALMFAVCMVLRLARFNTLMDDDNRPDWQREYFVGVPAPAGALIVLLPIAL
                     SEQFGDGWWVSFPLAAVWTVLTGLLCVSTLPTLAIKSVSVAPRTAPILLVLVALAAAL
                     LVTYPLILMMGLVALYLGHIPFAVHSARWVAARPETWNHKPAERRAQRRAQRRQRPLA
                     GRVPRVSTARLRLRRPGPRERVPDRTNR"
     gene            281223..283403
                     /locus_tag="NS506_00294"
     CDS             281223..283403
                     /locus_tag="NS506_00294"
                     /function="Acetylation; ATP-binding; Cell cycle; Cell
                     division; Cell membrane; Cytoplasm; Cytoskeleton;
                     Membrane; Nucleotide-binding; Nucleus; Phosphoprotein;
                     Protein transport; Repeat; Transport; Ubl conjugation."
                     /note="Probably functions in cell division and growth
                     processes. Interacts with certain SNAREs as part of
                     specialized membrane fusion events where vesicles from the
                     same organelle fuse (homotypic fusion) (By similarity);
                     Belongs to the AAA ATPase family"
                     /codon_start=1
                     /transl_table=11
                     /product="Cell division control protein 48 like protein"
                     /protein_id="APA94378.1"
                     /db_xref="UniProtKB/Swiss-Prot:P54609"
                     /translation="MALGLQAGDGVTLTGGRRTTAVVGPFKPTHGSTPGVALLDEVTL
                     SNAKVRDGGDVKIAAATVYDARRVAVTGSSLAIAAIPESTLRQALLGKIVTVGDTVTL
                     LPRDLLATDHPAAARRALKGLGIAWTSEVLRVTATDPQPGAVTILPSTAVTLGSIVGT
                     DTPHGLLDDTNLLSTGPIPVLERPTSAPTAAVAPTAAVAVADLAGVQAQAAKLKEWLN
                     LALDEPELLKALGATSHLGVLITGPAGVGKATLARAVTGTRRLVELDGPAVGAIEAGS
                     RLREVANKVTEICSGAGGVLLITDIDALLPAEPEPVATLILDQLRCAVARPAVAVLAT
                     TSNGVGLDARLRSPELFDRTVSLPLPTAGVRAALLEQLLCKAPTEDLKLDEIAARTPG
                     YVVTDLAALVREAALRAAGRASGDHSDPVLRQEDLTGALEVIRPLSRSGSEELAIGNL
                     SLDDVGDMAETKQALTEAVLWPLKHPDSFKRLGIEPPRGVLLYGPPGCGKTFLVRALA
                     GSGQLSVHAVKGAELMDKWVGSSERAVRELFQRARDSAPSLIFLDEVDALAPQRGQSS
                     DSGVSDRVVAALLTELDGVEPLRDVVVVGATNRPDLIDSALTRPGRLERLVFVPPPDA
                     EARGEILRTAAESVPLAADVNLRRLARDLDGYSAADCSALLREAALAAMRRDVEAGEV
                     TADDMAAARKAVRPSLNPVQVEALRLFAAQRESAGQPGDPSGYV"
     gene            283561..284889
                     /locus_tag="NS506_00295"
     CDS             283561..284889
                     /locus_tag="NS506_00295"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94379.1"
                     /translation="MRSYQVAAETITALVTATVAGLALALPIDFGWTSQTSALQLDLL
                     AYSLPRAIAAGVLVAMIAPVLLTTLGSTKAAWGTTVGGLLVLLANHGLGHATDPHSSL
                     STMNFIDSLAGGLVLGALGAAVLHHRLPAFAWTLGILISLLLGSVNPVPRVGGSIDET
                     TAGHWHATDIPPVWMILLALALAAFGFLTYRNRPVAQRLSIELPLAPILAGVVLVLVT
                     LASAEWLARHGDTLAGIGLAVVTAVGTALIAAMLLPGRDGEIVLLAVGLSAVAAATVA
                     AELPAWSIPLLVAVTAFGMWTGSRYGAPRACLVAAIVLGVSTALTSDTELAWLIVGGA
                     AIVSWLVGFGLASARPRYVPSRVLGTMVIFVPSAVLGMRDYVARGHYALQSPDHSAVC
                     TVTSGSTETPAWTAVLVAAGCLAGLLALRRSRPLPAATEAATDSNAATAD"
     gene            complement(284903..286258)
                     /locus_tag="NS506_00296"
     CDS             complement(284903..286258)
                     /locus_tag="NS506_00296"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94380.1"
                     /translation="MLLDDPRPKPGGGARRQGQWISSPRARLTAVLAALAVLLLALQI
                     VASQHHFVGPLESIWDDFAGNAKSFTVPWAGLGLALIGLPWRRRGIAVGAALAIDLAY
                     QSIRWLTGGPLAMGNGPVLVLIAILGLAVWKWQGAERTNALHAGSLGLLLVLSSKVAD
                     VWLGITVLAGPRVLDEHVLLVDHALGDPSWLMGQLVDWLGPIVTSVLHWVYIELPLGA
                     MIVTIWQLRNVVKTGQWPRHYLVRTFLVLGLIGPVFYVVFPVVGPIFAYGAEGHAFAL
                     GQYWPNMVPPVELSPGSIAFDHFAPRNCMPSLHTAWALSIFIHSRCDPFTGAPAPTWL
                     RWGGAFWLVATLSATLGFGYHYGADLVAGAVLCLTIESALRAPERGWDPIRARLVAAG
                     ITLFAGLLLSYRYLSAGFAEHPVPAGMIVLGLLAAYVTAFYRTWFAQLPVPALENAVR
                     A"
     gene            complement(286443..287591)
                     /gene="ybdK"
                     /locus_tag="NS506_00297"
     CDS             complement(286443..287591)
                     /gene="ybdK"
                     /locus_tag="NS506_00297"
                     /EC_number="6.3.-.-"
                     /function="ATP-binding; Ligase; Nucleotide-binding."
                     /note="ATP-dependent carboxylate-amine ligase which
                     exhibits weak glutamate--cysteine ligase activity; Belongs
                     to the glutamate--cysteine ligase type 2 family. YbdK
                     subfamily; KEGG: rhb:NY08_4575 carboxylate-amine ligase;
                     Forming carbon-nitrogen bonds"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative glutamate--cysteine ligase 2-2"
                     /protein_id="APA94381.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q5YNU2"
                     /translation="MAGAGISKVPFNSSPRPTLGVEWEVALVDKRTRDLSNTAAAVFE
                     ACGDLRAWDGTPQITKELLKNTVELVSGKHDTVSEVVDELRATQDVVRRAADQVGVDL
                     FCAGTHPFAQWSTQQLTRSAHYDELIERTQWWGRQMLIWGVHVHVGISHPDKVFPILN
                     ALLPSYPHLLALSASSPMWAGVDTGYASNRALMFQQLPTAGLPFQFENWGQFEGFVHD
                     QMKTGVFEQLGGMHWDIRPAPKWGTIEVRICEGTPTKAELAAIVALIHCLIVDLDRRV
                     ENGETLPPILPPWHVQENKWRAARYGLDAIIITDADSNERLVTDDLMELLNRLEPTAK
                     SLGCENELALVADIPKKGASYQRQRRVAAAAQGDLVAVVDSLVHELEQ"
     gene            complement(287610..288245)
                     /gene="sod1"
                     /locus_tag="NS506_00298"
     CDS             complement(287610..288245)
                     /gene="sod1"
                     /locus_tag="NS506_00298"
                     /EC_number="1.15.1.1"
                     /function="Antioxidant; Cell membrane; Copper; Disulfide
                     bond; Lipoprotein; Membrane; Metal-binding;
                     Oxidoreductase; Palmitate; Signal; Zinc."
                     /note="Destroys radicals which are normally produced
                     within the cells and which are toxic to biological
                     systems; Belongs to the Cu-Zn superoxide dismutase family;
                     KEGG: rha:RHA1_ro02173 superoxide dismutase, Cu-Zn family"
                     /codon_start=1
                     /transl_table=11
                     /product="Superoxide dismutase"
                     /protein_id="APA94382.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9RU48"
                     /translation="MASSSTRRPSWWTVAPVLAVAALGLTACSNSQESSDVKGTTPPV
                     FTSSAAPAGAKTGLGSAAEPRDSVSATLKDSNGQSVGTATFTSKGGHLEVIVEAHGLK
                     PGFHGLHLHQNGKCEGDFTSAGGHLQVGEANAHPSSGDLTSLQVLKDGTATLTTTTDS
                     VTLDEIKGKALIVHAGADNFGNIPTRYAAAPDADTLATGDAGARVACGVVA"
     gene            complement(288369..288950)
                     /locus_tag="NS506_00299"
     CDS             complement(288369..288950)
                     /locus_tag="NS506_00299"
                     /EC_number="2.7.11.1"
                     /note="KEGG: rav:AAT18_00200 serine/threonine protein
                     kinase, bacterial"
                     /codon_start=1
                     /transl_table=11
                     /product="Non-specific serine/threonine protein kinase"
                     /protein_id="APA94383.1"
                     /translation="MSNPNSPSGGPPLRALAMVLIALAIVFAGLGAMSLSSSDSSDAG
                     AGSQTSSAAPTTTAAQQNSAQVSTAPVVPTTTAAQPTTTTVAPTTTAPTTTTAAAGID
                     KTVPVRVYNNGTVAGLAKKTGDQLSADGFNVAEVGNYPNGVIPKTTVYYGSSPKEQAL
                     AQAIAAELGCSAEPRFPGISDSLAGVIVIVTGN"
     gene            complement(288967..289317)
                     /locus_tag="NS506_00300"
     CDS             complement(288967..289317)
                     /locus_tag="NS506_00300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94384.1"
                     /translation="MDSAAARDISASEDGIPAGAPGIPESAADEDGAHGLSRRERDIL
                     DFERKWWKYAGAKEEAIRELFDLSATRYYQVLNAVVDKPEALVADPMLVKRLRRLRAS
                     RQKTRAARRLGFQV"
     gene            289505..290131
                     /locus_tag="NS506_00301"
     CDS             289505..290131
                     /locus_tag="NS506_00301"
                     /EC_number="3.5.1.88"
                     /function="Hydrolase; Iron; Metal-binding; Protein
                     biosynthesis."
                     /note="Removes the formyl group from the N-terminal Met of
                     newly synthesized proteins. Requires at least a dipeptide
                     for an efficient rate of reaction. N-terminal L-methionine
                     is a prerequisite for activity but the enzyme has broad
                     specificity at other positions; Belongs to the polypeptide
                     deformylase family; KEGG: nno:NONO_c71690 peptide
                     deformylase"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptide deformylase"
                     /protein_id="APA94385.1"
                     /db_xref="UniProtKB/Swiss-Prot:C1B0D9"
                     /translation="MAILPIRIVGDPVLHRATTPVTQTPEELAELIADMYETMDAAHG
                     VGLAGNQVIIKDEDELAPRLFVYDCPDEAPRGKMVRRRGCVVNPVLVTSEIPETMPDP
                     DDDEEGCLSVPGEQFPTGRADWAKVTGTDEKGEPVELEGNGFFARMLQHETGHLDGYL
                     YVDVLVGRNARAAKKSIKRNGWGKPGLSWVPGTVPDPFGHDDVDEDDD"
     gene            290138..291088
                     /locus_tag="NS506_00302"
     CDS             290138..291088
                     /locus_tag="NS506_00302"
                     /EC_number="3.5.1.88"
                     /note="KEGG: mtuh:I917_03095 peptide deformylase"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptide deformylase"
                     /protein_id="APA94386.1"
                     /translation="MTESELPPIGKRVVVRYRLPAGYPQPLTDVIGELTATDPLTVRT
                     ADGQVVSIAWDQVVAWKPLGPRPIRTSEIRSLEAAAADGWPGQMRSWIDGWLLRAGNG
                     YTNRANSAVPLGGTDGPALMNTETLQRIGEWYTAHGLPLVLQLPDRLATAPAQWRTWN
                     ETQVLAVDIENMMLPQGPPMVRFTSEPDGAWLSVHRHRGGDTYVGSTPVVEVLTAVRD
                     GEVAFATLGLPTALAIGRAAVTTAPDGRRWVGLTCMAVADGHRRHGLGSLVCAEMVRW
                     GQSRGATHAYVQVSDDNDAALALYQEMGFVEHHSYRYAAP"
     gene            291140..291952
                     /gene="xthA"
                     /locus_tag="NS506_00303"
     CDS             291140..291952
                     /gene="xthA"
                     /locus_tag="NS506_00303"
                     /EC_number="3.1.11.2"
                     /function="DNA damage; DNA repair; Exonuclease; Hydrolase;
                     Magnesium; Metal-binding; Nuclease."
                     /note="Major apurinic-apyrimidinic endonuclease of E.
                     coli. It removes the damaged DNA at cytosines and guanines
                     by cleaving on the 3'-side of the AP site by a
                     beta-elimination reaction. It exhibits 3'-5'-exonuclease,
                     3'-phosphomonoesterase, 3'-repair diesterase and
                     ribonuclease H activities. Belongs to the DNA repair
                     enzymes AP/ExoA family; KEGG: xfa:XF1933
                     exodeoxyribonuclease III"
                     /codon_start=1
                     /transl_table=11
                     /product="Exodeoxyribonuclease III"
                     /protein_id="APA94387.1"
                     /db_xref="UniProtKB/Swiss-Prot:P09030"
                     /translation="MRIATWNVNSIRTRQDRVLAWLDRADIDVLAMQETKCKDEQFPF
                     EAFEAAGYEVAHVGYNQWNGVAIASRVGIEDVEIGFPDQPGFDKDAGESLLSTPVVEA
                     RAIGATCGGVRVWSLYVPNGRALDDPHYTYKLEWLAALRNAGSKWLAEAPDAQIALVG
                     DWNIAPTDLDVWSPEFFEGKTHVSQPERDAFDAFDEANFTDVMRPFHPGPGVYTYWDY
                     TQLRFPRREGMRIDYILGSPALAARVTEANVDREERKGKGASDHAPVVAELS"
     gene            complement(291949..292587)
                     /locus_tag="NS506_00304"
     CDS             complement(291949..292587)
                     /locus_tag="NS506_00304"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94388.1"
                     /translation="MVFPVSFGWIQILLLVLAIGAIGLLITAVLKARKVGWRVLAGRG
                     AGAIGVVLVAVVILWITTLLQTFLGLTGEVKAAHIEAKPIAGQEHMMNVDLTLYGDKD
                     HGDQHKSYQVEGDMWVLQANIVELDAWVNALGFNSGYKVTRLYGQRLDGIATKQNQIF
                     LNGSDADFFQDMKNRTWYTKPFVRSAYGNAVIATAGNYDVFISRDAIKTRPV"
     gene            complement(292697..294523)
                     /locus_tag="NS506_00305"
     CDS             complement(292697..294523)
                     /locus_tag="NS506_00305"
                     /EC_number="1.3.99.-"
                     /function="FAD; Flavoprotein; Oxidoreductase."
                     /note="Involved in the assimilation of
                     dimethylsulphoniopropionate (DMSP), an important compound
                     in the fixation of carbon in marine phytoplankton, by
                     mediating the conversion of 3-(methylthio)propanoyl-CoA
                     (MMPA-CoA) to 3- (methylthio)acryloyl-CoA (MTA-CoA);
                     Belongs to the acyl-CoA dehydrogenase family; KEGG:
                     mtu:Rv0244c null; With other acceptors"
                     /codon_start=1
                     /transl_table=11
                     /product="3-methylmercaptopropionyl-CoA dehydrogenase"
                     /protein_id="APA94389.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q5LLW7"
                     /translation="MSHYKANLRDIEFNLFEVLGIGELLDQGAYGDLDGDTAREMLAE
                     AKRLAEGPIAESFVDADRNPVEFLPEQHTITVPESLKKTVAAVNEAGYSGLGMSEDMG
                     GVPAPNALIWGIQEMIVAANNSASFFNTGPLMHKVLFDEGTEQQQKWAAHAWENRWGG
                     TMVLTEPDAGSDVGMGRTKAIAQADGTWHIEGVKRFISGGDVGDTAANIFHLVLARPE
                     GAGPGTKGLSLFVVPRFLFDTETMELGAKNGALVTGVEHKMGIKSSPTCEITFGGDIP
                     AVGYLVGDKHNGIAQMFKVIENARMMVGTKATGALSTGYLNALEYAKQRVQGADLTQM
                     TDKAAPRVTITHHPDVRRSLATQKAYAEGLRALYMFCASYQNADVAQANYGVDAELAE
                     RVNDLLLPIVKGCGSDRAYESLTESLQTLGGSGYLQDYPIEQYIRDCKIDSLYEGTTA
                     IQAQDFFFRKIIRDKGVALGHVAGLIQKFVDGGPDQFKVERGLLGAALADVQAMAATL
                     TGYLMAAQQQVDEIYKVGLGSVRFLYAVGDLVIAWRLLEHAAIAQAALDAGAAEKDKS
                     YYTGKVGVASFFAKNKLPLISGVRSVVENIDNDIMKLDEAAF"
     gene            complement(294831..295925)
                     /locus_tag="NS506_00306"
     CDS             complement(294831..295925)
                     /locus_tag="NS506_00306"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94390.1"
                     /translation="MSRIGGRFARSEPRERVREYVSGLLAGLERKNGWTLAERAGETG
                     PQGMQRLLRAADWDVEAVRDDVRDYVVERLGDPEAVLAGDETGFLKKGVKSAGVQRQY
                     SGTAGRTENCQIGVFLAYASTHGHALIDRELYVPQSWTSDRERCREAGIPDEVAFATK
                     PRQMIAMLERAVAAKVPFRWFTADEAYGQAGYLREWCEDHDVFYVLATRCDQQVATRA
                     DRIARADELVGEFTASTWQRFSVGAGAHGPREYDWARRQIEGRWASGRGHWLLARRSI
                     AKPTEIAYYLCYGPATARLVDLAWTAGSRWHVEEAFQQAKGEAGLDHYQVRNWRAWYA
                     HITLSMLALAWLAASKAVAAKGDSPIPAKA"
     gene            complement(296179..296826)
                     /gene="acpD"
                     /locus_tag="NS506_00307"
     CDS             complement(296179..296826)
                     /gene="acpD"
                     /locus_tag="NS506_00307"
                     /EC_number="1.7.-.-"
                     /function="Flavoprotein; FMN; NAD; Oxidoreductase."
                     /note="Catalyzes the reductive cleavage of azo bond in
                     aromatic azo compounds to the corresponding amines.
                     Requires NADH, but not NADPH, as an electron donor for its
                     activity; Belongs to the azoreductase type 1 family; KEGG:
                     nfa:nfa44770 FMN-dependent NADH-azoreductase; Acting on
                     other nitrogenous compounds as donors"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-dependent NADH-azoreductase"
                     /protein_id="APA94391.1"
                     /db_xref="UniProtKB/Swiss-Prot:C1F513"
                     /translation="MTTLLHLDASARRNSVSRLLGAVFADAWRAEHPDGRYLHRDLAA
                     DPVPFIGEGWTELCDRVLAHGRTDLDRLPELVNSPAQQAAWEIVEPLLAQARAADVIL
                     IGTPMYNYSIPAALKARLDQVTFPRMSLAPTRFVVVTARGGAYSPGAPKAVYDYQERY
                     LRDFFSGHFAVDDTVFVNAELVNSRQDPALAHLRSQHDESCTAALVSARQLGKEY"
     gene            296923..297537
                     /locus_tag="NS506_00308"
     CDS             296923..297537
                     /locus_tag="NS506_00308"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94392.1"
                     /translation="MSCMDTPALALLGDRSAPVERADAARNRAKVLAAATELFASRDP
                     RTVTMDDIAKAAGVGRGTLYRRYPDVVSIAVALLDEHERALQEQLLRGEPPLGPGAPP
                     ARRLAAFYAAMIELLETHAHLVLGAETGGARFRTGAYQFWAVHVRTMLVEAGVAEPDS
                     LVDVLLAPLAAEVYTHQRERGLSSEEIKSALAEVAIGVIGTAAG"
     gene            complement(297539..298387)
                     /locus_tag="NS506_00309"
     CDS             complement(297539..298387)
                     /locus_tag="NS506_00309"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94393.1"
                     /translation="MTDLLASTRAELLRLRKWPAFRIVLGTWILLNLTFAYLFNYLAY
                     RTGSTTRMSNGLPRDALIQQMLPASVPEVYTQGMAMFGGALMLVLGALAVGSGYGWGS
                     WKTALTQGPARVHVIGAVVLSLALTVFALVLAAFVIDTGVAALIAGTEGQSLALPSAG
                     HMLLGIASGTAILGMWTLAGAVVGAIARGPALAVGLGLVWVLVVENLLRGVAAIFSPI
                     EAVTDHLPGTAAGSLAGSLRTVGGPATPGVLNILSRGESLLVLAVYVLVFAAGTVWLI
                     RRRDLI"
     gene            complement(298384..299280)
                     /locus_tag="NS506_00310"
     CDS             complement(298384..299280)
                     /locus_tag="NS506_00310"
                     /function="Amino-acid transport; ATP-binding; Cell inner
                     membrane; Cell membrane; Membrane; Nucleotide-binding;
                     Plasmid; Transport."
                     /note="Probably part of a binding-protein-dependent
                     transport system y4tEFGH for an amino acid. Probably
                     responsible for energy coupling to the transport system.
                     Belongs to the ABC transporter superfamily; Contains 1 ABC
                     transporter domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative amino-acid ABC transporter ATP-binding
                     protein"
                     /protein_id="APA94394.1"
                     /db_xref="UniProtKB/Swiss-Prot:P55662"
                     /translation="MNEAIVVTDRLTKRYGSHTAVDAVSMSVRRGEIYGFLGPNGAGK
                     TTTLRMLVGLIRPSSGTATVLGTTPGDPDALRRMGVLIEGPGFYPYLSGRDNLRVLAR
                     YRGVGDDAVAEALDRVALSARGKDRFRTYSLGMKQRLGVAAALLGHPDLLILDEPTNG
                     LDPAGMAEMRELITGLAADGHTVVLSSHLLSEVQEICDRVGVISGGRLLVESTVRELR
                     GAASLLVRAEPAEVAFPAVRAVVGERSAMLTANGIRVDAGAEQAPAVARAVIASGAQL
                     FELRSDEKSLEEVFFEMTETAK"
     gene            299442..300632
                     /gene="desK"
                     /locus_tag="NS506_00311"
     CDS             299442..300632
                     /gene="desK"
                     /locus_tag="NS506_00311"
                     /EC_number="2.7.13.3"
                     /function="ATP-binding; Cell membrane; Kinase; Membrane;
                     Nucleotide-binding; Phosphoprotein; Transferase;
                     Transmembrane; Transmembrane helix; Two-component
                     regulatory system."
                     /note="Member of the two-component regulatory system
                     YvfT/YvfU. Probably activates YvfU by phosphorylation;
                     Contains 1 histidine kinase domain; KEGG: gpo:GPOL_c14480
                     two-component system, NarL family, sensor histidine kinase
                     DesK"
                     /codon_start=1
                     /transl_table=11
                     /product="Histidine kinase"
                     /protein_id="APA94395.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q795K2"
                     /translation="MLPAVAVGAIQLGFGTLANHHQSVVRDLDAFGYVLLAAGPVLLV
                     LRHRYPLQVFYGTLAAASAYLLAGYGYGPIFVSLVVAFMTAAIIGSRWYTYPFVAVGY
                     LLLVWPVPGWRGYETSAWQEFGLLAWLFVLAAGAEGIRQRAAAVTARRQRAESARRSE
                     QAQREREQAQRALESAEREQRVTEERLAIARELHDVLAHSLSLINVQSSVALELLDRK
                     PEQAATALAAIKSASKDALGEVNALLRSIRGGTATVAAPTAPTIGITDLDKLTGPARA
                     AGLVVHTMVTGGPRRLPAVVDVAAARIVQESLTNVVRHAPGASVLVTVHYATERLQLT
                     IDNTRPTRQPAPQSPTGGHGITGMTERAHALGGNLSAEPKADGGFRVRARLPTHLARP
                     EPAA"
     gene            300660..301322
                     /locus_tag="NS506_00312"
     CDS             300660..301322
                     /locus_tag="NS506_00312"
                     /function="Activator; Calcium; Cytoplasm; DNA-binding;
                     Metal-binding; Phosphoprotein; Repressor; Sporulation;
                     Transcription; Transcription regulation; Two-component
                     regulatory system."
                     /note="May play the central regulatory role in
                     sporulation. It may be an element of the effector pathway
                     responsible for the activation of sporulation genes in
                     response to nutritional stress. Spo0A may act in concert
                     with Spo0H (a sigma factor) to control the expression of
                     some genes that are critical to the sporulation process.
                     Repressor of abrB, activator of the spoIIa operon. Binds
                     the DNA sequence 5'-TGNCGAA-3' (0A box) (By similarity);
                     Contains 1 response regulatory domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Stage 0 sporulation protein"
                     /protein_id="APA94396.1"
                     /db_xref="UniProtKB/Swiss-Prot:P52934"
                     /translation="MGIRVVIADDQALVRAGFVALLGAQDDIEVVGEADDGEQAVDLA
                     RDLRPDVVLMDIRMPVLDGLAATRAIAADPALAAVKVVVLTTFELDEYVFEAMRAGAT
                     GFLVKHTEPADLVKAVRVVAGGDALLSPSVTRRLVAEFATHAKPAPAAEFSELTDRER
                     EVMALVAEGLTNAEIAERLYMSPATARTHVSRILVKLGARDRTQLVVMAYESGLVRPG
                     WQ"
     gene            complement(301333..301914)
                     /locus_tag="NS506_00313"
     CDS             complement(301333..301914)
                     /locus_tag="NS506_00313"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94397.1"
                     /translation="MREDGTPTESVTDSAVLSGCYPASVISVRSWFPALAGLALLAST
                     AACSGDETTPSAAPAKATTTVTTTLPAPTTSGALPADADARGWSNSFARCAGNGERPV
                     LLIAALTDSTERYAVCERSGADRVLRVAAPRLRAQPFEARFFTFTANSQQFVAEDGTK
                     IDLAREVVTVIDDPQAKRGLVVSYVVQQYWSSF"
     gene            complement(301919..302818)
                     /gene="ssuD"
                     /locus_tag="NS506_00314"
     CDS             complement(301919..302818)
                     /gene="ssuD"
                     /locus_tag="NS506_00314"
                     /EC_number="1.14.14.5"
                     /function="Carbohydrate metabolism; Oxidoreductase."
                     /note="Catalyzes the coenzyme F420-dependent oxidation of
                     glucose 6-phosphate (G6P) to 6-phosphogluconolactone;
                     Belongs to the F420-dependent glucose-6-phosphate
                     dehydrogenase family; KEGG: rha:RHA1_ro00619
                     alkanesulfonate monooxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Alkanesulfonate monooxygenase"
                     /protein_id="APA94398.1"
                     /db_xref="UniProtKB/Swiss-Prot:D8I5S8"
                     /translation="MELGLHLTNFALDTPSELIGPRLAEVVRTAEDSGFSVIAVGDHL
                     WQSPWLGRVEQNVLEAYSTLSFIAAHTARVELTALVSGVHYRHPAMLAKLVGTLDVLS
                     GGRAWLGIGAGTSTGDVEGYGLPFPPLRERYEMLEETLRICEAMWSDARGASEPVSGK
                     HFHVQRPLNAPQVLRTSPRRPRPPILIGGDGERRTLPLVARYADVASLRPGPDLPAKL
                     DLLNRLCGEIGRDPREIRKSCVFVVDPGPTGGGVAQVLGQLKWLADMGIDLVIARVAG
                     VDDISPLEVLGREVVPAVAEFGR"
     gene            complement(302895..303683)
                     /locus_tag="NS506_00315"
     CDS             complement(302895..303683)
                     /locus_tag="NS506_00315"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94399.1"
                     /translation="MLTDTQISDFITDGFVKVEGAFGAETAAAGREILWRETGCDPDD
                     PASWTQPVIRLWDHAEEPFTRAVTAPVLREAYDQLAGPGRWLPRISLGSWPIRFPSPE
                     SPGDAGWHVDVSFPGDAARDDYLSWRVNVFSKGRSLLMLFLFSDVDADDAPTRIRVGS
                     HLRLARELEPFGEAGTTMFDLADFYTATGDLPETLATGKAGDVYLCHPFLIHAAQPNL
                     VGRPRFMAQPPLLSREPCVLDRPDGAYSPVEQAIRRGLEVGVPR"
     gene            complement(303816..306401)
                     /locus_tag="NS506_00316"
     CDS             complement(303816..306401)
                     /locus_tag="NS506_00316"
                     /function="ATP-binding; Chaperone; Chloroplast;
                     Nucleotide-binding; Plastid; Repeat; Transit peptide."
                     /note="May interact with a ClpP-like protease involved in
                     degradation of denatured proteins in the chloroplast.
                     Belongs to the ClpA/ClpB family. ClpC subfamily; Contains
                     1 UVR domain"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ATP-binding subunit
                     ClpA like protein CD4A, chloroplastic"
                     /protein_id="APA94400.1"
                     /db_xref="UniProtKB/Swiss-Prot:P31541"
                     /translation="MAEQESEGAMFERFTDRARRVVVLAQEEARMLNHNYIGTEHILL
                     GLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLR
                     EALQLGHNYIGTEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGKEPV
                     EGSGQRGETGTPSTSLVLDQFGRNLTQAALEGKLDPVIGRSKEIERVMQVLSRRTKNN
                     PVLIGEPGVGKTAVVEGLAQAIVNGEVPETLKDKQLYTLDLGSLVAGSRYRGDFEERL
                     KKVLKEINTRGDIILFIDELHTLVGAGAAEGAIDAASILKPKLARGELQTIGATTLDE
                     YRKYIEKDAALERRFQPVQVGEPTVEHTINILKGLRDRYEAHHRVSITDGALVAAATL
                     ADRYINDRFLPDKAIDLIDEAGARMRIRRMTAPPDLREFDDKIAEARREKESAIDAQD
                     FEKAARLRDKEKQLVAKRAEREKQWRSGDLDVVAEVDDEQIAEVLANWTGIPVFKLTE
                     EETTRLLRMEDELHKRIIGQEDAVKAVSKAIRRTRAGLKDPKRPSGSFIFAGPSGVGK
                     TELSKALANFLFGEDDALIQIDMGEFHDRFTASRLFGAPPGYVGYEEGGQLTEKVRRK
                     PFSVVLFDEIEKAHQEIYNTLLQVLEDGRLTDGQGRTVDFKNTVLIFTSNLGTSDISK
                     AVGLGFAQSNVEGSNYERMKLKVNDELKKHFRPEFLNRIDDVIVFHQLTQDQIIQMVD
                     LMIGRVAKQLKNKDMEIELAPQAKSLLAKRGFDPVLGARPLRRTIQREIEDQLSEKIL
                     FGELGAGQVVVVDVEGWDGEGQGENAKFTFTAKAKLTKKSDDAAEDKPVAALAGDAPA
                     AASGE"
     gene            complement(306648..307607)
                     /locus_tag="NS506_00317"
     CDS             complement(306648..307607)
                     /locus_tag="NS506_00317"
                     /EC_number="3.1.1.3"
                     /function="Hydrolase; Lipid degradation; Lipid metabolism;
                     Secreted; Signal."
                     /note="An esterase which preferentially hydrolyzes
                     triacylglyceride substrates with short chain fatty acids
                     (less than C10) with the maximum activity towards
                     tricaprylin (C8:0). Active against p-nitrophenylesters
                     with fatty acid chain lengths from C6 to C18. Belongs to
                     the AB hydrolase superfamily; KEGG: rer:RER_06440
                     triacylglycerol lipase"
                     /codon_start=1
                     /transl_table=11
                     /product="Triacylglycerol lipase"
                     /protein_id="APA94401.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q79F14"
                     /translation="MRRMPMRRTPGSLLIIAVLAVLGIVASGTARAEYPVTFNFFAGI
                     PYELTNPGGSMPGSNDWNCKPTVMHPEPVVLVHGTAGGAQTNWGAYIPLLANEGYCVY
                     ALTYGSLDVPWPLSAMGGMKPIPESAAELAAFVNRVLAATGAAKVDFIAHSQGNTVGD
                     YYIKRLGGHGKVDKFVAIAPPWLGLFGDSMNSIRAFGKQLGVDADTVDEYATMGLICA
                     ACHQMLGDSTFLNALNADGVYDPTVTYTNLASNFDEGVFPSIALVPAANATNVLMQDG
                     CPTDYSDHLAIAGSHRGAMIALNALDPAHPRPVACEFVPPLTG"
     gene            complement(307788..308369)
                     /locus_tag="NS506_00318"
     CDS             complement(307788..308369)
                     /locus_tag="NS506_00318"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94402.1"
                     /translation="MFAFRTAALVAATLTTGLIAGVFYAYATSVMSALGRSDDKTFID
                     VMQKINVVIINPWFMLGFMGTVGFTVLAAALHLGKDSRTTLIWIGVALLLNIIAFGVT
                     SGLNVPLNNQLANAGDVGQIGDLAAVRAQFESSWVAWNIVRAVIHTLAFLVLMGALFV
                     AGAQHAKASVASPAAAPVHQQFVPQPGFPYGQR"
     gene            complement(308513..309136)
                     /locus_tag="NS506_00319"
     CDS             complement(308513..309136)
                     /locus_tag="NS506_00319"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94403.1"
                     /translation="MTAFHGSFLRVKDQEGRQHELMLSPDQPRITIGRSPQADLSLFW
                     DVEVSRLHATAEYLGAHWTIVDDGLSRNGTFVNGDRLVGRHRLQPGDVIRMGTSRVTF
                     HDFSGAAGDVTQTSTGGLPTLRSLTETQRSVLIALCRPLRGNDGFASPASNQQIAAEL
                     FLSVDAIKTHLRALFAKFGVEDLPQNQKRVRLANLAMQSGVISERDL"
     gene            complement(309409..309771)
                     /locus_tag="NS506_00320"
     CDS             complement(309409..309771)
                     /locus_tag="NS506_00320"
                     /function="Cytoplasm; DNA-binding; Repressor;
                     Transcription; Transcription regulation; Virulence."
                     /note="DNA-bridging protein that has both architectural
                     and regulatory roles. Influences the organization of
                     chromatin and gene expression by binding non-specifically
                     to DNA, with a preference for AT-rich sequences, and
                     bridging distant DNA segments (By similarity); Belongs to
                     the Lsr2 family"
                     /codon_start=1
                     /transl_table=11
                     /product="Nucleoid-associated protein Lsr2"
                     /protein_id="APA94404.1"
                     /db_xref="UniProtKB/Swiss-Prot:P65649"
                     /translation="MAKKVTVSLIDDVDGESIAEETIEFAIDGVSYEIDLSTENAARL
                     RDGLETWVSAARRVSGRRRTKVAGAPAAGPKNRVSIDREQSAAIREWARRNGHKVSAR
                     GRISADITEAYNKAASKN"
     gene            complement(309888..311378)
                     /gene="karS"
                     /locus_tag="NS506_00321"
     CDS             complement(309888..311378)
                     /gene="karS"
                     /locus_tag="NS506_00321"
                     /EC_number="6.1.1.6"
                     /function="Aminoacyl-tRNA synthetase; ATP-binding;
                     Cytoplasm; Ligase; Magnesium; Metal-binding;
                     Nucleotide-binding; Protein biosynthesis."
                     /note="Belongs to the class-II aminoacyl-tRNA synthetase
                     family; KEGG: ckp:ckrop_1644 lysyl-tRNA synthetase, class
                     II"
                     /codon_start=1
                     /transl_table=11
                     /product="Lysine--tRNA ligase"
                     /protein_id="APA94405.1"
                     /db_xref="UniProtKB/Swiss-Prot:P67608"
                     /translation="MEHDVPEQMRIRREKRERLLEEGREAYPVVVNRTHSLADIRAAH
                     PELEPDTQTGQMVGIAGRVIFVRNSGKLCFATLQEGDGTQLQVMISLNGVGEASLAAW
                     KADVDLGDFVFVHGEVIASRRGELSVIADSWEMAAKSLRPLPVLHKEMNEESRVRQRY
                     VDLIVRPEARENARTRVAVVRALRNALEHRGFLEVETPMLQTIHGGAAARPFATHSNA
                     LDMELFLRIAPELFLKRCVVGGIEKVFEINRNFRNEGADSTHSPEFAMLETYEAYGTY
                     DDSATMMRELIQEVAREVYGTLVVTLADGTEYDLSGEWTTVEMYPSLSEQIGVEVTPE
                     TTVAELLALADRVGLEIPEGKGYGHGKLVEELWEHVYGDKLYAPTFVRDFPVETSPLT
                     RQHRSKPGVTEKWDLYVRGFELATGYSELVDPVIQRERFEDQARLAAAGDDEAMRLDE
                     DFLAAMEHGMPPTTGTGMGIDRLLMALTGLGIRETILFPIVRPAAR"
     gene            complement(311512..311943)
                     /locus_tag="NS506_00322"
     CDS             complement(311512..311943)
                     /locus_tag="NS506_00322"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94406.1"
                     /translation="MTHLTIDGMLAHARQQLRRLLPIELPAAIARGAILVDIRPQAQR
                     LREGTLPGALVIERNVLEWRLDPSSSARLAMAEHHDVEWIIVCSEGYTSSLAAASLQQ
                     LGLRRATDLEGGYQALKAAGLLMVAASAPHFEREVATLAWL"
     gene            complement(311940..312551)
                     /locus_tag="NS506_00323"
     CDS             complement(311940..312551)
                     /locus_tag="NS506_00323"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94407.1"
                     /translation="MRSSVLSLPVDTRAPASRLLPEVTERATASALPTRLRPADLLRL
                     TDEGAHDVLEGRYDHLLPADGLWPTENRWAARLVADDEVDIWLISWVEGKYTELHDHA
                     GSLGALTVLSGALSEYRWNGRDLRRRTLTAGDQASFPLGWVHDVVRAPAEEAGITGPL
                     NPTLSVHAYSPPLTAMSYYEVTGHGTLRRTRSVLTDQPEGELE"
     gene            complement(312744..313538)
                     /gene="coaX"
                     /locus_tag="NS506_00324"
     CDS             complement(312744..313538)
                     /gene="coaX"
                     /locus_tag="NS506_00324"
                     /EC_number="2.7.1.33"
                     /function="ATP-binding; Coenzyme A biosynthesis;
                     Cytoplasm; Kinase; Metal-binding; Nucleotide-binding;
                     Potassium; Transferase."
                     /note="Catalyzes the phosphorylation of pantothenate
                     (Pan), the first step in CoA biosynthesis; Belongs to the
                     type III pantothenate kinase family; KEGG: mtu:Rv3600c
                     type III pantothenate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="Pantothenate kinase"
                     /protein_id="APA94408.1"
                     /db_xref="UniProtKB/Swiss-Prot:A0QA95"
                     /translation="MLLCIDVRNTSIELGLFSGSGEHAKLVRHWRMHTNPLFTADEFA
                     LQVRGLIGADADQVVGVAALSTVPPVLRELREMLSRYWAHVPHVLVEPGVRTGIPLLV
                     DNPKEVGADRIVNCLAAYHRFQSPAIVVDFGTAICVDLVSAKGEFLGGSIAPGVEIST
                     EALIARSALRRAELTRPRSVVGKNSMECLQSGAIFGFAGLVDGLIDRIRDIDAFSGDN
                     VAVVATGATAPLIVPESETIEHHEPHLTLDGLRLVYERNQQRRTRA"
     gene            complement(313552..313971)
                     /gene="panD"
                     /locus_tag="NS506_00325"
     CDS             complement(313552..313971)
                     /gene="panD"
                     /locus_tag="NS506_00325"
                     /EC_number="4.1.1.11"
                     /function="Autocatalytic cleavage; Cytoplasm;
                     Decarboxylase; Lyase; Pantothenate biosynthesis; Pyruvate;
                     Schiff base; Zymogen."
                     /note="Catalyzes the pyruvoyl-dependent decarboxylation of
                     aspartate to produce beta-alanine; Belongs to the PanD
                     family; KEGG: gpo:GPOL_c43260 aspartate 1-decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="Aspartate 1-decarboxylase"
                     /protein_id="APA94409.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q7NCY1"
                     /translation="MLRTMMTSKIHRATVTHADLHYVGSVTVDQDLLDAADLLEGEKV
                     SIVDITNGARLETYVIAGERGSGVIGINGAAAHLVHPGDLVILIAYGMLDAAELKDYA
                     PHVVFVDERNRPIELGTDPAHAPEGSDLISPRTLTLA"
     gene            complement(313984..314910)
                     /gene="panC"
                     /locus_tag="NS506_00326"
     CDS             complement(313984..314910)
                     /gene="panC"
                     /locus_tag="NS506_00326"
                     /EC_number="6.3.2.1"
                     /function="ATP-binding; Cytoplasm; Ligase;
                     Nucleotide-binding; Pantothenate biosynthesis."
                     /note="Catalyzes the condensation of pantoate with
                     beta-alanine in an ATP-dependent reaction via a
                     pantoyl-adenylate intermediate; Belongs to the
                     pantothenate synthetase family; KEGG: rhb:NY08_4411
                     pantoate--beta-alanine ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="Pantoate--beta-alanine ligase (AMP-forming)"
                     /protein_id="APA94410.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q0S8D5"
                     /translation="MDPKLIGSYKRGELTVHHDPAVMTKVVKALRSVGRRVALVPTMG
                     ALHEGHLELVRLAKLTNTTVIVSIFVNPLQFGANEDLDKYPRTLDADVELLRGEGVEL
                     VFAPSAKDMYPFGPRTTVQAGPFGDILEGATRPGHFSGVLTVVSKLFNICQPHEAFFG
                     EKDYQQLALIRQMVVDLNMDVKIVPAATVREQDGLAKSSRNRYLSESDRELAATLSAA
                     LLAGRHAAGRGPEAVLETAQSVLDLAPEIQVDYLALRGSDFSEEWPSGNARLLVAARV
                     GTTRLIDNMPVTIGKPLDGLPTVPDQPAQASL"
     gene            complement(314910..315911)
                     /locus_tag="NS506_00327"
     CDS             complement(314910..315911)
                     /locus_tag="NS506_00327"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94411.1"
                     /translation="MTSDKDVWSDPAPARLTVGIVSAGRVGSALGAALERAGHVVFGV
                     SAISDASLRRAATRLPDSRVLPAEDVAVRSELLILAVPDSELAGLVAGLAAANAVRPG
                     TIVAHTSGANGIGILAPLTAVGALPLAIHPAMTFTGHDEDVARLANACFGITAADDIG
                     YAIAQSLVIEMGGEPVRVSEEHRTLYHAALAHGSNHLVTLIVDAVEALRAALAGPGLL
                     GQQAVDEQPNGLAERMLAPLASAALDNALRRGPAALTGPVARGDVAAVAAHLDALEAL
                     DPRLAAGYRAQSLRSAERADSNPALIDLLEGPRPDGQARRRQRSVTTEGLDRPEEGY"
     gene            complement(316131..317069)
                     /locus_tag="NS506_00328"
     CDS             complement(316131..317069)
                     /locus_tag="NS506_00328"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94412.1"
                     /translation="MFTGFLLLLGLVASVFLIFSDNLHLIRVGLVAALWAAAIGALAA
                     TRYRREAAIDKAKVGDLQKVYQLQLEREVAARREYELGVETRVRHEVGADATEMAALR
                     AELTVLRESLQRLFDGDLPFERTALRADAVRVQELPGRDADPVAEAANNSWPDADPWD
                     PWSSPDQPEDDEDPRARIAPKIDPAHPEAPAFATPFDDPVTAETSIITDAMREEYEAE
                     RAAAEPDSPEQPPNPEPVNDSQPAETLTNLNGNANGNGNGGTPLPRLTPDPEPTTPVG
                     RATARRRRRGDTPDPEGTHRLSVAEIMANLKSENTN"
     gene            complement(317196..317666)
                     /locus_tag="NS506_00329"
     CDS             complement(317196..317666)
                     /locus_tag="NS506_00329"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94413.1"
                     /translation="MKPTRILDLCANVLLAAIVAWVATNVAYSSFPPISVFSGASLIP
                     VALLEAVLAFVIRQRKDNHGIGPGGSGQLHPITAARAVALAKASAQVGSLVGGIWLGF
                     LVWLLTHSDLRAAASDTPGAVVGLIGGVALVAAALWLEYCCRAPIDPPDEAATS"
     gene            complement(317722..318255)
                     /gene="folK"
                     /locus_tag="NS506_00330"
     CDS             complement(317722..318255)
                     /gene="folK"
                     /locus_tag="NS506_00330"
                     /EC_number="2.7.6.3"
                     /function="ATP-binding; Folate biosynthesis; Kinase;
                     Nucleotide-binding; Transferase."
                     /note="Belongs to the HPPK family; KEGG: mtu:Rv3606c
                     2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
                     diphosphokinase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine diphosphokinase"
                     /protein_id="APA94414.1"
                     /db_xref="UniProtKB/Swiss-Prot:P64144"
                     /translation="MTRVVLSIGSNLGDRLAHLRSVVAALGPRVIAVSSVYSTPPWGG
                     VPQQDYLNAVLVAEDPALEPSDWLRLGQELEQASGRVREVRWGARTLDVDVVWAEQRR
                     RDVRVVVRSLDPVLTLPHPQAHNRAFVLVPWLEVEPDAELAVSGAARSLREWLSALDS
                     AEVAGVRRTELSLGWTP"
     gene            complement(318252..318656)
                     /gene="folB"
                     /locus_tag="NS506_00331"
     CDS             complement(318252..318656)
                     /gene="folB"
                     /locus_tag="NS506_00331"
                     /EC_number="4.1.2.25"
                     /function="Folate biosynthesis; Isomerase; Lyase;
                     Oxidoreductase."
                     /note="Catalyzes the conversion of 7,8-dihydroneopterin to
                     6- hydroxymethyl-7,8-dihydropterin, 7,8-dihydromonapterin
                     and 7,8- dihydroxanthopterin, respectively, in equal
                     quantities. After longer incubation times the only product
                     is 6-hydroxymethyl-7,8- dihydropterin; Belongs to the DHNA
                     family; KEGG: req:REQ_05870 dihydroneopterin aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="Dihydroneopterin aldolase"
                     /protein_id="APA94415.1"
                     /db_xref="UniProtKB/Swiss-Prot:P0A581"
                     /translation="MSTDFTGLSGDRIELRGLRVFGHHGVFDFEKRDGQEFVVDLTLW
                     TDFTAAAKSDDIADTVHYGELAEQVVAIVAGEPCDLIETVVSKIADDVMADPRIEAVE
                     VVLHKPFAPIPHTFEDVRVVTSRRREAEESER"
     gene            complement(318653..319558)
                     /gene="folP"
                     /locus_tag="NS506_00332"
     CDS             complement(318653..319558)
                     /gene="folP"
                     /locus_tag="NS506_00332"
                     /EC_number="2.5.1.15"
                     /function="Folate biosynthesis; Magnesium; Metal-binding;
                     Transferase."
                     /note="Catalyzes the condensation of para-aminobenzoate
                     (pABA) with 6-hydroxymethyl-7,8-dihydropterin diphosphate
                     (DHPt-PP) to form 7,8-dihydropteroate (H2Pte), the
                     immediate precursor of folate derivatives; Belongs to the
                     DHPS family; Contains 1 pterin-binding domain; KEGG:
                     phl:KKY_1636 dihydropteroate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="Dihydropteroate synthase"
                     /protein_id="APA94416.1"
                     /db_xref="UniProtKB/Swiss-Prot:P28822"
                     /translation="MTSRLLEPRGGRSCVVMGVVNVTSDSFSDGGRYLDPELAVARGF
                     ELYELGADIIDVGGESTRPGAVRIDPETEAARVVPVIRELAEAGVPTSVDTMRASVAE
                     AAIEAGVSMVNDVSGGRADPNMVKVVAVTKIPWILMHWRADANYAHTGPAEQYDDVVS
                     KVWEELNAQIEFALAGGVEFGQLVLDPGLGFAKNADHNWELLGGMFYRMTELMDAGLP
                     VLIGASRKRFLGALLADSAGPRPPDGREVATATISALAAEHGAWGVRVHDVRSSLDAI
                     AVVDAATNAARRVRERYRRGAGEAL"
     gene            complement(319713..320348)
                     /gene="gch1"
                     /locus_tag="NS506_00333"
     CDS             complement(319713..320348)
                     /gene="gch1"
                     /locus_tag="NS506_00333"
                     /EC_number="3.5.4.16"
                     /function="GTP-binding; Hydrolase; Metal-binding;
                     Nucleotide-binding; One-carbon metabolism; Zinc."
                     /note="Belongs to the GTP cyclohydrolase I family; KEGG:
                     rha:RHA1_ro04408 GTP cyclohydrolase I"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase I"
                     /protein_id="APA94417.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q8FMG3"
                     /translation="MSATNTTANNRVGSGPIALETGRPFDQDRAEAAVRELLIAVGED
                     PDRPGLADTPGRVARAYREMFAGLFTDPAEVLNTTFDEGHQELVLVRDIPMYSTCEHH
                     LVAFHGVAHVGYIPGQHGRVTGLSKLARLVDLYAKRPQVQERLTSQIADAVMAKLDPR
                     GAIVVIEAEHLCMAMRGIRKPGASTTTSAVRGTLQSNASTRAEALDLILRK"
     gene            complement(320501..322858)
                     /gene="ftsH"
                     /locus_tag="NS506_00334"
     CDS             complement(320501..322858)
                     /gene="ftsH"
                     /locus_tag="NS506_00334"
                     /EC_number="3.4.24.-"
                     /function="ATP-binding; Cell membrane; Hydrolase;
                     Membrane; Metal-binding; Metalloprotease;
                     Nucleotide-binding; Protease; Transmembrane; Transmembrane
                     helix; Zinc."
                     /note="Acts as a processive, ATP-dependent zinc
                     metallopeptidase for both cytoplasmic and membrane
                     proteins. Plays a role in the quality control of integral
                     membrane proteins; In the central sectio; belongs to the
                     AAA ATPase family; In the C-terminal sectio; belongs to
                     the peptidase M41 family; KEGG: asd:AS9A_0311 cell
                     division protease FtsH; Metalloendopeptidases"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent zinc metalloprotease FtsH"
                     /protein_id="APA94418.1"
                     /db_xref="UniProtKB/Swiss-Prot:C0ZPK5"
                     /translation="MNRKTVFRHLAIVAGFLLVIWLVSYFSNDTRDWHSVDTSVALSQ
                     LQDKSNVESVQIDDKEQQLRVTLKNGNDATKGQTKIITKYPGGGEVSAQVFKAAEDSG
                     AKVNTTVKQDSWLSQILLFMLPMVILLGLFIFVMARMQGGGRGGMMGFGKSKAKLLSK
                     DMPKTTFQDVAGADEAIEELEEIKDFLQSPARYQALGAKIPKGVLLYGPPGTGKTLLA
                     KAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFDQAKQNSPCIIFVDEIDAVGRQR
                     GAGLGGGHDEREQTLNQLLVEMDGFGERTGVIIMAATNRPDILDPALLRPGRFDRQIP
                     VGNPDLKGRRAILAVHSKGKPISPDADLDGLAKRTVGMSGADLANVINEAALLTARVH
                     GTVITGAALEESVDRVIGGPRRKSRVISEHEKKITAYHEAGHTLAAWAMPDIEPVYKV
                     TILARGRTGGHAMTVPEDDKGLMTRSEMIARLVFAMGGRAAEELVFHEPTTGASSDID
                     QATKTARAMVTEYGMSARLGAVRYGQEQGDPFLGRSMGMASDYSHEVAREIDEEVRNL
                     IEAAHTEAWSVLNDYRDELDSLATALLERETLHRKELETILATVEKRPRITAFNDFGD
                     RTPSDRPPVKTPRELAAERGEPFPEEESRPVAQPANGHPEPAYGGAPQPQYGGYPAPA
                     PQGYPLPQAPAYPRQGTPTHGSRPDYGAPAGWSAPGWPPADDEPQAPQPRGAYGGWAP
                     AGNQRYQPGGQYQPGYGQPEYPAAPPAAGNDEDDKNGWDGPNGRR"
     gene            323164..324093
                     /locus_tag="NS506_00335"
     CDS             323164..324093
                     /locus_tag="NS506_00335"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94419.1"
                     /translation="MDIVELRTPTAIVRHGNGRLTVLRPGTDGERVLDVPVSDLLKVR
                     LNRRADDAVVIEIYLRYPTPVLTGVPADRTPLPVLIAEHDVPAATVIVERINNQILAT
                     QRLDVAAPDLTPPAPSWGRTGPARADVDRAVRRMAPKRDAKPAVAALQRYVTPDEYVL
                     ETALVTTGPPAPKATGLLAVTTTRLIFVSLGAGKRFAHELPVATLLWARTTDDADTPS
                     TAPADYGVEVSDGNLTWQFSGTDRADTDRVTGALNFAIQREVADGAAGPADPGVSKLY
                     SEWELLVERHSLGMVDDAQFQRYGRGILRSLPD"
     gene            complement(324161..324985)
                     /locus_tag="NS506_00336"
     CDS             complement(324161..324985)
                     /locus_tag="NS506_00336"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94420.1"
                     /translation="MPARDVPTLTTFPYPELDQREDDHWSGAQVSDDELRALSLGGFY
                     SARWDAFHDALLLGPEREHPLGDRRELAIDTLTGAWGITDGTEAMASMEQLLDGMHGP
                     LYALVHPLVMAAINSPERDRFGERADRHRAFLRQVGSFRGMENPEALVRDYDIWSQAI
                     KLGLTDHLVRPLPTDIQAWDLARVVAVARMAYTAGYLDADVAWDYLMRALPPAQRKYR
                     NWRQFGDAYLAGWTYWQACEDLAELKSGGVDRRMELLRLWMRPTSPWRRITLQPDE"
     gene            325270..325536
                     /locus_tag="NS506_00337"
     CDS             325270..325536
                     /locus_tag="NS506_00337"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94421.1"
                     /translation="MSGNITLLRGLTPAATEQEIYAAAQEYVRKVGGVSGLTTATKTA
                     VDKAVAAIAAATTQLLAELPDRRAAEGEAPVRRRVRDAVTEEAR"
     gene            complement(325548..326822)
                     /locus_tag="NS506_00338"
     CDS             complement(325548..326822)
                     /locus_tag="NS506_00338"
                     /note="Belongs to the CdaR family"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94422.1"
                     /db_xref="UniProtKB/Swiss-Prot:P49694"
                     /translation="MATTANSAEIRQWIADFVAETLRTETLEQVVARLDNAIIARVPE
                     FRDRDMRRDLAASSRAHALEVLSGLNQDRIDYPVPEEAHAFARTLARRGHDVRLLLRV
                     YHLGQEAVVDYMTEVVEQQQLPREIERSVLLRLFDRTTRWISTSVEALTDTYMEERER
                     GLRAAFTQRAEIVRGLLDGAEADVENDSARLGYRLAQRHLALVLWTDEDTTPLRPDED
                     AAAPRPDRTGEAVGLLDRVVTRYAAAFGNGSVFTMPSGASALWAWIGMDGELPDPADP
                     AWSVDAPVRVAVGVPAAHTKGFRDSHREAVAARQVAERARAGMSRVLHYAEVEVAYLA
                     GADEAAMRALVDRELGALAAPDAQSARLRETLHAYLRARRSPDAAAKLLGVHKNTVRY
                     RIQRIEELLGHSLDQRGARLEIALDCVGVYGV"
     gene            326955..328637
                     /gene="aldA"
                     /locus_tag="NS506_00339"
     CDS             326955..328637
                     /gene="aldA"
                     /locus_tag="NS506_00339"
                     /EC_number="1.2.1.22"
                     /EC_number="1.2.1.21"
                     /function="NAD; NADP; Oxidoreductase."
                     /note="Catalyzes the conversion of 5-oxopentanoate
                     (glutarate semialdehyde) to glutarate; Belongs to the
                     aldehyde dehydrogenase family; KEGG: esc:Entcl_2233
                     lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Lactaldehyde dehydrogenase"
                     /protein_id="APA94423.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9I6M5"
                     /translation="MKRTWGRHTVTNTEPAAGTARKTGTRKPAGTAVKAAPKPETAAK
                     PEAIPAPATEIEVRNPATGALAGTVPIDSADTVAAKVRELRAAQPAWEALGPDGRKEW
                     LLKLQDWLVDNTDHLADVLQSETGKARVDSLIDPAFSVDLTGYYARRAAKFLADEHPS
                     PHSPLARVKQLNTVFRPYQVVGVITPWNFPLAMPVIDVIPALAAGAAVILKPSEVTPL
                     SAVELARGWREIGAPPVFEVVTGAGETGAAVVGNADYIQFTGSTATGRKIAAACTERM
                     IPFSLELGGKDPAIVLADADLDRAAHGIAFGGLFNAGQVCISVERVYVEAPVYDQFLA
                     KLTAAVKQVRQGVDGRKPEFDMGALANENQAQIVQRHVEEAVKAGARVTTGGKRTGVG
                     TLFEPTVLADVDHTMTCMTEETFGPTLPVMKVADEAEAIRLANDSIYGLSASVWSGDK
                     DRAERVARQLNAGAVNINDVFANMFSFALPMGGWGQSGTGARWGGPNGVRKYCRQQAI
                     TKPILPTQTKEPLWFPYSPPKLTFAMAAMRAAGTRGLRRINVPAIIKTVRGL"
     gene            328637..329467
                     /gene="kduD"
                     /locus_tag="NS506_00340"
     CDS             328637..329467
                     /gene="kduD"
                     /locus_tag="NS506_00340"
                     /EC_number="1.1.1.125"
                     /function="Aromatic hydrocarbons catabolism; NAD;
                     Oxidoreductase."
                     /note="Catalyzes the degradation of 2,5-dichloro-2,5-
                     cyclohexadiene-1,4-diol (2,5-DDOL) into
                     2,5-dichlorohydroquinone (2,5-DCHQ). LinX appears not to
                     be involved in gamma-HCH degradation pathway. Belongs to
                     the short-chain dehydrogenases/reductases (SDR) family;
                     KEGG: yal:AT01_1159 2-deoxy-D-gluconate 3-dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-deoxy-D-gluconate 3-dehydrogenase"
                     /protein_id="APA94424.1"
                     /db_xref="UniProtKB/Swiss-Prot:P50198"
                     /translation="MTDFAAITGKVVVITGGARGIGLATATALQALGAKIAIGDIDET
                     TVKESGTARGFEVFGKLDVTDHQSFEAFLDDVERRLGPIDVLINNAGIMPTGRVVDEP
                     DQITRRILDINVYGVILGSKLAIARMLPRGRGQVINIASLAGETHIPGLATYNASKHA
                     VLGFTDTLREEYRGTGLSFSAVLPTLTKTELGSGVTPPKLLRPAEPEEIADAIAKLIV
                     EPRSKVRVTTVAGIISQVVGFLPQAVGDAIGRALGAQSAFLDDVDSDARKAYEHRVRE
                     "
     gene            complement(329866..332073)
                     /locus_tag="NS506_00341"
     CDS             complement(329866..332073)
                     /locus_tag="NS506_00341"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94425.1"
                     /translation="MNGLPAQAVARFAADWESTLRGERGEPPSLAGYLPDGAAVRLAV
                     LTDLVRVDMRQRWRRAGLEKRITEYRSEFPEVGASPGFADLVCDEYVARSRLRPLDVD
                     SFTAEYPEVAGEIRRRFTGETPPPAPPVLPDGIEIGRRLDDFELLTDLGGAEGSRMFL
                     ARQRSMQRLVAVRVEAGADSDTETVAQLDHQYIVRVFDQRLIADGSTGKPLRLLYMQY
                     LPGGTIEGVLERLRAETGTVADGGLLLRAIDAAMESKGEPRPSGSRVRAEIAGLTWPE
                     TVAWVGRRLAEAIEYGDRHGVLHHDIRPSNVLFTAEGVPKLADFSLGQGYWGPGGARG
                     AAAGGTEALRYKSPEALAALLDAAAPTPDTRGDIYSLGLVLWEMLTGTLPFEEDDDAG
                     VEDDGGTDMVTAMLARRIAGVPAAALATLPADTPATLRRVLLECLRPEPSRRWRSGAQ
                     LAGQLDLSLDARARDLVDPPPHSVWARLRRWPVPIAVLCVGLPNALASWYNIRINQSL
                     IVDELSAGDQHRFEQVALLNNAITFPLAAALLLWLARRPLTVSYRLARGQEYGPARLA
                     RARADTLLMGERAVWIPFAMWMIAGIAWPLALQRAGANLPHHAFWHFFAAQVVCALIA
                     LAYPYFGIMVYTLRSLYPQLLARGSVGANDRRQLAALARRSNLYLAAAASVPLLGVAT
                     MTFVSTADLWLVIVPLRWLSVGGVLAFVLTYWLSRLLESDLRALVRAIPEGGR"
     gene            complement(332070..334604)
                     /locus_tag="NS506_00342"
     CDS             complement(332070..334604)
                     /locus_tag="NS506_00342"
                     /EC_number="2.7.1.-"
                     /function="ATP-binding; Kinase; Nucleotide-binding;
                     Repeat; Serine/threonine-protein kinase; Transferase."
                     /note="Belongs to the protein kinase superfamily. Ser/Thr
                     protein kinase family; Contains 4 PASTA domains; Contains
                     1 protein kinase domain; KEGG: rba:RB7919 null;
                     Phosphotransferases with an alcohol group as acceptor"
                     /codon_start=1
                     /transl_table=11
                     /product="putative serine/threonine-protein kinase"
                     /protein_id="APA94426.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q8XJL8"
                     /translation="MGADMTSGSDHRSGGYTAGTEFSVVAAFAAAWDTAAAPPRIADY
                     LPDAVTLRRAALVELIRVDMRHRWLRRPGLPPGGRPPPTKRLREYCSEFSELTARDLP
                     AGLVYEEFVIRRHSGETVDPRDCLREYPHQANELRELLNADDEDQSTRRTLLEESTLG
                     GLTLAPTGPTLSHETVHVPNPFDGDSTRVPEPGEVTLFEEPPQPADAAPDRTRATGGV
                     SAPDTGELLDRIEIGQRIDDFDLLTSLGSGAFARVFLARQRSLQRLVAVKISADHGTE
                     PQTLAQLDHDYIVRVFDQRLMSDVRTESGRRLRLLYMQFLPGGTLLGVLRWVRATPPA
                     ERSGQLLLDAVDAAMEEKGEIRPTDSSVRAELAGLNWPETVAWLGRRLAEALDYADGH
                     GVLHRDVKPANVLLTAEAVPKLADFNISFSRNLDGTSPVSYFGGSLSYMSPEQLEACH
                     PGTARSAADLDTRADIFSLGVVLWELLTGAKPFDDTTAGPGDHGDRTTLEAMLDRRRG
                     GVDSTALDRVPADCPAALRRVLLTCLEPARDQRWSSGAVLAKQLDLCLDQRARDLVDP
                     PPHSWRMRLRPWLIPLVTLAVAIPNTLASLYNIAHNRAFIISHLSESAMNTFVLTTAT
                     VNLVFFPLGTAVIAYLCRYVIVVPRGLRKGREYDADTLRRARADVLLAGERISSVVFS
                     LWVIAGFTFPVILRLTASDLPVRGIVHFLVSLVVCGAMAVAYPFFLVTFYLVRCVYPM
                     FLRHGDISAEDAAWLHRLGHRCTTYLALAASIPLLAVAGVTFLPPDDIPQVIVAVRVL
                     SVGGIAAFVAVYAMFRALEADLAALERVVSPARPSRESGSPVGTEP"
     gene            334786..336240
                     /gene="gatA"
                     /locus_tag="NS506_00343"
     CDS             334786..336240
                     /gene="gatA"
                     /locus_tag="NS506_00343"
                     /EC_number="6.3.5.6"
                     /EC_number="6.3.5.7"
                     /function="ATP-binding; Ligase; Nucleotide-binding;
                     Protein biosynthesis."
                     /note="Allows the formation of correctly charged
                     Gln-tRNA(Gln) through the transamidation of misacylated
                     Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA
                     synthetase. The reaction takes place in the presence of
                     glutamine and ATP through an activated
                     gamma-phospho-Glu-tRNA(Gln); Belongs to the amidase
                     family. GatA subfamily; KEGG: ddn:DND132_3343
                     aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase
                     subunit A"
                     /codon_start=1
                     /transl_table=11
                     /product="Asparaginyl-tRNA synthase
                     (glutamine-hydrolyzing)"
                     /protein_id="APA94427.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q1J0C2"
                     /translation="MYDEGTALTADRVIAETTEEVAVASTTTDSDTSSDSRPPADLTT
                     ATGIAAAVQHGSISPEQAVDAALDRIRARDRKLNAFALVREEAARAEARAVAERQDLD
                     MLPLAGVPIAVKNNIDVAGEVTRGGSLSGSDTPAATDHPVVRRPRGAGAVIVGLTNVP
                     EFGLWGVTDGPGSITRSPWNTRYSSGGSSGGSGAAVGSGMVAIAHGNDGLGSVRIPAA
                     CCGVVGLKPGRGLVPSEVGVDSWGGMTENGVLATTVADTALMLSVLADRPDLADLETP
                     STLRIGLATGAPMPLTHVDLAWTAAADKAAAAASRAGHIIGVAELPYQGATFALLLRW
                     LGNAAREAATVPHPDRLQRRTRTHVALGKAVLKSGLLRPSQVDRVEARLLDYFERYDV
                     VITPTLATPAPRARRWHSRPWLANVLANVKFSPFTPLWNLVGWPALSIPMGIHPRTGT
                     PVAAQIAGPPGSESTILRLAAQIEAAHPWQRLAP"
     gene            complement(336337..337224)
                     /locus_tag="NS506_00344"
     CDS             complement(336337..337224)
                     /locus_tag="NS506_00344"
                     /function="DNA-binding; Transcription; Transcription
                     regulation."
                     /note="Could be the regulator of the abg operon. Contains
                     1 HTH lysR-type DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator AbgR"
                     /protein_id="APA94428.1"
                     /db_xref="UniProtKB/Swiss-Prot:P77744"
                     /translation="MDPHLRDLRYFVAVAEELHFTNAAQRLHIAQPTLSRQIRQLERQ
                     LDVVLFDRNQRSVALTVAGKELLEGARKILELWEVTNVALQEAGEVLRIGIQSSIGRG
                     LITDLESASGHRLALHSASWTDPSSGLAGRQADLALMWLPVPDTSRYRWQVLRTEPRW
                     VLLPENHALANQESIEFADLLDEPFIAMPAEAGAARDFWLGADARSGRQARIGAEAAT
                     AEERLEAVSLGLGVCLLAENNVPMYRWPGLTARPVTGLAPCERAVAWRADDDRPTILE
                     FAARVLEGGFAEPEPVAAQ"
     gene            complement(337606..338160)
                     /gene="hprT"
                     /locus_tag="NS506_00345"
     CDS             complement(337606..338160)
                     /gene="hprT"
                     /locus_tag="NS506_00345"
                     /EC_number="2.4.2.8"
                     /function="Cytoplasm; Glycosyltransferase; Magnesium;
                     Metal-binding; Nucleotide-binding; Purine salvage;
                     Transferase."
                     /note="Acts preferentially on hypoxanthin; has very low
                     activity towards guanine. Inactive towards xanthine (By
                     similarity); Belongs to the purine/pyrimidine
                     phosphoribosyltransferase family; KEGG: nfa:nfa3890
                     hypoxanthine phosphoribosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="Hypoxanthine phosphoribosyltransferase"
                     /protein_id="APA94429.1"
                     /db_xref="UniProtKB/Swiss-Prot:P0A9M3"
                     /translation="MYGDDIASVLISEEEIAGKVEELAELVAKRYPADAPEGDLLLVG
                     VLKGAIFFMTDLAKKLTVPTQMEFMAVSSYGSSTSSSGVVRIMKDLDKDIAGRNVLIV
                     EDIIDSGLTLSWLLRNLSSRNPASLEVVTLLRKPDALRTQVDVMAVGFDIPNEFVVGY
                     GLDYAERYRDLPYIGTLNPKVYGG"
     gene            complement(338218..339192)
                     /gene="tilS"
                     /locus_tag="NS506_00346"
     CDS             complement(338218..339192)
                     /gene="tilS"
                     /locus_tag="NS506_00346"
                     /EC_number="6.3.4.19"
                     /function="ATP-binding; Cytoplasm; Ligase;
                     Nucleotide-binding; tRNA processing."
                     /note="Ligates lysine onto the cytidine present at
                     position 34 of the AUA codon-specific tRNA(Ile) that
                     contains the anticodon CAU, in an ATP-dependent manner.
                     Cytidine is converted to lysidine, thus changing the amino
                     acid specificity of the tRNA from methionine to
                     isoleucine; Belongs to the tRNA(Ile)-lysidine synthase
                     family; KEGG: tpr:Tpau_0555 tRNA(Ile)-lysidine synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(Ile)-lysidine synthetase"
                     /protein_id="APA94430.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q0S8E7"
                     /translation="MNDRLRLPETRAALEMRRAVREWLGRYAPAGVVAVALSGGADSV
                     ALTAAACAEADVVDALIVDHGLQAGSAEVAAEAAALAMRLGCRSARVLPVSVGSDGGL
                     EAAARRARYAALDEARQGLPVLLGHTLDDQAETVLLGLARGSGGRSIRGMAEFDQPWG
                     RPLLGVRRGVPRELCADLGIVPWEDPHNGAPEFTRVRVRNEVLPLLEEVLGGGVAGAL
                     ARTAAQLREDGEVLDGLAEEWLADAREGDALRIETLATAAAAVRRRVIRAWLLGHGAK
                     SLTDSNLRAVDALVTRWRGQGGVAVGGSPSGTRLVAAREHGRLILRSE"
     gene            complement(339231..340334)
                     /locus_tag="NS506_00347"
     CDS             complement(339231..340334)
                     /locus_tag="NS506_00347"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94431.1"
                     /translation="MTGPENPSALADSEDREPTRRSRANLTGVVDWNVAARTGAALVP
                     AGPRTSRYSAEQAVAELASASVRAEGPVREVSGLDDGSVVPDALVVDRPGWIRAAADS
                     MSQLTGSGVEPGGAGKFVGKPAGLQAGAMLAFLSTAILGQYDPFTGPNGTLLLVAPNI
                     MAVERALGVPPADFRLWVCLHEVTHRVQFSSAPWISDYMRRNVEVLGEAGDEPLADML
                     ARLAEAVQARRRGEEDPAASGVIGLLRATQAEPQRDALDRLLMLGTLLEGHADHVMDA
                     VGPAVVPSVTRIRAAFDQRRKRPANPIQRLLRALLGMDAKVAQYVRGKAFVDEVVNTV
                     GMERFNTVWTDPETLPRTDEISEPQRWVTRVLG"
     gene            complement(340348..341811)
                     /locus_tag="NS506_00348"
     CDS             complement(340348..341811)
                     /locus_tag="NS506_00348"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94432.1"
                     /translation="MFGRNKQNIGGLEAKRRRRTWIVVSFGLVVVLVAAASVALILKP
                     WTEEFRHGGLTIADPPAPVKPIPQVAPAPVTAPAATATGLAAALGAAVANPDLGAFAA
                     SVSDGDTGKVLWTLDADKAMIPSSTGKILTIAGALLALPDDHRVTTKVVAGAVPGQIV
                     LVGGGDPTITAQPDGKGYYPDAPKLQDLVAQVKASGQRVDSILVDTSAYAGPNFAPGW
                     EAADIAGGSIAPLDPVMIDGGRLDPLVEYSPRTATPALDAGKRLATELGVDPAKVTMG
                     NAPAGATQLAVVQSAPLRERMLQAMVHSDNVLAEAIGREVAVALGQEPSFTGAVTAMS
                     TVLQAAGFDLNGLKMSDNSGLSTDDRIPPRLLNRVLTVAALPGTAGSQGNSTADPASD
                     KTAAGSPLAPLLDYLPVAGATGSLANRYVDRDREGAGWIRAKTGTLSVSSALVGYVLD
                     RDGRVLTFALMSNDRPPEVSRPALDAVANVLRNCGCS"
     gene            341982..342473
                     /locus_tag="NS506_00349"
     CDS             341982..342473
                     /locus_tag="NS506_00349"
                     /EC_number="3.6.1.1"
                     /function="Cytoplasm; Hydrolase; Magnesium;
                     Metal-binding."
                     /note="Belongs to the PPase family; KEGG: mtu:Rv3628
                     inorganic pyrophosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="Inorganic diphosphatase"
                     /protein_id="APA94433.1"
                     /db_xref="UniProtKB/Swiss-Prot:O82793"
                     /translation="MEFDVTIEIPRGQRNKYEVDHETGRVRLDRYLYTPMMYPADYGY
                     IENTLGGDGDPLDCMVLLPEPVFPGVLVEARPVGVLIMSDEAGTDEKLVAVPNKDKRW
                     DHIQDVEDIPEFQRKEIAHFFERYKDLEPGKWVKVEGWEGREKAEKLVGEAYARLKEQ
                     GGH"
     gene            complement(342520..344175)
                     /locus_tag="NS506_00350"
     CDS             complement(342520..344175)
                     /locus_tag="NS506_00350"
                     /function="Membrane; Transmembrane; Transmembrane helix."
                     /note="Belongs to the major facilitator superfamily.
                     TCR/Tet family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transporter"
                     /protein_id="APA94434.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q10072"
                     /translation="MATSEVSESTGEGGFTHRQILVILSGLLLGILLAALDQTIVSTA
                     IRTIADDLNGYSLQAWATTAYLITATLATPLYGKLSDMYGRKPFYLASISIFVTGSLL
                     CTFAQSMYELAVFRALQGLGAGGLMSLALTIVGDIVSPRERSRYQGYFLAVFGTSSVI
                     GPVLGGLFAGQHSILGIAGWRWVFLVNVPIGLFTLVVVTRVLHLPQREKSRDRVDYWG
                     ALALIIAVTPLLVVAQQGRDWGWSSVRALLCYGIGVLGIVGFVAVEAALGDAALVPLR
                     IFRNRTFALGVVISCVVGAGMFGGILLLPQYLQADRGASPMIGGLQMIPMVLGMMIGS
                     VVSGQLISRTGHYRIYTLLGAAMITIGLFLLHFLKADTAFWIVVLFMLCVGFGLGNLM
                     QPLIVALQNALPPKDMGVSTAAATFFRQIGGTLGAAVFLSILFDRLGPNIRSQLLEAG
                     QDPAFQQAVASGAYDGNPADMALSQGILNHDTSAAQGVLNDSSVIQKLNPVLAQPFKV
                     GFADALSTVFLTTSAVTLVAFLLVLLWKEVPLRTTAGLTTAAE"
     gene            complement(344255..345076)
                     /gene="paaF"
                     /locus_tag="NS506_00351"
     CDS             complement(344255..345076)
                     /gene="paaF"
                     /locus_tag="NS506_00351"
                     /EC_number="4.2.1.17"
                     /function="Fatty acid metabolism; Lipid metabolism;
                     Lyase."
                     /note="Plays a role in autotrophic carbon fixation via the
                     3- hydroxypropionate/4-hydroxybutyrate cycle. Catalyzes
                     the reversible dehydration of 3-hydroxypropionyl-CoA to
                     form acryloyl- CoA, and the reversible dehydration of
                     (S)-3-hydroxybutyryl-CoA to form crotonyl-CoA. Inactive
                     towards (R)-3-hydroxybutyryl-CoA; Belongs to the enoyl-CoA
                     hydratase/isomerase family; KEGG: abo:ABO_0148 enoyl-CoA
                     hydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="Enoyl-CoA hydratase"
                     /protein_id="APA94435.1"
                     /db_xref="UniProtKB/Swiss-Prot:A4YI89"
                     /translation="MTEWKAFEVESKDHIAQVTLTGPGKGNAMGPDFWRELPLVFGEL
                     DADPEVRAIVLTGSGKHFSYGLDLPAMSPLFGPLLADKALAGPRTDFLKHVRSMQDSV
                     TAVADCAKPVIAAISGWCIGGGLDLIAAADVRLASADAKFSLREAKVAIVADIGSLHR
                     LPGIIGEGHVRELAYTGKDIDAARAEKIGLVNDVFADQDAVLDAAYAMAREIAANPPL
                     VVRGIKDVLDQPKRGRIADGLRYVSAWNSAFLPSEDLTEAITAVFEKRPPEFKGK"
     gene            345223..345543
                     /gene="hpxQ"
                     /locus_tag="NS506_00352"
     CDS             345223..345543
                     /gene="hpxQ"
                     /locus_tag="NS506_00352"
                     /EC_number="4.1.1.97"
                     /note="KEGG: nbr:O3I_002085
                     2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline
                     decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline
                     decarboxylase"
                     /protein_id="APA94436.1"
                     /translation="MLMHHGIGLDRFNSLSRLRAIHALYECCCNVTWAQKLADGRPYP
                     GYAALQTAAAAELHALSAVDLERVFDSCVREQVSGRTVEELIPVVRARIHELLGPEEG
                     YPDY"
     gene            345584..346057
                     /locus_tag="NS506_00353"
     CDS             345584..346057
                     /locus_tag="NS506_00353"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94437.1"
                     /translation="MRRSLPPVASRVSDTLIARGHHGVIITQPNPTHTAQEAAEALGV
                     TVGAITKSLVFLLDDDPVLLLVSGAHQVDLDRTGERLEGTLTRAPAAMVREVTGQPIG
                     GVAPLGHPTNLPTFVDNALSQHQELWAAGGHPNTVFRTTFGELVRITAGLAIDVD"
     gene            346190..346738
                     /gene="rutF"
                     /locus_tag="NS506_00354"
     CDS             346190..346738
                     /gene="rutF"
                     /locus_tag="NS506_00354"
                     /EC_number="1.5.1.-"
                     /function="Flavoprotein; FMN; NAD; Oxidoreductase."
                     /note="Catalyzes the NADH-dependent reduction of the FMN
                     cofactor of the nitrilotriacetate monooxygenase subunit A.
                     Belongs to the non-flavoprotein flavin reductase family;
                     KEGG: cse:Cseg_1730 flavin reductase; With NAD(+) or
                     NADP(+) as acceptor"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase (NADH) NtaB"
                     /protein_id="APA94438.1"
                     /db_xref="UniProtKB/Swiss-Prot:P54990"
                     /translation="MSDSPTPGTELHVPDDLSGITAQQYRAAMRHYPAGVTIVTLNSE
                     NGPVGFTATSFASLSAQPPLISFNIAETSSSIEAMLRAESLVVHFLGEHQKHLAQRFS
                     RSAEERFTDRSLWTTLGTGEPVLHGTPIWVRATVHQLLPIGDHTLIIGLVTQVHDNTA
                     DSPAVGPLVYYNGAYHRAEIAD"
     gene            complement(346740..347378)
                     /locus_tag="NS506_00355"
     CDS             complement(346740..347378)
                     /locus_tag="NS506_00355"
                     /function="Cell membrane; Membrane; Transmembrane;
                     Transmembrane helix."
                     /note="Belongs to the rht family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein YrhP"
                     /protein_id="APA94439.1"
                     /db_xref="UniProtKB/Swiss-Prot:O05406"
                     /translation="MSFALLLSFVGLCVLLALTPGPDTFLVLRFSMAGSRPGIAAAVG
                     SAFGGIVWATVVAAGVAALLEQSATAYRTLKVIGGIYLVYLGIRALLAHRRGQGEDSG
                     ETEVQVAQGKPVSIRSAFAAGLLSCVFNPKVGLFYLAVLPQFLVQVTFLNTLTLGAIE
                     STVAAIEMIVLAVAAARAVALLKRPKIRARLEQASAAILAALGIGTAASAAA"
     gene            complement(347555..348214)
                     /gene="hmoX"
                     /locus_tag="NS506_00356"
     CDS             complement(347555..348214)
                     /gene="hmoX"
                     /locus_tag="NS506_00356"
                     /EC_number="1.14.14.18"
                     /function="Endoplasmic reticulum; Heme; Iron;
                     Metal-binding; Microsome; Oxidoreductase."
                     /note="Heme oxygenase cleaves the heme ring at the alpha
                     methene bridge to form biliverdin. Biliverdin is
                     subsequently converted to bilirubin by biliverdin
                     reductase. Under physiological conditions, the activity of
                     heme oxygenase is highest in the spleen, where senescent
                     erythrocytes are sequestrated and destroyed. Belongs to
                     the heme oxygenase family; KEGG: sgr:SGR_5243 heme
                     oxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Heme oxygenase (biliverdin-producing)"
                     /protein_id="APA94440.1"
                     /db_xref="UniProtKB/Swiss-Prot:P14791"
                     /translation="MLDTGTPFSTLIRTATEQQHNEAEHSTFMRDMLTGQLGVEAFYR
                     YTAQLWFVYAALEKHSDALASDPVAGPFVKPELARRAALESDLAYLGGENWREQLTAL
                     PSTAAYAARIEECADAWSAGYVVHHYTRYLGDLSGGQVIRGTAEKQWNLPKKGDGVRF
                     YVFDGIANPAAFKREYRESLDRLPLEGPEVDRVLDEARLAFTMNTDLFRELGAEFSSR
                     N"
     gene            348614..349927
                     /gene="sufS"
                     /locus_tag="NS506_00357"
     CDS             348614..349927
                     /gene="sufS"
                     /locus_tag="NS506_00357"
                     /EC_number="2.8.1.7"
                     /EC_number="4.4.1.16"
                     /function="Pyridoxal phosphate; Transferase."
                     /note="Catalyzes the removal of elemental sulfur and
                     selenium atoms from L-cysteine, L-cystine,
                     L-selenocysteine, and L- selenocystine to produce
                     L-alanine; Belongs to the class-V
                     pyridoxal-phosphate-dependent aminotransferase family. Csd
                     subfamily; KEGG: sjp:SJA_C1-33940 cysteine desulfurase /
                     selenocysteine lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="Cysteine desulfurase"
                     /protein_id="APA94441.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q5HHH0"
                     /translation="MTAFADQTCAALATVSGCDLQVPLVQGGTIGYANFDYAASAPAL
                     QQVTDRIAELLPFYASVHRGAGYASRISTDCYESARGSVARFLNTADDQVVVFTRNTT
                     DSLNLLACCVPGDTVVLDVEHHANFLPWARRGRRVVPIADTIEETIQRVVAELCSKPA
                     ALLAVTGASNVTGELLPLERLAWIAHQCGTRILVDAAQLAPHRRIDLRTTGIDYLAFS
                     GHKAYAPFGAGVLVGRRDWLDAAQPYLAGGGAVRSVSTDSVEWAPAPQRHEAGSPNVL
                     GVAALAAACDALADLDETTVVEHEQYLTHRLRYGLKTVPGVNFLRIWRDSTDAVGIVA
                     FTIDGFEPGRVAAYLSAEHGIGVRDGRFCAHPLLSRLGVDAALRASIGLGTTAADVDR
                     LIDAIATLVENGPAWNYAHTEGHWNPVPETRPFNGSADGSAPCGF"
     gene            complement(349943..350179)
                     /locus_tag="NS506_00358"
     CDS             complement(349943..350179)
                     /locus_tag="NS506_00358"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94442.1"
                     /translation="MGELDRTRLVLGHALGMSDSLKSRVREKLVRQLEEDGPPDPDLE
                     DTRQVSVRDDLDRLDAVAEDDPLIEELAARYLVP"
     gene            complement(350152..350625)
                     /locus_tag="NS506_00359"
     CDS             complement(350152..350625)
                     /locus_tag="NS506_00359"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94443.1"
                     /translation="MTRLPLGVVDITAAAMESPARPRWLGVGLPLLAGGAVAGGLALL
                     HFRDPHVQNSYGVCPFYELTGYWCPGCGGLRGLHNLTDGRFLDAIQSNVLILPLTLGF
                     IAWWGTWLVRGFRGSSTPPRLPQVLPKSAMWVALAFLFVFTVVRNTPWGSWIAPV"
     gene            350728..351339
                     /locus_tag="NS506_00360"
     CDS             350728..351339
                     /locus_tag="NS506_00360"
                     /function="Cytoplasmic vesicle; Endoplasmic reticulum;
                     ER-Golgi transport; Membrane; Protein transport; Repeat;
                     Transport; WD repeat."
                     /note="Component of the coat protein complex II (COPII)
                     which promotes the formation of transport vesicles from
                     the endoplasmic reticulum (ER). The coat has two main
                     functions, the physical deformation of the endoplasmic
                     reticulum membrane into vesicles and the selection of
                     cargo molecules (By similarity); Belongs to the WD repeat
                     SEC31 family; Contains 8 WD repeats"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein transport protein sec31"
                     /protein_id="APA94444.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q0CYG9"
                     /translation="MSQQQGGGKVRGVIAVVGAIVVIIAIRIGVRLIDHAFGLIGLLV
                     FILICVGTWFALKKKRESAQSTAPVYAPAPAPYDQAPSPYDQQNTPVQGYPAPSGSFP
                     PPIGAPQHGYLPPPSAPAAQNYPAPQSNYPAPQPNYGAPQQNYQHPQPGYAAPNQPGY
                     PAQPSDPYAPQGYPPPGGGYQQPGYQQGGYPQPAPPNYPPQQR"
     gene            complement(351429..351893)
                     /locus_tag="NS506_00361"
     CDS             complement(351429..351893)
                     /locus_tag="NS506_00361"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94445.1"
                     /translation="MVEHRLATLEVRRLELLAEQSGAGAAGVHELLEALVIPMLELGD
                     RHGINHYGRFLEQIHTHPAVTDAANLESARRTSVRVIMRQLQAELTDLPKRLRLRRLR
                     ALPTVLFALLADHERAVEAGRVAAGDVAAWGEIVDMLAGVLTAPVVERAPIR"
     gene            complement(352087..353181)
                     /locus_tag="NS506_00362"
     CDS             complement(352087..353181)
                     /locus_tag="NS506_00362"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94446.1"
                     /translation="MSRIGGRFARSEPRERVREYVSGLLAGLERKNGWTLAERAGETG
                     PQGMQRLLRAADWDVEAVRDDVRDYVVERLGDPEAVLAGDETGFLKKGVKSAGVQRQY
                     SGTAGRTENCQIGVFLAYASTHGHALIDRELYVPQSWTSDRERCREAGIPDEVAFATK
                     PRQMIAMLERAVAAKVPFRWFTADEAYGQAGYLREWCEDHDVFYVLATRCDQQVATRA
                     DRIARADELVGEFTASTWQRFSVGAGAHGPREYDWARRQIEGRWASGRGHWLLARRSI
                     AKPTEIAYYLCYGPATARLVDLAWTAGSRWHVEEAFQQAKGEAGLDHYQVRNWRAWYA
                     HITLSMLALAWLAASKAVAAKGDSPIPAKA"
     gene            353534..354322
                     /locus_tag="NS506_00363"
     CDS             353534..354322
                     /locus_tag="NS506_00363"
                     /EC_number="1.1.1.125"
                     /function="NADP; Oxidoreductase."
                     /note="Catalyzes the conversion of versicolorin A to
                     sterigmatocystin. Belongs to the short-chain
                     dehydrogenases/reductases (SDR) family; KEGG:
                     mts:MTES_2096 2-deoxy-D-gluconate 3-dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-deoxy-D-gluconate 3-dehydrogenase"
                     /protein_id="APA94447.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q00791"
                     /translation="MILDTFRLDGRVAVVTGAGRGIGTATALALAEAGADVAISARTA
                     AQLDEVAGKIRALGRRAITVPADLSDLSAVTALAETAAAELGRLDIVVNNVGGTMPNT
                     FLTTTTEFLEEAFRFNVSTAHALTQAAVPHMLKNGGGSVVNISSRMGITPGRGFLAYG
                     TAKAALAHWTRLAATDLSPRIRVNAIAVGSVLTSALEVVAQQPEIKKQMEDATPLHRL
                     GEPWEIAAAIVYLSSRAGGYVTGKVLEVDGGIDHPNLDLPIPDL"
     gene            354348..355412
                     /gene="dapB"
                     /locus_tag="NS506_00364"
     CDS             354348..355412
                     /gene="dapB"
                     /locus_tag="NS506_00364"
                     /EC_number="1.17.1.8"
                     /note="KEGG: mav:MAV_0371 4-hydroxy-tetrahydrodipicolinate
                     reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-tetrahydrodipicolinate reductase"
                     /protein_id="APA94448.1"
                     /translation="MKYRVVQWSTGNVGRRTLRSIIARPELELVGVWVSSPAKAGKDA
                     GELAGLDREIGVTATQDAEALLALKPDCIIHTAMADDRLMEAVEDLKTFLRAGINVIS
                     SSPVFLQFPYGTLPDEAIAPIIEAADEGGVSLWVNGIDPGWANDWLPLLLSSGSERID
                     KIICSEIMDYSTYDNPKVLFDIMGFGKPLDDLPLLLQPGVLTLAWGSVIRQLAHALDI
                     ELDSVTQHFERLPATEELKVGTHTIPEGTAAALRFQVHGISKAREILTLEHTTRLHPA
                     LAPDWPQPAGKGCYRVEIKGDPAYLLDLQLYSNGDHAEAGVVGTAARLVSAIPAVVSA
                     RPGLLTAMDLPLTTGRGLIS"
     gene            complement(355425..355736)
                     /locus_tag="NS506_00365"
     CDS             complement(355425..355736)
                     /locus_tag="NS506_00365"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94449.1"
                     /translation="MLIFGWRRELYTLATLTVFCGSCRCTGPHALRKFVTRFTLFFVP
                     LFAGNVEQYLECPVCGVRSTVPARDIPNLVARAGRIEVPLEEMIRTSPRNPEPAWPDL
                     P"
     gene            complement(355858..355933)
                     /locus_tag="NS506_00366"
     tRNA            complement(355858..355933)
                     /locus_tag="NS506_00366"
                     /product="tRNA-Thr"
     gene            complement(356016..357230)
                     /gene="holB"
                     /locus_tag="NS506_00367"
     CDS             complement(356016..357230)
                     /gene="holB"
                     /locus_tag="NS506_00367"
                     /EC_number="2.7.7.7"
                     /function="DNA replication; DNA-directed DNA polymerase;
                     Nucleotidyltransferase; Transferase."
                     /note="KEGG: nfa:nfa3680 DNA polymerase III subunit
                     delta'"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed DNA polymerase"
                     /protein_id="APA94450.1"
                     /db_xref="UniProtKB/Swiss-Prot:P37540"
                     /translation="MAGVFDRLVGQGAVESELTAAAVAARGGAGSSSAMTHSWLFTGP
                     PGSGRSVAALCFAAALQCTDEGTPGCGRCHACTTTVAGTHGDVRRVVPEGLSIGTKEM
                     REIVQVASRRPSTGRWQVVVVEDADRLTEAAGNVLLKVVEEPPERTVFLLCAPSVDPE
                     DISVTLRSRCRHVHLATPSVDSIARVLRERDGLDERTAGWAAGVSGGHIGRARRLATD
                     DQARARRKRALALVTATARPAAAYAAADELVKSADDEAKQVSAERDEKEREELAIALG
                     AGGTGKGAASATRSSAGALKELEKRQKSRATRTGRDALDRALIDVAGLYRDALAVRFG
                     AAKADSSAGVVLTHPDMADQIRELATDVRPEGLLLSIQAVLDCREALETNVKPRFALA
                     AMAAALIAARSA"
     gene            complement(357273..357779)
                     /locus_tag="NS506_00368"
     CDS             complement(357273..357779)
                     /locus_tag="NS506_00368"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94451.1"
                     /translation="MTVDHEREELIKILDSQRELFRITLRGIDDAQARQRTTVSELTL
                     GGLLSHAVNVERHWTTILVERDPDSEFDVSRMDSEYRLDPDQTVAGLLAEWEVVAEHT
                     AKLIRELPNLEDSVPTPTAPWAPEREYLGVRYILLHILREIAHHSGHADIIREALDGA
                     NTTYQRAN"
     gene            complement(357898..360777)
                     /gene="topA"
                     /locus_tag="NS506_00369"
     CDS             complement(357898..360777)
                     /gene="topA"
                     /locus_tag="NS506_00369"
                     /EC_number="5.99.1.2"
                     /function="DNA-binding; Isomerase; Magnesium;
                     Metal-binding; Topoisomerase."
                     /note="Releases the supercoiling and torsional tension of
                     DNA, which is introduced during the DNA replication and
                     transcription, by transiently cleaving and rejoining one
                     strand of the DNA duplex. Introduces a single-strand break
                     via transesterification at a target site in duplex DNA.
                     The scissile phosphodiester is attacked by the catalytic
                     tyrosine of the enzyme, resulting in the formation of a
                     DNA-(5'-phosphotyrosyl)-enzyme intermediate and the
                     expulsion of a 3'-OH DNA strand. The free DNA strand then
                     undergoes passage around the unbroken strand, thus
                     removing DNA supercoils. Finally, in the religation step,
                     the DNA 3'-OH attacks the covalent intermediate to expel
                     the active-site tyrosine and restore the DNA
                     phosphodiester backbone; Belongs to the type IA
                     topoisomerase family; Contains 1 Toprim domain; KEGG:
                     mei:Msip34_2877 DNA topoisomerase I"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase"
                     /protein_id="APA94452.1"
                     /db_xref="UniProtKB/Swiss-Prot:O51768"
                     /translation="MIVESPTKAKKIAPYLGRGYVVEASVGHIRDLPRGAADVPAKYK
                     GQQWARLGVDVDHDFEPIYVVSPEKKGKVSELKSLLADADELYLATDPDREGEAIAWH
                     LLETLKPKVPVRRMVFHEITESAIRAAAADTRELDQDLVDAQETRRILDRLYGYEVSP
                     VLWKKVMPRLSAGRVQSVATRVIVQRERERMAFRSAEYWDIAAKLDAGGNEEGGNPRV
                     FGARLVSVEGARVATGRDFGSDGQLKSQGVVVLDAGYAQRLAESLHGVDLTVTSVESK
                     PYTRKPYAPFMTSTLQQEAARKLRFTSERTMRVAQRLYENGYITYMRTDSTTLSQSAI
                     NAARAQATQLYGAEYVSPTPRQYNRKVKNAQEAHEAIRPSGDVFATPGQLHNKIDNDE
                     FRLYELIWQRTVASQMQDARGTTLTVRITGVANSGEECVFSASGRTITFAGFLKAYVE
                     SVDEEAGGQSDDAESRLPALTEGQGVTAVELAPDGHTTNPPARFTEASLIKALEDLGI
                     GRPSTYSSIIKTILDRGYVYKRGSALVPSWVAFAVIGLLEEHFGRLVDFDFTAAMEDD
                     LDAIAGGREQRGNWLSSFYFGGDHGAQGSVARSGGLKKMVGERLDGIDAREVNSIKLF
                     ADDEGRDVVVRVGKFGPYLERMIANPDDPDGNPVSQRANLPDDLPPDELTPEVAEKLF
                     ATPQEGRSLGTDPATGHEIVAKEGRFGPYVTEVLPEPAEDIDTGAKKTAKKAADKPKP
                     RTGSLFKSMSVETVTLDEALKLLSLPRVVGVDPASGDEITAQNGRYGPYLKKGTDSRS
                     LTGEDQIFSVTLEEALKIYAEPKRRGGQSASAPPLRELGVDPVSEKPMVIKDGRFGPY
                     VTDGETNASLRKGDEVESITDARASELLADRRARGPVKKAAKKTAKKAAAKKTAVAKT
                     VVKKAAAKQAAAKTADGVTTKKAAAAKKTPVKKAAAKKTAAAAKS"
     gene            complement(361096..361299)
                     /locus_tag="NS506_00370"
     CDS             complement(361096..361299)
                     /locus_tag="NS506_00370"
                     /function="Activator; Cytoplasm; DNA-binding;
                     Transcription; Transcription regulation."
                     /note="Contains 1 CSD (cold-shock) domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cold shock protein A"
                     /protein_id="APA94453.1"
                     /db_xref="UniProtKB/Swiss-Prot:P63849"
                     /translation="MAQGTVKWFNAEKGFGFIAPEDGSADVFVHYSEIQGTGFRTLEE
                     NQKVEFEVGQGTKGPQATGVRAL"
     gene            361799..362827
                     /locus_tag="NS506_00371"
     CDS             361799..362827
                     /locus_tag="NS506_00371"
                     /function="ATP-binding; DNA damage; DNA repair;
                     DNA-binding; Helicase; Hydrolase; Nucleotide-binding;
                     Nucleus."
                     /note="Helicase with 3'-5' helicase activity involved in
                     genome stability (PubMed:22064477). Functions in the
                     nucleotide excision repair (NER) pathway and plays a
                     critical role in DNA interstrand cross-link repair
                     (PubMed:22064477). Unwinds relatively long duplex DNA up
                     to 120-bp and requires a long 3'-tail of at least 70
                     nucleotides for efficient unwinding of duplex DNA (By
                     similarity). Shows both processive helicase and DNA strand
                     annealing activities (By similarity). Affects telomere
                     length by a non-catalytic mechanism, probably through
                     inhibiting telomerase by competing with it for ssDNA
                     binding (By similarity); Belongs to the helicase family.
                     HRQ1 subfamily; Contains 1 helicase ATP-binding domain;
                     Contains 1 helicase C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase hrq1"
                     /protein_id="APA94454.1"
                     /db_xref="UniProtKB/Swiss-Prot:O13983"
                     /translation="MLNRVLNGAGSGDPRLTHVTELPPRAAQVTKWPEWTSPEVIAAV
                     QAAGVAEPWSHQIRAAELAAAGRHVVVSTGTASGKSLAYQLPVLTALQADPRATALYL
                     SPTKALGADQLRMVNELTSEDPLRNVHPAPYDGDTPAEIRQWVRAHARWVFTNPDMLH
                     VGMLRSHQRWARFFRQLKYVVVDECHIYRGVFGSHVALVLRRLRRLAARYGADPVFVL
                     CSATTADPAATAEKLIGAPCVAVTEDGSPQGARTVALWEPPLLGAGVTGENGAAVRRS
                     AGAEAATVMADLVAEGARTLTFVRSRRGAELVAMDTRRLLADVDAELPGRVAAYRAGY
                     LAEDRRAL"
     gene            362888..364132
                     /locus_tag="NS506_00372"
     CDS             362888..364132
                     /locus_tag="NS506_00372"
                     /function="ATP-binding; DNA damage; DNA repair;
                     DNA-binding; Helicase; Hydrolase; Nucleotide-binding;
                     Nucleus; Stress response."
                     /note="Helicase with 3'-5' helicase activity involved in
                     genome stability (PubMed:23456718, PubMed:24440721,
                     PubMed:24700328). Functions in the RAD4-dependent
                     nucleotide excision repair (NER) pathway and plays a
                     critical role in DNA interstrand cross-link repair
                     (PubMed:24440721, PubMed:24682993). Unwinds relatively
                     long duplex DNA up to 120-bp and requires a long 3'-tail
                     of at least 70 nucleotides for efficient unwinding of
                     duplex DNA (PubMed:23026052). Activity is significantly
                     stimulated by a preexisting fork structure
                     (PubMed:24682993). Shows both processive helicase and DNA
                     strand annealing activities (PubMed:24682993). Affects
                     telomere length by a non-catalytic mechanism, probably
                     through inhibiting telomerase by competing with it for
                     ssDNA binding (PubMed:24440721); Belongs to the helicase
                     family. HRQ1 subfamily; Contains 1 helicase ATP-binding
                     domain; Contains 1 helicase C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase HRQ1"
                     /protein_id="APA94455.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q05549"
                     /translation="MDIAGLDAVVVAGYPGTVASFWQQAGRAGRRTQGSLVLLIARDD
                     PLDTYLVHHPEALLGRPLEASITDPHNPYVLGPHLLCAALEQPLSDAEVHGFQAWELL
                     SDLAEQGLIRRRAGVARDGTARWFVTADAHPHDAVDVRGGIGTAVAVVDGESGRMLGT
                     TDAGRAPATLHPGAVHLHQGESYVVDELDLEEGVALVHADTPGWSTSARAVTTLEIEE
                     VGVERRFGSVTTAFAQVLVTRRVTGYLRRLPSGEVLDLVELDLPAQTLPTRAVYYTVT
                     PELLARAGIDARHAAGALHAAEHAAIGMLPLVATCDRWDIGGVSMAEHADTGLPTVFV
                     YDGHPGGAGFAERGFSRLRHWLQATLGAIRSCACASGCPSCVQSPKCGNGNNPLDKAG
                     AARLLRAILAELGAGDDGNADP"
     gene            complement(364485..364838)
                     /locus_tag="NS506_00373"
     CDS             complement(364485..364838)
                     /locus_tag="NS506_00373"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94456.1"
                     /translation="MGADAGGVTVTACLALLGVFAAVVLIGQIGVAVAGRHRLQSAAD
                     LGALAAAGALDGGTVAGCGRAGDIAGRMGARLVGCEVRGWDVTVTVEARISLGPVGAW
                     DVRAAARAGPMEGER"
     gene            complement(364859..365173)
                     /locus_tag="NS506_00374"
     CDS             complement(364859..365173)
                     /locus_tag="NS506_00374"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94457.1"
                     /translation="MATVEAAIALAALVAVLVLGVGALLAVSAQVRCVDAAREAARLA
                     ARGDEASAVSTARRVAPAGARIDLRAEGGLVVAEVSARATLLPVTLRAAAVAALEPGE
                     FG"
     gene            complement(365209..365424)
                     /locus_tag="NS506_00375"
     CDS             complement(365209..365424)
                     /locus_tag="NS506_00375"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94458.1"
                     /translation="MGTTVRNAFWGLRTRLLRVVTAEDGMSTAEYAIGTIAAAAFGAV
                     LYTVVTGDSIVNALTKIIDKALKTPVK"
     gene            complement(365518..366108)
                     /locus_tag="NS506_00376"
     CDS             complement(365518..366108)
                     /locus_tag="NS506_00376"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94459.1"
                     /translation="MTASIAALLAVALLMLPGRAAVVRRLARLHEPGADPRPIAAAAP
                     SDPLGVASALDLLAACLRAGLPTAAASAAVAVSAPEPLATVLHRASDLLALGADPAAA
                     WVQATAGHADDAVTALARLARRSARSGTGLATAVAELAERRRGELEDAAAARAERAGV
                     LIGGPLGLCFLPAFLCLGIVPVVIGLAGRVLEGGLL"
     gene            complement(366105..366908)
                     /locus_tag="NS506_00377"
     CDS             complement(366105..366908)
                     /locus_tag="NS506_00377"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94460.1"
                     /translation="MSAGIAAALACVASAMLVAPAPAGRRRCERLFRRTERTRMPFGR
                     WVIRSAPSFLVPLVVLAGPGPAGAASILAATLVFRRRRVLRERRRAAAAAQLLEGLEA
                     VIGELRIGAHPSAAARVAAQETEGEVARAFAVSAARSRLGGSGAAGLRRPGTVVAGEL
                     ARVAAAWRVAERHGLALAELLTAARLDLLGRKRFRDRTRAALAGARATATVLALLPLL
                     GIGLGQLMGAAPLRVLFLTPAGTLLLLLGSALTCAGLLWADAITDRVLR"
     gene            complement(367101..367913)
                     /locus_tag="NS506_00378"
     CDS             complement(367101..367913)
                     /locus_tag="NS506_00378"
                     /function="ATP-binding; Conjugation; Cytoplasm;
                     Nucleotide-binding; Plasmid; Transport."
                     /note="Belongs to the GSP E family"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative conjugal transfer protein"
                     /protein_id="APA94461.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WMT2"
                     /translation="MDGRLAGTEAALGDSFGVRLHAVLSPIAHGGTCLSLRVLRPATQ
                     GLDALAAAGAVPPDAKVLLERIIRARLAFLVVGGTGAGKTTLLSGLLAKVASTERIVC
                     VEDAAELAPPHPHVVRLVARPANVEGAGQITVRDLVRQALRMRPDRIVVGEVRGAEVV
                     DLLTALNTGHDGGAGTVHANSPGEVPARLEALAALGGMPAAALHSQLAAAIQVVLHVH
                     RQPDGRRTLREIGMVAPVDGRVHITPAWTADGRPAPALVNLLDRRIPDDSLE"
     gene            complement(368456..369904)
                     /locus_tag="NS506_00379"
     CDS             complement(368456..369904)
                     /locus_tag="NS506_00379"
                     /note="May play a role in septum formation"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94462.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WKX6"
                     /translation="MNSDAATPPALSLVADPRLRDEIRRIAAAADRPLDEREPPPGRH
                     AWATASAIILDTAAALSCTSAGHLRRAGILLVTDGEPSLLDWQSATRVGAEHVLSLPA
                     DADALIAAFAAHDGRRPGDGAVLAVAGAGAGAGASVLAAAVGLTAAGRFRDHTLLVDC
                     APYGGGLDLLLGLESAPGLRWTDLTIEHGRVSAPALHAALPVASGLAVLSCGRGTSAT
                     EFGSALPRPVGPAVICADGWNGMPSLTAGLGEAVPDPDLARTAGRRDSADESGARSAA
                     EAYPRIDRGRVAAVLENELPAVVPGVTGRPAVLAPGAVRAVLEGGRAAGDLVVADLSS
                     DHGPHTDQVLDSAALVVLVTQARLRSIAAAQVTAAYLSARNPNVRVVVRGPAPSGCSP
                     GDIAEMLRLPLLTGVPSQPGLAERLERGGLTVRRRGPLRTAAETCLTALFSEDPAPHR
                     SVGRVGPSWWRRAGSRDSCGGAARPESAGAGK"
     gene            370343..371143
                     /locus_tag="NS506_00380"
     CDS             370343..371143
                     /locus_tag="NS506_00380"
                     /EC_number="3.1.3.3"
                     /EC_number="2.3.1.51"
                     /function="Hydrolase; Magnesium; Metal-binding."
                     /note="Belongs to the SerB family; KEGG: nno:NONO_c06800
                     putative phosphoserine phosphatase /
                     1-acylglycerol-3-phosphate O-acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoserine phosphatase"
                     /protein_id="APA94463.1"
                     /db_xref="UniProtKB/Swiss-Prot:O33611"
                     /translation="MTAERGRVAAFFDLDKTVIARSSAFVFSKPFLDQGLLSRRAVLE
                     SSYAHFLFLLSGADHDQMERMREHLTKMCAGWDVDQVRSIVAETLHDIVDPLIYAEAA
                     DLIADHRIRGHDVIIVSASGEEMVAPIAAALGADHFAATRMVIENGKYAGEVEFYCYG
                     KGKVEAIEKLAAQYDYDLARCYAYSDSVTDLPMLEVVGHPTAVNPDRGLRREATARGW
                     PVLTFSNPVSLWARIPAPTTTTVAATAAVSLGALAAGALTYRLLRRRR"
     gene            complement(371611..372357)
                     /locus_tag="NS506_00381"
     CDS             complement(371611..372357)
                     /locus_tag="NS506_00381"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94464.1"
                     /translation="MTDPLQPLVDLPGVRDAADKARDALAEVHRHRANRRGWPTTAAE
                     AAVRAARSSAAIEGGTIDLPADGRVEDPILAGSLRVGQALDAEALTNLVGVWQRAPLQ
                     ALARLHLLAAADMVDDQQQLGRPRNVPGVAERLDLLAQTITTTKAPAPVIAAVVHGEL
                     LSLRPFGTADGIVARAASRLVSVSSGLDPHSLGVPEVFWLRRRPAYLDAAAAFGMGTA
                     EGVGGWVIFTCGALEDGAREARSIADSASG"
     gene            complement(372393..374081)
                     /locus_tag="NS506_00382"
     CDS             complement(372393..374081)
                     /locus_tag="NS506_00382"
                     /function="ATP-binding; Cell inner membrane; Cell
                     membrane; Membrane; Nucleotide-binding; Peptide transport;
                     Protein transport; Transport."
                     /note="Part of the ABC transporter complex DdpABCDF, which
                     is probably involved in D,D-dipeptide transport. Probably
                     responsible for energy coupling to the transport system.
                     Belongs to the ABC transporter superfamily; Contains 1 ABC
                     transporter domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative D,D-dipeptide transport ATP-binding
                     protein DdpD"
                     /protein_id="APA94465.1"
                     /db_xref="UniProtKB/Swiss-Prot:P77268"
                     /translation="MTEPLLDVRDLNVCFTSEGKRIPAVRGVNLTVYPGQTVAIVGES
                     GSGKSTTAHAIIDLLPGTGQITSGSIAFGGKDLAKASKHEIVKVRGKGIGFVPQDPTS
                     NLNPVWKIGFQIRETLEANGIAKGKAARQRAVELLTEAGMPDAQRRVNQYPHEFSGGM
                     RQRALIAMGLSCRPQLLIADEPTSALDVTVQRQILDHLDGLTAELGTAVLLITHDLGL
                     AAERAEHLVVMYRGRVVESGPALQILREPQHLYTKKLVNSAPSLASQRLSSVAERAEV
                     RAQAVQVAGQLTETDAEFSSAPDSVMVVEGLTKRFRIRGNAPWKSSELVAVDDVSFTL
                     CRGTTKAIVGESGSGKSTVAQMVLGLLPPTSGHVTFDGRDVATLDAKGAFAFRRRVQP
                     VFQDPYGSLDPMYSIYRTIEEPLRTHGIFSQKEREAAIRDLLDKVSLPATVMRRYPNE
                     LSGGQRQRVAIARALALSPEVVVCDEAVSALDVLVQAQILQLLNELQAELGLTYLFIT
                     HDLAVVRQIADDVLVMQQGKVVEAASTTEVFDNPRSDYTRRLLEAIPGRDLLVG"
     gene            complement(374086..375054)
                     /locus_tag="NS506_00383"
     CDS             complement(374086..375054)
                     /locus_tag="NS506_00383"
                     /function="Cell membrane; Membrane; Peptide transport;
                     Protein transport; Transmembrane; Transmembrane helix;
                     Transport."
                     /note="Part of the binding-protein-dependent transport
                     system for dipeptide; probably responsible for the
                     translocation of the substrate across the membrane.
                     Belongs to the binding-protein-dependent transport system
                     permease family. OppBC subfamily; Contains 1 ABC
                     transmembrane type-1 domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Dipeptide transport system permease protein
                     DppC"
                     /protein_id="APA94466.1"
                     /db_xref="UniProtKB/Swiss-Prot:P94312"
                     /translation="MPEPQTDVREAPEIRPGQEHFVAPPDEVEVLATDRVNEAAAPTS
                     VWREAWQQLRRNPIFIVAALLILFILLVAIWPQLFSGQDPRYCSGDFSMHPPSSGHPF
                     GFDKQGCDIYTRTVYGARASVQTGLGATVLFVLIGGTLGAFAGYYGGLLDAVVSRIAE
                     IFYALPLTLAAIVLMQLLHTRTVWTVMVTLASFSWPQAARIARGAVIQSRNSEYVTAA
                     KALGVSRFRTLIRHVLPNSTGPLIVVSTISLGVFIVTEATLSYLGVGLSRQIVSWGSD
                     IAADQKEIRTSAILFYPATALALTVLSFIMLGDAVRDALDPKARKR"
     gene            complement(375047..375973)
                     /locus_tag="NS506_00384"
     CDS             complement(375047..375973)
                     /locus_tag="NS506_00384"
                     /function="Cell inner membrane; Cell membrane; Membrane;
                     Peptide transport; Protein transport; Transmembrane;
                     Transmembrane helix; Transport."
                     /note="Part of the binding-protein-dependent transport
                     system for dipeptide; probably responsible for the
                     translocation of the substrate across the membrane;
                     Belongs to the binding-protein-dependent transport system
                     permease family. OppBC subfamily; Contains 1 ABC
                     transmembrane type-1 domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Dipeptide transport system permease protein
                     DppB"
                     /protein_id="APA94467.1"
                     /db_xref="UniProtKB/Swiss-Prot:P45096"
                     /translation="MAWYVVRRLLQMIPVFLGATLLIYAMVFLIPGDPVQALAGDRQM
                     TPAVEATLKARYHLDQPFHIQYLEYLKGIVTLDFGTSFSGRPVREELARAFPITFRLA
                     VMAVCIEFFFGVVFGLIAGLRKGKLFDSTMLVLSLVIIAVPIFVVGFLAQYLLGIKWG
                     IAPVTVGAKASFGDLLVPAFVLGSLSFAYVLRLTRNAVAENMTADYVRTATAKGLSRR
                     RVIVVHILRNSLIPVITFVGTDLGFLMGGAVVTEGIFNIPGVGGTLYQAITRGEPPTV
                     VAFVTVLIVILLLTNLIVDLLYAALDPRIRYA"
     gene            complement(376041..377633)
                     /locus_tag="NS506_00385"
     CDS             complement(376041..377633)
                     /locus_tag="NS506_00385"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94468.1"
                     /translation="MRIKTFTALAAAAVLASGLALTGCSSSGGDNTDLVTVNGGEPQR
                     PLVPTDVNENMGGRVTDRLWAGLKYYDVNGTARNEVAQSIESTDRQHYKITLKDWKFT
                     DGTPVTAKSFVDAWNYGALSTNGQLQNWAFEGIAGYDEVEANPPKAQTMSGLKVIDDK
                     TFTVDLTSPSIDFELKLGFAPFYPMPDAFFKNTKDFGQNPIGNGPYKFSTWQHNVKIE
                     VLPNPDYHGGRPAKNKGLRFVMYQSYDTAYADLLQGNLDALDIIPDTALATYEKDLGD
                     RAIHKPIAYSQHIGIQPTVAHFAGEEGVLRRKAISMAINREQIAQNIFHGTRVPCQDF
                     TAFTLPGFRKDLPGSEVLKFNPDEAKKLWAQANAISPWSGTYQIAYNADGGHQAWVEA
                     VANSVKNTLGIDSVGVPYPTFKNIRDEITNKTVGKAFRYGWQGDYPSMFEFLTSQYLT
                     GSGTNNVQYANPEFDKLLGRAQAAPTPEAAYDILAQAQQLLFKDMADSPIFDYNVAAG
                     RSDKVKAQVSWSGLFDFENIEK"
     gene            378007..379959
                     /gene="acsS"
                     /locus_tag="NS506_00386"
     CDS             378007..379959
                     /gene="acsS"
                     /locus_tag="NS506_00386"
                     /EC_number="6.2.1.1"
                     /function="Acetylation; ATP-binding; Ligase; Magnesium;
                     Metal-binding; Nucleotide-binding."
                     /note="Catalyzes the conversion of acetate into acetyl-CoA
                     (AcCoA), an essential intermediate at the junction of
                     anabolic and catabolic pathways. AcsA undergoes a two-step
                     reaction. In the first half reaction, AcsA combines
                     acetate with ATP to form acetyl-adenylate (AcAMP)
                     intermediate. In the second half reaction, it can then
                     transfer the acetyl group from AcAMP to the sulfhydryl
                     group of CoA, forming the product AcCoA; Belongs to the
                     ATP-dependent AMP-binding enzyme family; KEGG:
                     nno:NONO_c03820 acetyl-CoA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="Acetate--CoA ligase"
                     /protein_id="APA94469.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q82EL5"
                     /translation="MTTEPSADHLDVYPPSTEFAAAANGDASLYDRAAADRDGFWAEQ
                     AKRLHWHQPFTQVLDWSDAPFAKWFADGKLNVAYNCVDRHVLDGRGEQVAIHWEGEPG
                     DSRAITYAELLAEVSRAANYLTGLGLVAGDRVAIYMPMVPEAIVAMLACARLGLTHSV
                     VFAGFSPSALRQRVDDAETKLVITTDGQWRRGTAAPLKYAVDEALAFDGPSTVEHVLV
                     VRRTGIDTPMTEGRDLWWDETVSLASPEHEAQAFDAEHPLFILYTSGTTGKPKGILHT
                     TGGYLTQAAYTHHYVFDHQPGQDVYWCTADIGWVTGHSYIVYGPLANGATEVVYEGTP
                     NFPDEHRHWQIIEKYGVTIYYTAPTLVRTFMKWGREIPEAHDLSSLRLLGSVGEPINP
                     EAWRWYRDVVGGNKTPIVDTWWQTETGAIMISPLPGVTAAKPGAAMTPLPGISSKVVD
                     EDGNPVELGETEANGYLVLDQPWPSMLRGIWGDNERYRDTYWSRYAEKGWYFAGDGAK
                     LDKEGDLWVLGRVDDVMNVSGHRISTAEVESALVGHSGVAEAAVVGASDDTTGQGIVA
                     FVILTAEAKDTGVDLVAELKAEVSREISPIARPREIHVVPELPKTRSGKIMRRLLRDV
                     AEGRELGDTSTLVDPNVFEAIRAGKA"
     gene            380160..381386
                     /locus_tag="NS506_00387"
     CDS             380160..381386
                     /locus_tag="NS506_00387"
                     /function="Antiport; Cell membrane; Ion transport;
                     Membrane; Sodium; Sodium transport; Transmembrane;
                     Transmembrane helix; Transport."
                     /note="Na(+)/H(+) antiporter that extrudes sodium in
                     exchange for external protons; Belongs to the NhaA
                     Na(+)/H(+) (TC 2. A. 33) antiporter family"
                     /codon_start=1
                     /transl_table=11
                     /product="Na(+)/H(+) antiporter NhaA"
                     /protein_id="APA94470.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q5Z2Z5"
                     /translation="MIVQVRSELARYLRTETFGGALLLIAAASALIWVNSPWGASYQT
                     MVDTKLAIPALHLDLTLAEWTQDGLLAIFFFVAGLELKRELVVGELADRKRATLPIVA
                     AIGGVVLPALIATAVGWGAPGMDRGWAIPVATDIAFALAVLAMTGSRIPAGARVFLLS
                     LAVVDDLIAIILIAVLFTTTLKMLWLLIAVACFAGWALAQKFRLGSPFIYVPLGLVSW
                     YALHEAGIHATLAGVACGLLTRVRPDQDEDEHCVPAARLEHFFQPISAAICVPLFALF
                     ASGVPLDSNVLSKLFTDRLALAVIAGLLVGKTVGIFGSSWLAVRLGIAERPGDLGYRD
                     MFALSVLGAIGFTVSLLVAELALEDVGDGSEAELAKAAVLLTSLAASLAGSALLLRRG
                     RAHQARRDERALQSQE"
     gene            381428..381943
                     /locus_tag="NS506_00388"
     CDS             381428..381943
                     /locus_tag="NS506_00388"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94471.1"
                     /translation="MSFTQGGNGYDGNRTRTVTSIPLSDVDAHQSATFGTLVRDATEQ
                     MSTLVRAEVELAKAEVTGEIKKGLQGSVYFILALTILLFSSFFFFFFLAELLDVWLYR
                     WAAFLVVFLLMIAAVAAFALLGYLKVRKLRAPEKTIESLKEAKTLLPSGFGVGDEHTI
                     DATVELGKPRT"
     gene            381967..382917
                     /locus_tag="NS506_00389"
     CDS             381967..382917
                     /locus_tag="NS506_00389"
                     /EC_number="3.3.2.10"
                     /EC_number="3.1.3.76"
                     /function="Hydrolase."
                     /note="Belongs to the AB hydrolase superfamily. Epoxide
                     hydrolase family; KEGG: scm:SCHCODRAFT_12753 soluble
                     epoxide hydrolase / lipid-phosphate phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="Soluble epoxide hydrolase"
                     /protein_id="APA94472.1"
                     /db_xref="UniProtKB/Swiss-Prot:O31581"
                     /translation="MSSNTHPDPSTVRYDGPWAHRDVHANGIRFHVVEAVPGATAYTD
                     PDTPLVVLLHGFGDFWWSWRHQLTGLAARGYRTVAVDLRGYGDSDKPPRGYDGWTLAG
                     DVAGLIRALGHTEATLVGHAEGGLVCWATAVLHPRVVRSIALISSPHPVALKRAVLRD
                     RAQRAAWLPDFLRCQLPRLPEHRLTREAGIEIELLLRERAGEAWSATAEFADTARRMR
                     TAIRIPGAAHCALEYQRWAFRSQWRPDGRRFMAAMSEPVRVPTLALYGDQDRYILAST
                     IRRGQQFSPERRVVAIPDAGHYAHQENPEPVTAEIAKLLA"
     gene            complement(382975..384168)
                     /locus_tag="NS506_00390"
     CDS             complement(382975..384168)
                     /locus_tag="NS506_00390"
                     /function="Autocatalytic cleavage; Disulfide bond;
                     Hydrolase; Membrane; Protease; Transmembrane;
                     Transmembrane helix."
                     /note="Required for M. tuberculosis resistance to
                     oxidative stress in addition to its role in resistance to
                     acid, which is essential for virulence; Belongs to the
                     peptidase S1C family; Contains 1 peptidase S1 domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Serine protease"
                     /protein_id="APA94473.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WHR8"
                     /translation="MSASGWLDLGIIILALLAATSGWRQGAVASALAFLGVILGAVAG
                     ILIAPHILKHLSEGRTRVLVGVLLIVALVIVGEVAGMVLGRAARGGMRDPFTRSVDSV
                     VGAGLQAVAVLATAWLLALPLTNSSQPGIATAVSNSQVLRNVDHVAPDWLRRVPTDFS
                     NLLNTSGLPDVIGPFGHVPITAVEPPDAGVLQLPVAQQLQSSVLRIRGIAPSCQRQLE
                     GSGFVVAPERVMTNAHVVAGTNSVGVDTARGTLPATVVLFDSSKDVAILAVPGLNAQP
                     LELAPADATSGESSIVLGYPGGGRYTASAARVRETLNLKGPNIYRDADVKREVYTIRG
                     QVRAGNSGGPLVDTDGRILGVVFGAAVTDEDTGYVLTLDEVRPELDAAASKTTAVGTG
                     SCVLS"
     gene            complement(384165..384893)
                     /locus_tag="NS506_00391"
     CDS             complement(384165..384893)
                     /locus_tag="NS506_00391"
                     /EC_number="3.6.1.-"
                     /function="Hydrolase; Magnesium; Manganese;
                     Metal-binding."
                     /note="Probably mediates the hydrolysis of some nucleoside
                     diphosphate derivatives; Belongs to the Nudix hydrolase
                     family. PCD1 subfamily; Contains 1 nudix hydrolase domain;
                     KEGG: spu:580764 nudix motif 8; In phosphorus-containing
                     anhydrides"
                     /codon_start=1
                     /transl_table=11
                     /product="putative nudix hydrolase"
                     /protein_id="APA94474.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q92350"
                     /translation="MRLDESANGIPEWLRGVAEHDPADPTGVNPVLRRTAMRRFAAAA
                     ARSREAAVLVLFGGSSVADSGARGGLPADADVLLTQRAATLRQHSGQVAFPGGGVEPQ
                     DRGPVSTALREAEEETGLDPASVEPIAVLPKIFVPPSRFDVTPVVAYWRTPGAVGVVS
                     ETEAARVTRVPIAELIDPANRFVVRHPLGYMGPAFAVDGMLVWGFTAGVLAGLLAVSG
                     WETEWDHHDVRDLQASLAAVGMTL"
     gene            complement(384890..385552)
                     /locus_tag="NS506_00392"
     CDS             complement(384890..385552)
                     /locus_tag="NS506_00392"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94475.1"
                     /translation="MSADTARGNTWWRWALAAVIVAVAAAVALWPQFTRHDSANTATG
                     STSLAPPAEAAVPEADRAAAALAACPQPSGAPVGDSPLRGITLNCLADGKPVDLVAAL
                     AGKPALLNLWAYWCGPCAEELPLLQEFSRQAGNALTVLTVHSDRGTAKALSRLTDLGI
                     HLPGVEDPNAKVRTAVGAPAVLPISVLLRADGTVAKVVVRPFTSVDDISATVAAELGV
                     KA"
     gene            complement(385549..386430)
                     /locus_tag="NS506_00393"
     CDS             complement(385549..386430)
                     /locus_tag="NS506_00393"
                     /EC_number="4.2.99.18"
                     /function="4Fe-4S; DNA damage; DNA repair; DNA-binding;
                     Glycosidase; Hydrolase; Iron; Iron-sulfur; Lyase;
                     Metal-binding."
                     /note="DNA repair enzyme that has both DNA N-glycosylase
                     activity and AP-lyase activity. The DNA N-glycosylase
                     activity releases various damaged pyrimidines from DNA by
                     cleaving the N- glycosidic bond, leaving an AP
                     (apurinic/apyrimidinic) site. The AP-lyase activity
                     cleaves the phosphodiester bond 3' to the AP site by a
                     beta-elimination, leaving a 3'-terminal unsaturated sugar
                     and a product with a terminal 5'-phosphate; Belongs to the
                     Nth/MutY family; Contains 1 HhH domain; KEGG:
                     cfn:CFAL_11075 endonuclease III"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-(apurinic or apyrimidinic site) lyase"
                     /protein_id="APA94476.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9CB92"
                     /translation="MRVTESNAAVSGADPDKSGVLAGVDGESADGSVSGRNDSDAPRF
                     SRPSKADKRAKETRIGLVRRARRMYRDMTVEFPGAHCELDFTTPLELAVATILSAQCT
                     DVRVNLTTPALFAKYRGARDYAEANRAELEEYIRPTGFYRNKASSLIGLGQELVERFD
                     GELPGTLDELVTLPGIGRKTANVVLGNAFGVPGITVDTHFGRLVRRWNWTDEEDPVKV
                     EHAIGELIERRDWTMLSHRVIFHGRRVCHARKPACGACFLANDCPSFGEGPTDPTEAA
                     KLVKGPETEHLLGLVGL"
     gene            386537..386764
                     /locus_tag="NS506_00394"
     CDS             386537..386764
                     /locus_tag="NS506_00394"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94477.1"
                     /translation="MVLFPIALMLFALVMERVENRLRKLLEPDPEVQQYLDRATNAEV
                     SDLTKLGLPAAAARPRRARPAAKGMDVAQAS"
     gene            387037..387711
                     /locus_tag="NS506_00395"
     CDS             387037..387711
                     /locus_tag="NS506_00395"
                     /function="Activator; cAMP; cAMP-binding; DNA-binding;
                     Nucleotide-binding; Repressor; Transcription;
                     Transcription regulation; Virulence."
                     /note="Global transcriptional regulator that complexes
                     with cAMP and binds to specific DNA promoter sites,
                     causing DNA- bending, to regulate transcription. cAMP
                     improves binding to specific DNA sequences, probably by
                     altering protein conformation. Activates expression of
                     whiB1; Contains 1 cyclic nucleotide-binding domain;
                     Contains 1 HTH crp-type DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="CRP-like cAMP-activated global transcriptional
                     regulator"
                     /protein_id="APA94478.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WMH2"
                     /translation="MDEALARAGIFQGVEPTAVAALAKQLQPVDFPRGHVIFNEGEPG
                     DRLYIITSGKVKIGRRSPDGRENLLTIMGPSDMFGELSIFDPGPRTSTATTVTEVRAV
                     TMDRDALKAWIDQRPEIAEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKALLQLAQR
                     FGTQEAGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWLRLEGKSVLISDSER
                     LARRAR"
     gene            complement(387783..388589)
                     /gene="gloB"
                     /locus_tag="NS506_00396"
     CDS             complement(387783..388589)
                     /gene="gloB"
                     /locus_tag="NS506_00396"
                     /EC_number="3.1.2.6"
                     /function="Hydrolase; Metal-binding; Zinc."
                     /note="Thiolesterase that catalyzes the hydrolysis of S-D-
                     lactoyl-glutathione to form glutathione and D-lactic acid;
                     Belongs to the metallo-beta-lactamase superfamily.
                     Glyoxalase II family; KEGG: aeh:Mlg_1994
                     hydroxyacylglutathione hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="Hydroxyacylglutathione hydrolase"
                     /protein_id="APA94479.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q0A751"
                     /translation="MTLTHPAYGRLRQVTPSAAVVLADNPSGMTLQGTNTWLLRAPGA
                     TEYVLVDPGPKDRKHTEALVRETGGNIALTLITHKHHDHTGGIDHLVQATGTPVRAKA
                     SEFLRGDGTALFDGEVIEAAGLRITVLATPGHTEDSHSFLIDGPEGEQALLTGDTVLG
                     SGTTVLESWDGALAAYLDSLDRLVAVAPGRHLLPAHGPDHADAEPVIRYYIAHREERL
                     NQVRAALEKLGPKAGSLRIVAEVYADVDKRLWPAAQSSVKAQLAYLRSRG"
     gene            complement(388673..389182)
                     /locus_tag="NS506_00397"
     CDS             complement(388673..389182)
                     /locus_tag="NS506_00397"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94480.1"
                     /translation="MAASRSDSVGGGGGATGRAGWAENLKKLGLELPPAPPPVAVYVP
                     GVRSGNYVYTSGQLPFVNGQLPLTGKVGAELTIEQGAEMAKLAALNALAVVHDLVGLD
                     NVVRVVKVVGFVASAPGFNDQPLVINGASELLGEVLGEAGVHARSAVGTSELPKNTPV
                     EVELIAEVR"
     gene            complement(389182..389343)
                     /locus_tag="NS506_00398"
     CDS             complement(389182..389343)
                     /locus_tag="NS506_00398"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94481.1"
                     /translation="MSDLTVWEYATVPLLTHATKAILDQWGADGWELVTVLPGPTGEQ
                     HVAYLKRSK"
     gene            389495..390535
                     /gene="arsA"
                     /locus_tag="NS506_00399"
     CDS             389495..390535
                     /gene="arsA"
                     /locus_tag="NS506_00399"
                     /EC_number="3.6.3.16"
                     /function="ATP-binding; Nucleotide-binding."
                     /note="KEGG: pbm:CL52_01750 arsenite-transporting ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="Arsenite-transporting ATPase"
                     /protein_id="APA94482.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WKX4"
                     /translation="MGVPIAVPVSVEPGVEAGWPERADKARLHYVSGKGGTGKSTVAA
                     ALALALAAGGRRVLLVEVEGRQSIAQLFDLPPLPPTETRIATADGGGEVLALALDVEH
                     AFLEYLDMFYNLGFAGRAMKRVGAIEFVTTIAPGLRDVILTGKIKECAVRVDKKTGKP
                     AYDEIVIDAPPTGRIASFLDVTQAMAEIAGGGPIASQAEGVSKLLHSPQTMIHLVTLL
                     EALPVQETADAIAELTANDLKIGTVIVNRAGEGYLPRAVRERAATGDLDVDALRAGLA
                     EAGITLSEADFQGLVAETVEHSARLAAQDESAAELSAVDISRLYLPSLTDGMDLGGLY
                     ELAEVLSAQGVR"
     gene            390538..391719
                     /locus_tag="NS506_00400"
     CDS             390538..391719
                     /locus_tag="NS506_00400"
                     /EC_number="3.6.3.16"
                     /function="Arsenical resistance; ATP-binding; Hydrolase;
                     Nucleotide-binding."
                     /note="Anion-transporting ATPase. Catalyzes the extrusion
                     of arsenite (By similarity); Belongs to the arsA ATPase
                     family; KEGG: rha:RHA1_ro04317 arsenite-transporting
                     ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="Arsenite-transporting ATPase"
                     /protein_id="APA94483.1"
                     /db_xref="UniProtKB/Swiss-Prot:O66908"
                     /translation="MVVPAGTVPLDISKIIADPSARIVVCCGSGGVGKTTTAAAIALR
                     AAEAGRKVVVLTIDPARRLAQSLGVSDLGNVPQKVELGSEAKGELFAMMLNMRRTFDE
                     MVLEHTNPEKAEQIFANPIYQTVASSFGGTQEYMAMEKLGQLAAKREWDLIVVDTPPS
                     RNALDFLDAPKRLGNFLNGKMIRVIMAPGRGVGKLVAGAMSLALRGVSTIVGGQLLKD
                     ASVFLQSLESMFGGFQDRADRTYAMLSRPGTHFLVVAAAEPDALREASFFVDRLSTDK
                     MPLAGLVLNRTHPILSSLSAEQAQVAADRLAPLTAGNGSNPDDAPETPETLAAAVLRI
                     HADRAAIAKRESHLLHRFTGAHPSVPIVAVTALPFEVADLEALRAVGDQLVEAGVAKS
                     A"
     gene            complement(391844..392167)
                     /locus_tag="NS506_00401"
     CDS             complement(391844..392167)
                     /locus_tag="NS506_00401"
                     /function="4Fe-4S; Cytoplasm; Disulfide bond; DNA-binding;
                     Iron; Iron-sulfur; Metal-binding; Transcription;
                     Transcription regulation."
                     /note="Acts as a transcriptional regulator. Probably
                     redox- responsive. The apo- but not holo-form probably
                     binds DNA (By similarity); Belongs to the WhiB family;
                     Contains 1 4Fe-4S Wbl-type domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Transcriptional regulator WhiB4"
                     /protein_id="APA94484.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WF38"
                     /translation="MHMTTPIARLDVEQAEARIAWVSQARCKEVDPDQLFVRGAAQRK
                     AATICRHCPVLMECGADALDNRVEFGVWGGMTERQRRALLKQHPEVTSWADFFRVQRS
                     QKVAM"
     gene            392412..394835
                     /gene="mrcA"
                     /locus_tag="NS506_00402"
     CDS             392412..394835
                     /gene="mrcA"
                     /locus_tag="NS506_00402"
                     /EC_number="2.4.1.-"
                     /EC_number="3.4.-.-"
                     /function="Cell membrane; Cell shape; Cell wall
                     biogenesis/degradation; Membrane; Peptidoglycan synthesis;
                     Signal-anchor; Transmembrane; Transmembrane helix."
                     /note="Cell wall formation. May be involved in outgrowth
                     of the germinated spore or it could function in the
                     synthesis of the germ cell wall. In the N-terminal sectio;
                     belongs to the glycosyltransferase 51 family; In the
                     C-terminal sectio; belongs to the transpeptidase family;
                     KEGG: samy:DB32_002475 penicillin-binding protein 1A;
                     Hexosyltransferases"
                     /codon_start=1
                     /transl_table=11
                     /product="Penicillin-binding protein 1F"
                     /protein_id="APA94485.1"
                     /db_xref="UniProtKB/Swiss-Prot:P38050"
                     /translation="MDTPAGEHRVSARPIRLGRVPITRTLWRLAGACVLAAVLLAGLL
                     FPLAGGFGFISNRAADAVDNVSAELVEGTVPAVSTMVDANGTPFAWLYEQRRFEVPSE
                     KISNDMKLSLVSVEDKRFADHHGVDWQGTFRAFLTNTSGGQVSQGGSTIDQQYVKNYL
                     LLVVAKTDAERRAAIETTPARKIREIRMALTLDKRLTKDEILTRYLNLVPFGNGSYGI
                     QDAAQTYFGVDAKELNIVQSAMLAGMVQSSSKLNPYTNPAGVLERRNTVLDTLIQNVP
                     SRADEFRKAKEAPLGVLPEAKSLPRGCIAANDRGFFCDYAMQYLNNAGISKDQIEKGG
                     YLIRTTLDPAVQDSVRDSLAANANPNLDDIAEVMNIIAPGQDSHHVLAMGSSRQYGLD
                     SNAHQTVQPQPYSMVGDGAGSIFKIFTTAAAMEKGLGTSATLDVPAFFSAKGMGDSRT
                     PGCPPETYCVKNAGAYKGSMSVTEALATSPNTAFVKLIQAVGVSPTVDMAVRLGMRSY
                     TQPGTSGHGNQSLADMIKDQNLGSFTLGPVAINALELSNVAATLASSGKWCPPSPIKE
                     VVDRNGKAVPLTQQACEQVVDPGLANTLAVALGQDVVSGTGAASARSVGWNAPTSAKT
                     GTTESHRSSAFLAFTNSFAGAAYVYGDSPTPGEICTSPLRSCGSGNLYGGNEPAHTWL
                     GAMKNVLDRFPPAALPPTDDKYVRGSNNSQIPDVIGMQQAEATSALVAAGFQVSVTTQ
                     PGAAKGTVMNVSPNGSAIPGSVITLYVSDGSQIPAPAPNAPAPGIPGLPTITIPQLPP
                     IPIPIPIPR"
     gene            complement(394894..395358)
                     /locus_tag="NS506_00403"
     CDS             complement(394894..395358)
                     /locus_tag="NS506_00403"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94486.1"
                     /translation="MSELKTKLRSDMTTAMKSKDTLRLGTLRMLLSAIQNAEVAGPQA
                     RELSDPEVVAVLQKEAKKRNEAAVVYEQAGRGELAANERAEEQVIDEYLPTQLTDAEV
                     ADIADTAIAEIAEQIGERPGMKQMGQVMKAATALAAGRADGSRISAAVKARL"
     gene            395442..396407
                     /locus_tag="NS506_00404"
     CDS             395442..396407
                     /locus_tag="NS506_00404"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94487.1"
                     /translation="MPVFSTSTLSRAALGAAGAAVAGIGYATLIERNAFTLREATLPV
                     LEPGKPSLRVLHISDLHMMPGQQLKQAWLRELDRLEPDLVVNTGDNLSHLKAVPSVVQ
                     SLGGLLARPGIFVFGSNDYFAPVPKNPLKYFKKDHKRVYGEPLPWQDLRAAFTERGWL
                     DLTHVRRDLEVSGVKISTAGVDDPHLKRDRYDTVAGAPNPLADLSIGLTHSPEPRVLD
                     RFAADGYDLVMAGHTHGGQLCVPGFGALVTNCGIDRARVKGASRWGAHTRLHVSAGLG
                     TSPWAPYRFCCRPEATLLTLVGAPPKKPAAESGHGRTASSEAVAR"
     gene            396458..397423
                     /locus_tag="NS506_00405"
     CDS             396458..397423
                     /locus_tag="NS506_00405"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94488.1"
                     /translation="MTSGNDPGNEPGRAAPNPEWWQGTPEQQPTWQQPQQPWQPTTPM
                     PGPYPAPPQYPPGYGGQPPYPPPPGGGKRRVWLFAGLAALVVAVIAAVVIVALVNKNS
                     AEPSAQSTTTPSLISALTSTTAKPGGSAKPTPTKTSAAKPTSTPAAVIPGYQVVTIPN
                     FGAVYDIPPTWKVDRSGQNAFGTGADVVVAAGLAQDGVDYCPKNVRTNVFLTQSDESD
                     PAKAAVDIGTRLGRIGWSTASGATPGATESFQSTDGQLQGVYLETRGNAQPAAGCAST
                     FSVYTFAFPGESGAFVFTIAADTGVDQAVDPAMAKKILGSLRPIQ"
     gene            397461..398447
                     /locus_tag="NS506_00406"
     CDS             397461..398447
                     /locus_tag="NS506_00406"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94489.1"
                     /translation="MSGGNDDRDIDPERTTSSGDWWQGPIHGPRAQGPGPQPPPHPHP
                     NTPAPGPNPYRTGPSRYQSAPNPVPPVWNPYATGPNAFQPQPSGSRNRLWLLVAVGAL
                     VVAIVAVVAIIFVNHDPGRSASPATTSVTTTTARFTTTTAVHTNTTAPATTLTPTISG
                     YQVVVPTGYKVAWDVPSDWIDDPTATSYGTDADNLPIAGMADEGENYCPDNVRTQMFL
                     TASQISDAAAAAADIGTHVARIGWSTGSAITPGTGQDFKTSDGGMHGTFLETKGTFTA
                     PAGCATTFSVYTFAVSAGDKGSLVLVIGADTGMERSMTPGFARRIFGTLRTI"
     gene            398512..398585
                     /locus_tag="NS506_00407"
     tRNA            398512..398585
                     /locus_tag="NS506_00407"
                     /product="tRNA-Pro"
     gene            complement(398647..399852)
                     /locus_tag="NS506_00408"
     CDS             complement(398647..399852)
                     /locus_tag="NS506_00408"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94490.1"
                     /translation="MIATMLAVAVSLTVWALFATKFEQWRISAPMVTVAAGVVVGLMV
                     RDSIGPTLDTETALHAAEVVLAVLLFIDATEVRGGLFGRNPGAALRLLLIALPLSLAA
                     AVGLGLWLLPGSGWAVLLVIACVVVPIDFAPAAAILRDRRIPVRVRNILNVESGYNDG
                     IVSPIIIFALILAGDLTQEHSPLSALGTAAPAALKALVVGAGCGAALAFLTNQADAAH
                     LMNLQSKRLIMVAAPLGSYALSVAVDGNGFVAAFICGFVIHRIRRTEEHARELELIED
                     IGFLLTVVMWFVFGAVVVFTLWDGVNWRLWLFCAAVLTVVRIAPVMLSLIGYRLTTVE
                     TFLIGWLGPRGTTSIVFGLLAFNKLRGENAELALTAMVVTVLGSVLLHGLGSPLTARG
                     YRRRLSARP"
     gene            complement(399871..400719)
                     /locus_tag="NS506_00409"
     CDS             complement(399871..400719)
                     /locus_tag="NS506_00409"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94491.1"
                     /translation="MESGLELGAFLRAMRERLTPEDAGLPSVGTRRTPGLRRQEVAQL
                     AAVSIDWYIRLEQGRVGTPGAGILDALAAALRLTDAERAHLHLIARGAQPPTRRPADP
                     PASLRAILDGMPSLPAYLSDFRLDVLARNTAAVALFGPGFGPGVNAARLTLLDPGVRA
                     TQLDWERVARETVGNLRRNLARHPDDARLREVIAELRSESLEFATWWDGHTVQDRSHG
                     SKRIRHPEVGDLTVCYDNLTSPDGADHSLTVLTPADAATEAGLRDLLTAHADRLGGTR
                     LRPVAG"
     gene            400849..401463
                     /locus_tag="NS506_00410"
     CDS             400849..401463
                     /locus_tag="NS506_00410"
                     /note="Belongs to the UPF0098 family"
                     /codon_start=1
                     /transl_table=11
                     /product="UPF0098 protein"
                     /protein_id="APA94492.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9X9Z8"
                     /translation="MMNRTARIAATTFAVAALAGVAGCSSDKDSSTATGTTTPASPSV
                     QVRPVVPATAAAFTVTADTTAAFPADFYAGAFGCTAANRAPHLQWSGAPAAAQSFAVT
                     MFDPDAPTGAGFWHWMNWDIPATATDFTAGAAGVAGTNDAGIPGYLGPCPPTGDKPHT
                     YKISILALDTPSLGLPATTTPTVASFSMGAHIIGTAELTLTAQR"
     gene            complement(401517..403106)
                     /gene="gabD"
                     /locus_tag="NS506_00411"
     CDS             complement(401517..403106)
                     /gene="gabD"
                     /locus_tag="NS506_00411"
                     /EC_number="1.2.1.16"
                     /EC_number="1.2.1.79"
                     /EC_number="1.2.1.20"
                     /function="NADP; Oxidoreductase; Tricarboxylic acid
                     cycle."
                     /note="Catalyzes the NADP(+)-dependent oxidation of
                     succinate semialdehyde to succinate. It is believed to be
                     the main source of succinate semialdehyde dehydrogenase
                     activity in Mycobacterium (By similarity); Belongs to the
                     aldehyde dehydrogenase family; KEGG: nfa:nfa46640
                     succinate-semialdehyde dehydrogenase /
                     glutarate-semialdehyde dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Succinate-semialdehyde dehydrogenase
                     (NAD(P)(+))"
                     /protein_id="APA94493.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q7U2I0"
                     /translation="MSTTSKAKLPPRVTESLINRLTAMVTAGKAGEAREPFEMIEVYT
                     GDVVGYLPQSSPEDVVAAAEIARAAQQEWAARPLKDRLAVFERAHELILSEIETLADL
                     IQIGCGKARRMAIEEACDTPMVIAHYLKTAEKTLKPKKRSGPMPVITSSTEEHRPKGV
                     VAVIAPWNFPFAISMSDSTPALIAGNGVIMKPDNKTALCTLYGIELLHKAGLPRGLVQ
                     VVCGGGPDVGPTLIDNVDFVMFTGSTNTGRTIGEQAGRNLIGCSLELGGKNPMIVLDD
                     VNLDEAIPSAIFAVFGNTGQACMHIERIYVQERIYDEYLRRFVAAAEELGKKMGASYD
                     FEPEMGSLVSVEHMKRVAAHVDEAREKGATVVTGGNPRPDIGPAFFEPTVLTGVTKDM
                     AHATMETFGPVVSIYKYGTVDEAVALANDTSYGLNASVWTGNIDRATKLAERIEAGAI
                     NINDGFVTSYAAKGTPSGGVKQSGVGTRHGAAGILKYTDTINVGVQKKQIMAARASMP
                     YEKQLKSTLVTLRLMRRLHLG"
     gene            403241..404062
                     /locus_tag="NS506_00412"
     CDS             403241..404062
                     /locus_tag="NS506_00412"
                     /EC_number="4.2.1.17"
                     /function="Fatty acid metabolism; Lipid metabolism;
                     Lyase."
                     /note="Catalyzes the reversible conversion of
                     enzymatically produced 2,3-dehydroadipyl-CoA into
                     3-hydroxyadipyl-CoA; Belongs to the enoyl-CoA
                     hydratase/isomerase family; KEGG: nno:NONO_c03500
                     enoyl-CoA hydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="Enoyl-CoA hydratase"
                     /protein_id="APA94494.1"
                     /db_xref="UniProtKB/Swiss-Prot:P76082"
                     /translation="MTAATAQTPSNTEPHALVEKRGATLIVTMNRPKSKNALTGEMLA
                     IMTEAWDTVDNDPEIRSCILTGAGGAFCAGADLKAMNKRNPEDGMKEGSAFDPSRMPG
                     LLKGRRLTKPLIAAVEGAAIAGGTEILQGTDIRIAGESAKFGVSEAKWSLFPMGGSAV
                     RLPRQIPYTVAAELLLTGRHITAAEALNFGLIGHVVPDGTALDKALEIAELINNNGPL
                     AVQAILQVIRDTEGMHEEDAFKIDAKVGLPVFRSEDAKEGPRAFAEKRKPNFQGK"
     gene            complement(404067..405848)
                     /locus_tag="NS506_00413"
     CDS             complement(404067..405848)
                     /locus_tag="NS506_00413"
                     /function="ATP-binding; Cell membrane; Membrane;
                     Nucleotide-binding; Transmembrane; Transmembrane helix;
                     Transport."
                     /note="Belongs to the ABC transporter superfamily;
                     Contains 1 ABC transmembrane type-1 domain; Contains 1 ABC
                     transporter domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="APA94495.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q57180"
                     /translation="MSSHTSAVRLVLRFYGRELARRKTITALGLLGPALGNICQSYLA
                     PLLIAVVVGKVAATGDSSFGALAPYVLAFGGLLLLSEVFWRIGIHFLNRTDAYGIEHL
                     YVAAMDELLAKDAAFFHNNFAGSLTKRSVSFARQFEEFVDTFSFEIVGALVPIAFGSV
                     VLWRYDPAFVFVLVGLIALCVVVITPLIRRRQHLVDEREAAVALVSGHISDSLSNMAA
                     VRAFSAEPQEAAEHGRRVVDQRAKTLRSWDYNNLFIDTAVAPMFVITNIAGLLIALGI
                     RGGHASVEVIIVAFTYYWNATGIMFRFNQIYRRLESTVTEAAQFTELLLESPTVLDVA
                     EPEPLRPKDSGIRFEHVDFAHAGAAPLFRGLDLDVPSGSRVGLVGRSGGGKSTITQLL
                     LRMMDIDGGAIRIGGQDISRMKQSELRGLLSYVPQDPAMFHRTLSENIRFARPAATDE
                     EVRRAAKAAHVTEFADALPQGMDTLIGERGVKLSGGQRQRVALARAILRDAPILLLDE
                     ATSALDSESEILVQQALWELMEGRTALVVAHRLSTVADMDRLIVLDRGRIVEQGSHEE
                     LLRAEGTYAQLWRHQSGGFLGEELAAR"
     gene            complement(406038..406808)
                     /gene="phbB"
                     /locus_tag="NS506_00414"
     CDS             complement(406038..406808)
                     /gene="phbB"
                     /locus_tag="NS506_00414"
                     /EC_number="1.1.1.36"
                     /function="Antibiotic biosynthesis; NADP; Oxidoreductase."
                     /note="Involved in the biosynthesis of aklavinone which is
                     an important precursor common to the formation of the
                     clinically significant anthracyclines such as
                     carminomycin, daunorubicin (daunomycin), rhodomycin,
                     aclacinomycin T (aklavin) and aclacinomycin A
                     (aclarubicin). These compounds are aromatic polyketide
                     antibiotics that exhibit high cytotoxicity and are widely
                     applied in the chemotherapy of a variety of cancers.
                     Catalyzes the NADPH-specific conversion of aklaviketone to
                     yield aklavinone. It can also convert maggiemycin and
                     7-oxodaunomycinone to epsilon-rhodomycinone and
                     daunomycinone, respectively; Belongs to the short-chain
                     dehydrogenases/reductases (SDR) family; KEGG: sil:SPO0325
                     acetoacetyl-CoA reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="Acetoacetyl-CoA reductase"
                     /protein_id="APA94496.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q53882"
                     /translation="MSRTALVTGAASGMGRIVAQRLAAAGWNVAAVDLNAAGLAETAL
                     RSPNTHTYTCDVSDPGQVRAVVDKIRSEFGTIDRLVHAAGMCHVHASVLDHDVAQIRK
                     MMDVNYIGTVNLCQAVIPAMKQAGAGTMVLFASLAGWLPSPGMAGYTASKHAVVGFAD
                     SLSYELHGSGVRLLVLCPPMVETPFLDAVRAENASVLGNTGGATPESIVDALEKALAK
                     PKTPLFVLPGQARPVYYMRRFFPGLARAIVRRSVRPTE"
     gene            complement(406805..407476)
                     /locus_tag="NS506_00415"
     CDS             complement(406805..407476)
                     /locus_tag="NS506_00415"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94497.1"
                     /translation="MPVEIRHADAGSALFAVDAAAARELLADAGLEPLTVFGKAVLSL
                     AFVRYVDGDLGPYHEFAFSLMAKQPGRKNSTGAYIHWLPVNQSFTCEAGQSIWGFPKL
                     MADIDITPDGHGHRCEVRVDGQLVIALRVADGFPMPGGAGGASIDAYTWRDGLLRRTP
                     WVMNPGGVRGRPGGARVELGTHPVSDRLRALGLPKPALFTSRIGTLRMTFGDAATVLQ
                     TREVR"
     gene            complement(407570..409180)
                     /locus_tag="NS506_00416"
     CDS             complement(407570..409180)
                     /locus_tag="NS506_00416"
                     /EC_number="6.2.1.-"
                     /function="ATP-binding; Cholesterol metabolism; Fatty acid
                     metabolism; Ligase; Lipid metabolism; Nucleotide-binding;
                     Steroid metabolism; Sterol metabolism."
                     /note="Catalyzes the activation of long-chain fatty acids
                     as acyl-coenzyme A (acyl-CoA), which are then transferred
                     to the multifunctional polyketide synthase (PKS) type III
                     for further chain extension. Also involved in the
                     degradation of cholesterol via the degradation of the side
                     chains of C-24 branched-chain sterols. Catalyzes the
                     ATP-dependent CoA thioesterification of the sterol
                     3-oxocholest-4-en-26-oate to yield 3-oxocholest-4-en-26-
                     oyl-CoA; Belongs to the ATP-dependent AMP-binding enzyme
                     family; KEGG: rha:RHA1_ro04675 fatty-acyl-CoA synthase;
                     Acid--thiol ligases"
                     /codon_start=1
                     /transl_table=11
                     /product="Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-
                     oate--CoA ligase"
                     /protein_id="APA94498.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q7TWB7"
                     /translation="MACNFADLYEHAADAVPERTAVIAGGRRLTFAELDARANRLAHH
                     LAGAGAGAGTHIGFHMHNSIESLEMLLGCYKIRSVPVNVNYRYRAEELRYVYDNADLE
                     MAVHHRCYAPLVEEIRPQLPKLRHTLVVEDDQGGAGLASSSVPYEQALESGSAERDFG
                     PRSADDHFIMYTGGTTGLPKGVIWRQEDMWRVLGGGIDFYTGEPVADEYQQSRAAAQN
                     EWPMTWFVLPPLIHAAAMMPTFTALWSGNAVLFQPRFDPDEVWRLVAQERPQVLVVTG
                     DAIARPLVDSYRAAPVDASSLVSIGSGAAQLTQPVKNALLELFPSTLVTESIGSSETG
                     FGGIGFAQKDDDPARAPRVTTGRGALVVDDAGHPVEPGGEGWVAKTGNVPIGYYKDPV
                     KTGKLFRTVDGVRMVITDDRARVEADGSVTLIGRGNMVVNTGGEKVFPEEVEAVLKAH
                     PAVYDAVVIGVPHERWGQQVAAVVSAADGAIDFAALEQHVRTHLAGYKLPRRIWVAET
                     VSRTPSGKPDYRWAKSFVLSREPDHETR"
     gene            complement(409205..410458)
                     /locus_tag="NS506_00417"
     CDS             complement(409205..410458)
                     /locus_tag="NS506_00417"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94499.1"
                     /translation="MTSGYEFLTRSELARLVPELLLCGHLIDRSGMAHVLGALGRPGM
                     TAVAIDEWRLASPVYTRRMRKALGIDGDGVDAIFKCFQLDIGAPPQFMDFRFRVIDHD
                     HGEFHLDHCGALADVEPMGTEFVVAMCHDIEDPTFDATALATNPHARVRPVHRPPREP
                     ADRKPVCAWTVTIDPQHEPPAAVEGAELVAGSEAAGTVLSPIDPDDEGLRDYSGPLLS
                     DLRFEDFSRSALIRIADEVSLQHHLLTLGYRAAVEARTESTVAVDILRKQFTGIAGLT
                     SERLRAALGLGDDFAALAKVLRVHPAFNPAAYVDAMVSTETAGGEQSVELRIGRACGA
                     ADDGAWAALLDPDHLEPLDALVRGVNPRFYCGVRTVDDCALTIEIRRADLPFRTADEV
                     AITRFSSGAGFAFTDRGTPLPLTVR"
     gene            complement(410455..411003)
                     /locus_tag="NS506_00418"
     CDS             complement(410455..411003)
                     /locus_tag="NS506_00418"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94500.1"
                     /translation="MAWSRDELDEMIRRWVDENKQCEAQGDWKPLDHFYTEDATYGWN
                     YGPQQEFMAVGRDEIREIALGQEMFGLEGWTYPYQEFVVDERSGSVIGFWKQVNEQRR
                     ADGRPYSPEGIGGSWFRYAGDFQWSWQRDFFDFGNVTALFVEMISNDALSSGMRKRME
                     RAMSGEPLPGWYPVGKGPVPLW"
     gene            complement(411005..411214)
                     /locus_tag="NS506_00419"
     CDS             complement(411005..411214)
                     /locus_tag="NS506_00419"
                     /EC_number="1.14.13.70"
                     /note="KEGG: mah:MEALZ_0770 sterol 14-demethylase"
                     /codon_start=1
                     /transl_table=11
                     /product="Sterol 14-alpha-demethylase"
                     /protein_id="APA94501.1"
                     /translation="MRLVVDLDLCQGHAVCRDEAPELFHVPRQGQVEILRPDPGTDLE
                     AARTAVRYCPTQALSLIADPANEGA"
     gene            complement(411217..411999)
                     /locus_tag="NS506_00420"
     CDS             complement(411217..411999)
                     /locus_tag="NS506_00420"
                     /EC_number="1.1.1.100"
                     /function="Lipid metabolism; NADP; Oxidoreductase."
                     /note="Catalyzes the NADPH-dependent reduction of long
                     chain acyl-CoA (with chain lengths of 14 to 22 carbons) to
                     the corresponding aldehyde; Belongs to the short-chain
                     dehydrogenases/reductases (SDR) family; KEGG:
                     ebi:EbC_10690 3-oxoacyl-(acyl-carrier protein) reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-[acyl-carrier-protein] reductase"
                     /protein_id="APA94502.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q6F7B8"
                     /translation="MARFAPHPDRRPAIVAGASSGIGAATAEALAALGHPVALGARRV
                     EICETLAEKIRAAGGEAFAGALDVRDTGSVDEFVSAAERALGPTEVLVSGAGDLEFGK
                     GWEMDPDLFESQVRVHLVGAQRLAHRVLPGMISRRRGDFVIIGSDCAVRARPGGGAYN
                     AAKSGVEAFATQLRMELEGTGVRSSIVRPGQTLTGMGMQATPEVVGPLLQNWAKWGFA
                     RHAHFLRPADLAAAVTAVVATPRGSHLVLVEVQPEAPLSEGP"
     gene            complement(411999..413204)
                     /locus_tag="NS506_00421"
     CDS             complement(411999..413204)
                     /locus_tag="NS506_00421"
                     /EC_number="1.14.-.-"
                     /function="Heme; Iron; Metal-binding; Monooxygenase;
                     Oxidoreductase."
                     /note="Belongs to the cytochrome P450 family; KEGG:
                     nfa:nfa25810 null; Acting on paired donors, with
                     incorporation or reduction of molecular oxygen. The oxygen
                     incorporated need not be derived from O(2)"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative cytochrome P450 123"
                     /protein_id="APA94503.1"
                     /db_xref="UniProtKB/Swiss-Prot:P63708"
                     /translation="MTAASVEPLLFDPYDYRVHEDPYPVYQRLRAEAPVYHHPELDFW
                     ALSRHVDVAAGFRDNVRLSSTNGVSLDPAAWGPHAWRTMSFLAMDDPRHLRLRKLVYQ
                     GFTPRRVTEMSARIREITLRYLEPALAGGDFDWIDAVAGQVPMDVISELLGVPESDRA
                     ELRRLADLLVHREEGVLDVPVAAMEAALQLAGYYNEVLAARKRQRTGDLTSALLDAEA
                     DGDRLTDEEILGFMFLMVVAGNETTTKLLGNALYWAGRNPGEYAKVAGQPELVEDWVE
                     ETLRYDASSQILARTAAEDLEYYGQTIPQGSKVLLLIGSANRDSAVFHDADRYDIERP
                     DKGGLISFGRGVHFCLGAHLARLEASIVLREFVARVRGYGIGESGIQRVHSVNVRGFA
                     HLPVSVEVR"
     gene            413438..414907
                     /locus_tag="NS506_00422"
     CDS             413438..414907
                     /locus_tag="NS506_00422"
                     /EC_number="1.2.1.3"
                     /function="Aromatic hydrocarbons catabolism; NAD;
                     Oxidoreductase; Plasmid."
                     /note="2-hydroxymuconic acid semialdehyde can be converted
                     to 2-hydroxypent-2,4-dienoate either directly by the
                     action of 2- hydroxymuconic semialdehyde hydrolase (HMSH)
                     or by the action of three sequential enzymes, the first of
                     which is HMSD. Belongs to the aldehyde dehydrogenase
                     family; KEGG: mtu:Rv0768 aldehyde dehydrogenase (NAD+)"
                     /codon_start=1
                     /transl_table=11
                     /product="Aldehyde dehydrogenase (NAD(+))"
                     /protein_id="APA94504.1"
                     /db_xref="UniProtKB/Swiss-Prot:P19059"
                     /translation="MSPSDLVPDGGSHLLIGGKLTPGGGGVFTTADPATGETLGNAAN
                     ADPADMDAAIAAARTAFDTTDWSRDPGFRATSLRQLRTALQSHIEELREITIAEAGAP
                     RMLTSGPQLEGPINDLAYFADLAENYSWETDLGIASPMGIKSSRKLRREPIGVVGAIT
                     PWNFPHQINFAKLGPALAAGTTVVLKPAPDTPWCAAAVGRIIAEETDIPAGVVNIVTS
                     DDHGLGAQLVTDPRVDMISFTGSTATGKSVMAAAAASLKKVFLELGGKSAFIVLDDAD
                     IAAAASYAAFGVCVHAGQGCAISTRLLVPREHHDQAVEAAARTLANIKPGDPAKPGTV
                     CGPVISERQLARVERYLDIARAEGGTIVTGGNRIDGPGWFIEPTLITGLPNSSRVAQE
                     EIFGPVLTVIPHDGDADAVRIANDSPYGLSGSVWGRDPERLRTVVEGIRTGTLSVNGG
                     IWYSADAPFGGYKQSGLGREMGVLGFEEYTETKLIATGC"
     gene            414919..415671
                     /gene="budC"
                     /locus_tag="NS506_00423"
     CDS             414919..415671
                     /gene="budC"
                     /locus_tag="NS506_00423"
                     /EC_number="1.1.1.-"
                     /EC_number="1.1.1.76"
                     /EC_number="1.1.1.304"
                     /function="Heterocyst; Oxidoreductase."
                     /note="May be involved in repressing heterocyst
                     differentiation and may be essential for preventing all
                     vegetative cells from differentiating. Belongs to the
                     short-chain dehydrogenases/reductases (SDR) family; KEGG:
                     eli:ELI_09045 meso-butanediol dehydrogenase /
                     (S,S)-butanediol dehydrogenase / diacetyl reductase; With
                     NAD(+) or NADP(+) as acceptor"
                     /codon_start=1
                     /transl_table=11
                     /product="Ketoacyl reductase HetN"
                     /protein_id="APA94505.1"
                     /db_xref="UniProtKB/Swiss-Prot:P37694"
                     /translation="MGRFTDRSIIVTGAARGIGAAYARALAAEGAKVVVADLNSALGE
                     ATAKEITADGGTAVFAQVDVADPQSAKAVADFTVAEFGGIHHLVNNAAIYGDMKLDIL
                     LTVPWDYYKKFMAVNLDGALNMTRAVYKHIAKAGGGSIVNQSSTAAWTYSGFYGLAKA
                     GINSLTQQLAHELGHSKIRVNAIAPGPTDTEATRSIVPEQFVDQLVSQMALKRLGTTE
                     DMVGACLYLLSDDAAWVTGQVLNVDGGQVFRP"
     gene            415668..416543
                     /locus_tag="NS506_00424"
     CDS             415668..416543
                     /locus_tag="NS506_00424"
                     /EC_number="1.1.1.-"
                     /function="Acetylation; Branched-chain amino acid
                     catabolism; Mitochondrion; NAD; Oxidoreductase; Transit
                     peptide."
                     /note="Belongs to the 3-hydroxyisobutyrate dehydrogenase
                     family; KEGG: xcv:XCV0331 null; With NAD(+) or NADP(+) as
                     acceptor"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyisobutyrate dehydrogenase,
                     mitochondrial"
                     /protein_id="APA94506.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q2HJD7"
                     /translation="MSETQEFPVGFIGLGNMGAPMAQRLTDWPGGLVVCDMRPEAVQP
                     FTDAGALAAANPAEVAERCAVISVVVLDDDQVRTVVADLLQTAKPGTVIAVHSTISDT
                     TAVELAAECASHGVEFVDAPISGGAPAAQRGGLAVMVGGSPAAFETVREPFARFGSLV
                     IHAGEVGAGTRMKLARNLLHFVAFTAAAEAQRLAEAAGLNITELGKVVRHSDSHTGGP
                     GAIMLRKTTAPVAPDDFWFPILGHVRDLGEKDLSLALELAARLDVNLPLAQHALQDLG
                     TGLGVGPGPIAKEQA"
     gene            416540..416902
                     /locus_tag="NS506_00425"
     CDS             416540..416902
                     /locus_tag="NS506_00425"
                     /EC_number="4.1.1.44"
                     /note="KEGG: req:REQ_13740 4-carboxymuconolactone
                     decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="4-carboxymuconolactone decarboxylase"
                     /protein_id="APA94507.1"
                     /translation="MTTERRERGLKKMSEVYGFDLPDLEGDPFYEVTVDHLFADIWNR
                     PGLSMRDRRLLLLGAITALGHSEIAEIQVGAALRNGELDADQLREIAVFLAHYVGWPS
                     ATKLDGAIRKTLAKDKKK"
     gene            416933..418405
                     /gene="tesI"
                     /locus_tag="NS506_00426"
     CDS             416933..418405
                     /gene="tesI"
                     /locus_tag="NS506_00426"
                     /EC_number="1.3.99.5"
                     /function="FAD; Flavoprotein; Lipid degradation; Lipid
                     metabolism; Oxidoreductase; Steroid metabolism."
                     /note="Catalyzes the elimination of the C-1 and C-2
                     hydrogen atoms of the A-ring from the polycyclic ring
                     structure of 3- ketosteroids. Is also involved in the
                     formation of 3-keto-1,4- diene-steroid from
                     3-keto-4-ene-steroid; Belongs to the FAD-dependent
                     oxidoreductase 2 family. 3-oxosteroid dehydrogenase
                     subfamily; KEGG: mpa:MAP1447c 3-oxo-5alpha-steroid
                     4-dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxo-5-alpha-steroid 4-dehydrogenase
                     (acceptor)"
                     /protein_id="APA94508.1"
                     /db_xref="UniProtKB/Swiss-Prot:P71864"
                     /translation="MAETPTVTPLPAHTVETWDYEADVVVVGFGIAGVCAAIEASRAG
                     ADVLVLERTGGWGGAAAMSGGFIYLGGGTALQRKLGFEDTPEHMEAFLTAALGPGVDK
                     AKIHDYCQGSVDHFDWLVAQGVPFKEEFWGEPGYEPPADQGLMFSGGENAAPFKDEIP
                     PAPRGHLAWTKDKKLGEKGGGYMLMEPLAQKAEELGVRHEYDIRLRRLITDDEGRVVG
                     VAATRYGKPVHVRATRGVVLATGSFAYNHEMVERFAPKISGRPAATVEEHDGIGIRVA
                     QALGADLAHMDATEVALVVDPQLVARGILINGRGQRFITEDTYPGRMGQAVLLEQGNQ
                     AYLVIDEIALEEALETKSSMSFLRIAPTWVAETVAELEDEMGLPENTLQATIDLYNHH
                     AEKSEDPFLDKKPEWVKPIRTPLGAYDLRGYTGGFTLGGLRTDLDSRVLHVSGNPIPG
                     LYAAGRVTSGICAGGYASGCSLGDGSFYGRRAGVSAAKQL"
     gene            418421..419281
                     /locus_tag="NS506_00427"
     CDS             418421..419281
                     /locus_tag="NS506_00427"
                     /EC_number="1.-.-.-"
                     /note="To M. tuberculosis Rv2161c and Rv3079c; KEGG:
                     mbb:BCG_1007c null; Oxidoreductases"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94509.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WKN4"
                     /translation="MRFGIVLFTSDRGITPASAAKAAEDRGFHSFFVPEHTHIPVKRE
                     AAHPQTGDSSLPDDRYMRTLDPWVALATAAAVTSRIELSTAVALPTESDCVTLAKTIA
                     TLDHLSGGRVTLGAGFGWNTDELTDHGVPGNKRRTVLREYVEAMRALWTQEEATYEGD
                     FVNFGPSWAWPKPVQPHIPVLIGAGGTEKTFKWIARTGDGWITTPYESDVSASTSLLM
                     KHWEEAGRQDVPRVVALAYKPNPDQLTAWAEAGVTDILYGLPDKPEPDVLTYLDRLTE
                     KLTPLGLSSP"
     gene            complement(419473..420939)
                     /locus_tag="NS506_00428"
     CDS             complement(419473..420939)
                     /locus_tag="NS506_00428"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94510.1"
                     /db_xref="UniProtKB/Swiss-Prot:P72042"
                     /translation="MIDGMSEIADDAFAIVAVVEELRAVHSEIAALQAREIELMTRLY
                     RMRREEQLDLGVGQLYAGEDAATEIGVALKTSQRSADNLIGLGLGLEHRYPATREAFA
                     AGRIDLPRVRAISETLTNVSEELLTELEPKIVAYAEGAAPQRVRRTVRRWLLEADPEG
                     QTLRRKTAEAERYVNITAADNGTAVLDAVLPAAGGQTVYERLREMASTQCCGQDSRNS
                     SQRRADALVALADGTGRLVCQCGRSDCPRAVTAEEVPVARKALVQVGVSAETFAGLRD
                     NPALLAGLGAIDADLARSVARHARFDIITETSQNTENPGVEPELRYRPRERLARRVRA
                     LDGTCRAPGCHVPAAATDLDHQDRFDHTDPASGGHTTEDNLGARCRRHHRLKTLADNH
                     ANGWQVLHHPGREVEWRTPTGDSVTTTPEGVDYLFPRTPVAPVTGGGVPDVAAPVPWF
                     DPGIAVNTLTELIHVYTTPAQRKQARRERIARLARHNM"
     gene            421043..421786
                     /locus_tag="NS506_00429"
     CDS             421043..421786
                     /locus_tag="NS506_00429"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94511.1"
                     /translation="MLAIRFGPDAMDFTSPRGQTRMYYNDIRAVYTDNLHAVVLRHRG
                     SLCAFPRELLPDWSIELITPARNGSQPPDRPTVAELPPIPVIDAPTASFISGPDTARA
                     MARTYAPHALRPLLTCTPILPILPLEAALLMHSRTGNAMALALSAVCLGFLALASILT
                     LRQSARSYARAVPVGRPLTVHYGTDAVDFQQATARSRTPYSAIRSIDIRGPIAALTTA
                     RTSVCPRELLPDNAIAHLCAVNPRIKVKR"
     gene            complement(421805..422185)
                     /locus_tag="NS506_00430"
     CDS             complement(421805..422185)
                     /locus_tag="NS506_00430"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94512.1"
                     /translation="MSVAALTAEVRELSALAEQMVEIVRPYVGAGLVLEVATRAESAD
                     SIAYRDTVRSWRSPVRLLLISIPDGDAGADNAYDDWVHWIAGGGLLAVGNQRLYARAM
                     ASGKFRELPTTGAIRILQRIAACN"
     gene            422311..422868
                     /locus_tag="NS506_00431"
     CDS             422311..422868
                     /locus_tag="NS506_00431"
                     /function="DNA-binding; Repeat; Transcription;
                     Transcription regulation."
                     /note="Contains 1 HTH tetR-type DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative HTH-type transcriptional regulator"
                     /protein_id="APA94513.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WMD6"
                     /translation="MEATRRRLTEKQAETVDRLTRAAMDVLSREGFAGLTVRMVAAQA
                     GVGTATAYTYFSSKEHLVAEMFWRRLAATEAPAEDETDSTKRVLAVLRQIALLLADEP
                     TLAGAVTAALLGTDPDVAHLRLRIGSEIRRRLIDALGMDADLELVETLEMIYAGALVR
                     AGMGYASYAEIAERMEKSTLRVLKP"
     gene            422955..424316
                     /locus_tag="NS506_00432"
     CDS             422955..424316
                     /locus_tag="NS506_00432"
                     /EC_number="1.14.13.70"
                     /function="Cytoplasm; Heme; Iron; Lipid biosynthesis;
                     Lipid metabolism; Metal-binding; Monooxygenase; NADP;
                     Oxidoreductase; Steroid biosynthesis; Steroid metabolism;
                     Sterol biosynthesis; Sterol metabolism."
                     /note="Its precise biological substrate is not known.
                     Catalyzes C14-demethylation of lanosterol,
                     24,25-dihydrolanosterol and obtusifoliol which is critical
                     for ergosterol biosynthesis. It transforms lanosterol into
                     4,4'-dimethyl cholesta-8,14,24-triene- 3-beta-ol (By
                     similarity); Belongs to the cytochrome P450 family; KEGG:
                     nfa:nfa25890 sterol 14-demethylase"
                     /codon_start=1
                     /transl_table=11
                     /product="Sterol 14-alpha-demethylase"
                     /protein_id="APA94514.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q5IZM4"
                     /translation="MTLVKPRAVSGGEHEHGHLEEFRTDPIALMTRVRAECGDIGSFR
                     LADKDVILLTGAQANEFFFRASDDELDQAAAYPFMKPIFGEGVVFDAPPERRKEMLHN
                     TALRAEQMRGHATTIAREVDRMLSRWGDEGEIDLLEFFAELTIYTSSACLIGTKFREE
                     LDDRFAHLYHELERGTDAYCYVDPYAPIESFRRRDEARWELVKLVRHIMAGRLANPPT
                     GKDDRDMLDVLVSIQDEQGRPRFSASEITGIFISMMFAGHHTTSGTAAWTIIELLRHP
                     DVLEQVVAELDTLYADGSDVSFHALRQIPILEAVLKEALRLHPPLIILMRVAREEFEV
                     CGHRIDRGDLVAASPAVSNRIPEAFPNPERFDPSRYIDPNQEDLANRWTWIPFGAGRH
                     RCVGAAFALMQLKAIFSILLRDWEFELAQPSDSYRNDHSKMVVQLQQPCAVRYRRRAR
                     PES"
     gene            complement(424317..424787)
                     /locus_tag="NS506_00433"
     CDS             complement(424317..424787)
                     /locus_tag="NS506_00433"
                     /EC_number="1.11.1.9"
                     /function="NADP; Oxidoreductase; Peroxidase."
                     /note="Hydroperoxy fatty acid reductase essential for the
                     removal of lipid hydroperoxides under normal and stress
                     conditions, leading to the protection of membrane
                     integrity; Belongs to the glutathione peroxidase family;
                     KEGG: sro:Sros_6518 glutathione peroxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutathione peroxidase"
                     /protein_id="APA94515.1"
                     /db_xref="UniProtKB/Swiss-Prot:P74250"
                     /translation="MPLRTLTDKPTTLADLADDKVVLLVNVASECGLTPQYSGLVGLQ
                     QTYGPQGFTVVGVPCNQFMGQEPGTAEEIAEFCSATYGVDFPLLEKSEVNGEGRIPLY
                     TELTQVADADGAAGDIQWNFEKFLIGRDGSVLGRFRPRTEPKDPAITGAIEAAL"
     gene            complement(424845..426074)
                     /locus_tag="NS506_00434"
     CDS             complement(424845..426074)
                     /locus_tag="NS506_00434"
                     /EC_number="1.14.13.141"
                     /function="Heme; Iron; Metal-binding; Monooxygenase; NAD;
                     Oxidoreductase."
                     /note="Catalyzes the C-27 hydroxylation of
                     cholest-4-en-3-one and cholesterol and subsequently
                     oxidizes the alcohol of the former to the
                     cholest-4-en-3-one-27-oic acid via the aldehyde
                     intermediate. Cyp125 is required to incorporate the
                     cholesterol side-chain carbon atoms into cellular lipids;
                     Belongs to the cytochrome P450 family; KEGG:
                     mkn:MKAN_23385 cholest-4-en-3-one 26-monooxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Cholest-4-en-3-one 26-monooxygenase"
                     /protein_id="APA94516.1"
                     /db_xref="UniProtKB/Swiss-Prot:P63710"
                     /translation="MSVPSLPAGFDFTDPALWADHSPAEEFALLRRTAPVWWIAQTPE
                     QAAPFTDGGYWAITRHEDVKEISRKAELWSSHAKGSIIRTKSDSTPEQMELSRNALLV
                     NLDPPKHTKRRRIVSKGFTPRPVEGLRKALTERATAIVAEAKALGGGDFVEQVACELP
                     LQAIAELLGVPQQDRHKLFTWSNNLMNFDDPEFGDPMVANAELLGYAYNMAEERRACP
                     AGDIVSQLVNADIDGEALASDEFGFFVILLTVAGNETTRNAISHGMKAFVDNPDQWKL
                     YRERRPRTAPDEIVRWATPVVAFQRTAMQDTEIGGQAIREGDRVGLFYSSANFDDEVF
                     EDPFSFDVFRDPNPHVGFGGTGNHFCVGANLARLEIDLIFNAIADAMPEISEVAPPQR
                     LRSGWINGIKHWQVRYS"
     gene            426268..427893
                     /gene="betA"
                     /locus_tag="NS506_00435"
     CDS             426268..427893
                     /gene="betA"
                     /locus_tag="NS506_00435"
                     /EC_number="1.1.99.1"
                     /function="FAD; Flavoprotein; Oxidoreductase."
                     /note="Belongs to the GMC oxidoreductase family; KEGG:
                     rde:RD1_2024 choline dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Choline dehydrogenase"
                     /protein_id="APA94517.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q47944"
                     /translation="MTPSPGSTSEADYVVVGAGSAGAVLAGRLAQRGASVILLEAGRK
                     DNTRLVTSPGMISVVHTVPQLKARVAWKQYSTPQKHANDRLIPMTRGKILGGSSSING
                     MLYVRGNRANFDSWAAEGNKGWSYEDVLPAYKRLENWVDGADDYRATGGPIEVTRPRE
                     ITPISEEFMTAASETLGAPIIKDYNGASQEGISIFQQSVKDGLRYSSSRGFITNMPNS
                     NLTVLTHVHATRVVIENGRATGVEIAEKNGARRIVKAAKEVIVSGGVVGSPQLLMLSG
                     IGPAGHLRELGIDVVADLPVGQNLHDHLFVPMTFVSKKAINRGIPTYFARGILKEMRN
                     PGSSFMGRTVFEAAGFVKTKFAEGDHPDMQIHTLPWSYPTPNQDADKMHMVDRRPALT
                     VMPSLIYPKSRGELKLASADPFASPLIDPGYLTDPWDTEFLVEGIKMIREVMSHKSIA
                     GDITENFFPGNEWADETALRRELPNRVHSIYHPVGTCRMGVDERAVVDPTLKVRGVEG
                     LRVADASIMPSITGGNTNAPSYMIGEKAAEFIG"
     gene            428044..429045
                     /locus_tag="NS506_00436"
     CDS             428044..429045
                     /locus_tag="NS506_00436"
                     /function="Signal."
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="APA94518.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WM02"
                     /translation="MSLPVDIWLDAPVAESASRARELRALGVDGVFTFEGAHDVFMPL
                     TLAATAGVDIMTNVAMAFPRSPMHLAHTAWDLQALSGGRFRLGLGSQIRAHIEKRYGS
                     VWSEPVERMRDTVLATQAILRAWQTGERLDYRGRFRQHTLMTPQFDPGPNPFGVPPVL
                     VGALGPRMTEMAAQVADGLLVMPFNTERNFRERTLAAVDKGLAGSDRPFQIVVEAIVA
                     MGDSEEEWRSARRAVRNLLAFYGSTPSYRPVLEVEGWEDLQPELNVLSKQGRWQEMAG
                     LIDDPMVDALTVSGTPAECAELIRTRFGDNASRVCCYFPGYQVTDAAIADLVAALHS"
     gene            complement(429047..430885)
                     /locus_tag="NS506_00437"
     CDS             complement(429047..430885)
                     /locus_tag="NS506_00437"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94519.1"
                     /translation="MLHPNSRTPLRNTPLRRNLGPRHLTARTRLVTATNAEKCESRVQ
                     VERTKFGHFGAPRGPRADRFRSMSAVRLRNSQIVDSQEEHVKLWRSRQCRAALLPTLA
                     GALAVAGAVAEAQADTANDLLPLIIDVSTPHDGPCNGPLHGTTAVYFPPGVPGHAEVE
                     WRILGGGQPIRSGITVVQNDVMTVGFDIRRDELPSDGLLRVDARARVPGGDVSGYGKP
                     WNFRVNRECRPLHVVSVGDSVLWGQNLDRDRTFADLFAETLGTRTGRTAQLHDYTVSG
                     AALDAPALHPSCPTGDDATPDVFCQLEQAAADATANGYRIDLVLIDGCLNDLDPFFGI
                     PVGVTPGTQDLTAAVRRECGGVGAESVNPAATVPYFSGAKLGYGGRGMSDAVRAAHAL
                     PGAPKVLMGDYFHGYDAGRVPQGLTQRWSEFVRLSAESVRQAADEANTAAGEVFATAA
                     DGLFTQDAVPTGDRRPAMSPLGDEATALRQLACSQPGELPQCLTVPAAARPDLDGARK
                     YAEAFLLNPHIGEWFGGGGPFGDGFTASRTTTHAGTPVAFDAAAAGGAIRQYDWYFGD
                     GSHETTTGGATSHAYNDRGPNLPRLVVTDMTGHRSLFELGHPITVG"
     gene            430933..432261
                     /locus_tag="NS506_00438"
     CDS             430933..432261
                     /locus_tag="NS506_00438"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94520.1"
                     /translation="MLQPCTLPVALTRVLFPLRKCFTAPTFTTFTMLVAGLFAQPATR
                     TVCGMLTGAGLARVWHHTRAHRFFSAARWDPAQLGLVVAELIVAQLLPPGSAITVAVD
                     DTLCRRRGKRVHAAGWFHDGSAAGRAKLGFGNNWIVLAIVVRLPFTSRPVALPVAAAL
                     FVKGGPAKPDLAREMLDALAERFADRAIHLVADSAYGCGAFAGLGEAMTMTTRAKTNA
                     VFYAPAPPRTGKRGRPALKGDRIGTPAELAVTGGWTPVTVTRYGVTGQVRVIERVCLW
                     FGTWRTDPVRVILVEDPSRSTKTGKSQRYSIALITTDLTSPAAEIIARYADRWAIEVT
                     FFDAKNILGVGQARNRVAHAVTRTVPFGLFAHSILVLWYAAAGHDDNDAALRRIAAPW
                     YRTKTEPSTLDMLVKLRRQLIAARFIPESPRPATTQEIMEVQLAWAQAAA"
     gene            complement(432390..433094)
                     /locus_tag="NS506_00439"
     CDS             complement(432390..433094)
                     /locus_tag="NS506_00439"
                     /EC_number="1.1.1.100"
                     /function="Acetylation; Carbohydrate metabolism; Glucose
                     metabolism; Membrane; NADP; Oxidoreductase;
                     Phosphoprotein; Xylose metabolism."
                     /note="Catalyzes the NADPH-dependent reduction of several
                     pentoses, tetroses, trioses, alpha-dicarbonyl compounds
                     and L- xylulose. Participates in the uronate cycle of
                     glucose metabolism. May play a role in the water
                     absorption and cellular osmoregulation in the proximal
                     renal tubules by producing xylitol, an osmolyte, thereby
                     preventing osmolytic stress from occurring in the renal
                     tubules (By similarity); Belongs to the short-chain
                     dehydrogenases/reductases (SDR) family; KEGG:
                     dgo:DGo_CA2348 3-oxoacyl-(acyl-carrier protein) reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-[acyl-carrier-protein] reductase"
                     /protein_id="APA94521.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q1JP75"
                     /translation="MANSAKTSTDQPTALITGASRGLGAAIARELAPTHRLLLGARTA
                     AALEPIARELPGGAGWPVDLTDYAAVTAAVEGIERLDVLVHNAGIADLRTIADSSVAQ
                     WRNTLEANLIAVAELTRLLLPALRAANGHVVLINSGAGLRANPGWGVYAASKFGLRAF
                     GDALRREEPALRVTSVHPGRIDTDMQREIIAREGRAYEPKEFLTAETVARAVRQAVET
                     PRDAHPTEIVLRPIAR"
     gene            433179..434573
                     /gene="treA"
                     /locus_tag="NS506_00440"
     CDS             433179..434573
                     /gene="treA"
                     /locus_tag="NS506_00440"
                     /EC_number="3.2.1.28"
                     /note="KEGG: msv:Mesil_0668 alpha,alpha-trehalase"
                     /codon_start=1
                     /transl_table=11
                     /product="Alpha,alpha-trehalase"
                     /protein_id="APA94522.1"
                     /translation="MQQPVSRAYLRVPAQNRAMTHPGFTPTQLAARAAYLLRGNDLGT
                     MTSAAPRLYPHMWSWDAAFVAVGLAPLSVERAALERDTLLSAQWRNGMIPHIVFANGV
                     DGYFPGPARWECRRLAADAPDGPDTSGITQPPVHAIAVQRILDHSRRHGRSTRAVAED
                     FLHRRWPDLMRWHRWLAYARDPKQHGRITLYHGWESGMDNSPRWDRAYENVIPGPDLP
                     PYQRADTQVVGDPTQRPSDREYDRYLWLVEQMRRCGYDDYQLASTMSFAVEDVFVTAI
                     FALACDVLANIGEDYKQPHADVRELYEWADYFRAGVVATTDPRSGVARDFDVRADKWI
                     ETETLACFAPLLSGGLPRDAERRLLRLFEGPRWCGHPDLRYALPPSTSPVSKDFRPRE
                     YWRGPVWPVISWLFSWVFARRGWAERSFMLRAEGLRQASDGSFAEYYEPFTGLPLGSM
                     QQSWTAASVLDWLG"
     gene            434663..435385
                     /locus_tag="NS506_00441"
     CDS             434663..435385
                     /locus_tag="NS506_00441"
                     /function="Disulfide bond; Glycosidase; Hydrolase;
                     Secreted; Signal."
                     /note="This enzyme has both lysozyme (acetylmuramidase)
                     and diacetylmuramidase activities. Belongs to the glycosyl
                     hydrolase 25 family"
                     /codon_start=1
                     /transl_table=11
                     /product="Lysozyme M1"
                     /protein_id="APA94523.1"
                     /db_xref="UniProtKB/Swiss-Prot:P25310"
                     /translation="MKAAVFATTGILMATPAGVAAADIEGPDVASYQHPGGSGINWFG
                     VRAAGYQFAMLKATEGLSYMNPFFVQDSLAMRVAGVARGTYHFARPNLPPELQAAYYA
                     AVVLGQNGPLDLPPVLDIEDSGGLPPDALIDWTHRYLDTVQALTGRRPVIYTYPRFWR
                     TAMADTNQFTSYPLWIADYRGNDQPEVPGGWPNWTFWQTTDSGSINGIAAGVDLNVYS
                     GAQGDFAGYANFPFAGSGRGSS"
     gene            complement(435382..436107)
                     /locus_tag="NS506_00442"
     CDS             complement(435382..436107)
                     /locus_tag="NS506_00442"
                     /EC_number="3.6.3.21"
                     /function="ATP-binding; Cell inner membrane; Cell
                     membrane; Hydrolase; Membrane; Nucleotide-binding;
                     Transport."
                     /note="Part of the ABC transporter complex SsuABC involved
                     in aliphatic sulfonates import. Responsible for energy
                     coupling to the transport system; Belongs to the ABC
                     transporter superfamily. Aliphatic sulfonates importer (TC
                     3. A. 1. 17. 2) family; Contains 1 ABC transporter domain;
                     KEGG: ncy:NOCYR_5421 polar amino acid transport system
                     ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Polar-amino-acid-transporting ATPase"
                     /protein_id="APA94524.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q89ER4"
                     /translation="MSASLTGTGLRLTLGHNEILRGVDVHVDAGKTTTVIGPSGSGKS
                     TLLRVLNRLHEPDSGDILLDGKSVLAENPDRLRQRIGMVFQHFNLFPHRTVADNVALG
                     PRKLHGLSKEQARTLAVQQLEAVGLAGKADARPANLSGGQQQRVAIARALAMRPDIMF
                     FDEATSALDPELVKGVLALMSELARGGMSMIVVTHEMSFARSVSDRVVFMDHGRVVET
                     GTPEQIFENAETPRLRQFLSQVL"
     gene            complement(436104..437930)
                     /locus_tag="NS506_00443"
     CDS             complement(436104..437930)
                     /locus_tag="NS506_00443"
                     /function="Amino-acid transport; Cell membrane;
                     Lipoprotein; Membrane; Palmitate; Signal; Transport."
                     /note="Probably part of the ABC transporter complex YxeMNO
                     that could be involved in amino-acid import. May transport
                     S- methylcysteine. Belongs to the bacterial solute-binding
                     protein 3 family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative amino-acid-binding protein YxeM"
                     /protein_id="APA94525.1"
                     /db_xref="UniProtKB/Swiss-Prot:P54952"
                     /translation="MVSLRPGAPRRRRPSRLLAIAGVLLVGLVGTVTLGPGGAAADDR
                     DKCSPAGLAAASAAPSNLAAGQQGESADRFTTATTEPLDRIDIGKLGLITPGKLTVGT
                     ISDAPPSICVNSKGVFTGMDNELLRAIGAKLGLQVEFVGTEFSSLLAQVANGRFDVGS
                     SNITTTDDRRQLVGFTNGYDFGYFSLVVPNGSGIKGFSDLHRGNRIGVVQGTVQDEYV
                     VNELHLDPVKFPDYNTAYANLKTGQIDAWVAPSAQAIGAIQPGDGTSIVQNTFSLSNF
                     VGYAVRKGNQPLTDALNAGLDAVIKDGTYLKLYEDWVPRQPPPGWKPGSKTVAAPDWP
                     DFARIAAEHAGDRPDNSSVAPKSTLRQLKDTFFDWSLYRKAFPDLIKTGLPNTLILAL
                     VSGVLGTLIGMLLAVAGISRTRWLRWPARVYTDIFRGLPAVVIILIIGLGVGPVVKNI
                     TGNNPYWLGAVALGLLASAYIGEIFRSGIQSVEAGQLEAARAIGFGYRQAMTLVVIPQ
                     GVRRVLPALMNQFIALIKDSSLIYFLGLLATQRELFAVGRDLNAQTGNLSPLVAAGLM
                     YLLLTVPLTHLVNYIDKRMRDGRPQTPTDPVEQAVITEGRGA"
     gene            complement(438003..438779)
                     /locus_tag="NS506_00444"
     CDS             complement(438003..438779)
                     /locus_tag="NS506_00444"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94526.1"
                     /translation="MGRAVRIGVQLQPQQAPDYGLIRDAVRRCEDAGVDVVFNWDHFY
                     PLYGDPEGAHFECWTMLGAIAEQTERVEIGALVTGGGYRNPDLLADMARTVDHISNGR
                     LILGIGAGWFRKDYDRYGYEFGTAGSRLAGLKEAMGRIADRLGKLNPQPVRDIPILIG
                     GGGEKKTLRLVAQYADIWHSFSDIEVLQRKIGILGEHCAEVGTDASAIAKSVAWPGID
                     QAAGYADVGVSLFTVSSGGPDYDMSRILEAVAWRDRRNEG"
     gene            complement(438903..439331)
                     /locus_tag="NS506_00445"
     CDS             complement(438903..439331)
                     /locus_tag="NS506_00445"
                     /function="Hydrolase; Magnesium; Metal-binding; Nuclease;
                     Toxin."
                     /note="Toxic component of a toxin-antitoxin (TA) module.
                     An RNase. Its toxic effect is neutralized by coexpression
                     with cognate antitoxin VapB35 (By similarity); Belongs to
                     the PINc/VapC protein family; Contains 1 PINc domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribonuclease VapC35"
                     /protein_id="APA94527.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WF66"
                     /translation="MIYLDSAAVVKLAHREAESDALRGWLADRRGTPWVSSTLIEVEA
                     FRAVARHSPEAVSRLASVLALVDTIEMGARVRSLARAVLPVTVRSLDAVHLATALTLG
                     ADLTAFVTYDKRLADAARSAGLTVEAPEQISGPGLGHSRG"
     gene            complement(439328..439561)
                     /locus_tag="NS506_00446"
     CDS             complement(439328..439561)
                     /locus_tag="NS506_00446"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94528.1"
                     /translation="MADTITIRTDVETEHALEVLTRDGVSRSAAIRAAVLAAAERKER
                     LADMQLAVLAMPLGEADGVNLAEEIARERSGDL"
     gene            439754..440254
                     /locus_tag="NS506_00447"
     CDS             439754..440254
                     /locus_tag="NS506_00447"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94529.1"
                     /translation="MTRNQVFRSAQIAGHSAWWVFVVAAMLKGGVTWLSSGEEGPFGW
                     VAYTPIADQPRRYADYLPSNGFDQLGAISLIGFCLLVLAALTEAVAAQRLVAGIITVA
                     VPFIAATLIWCALPRGHWNFYLEPIPALVVILVAVAIREGWERRLALTVTQTRSPEKG
                     SGNALG"
     gene            440241..440465
                     /locus_tag="NS506_00448"
     CDS             440241..440465
                     /locus_tag="NS506_00448"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94530.1"
                     /translation="MRWGDIRTSQIQLAVVSALLLIPGLIFRSAAWGSYINILAVCAL
                     ISAVATTVGTTLCRRIGLSFKAIDTTLVAV"
     gene            440530..440853
                     /locus_tag="NS506_00449"
     CDS             440530..440853
                     /locus_tag="NS506_00449"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94531.1"
                     /translation="MPPRKRRSFTAEYKVEAAHRVIDSGRTIAEVARELGPNEGLLSN
                     WVKDERRRVAAAEAVGEKPLDAAERAELLRLRKQVSELEKDNAFLVKASAYFAAMQKN
                     RPGSI"
     gene            440853..441779
                     /locus_tag="NS506_00450"
     CDS             440853..441779
                     /locus_tag="NS506_00450"
                     /function="DNA recombination; DNA-binding; Transposable
                     element; Transposition."
                     /note="Involved in the transposition of the insertion
                     sequence IS3. Belongs to the transposase IS3/IS150/IS904
                     family; Contains 1 integrase catalytic domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase InsF for insertion sequence IS3A"
                     /protein_id="APA94532.1"
                     /db_xref="UniProtKB/Swiss-Prot:P0CF79"
                     /translation="MAKYAGPDDIAETAGTSSPEGQRFSIIRMARLLKVSTSGYYQHV
                     KRRAATVLTPRQQRRADLTVKILDVHADSDGTYGSPRITDELRERGEIVNYKTVAAIM
                     AEIGIEGISPRTFKVRTTVVDPTASFPPDLVARTFDQGRPDAVWTTDFTYLTCGEGDM
                     YLCAIRDGHTRRVLGHVVADHIGSDVVEAAIEAAVAVRGGGVRGTILHSDRGGEFTAG
                     LTAKACARHGLRRSMGATGICWDNSPAESLWSTFKHEFYYRHTFTRKAELVAAVDKWV
                     DRYNTTRRHSAIGGISPIRYERSLETDAANAA"
     gene            complement(442007..442426)
                     /locus_tag="NS506_00451"
     CDS             complement(442007..442426)
                     /locus_tag="NS506_00451"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94533.1"
                     /translation="MARSLPAGESLLLRTDFTDDTTWAQTLAAVIASYREDTITGLTP
                     VNDAAFDRLTLDALGELIHDQTYVFLADATTMTDPEHPLLAVDTSDESSHGNYPMLRL
                     APSVMAEVEVNLFLANTDFADFADTVDDDGVYRGLNR"
     gene            442981..443364
                     /locus_tag="NS506_00452"
     CDS             442981..443364
                     /locus_tag="NS506_00452"
                     /function="DNA integration; DNA invertase; DNA
                     recombination; DNA-binding; Plasmid."
                     /note="Belongs to the site-specific recombinase resolvase
                     family; Contains 1 resolvase/invertase-type recombinase
                     catalytic domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-invertase"
                     /protein_id="APA94534.1"
                     /db_xref="UniProtKB/Swiss-Prot:P55389"
                     /translation="MCWRCGSWTRLGRNTVHVLQLIEQLTERGIGFHSLTEGLRTDGA
                     MGKAMLTIMAAFAQLERDTMIERTRVGLAAAAANGRKGGRPRKVDDATAAKARELKEK
                     GIGAPDIAKMLGCSRATVYRYLSTV"
     gene            complement(443442..443825)
                     /locus_tag="NS506_00453"
     CDS             complement(443442..443825)
                     /locus_tag="NS506_00453"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94535.1"
                     /translation="MDESEYVRRIRAKLPPEAAHIPIWDTTVPEDRPDVPVWRYRSIA
                     NDSALAKLYAARFGLELLGEPGATTAASVTELAECAATEPERVVDMFEAAHQGGALTW
                     DSQRWVHVETRRGWAREYRDLLRGN"
     gene            complement(443858..444226)
                     /locus_tag="NS506_00454"
     CDS             complement(443858..444226)
                     /locus_tag="NS506_00454"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94536.1"
                     /translation="MREFYYAVRTRQLPVLATAGEVTLWGQWILEERDRRRTGFTLSW
                     FFLALAAFCLILPALLALKPHGYTGGLGFPAVGVIALVGFAWGRFANPRVLAGLDALA
                     QQGTARGYGRGLVMGQPYLY"
     gene            444515..445081
                     /locus_tag="NS506_00455"
     CDS             444515..445081
                     /locus_tag="NS506_00455"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94537.1"
                     /translation="MVADHESSWAWRLARSELELPLPRRWAHSQGVGRAAIEVAARLD
                     CDTELLVASAILHDVGYAPRLVVTGFHPLDGARFLRDEHEADQRVTRLVANHTFALLE
                     ADERELGVQLAAEFPILDDHVLVDALTYCDMTTTPDGEPTTAANRIHEILTRYGRDTT
                     VGRFMQCAATNILEAVFRTEEAMGAHPR"
     gene            complement(445069..445386)
                     /gene="mutT"
                     /locus_tag="NS506_00456"
     CDS             complement(445069..445386)
                     /gene="mutT"
                     /locus_tag="NS506_00456"
                     /EC_number="3.6.1.55"
                     /note="KEGG: mah:MEALZ_2782 8-oxo-dGTP diphosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="8-oxo-dGTP diphosphatase"
                     /protein_id="APA94538.1"
                     /translation="MDLGETAAECAIRECREETGITAEITGFLGVYSNPNHIVAYTDG
                     EIRQQYENCYIGRPVSGTPTINEEADGVTFVRTEDLDRYDIHPSMRQQIGDFLSGSYP
                     YLG"
     gene            complement(445547..446359)
                     /locus_tag="NS506_00457"
     CDS             complement(445547..446359)
                     /locus_tag="NS506_00457"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94539.1"
                     /translation="MDVLGRFRRPVAISLPTVGASVSMETVNIRLQNVLLQRGIRPEV
                     LAEVCEVDPKTVSRWLGGRVPYPKHRRSVAQHLRIGEEFLWPPVPEATPVPRNAELVA
                     TYPNRADVPRDVWLSLLRSATEQIDVLVFSGTLIVQSNPMVVKMLSAQAAQGVRIRLC
                     FGNPNGEAVATRGHEEGIGDTLSAKVRASLTYYRPLLSEERCEIRLHNTTLYRSLFRY
                     DENMLVNPHIWGQPASANPVFQLKRVNDAAWFDSYAQSFETIWATAQPWLPQ"
     gene            446440..446943
                     /locus_tag="NS506_00458"
     CDS             446440..446943
                     /locus_tag="NS506_00458"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94540.1"
                     /translation="MKRTRIYQFPGGVFELQATEDDADDYAGFYLEFPGRGALIGSDD
                     KGAVMRYRPAALGYLRCNVSGISQLWDETQVRRLAERFGYDFCGLIVFDPKSGRPPLA
                     RLKAQATRLDAEAVIVPGPNHFEGGQIPGSLVKQLDVITVHPEETYARGSMLPLRDLP
                     PVQADGA"
     gene            447159..447857
                     /locus_tag="NS506_00459"
     CDS             447159..447857
                     /locus_tag="NS506_00459"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94541.1"
                     /translation="MHHNNVLRSMSSIETDTHTKGTPMQYRTWQHDCSSGLAPLQRSI
                     LGEEARTRLIRDWQPEVIIGLLRTEPYARAILRACIDVLGIPSDLETVVATRMQRQQI
                     LTQDGHEFRFLIGEWVLYRTVDTHDVMTEQLEHLVNAADNPRLSLGIVPMDARFLAPT
                     TGFLIHDDTKASTEAVGGEIIVTEPEGIALHAKTFDILTRQAVFGNAARQLIEAAAET
                     HRSGHRPRRIETKP"
     gene            complement(448502..449587)
                     /locus_tag="NS506_00460"
     CDS             complement(448502..449587)
                     /locus_tag="NS506_00460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94542.1"
                     /translation="MPPKVEPLKLSDTERQVLVGWSRRRKTAQALALRSRIVLACAES
                     GSNSEVARQLGVSRETVRKWRTRFERDRLEGLSDEPRPGAPRKITDEQVEHVITTTLE
                     TSPPQRDTHWSTRSMAQATGMSQSAVSRIWRAFGLKPHLVETWKLSTDPLFVDKVRDV
                     VGLYMNPPQNALVLCVDEKSQMQALDRTAPTLPIMPTTPARMTHDYVRNGTTNLFAAL
                     DVASGSVIAEHYARHRHQEFLRFLKTIDTAVPAEFDLHLVCDNYGTHKTPAVKKWLLR
                     HPRFHVHFTPTSASWLNLVERWFAELTNRKLRRSAHRSVTELKADVQAWINAWNADPK
                     PFVWTKTADEILETLAAYCQRINDSRH"
     gene            449835..450125
                     /locus_tag="NS506_00461"
     CDS             449835..450125
                     /locus_tag="NS506_00461"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94543.1"
                     /translation="MTRPHSYNGWFIGAVQEITPHDLRHTCASLAISAGANVMALSRM
                     LGHKDKSETLNTYADLFDDDLDRVANAMRKLYEAVTPCQNLVTEPDKIDKAA"
     gene            450217..451287
                     /locus_tag="NS506_00462"
     CDS             450217..451287
                     /locus_tag="NS506_00462"
                     /function="ATP-binding; Cell inner membrane; Cell
                     membrane; Hydrolase; Membrane; Nucleotide-binding; Sugar
                     transport; Transport."
                     /note="Part of the ABC transporter complex UgpABCE
                     involved in sn-glycerol-3-phosphate import. Responsible
                     for energy coupling to the transport system; Belongs to
                     the ABC transporter superfamily. sn- glycerol-3-phosphate
                     importer (TC 3. A. 1. 1. 3) family; Contains 1 ABC
                     transporter domain"
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate import ATP-binding
                     protein UgpC"
                     /protein_id="APA94544.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q7NRX5"
                     /translation="MATVTFDKATRLYPGGNKPAVDALDLEIADGEFLVLVGPSGCGK
                     STSLRMLAGLEEVSHGRILIGDNDVTHAEPKERDIAMVFQNYALYPHMSVAENMGFAL
                     KMAKVSKEERRQRVLEAAKLLDLEPYLDRKPKALSGGQRQRVAMGRAIVRQPQVFLMD
                     EPLSNLDAKLRVQTRTQIAQLQRRLGTTTVYVTHDQVEAMTMGDRVAVLKDGLLQQCA
                     SPRDLYRDPANLFVAGFMGSPAMNLFTLPVTNGSVTLGGCPLPLPRAVAAVTGERVVV
                     GIRPEHLEPVGDGAGIAMEVDVVEELGSDAYIYGRTLGDGETIVARVDWRHPPAKGAR
                     LALVSDADHTYFFHPEDGRRLH"
     gene            complement(451298..451807)
                     /locus_tag="NS506_00463"
     CDS             complement(451298..451807)
                     /locus_tag="NS506_00463"
                     /function="DNA-binding; Transcription; Transcription
                     regulation."
                     /note="Contains 1 HTH hxlR-type DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative HTH-type transcriptional regulator"
                     /protein_id="APA94545.1"
                     /db_xref="UniProtKB/Swiss-Prot:P9WMG2"
                     /translation="MYAMSAVMEGKLSDLGSWKPEGCSIAKAMDIVGTRSAILILRES
                     YYGTTRFDGFAARVGITDAAASTALRKLVEAGLLEKRPYQEEGKRTRNEYILTPMGLD
                     LLPAVVALWQWGDKYLQDGTAPLERLEDSTGEPVRAELRSASGNQVPLENLRVRVNEE
                     WRRKRRRHS"
     gene            451922..453091
                     /gene="fadA"
                     /locus_tag="NS506_00464"
     CDS             451922..453091
                     /gene="fadA"
                     /locus_tag="NS506_00464"
                     /EC_number="2.3.1.16"
                     /function="Acyltransferase; Fatty acid biosynthesis; Fatty
                     acid metabolism; Lipid biosynthesis; Lipid metabolism;
                     Oxylipin biosynthesis; Peroxisome; Transferase; Transit
                     peptide."
                     /note="Involved in fatty-acid beta-oxidation prior to
                     gluconeogenesis during germination and subsequent seedling
                     growth. Implicated in jasmonic acid (JA) biosynthesis (By
                     similarity); Belongs to the thiolase family; KEGG:
                     reu:Reut_A1669 acetyl-CoA acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="Acetyl-CoA C-acyltransferase"
                     /protein_id="APA94546.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q8LF48"
                     /translation="MRDAVIVEAVRTPIGKGKAAGGLHGVHPADLLAHSLREVVRRSE
                     IDPVLIDDVIGGVVTQVGEQGSNLTRRAALAAGYPESVPATTVDRQCGSSQQAIHFAA
                     QGVIAGAYDIVVAAGVESMSRVPMGANLIGAEDIAGVGFAERYPEGLVPQGISAELIA
                     AKWGLTRTQLDEFALTSHEKAATATKNGSFEAQLTPYGGLTDDEGIRLGSTLDTLGAL
                     RPAFYSEEMAARFPQIDWSITAANSSPINDGSAATLIMTSERAARLGLRPLARLHSFA
                     VAGDDPLLMLTAVIPATRKVLTRAGLDLSDIDLFEVNEAFSSVVLAWAHDTGADLSKV
                     NVNGGAIALGHPLGASGARLATTLVHAMHDRGARYGLQTMCEAGGLANATIYERL"
     gene            453194..453841
                     /locus_tag="NS506_00465"
     CDS             453194..453841
                     /locus_tag="NS506_00465"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94547.1"
                     /translation="MTTVSEAFDWSSPKTYIMTVDMDDYLAMPEDMSRSVEIKDGMIV
                     FCESPSPNHNVISYNIRRALAEGESRRADRQPCLRVNHDVDMLVSEVPFHYKRPDAIV
                     YRCVEQPRPRWKTKPTIADTVLVVEVVSPSTITADTIDKRAEYARYGIQHYWIVRMAN
                     DDGPAVSVEMLTLNSAGRYAVDERRTRADHFGVAIDTLVPFPVRLTWEELDDGLD"
     gene            complement(453842..454177)
                     /locus_tag="NS506_00466"
     CDS             complement(453842..454177)
                     /locus_tag="NS506_00466"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94548.1"
                     /translation="MAEWRRPPITVADFVATVLIYTVACLAAWTLAGLVPDYRTLFPP
                     DADTRYLPLAYAVAWLGIGLTLLIIPLWMIHAIRLRRRAWTTAIVAFPLLAEAWVLGL
                     LTAIVAVPP"
     gene            complement(454217..454873)
                     /locus_tag="NS506_00467"
     CDS             complement(454217..454873)
                     /locus_tag="NS506_00467"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94549.1"
                     /translation="MPGGPANPAYGGGPGYVDRGAPMGPGVPPYVVGTPTEVVSAPNR
                     PAGEAVSPEAWAPAGGPYGPGAPGPVLGENDQTMPAKLPTAEAAAAPPEAAQARKPVR
                     RRDIAVAGLLYVVGVAAAFGFAYDLFAKLFDLVHNRCALQKKDFTVQCDVIRPPASAL
                     WGLLIGGGGMFMALVAALVLTAVAAMTGRRAWTYTAIALPVILLAGGAGHVLVATAIK
                     "
     gene            455409..456392
                     /gene="menC"
                     /locus_tag="NS506_00468"
     CDS             455409..456392
                     /gene="menC"
                     /locus_tag="NS506_00468"
                     /EC_number="4.2.1.113"
                     /function="Lyase; Magnesium; Menaquinone biosynthesis;
                     Metal-binding."
                     /note="Converts 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-
                     carboxylate (SHCHC) to 2-succinylbenzoate (OSB); Belongs
                     to the mandelate racemase/muconate lactonizing enzyme
                     family. MenC type 1 subfamily; KEGG: nno:NONO_c75080
                     O-succinylbenzoate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="o-succinylbenzoate synthase"
                     /protein_id="APA94550.1"
                     /db_xref="UniProtKB/Swiss-Prot:P65426"
                     /translation="MSDSGDAVDFESAVVYAIPMRTRFRGITVREGMLIPGPNGWGEF
                     CAFPEYDDREAAAWLATAVEQATLGWPEPVRDRVPVNCIVPAVGPERAREIVIASGCR
                     TAKVKGADHPDSRREDLDRVATVRDALGPGGAVRVDANAVWDADTAVARIREIDRAAG
                     GLEYVEQPCRTIEELARVRKQVDVRIAADESIRRAEDPLRVAVAGAADVAVLKCTPLG
                     GVRRALEVADAAGLPCLVSSALETSVGLAAQIALAGALPHLDFACGLDTLSLLTGDVV
                     TEPLRPIDGYLQVPRSAPTPDPELLERYRHPDSERVDWWRQRLARVRKLLP"
     gene            complement(456373..456912)
                     /locus_tag="NS506_00469"
     CDS             complement(456373..456912)
                     /locus_tag="NS506_00469"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94551.1"
                     /translation="MPWEPPPGKTKREWPVSRLPELLAKGVRHDWILEVMVREPLQET
                     LRDNVYHPARAALLGPEGRCVDAAGYEQYDTWAAAFHDLCRTVGFVEYRDNDARHLDQ
                     WVRLARTTGWWWPGQRRCVMAERPTAVHVEPQPGALYGQLRLHRFDGPAVEYADGAEV
                     FARSGILVRDRTKVRAAVS"
     gene            complement(457360..457872)
                     /locus_tag="NS506_00470"
     CDS             complement(457360..457872)
                     /locus_tag="NS506_00470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94552.1"
                     /translation="MAERDAQRSRVYDAEGLVRGMFDRADEFGVRTVELHGSRITLPI
                     ERRFASVESVQTYVDRVLGLNWVRAQWDRATVAVTVRARAGAKAAHYETGHAVLAIPL
                     HVRGNAWALRELMILHELAHHLEPESDEVAAHGPEFCGRYIELVDGVIGPEAALVLRT
                     TMYSCGIRIA"
     gene            complement(457884..458726)
                     /locus_tag="NS506_00471"
     CDS             complement(457884..458726)
                     /locus_tag="NS506_00471"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="APA94553.1"
                     /translation="MSSQDKMLTRIGGLLRQAESTDNEHEAEAFLAAAQRLATGSSVD
                     LAVARAHIANRERRPTPTQRVIPIGEAGKRGLRTYVQLFVAIAAANDVRCDVARTSTT
                     LYAYGFDTDIDTCEALYTSLLIQMVRASDQYIKSGAYKTATTEKVVIERRYGRTFHRP
                     VEVPVAAVTARLNFQMAFASRIGRRLAEVKADVETAAVEADAAESTPTGTALALRNKE
                     LELTDFYSRTSEARGTWRGPQASAGYSAAARRAGDRAGKAARLGNSPELGGARGQLPR
                     GTGE"
     gene            458875..460179
                     /locus_tag="NS506_00472"
     CDS             458875..460179
                     /locus_tag="NS506_00472"
                     /function="Cell membrane; Glycoprotein; Lipoprotein;
                     Membrane; Signal; Sugar transport; Transport."
                     /note="Part of the ABC transporter complex MalEFGK
                     involved in trehalose/maltose import. Binds maltose and
                     trehalose; Belongs to the bacterial solute-binding protein
                     1 family"
                     /codon_start=1
                     /transl_table=11
                     /product="Trehalose/maltose-binding protein MalE"
                     /protein_id="APA94554.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q7LYW7"
                     /translation="MALKKVSSLRSTLVPRAVLAVTSAALLTATLATGCSSGSGGSGS
                     TTENLTGRGPITYVEGKDTTETGAVKQLIDRWNAAHPDEKVTFKEQSSDASQQYDDLK
                     QHMQAKASDYDVVALDVPWTAEFAAKGWIQPLKDSFAIDTSTLLSPPVASATYNGTLY
                     AAPRNTNGGLLFYRKDLAAEAPKTWAEMISMCPKAKEAGIGCYAGQLAPYEGLTVNTA
                     EVINAFGGSFVGPDGKTPTVNTPQAKQGLQTLVDAYKNDDMPKEALSFKETESQNAFV
                     SGKLMFMRGWPSSFGDAGSDTSAVKDKFGVAPLPGKDGIGTSTLGGYNAAISAFSKNK
                     ATALDFLRYLISEDAQHIVAQGALPSVRASVYDDPALIAKMPYLPALKDSIASAVPRP
                     VTPFYPAVSKAIQENAFAALQGTKSVDDAITGMQKGIETAGS"
     gene            460225..461259
                     /locus_tag="NS506_00473"
     CDS             460225..461259
                     /locus_tag="NS506_00473"
                     /function="Cell inner membrane; Cell membrane; Membrane;
                     Plasmid; Transmembrane; Transmembrane helix; Transport."
                     /note="Probably part of the binding-protein-dependent
                     transport system y4oPQRS. This system probably transports
                     a sugar-like molecule. Probably responsible for the
                     translocation of the substrate across the membrane.
                     Belongs to the binding-protein-dependent transport system
                     permease family. MalFG subfamily; Contains 1 ABC
                     transmemb