LOCUS       CP006850             8348532 bp    DNA     circular BCT 16-JUN-2014
DEFINITION  Nocardia nova SH22a, complete genome.
ACCESSION   CP006850
VERSION     CP006850.1
DBLINK      BioProject: PRJNA225667
            BioSample: SAMN02641505
KEYWORDS    .
SOURCE      Nocardia nova SH22a
  ORGANISM  Nocardia nova SH22a
            Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae;
            Nocardia.
REFERENCE   1  (bases 1 to 8348532)
  AUTHORS   Luo,Q., Hiessl,S., Poehlein,A., Daniel,R. and Steinbuchel,A.
  TITLE     Insights into the Microbial Degradation of Rubber and Gutta-Percha
            by Analysis of the Complete Genome of Nocardia nova SH22a
  JOURNAL   Appl. Environ. Microbiol. 80 (13), 3895-3907 (2014)
   PUBMED   24747905
REFERENCE   2  (bases 1 to 8348532)
  AUTHORS   Poehlein,A., Luo,Q., Hiessl,S., Steinbuechel,A. and Daniel,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-OCT-2013) Genomic and Applied Microbiology,
            Goettingen Genomics Laboratory, Georg-August-University Goettingen,
            Grisebachstr. 8, Goettingen, Lower Saxony 37077, Germany
COMMENT     Source DNA/bacteria available from Prof. Alexander Steinbuechel,
            IMMB, Corrensstrasse 3, D-48149 Muenster, Germany.
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: MIRA v. v3.4
            Genome Coverage       :: 42.23x;31.84x
            Sequencing Technology :: 454; Illumina; Sanger dideoxy sequencing
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..8348532
                     /organism="Nocardia nova SH22a"
                     /mol_type="genomic DNA"
                     /strain="SH22a"
                     /db_xref="taxon:1415166"
     gene            101..2047
                     /gene="dnaA"
                     /locus_tag="NONO_c00010"
     CDS             101..2047
                     /gene="dnaA"
                     /locus_tag="NONO_c00010"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="AHH14824.1"
                     /translation="MDDEQNVLTAVWPEVVAELTAGSTDGAIPPVTNAQKAWLGLVKP
                     LTVAQGFALLSVPSSLAQEAIERDLREPILRSLARRLGPQVEGLGVRIAAPTTPPPDR
                     SGTTARHARLTSRPDRMRDKPREPAGFQPPPQYPDSGELSRYLSPADYQARAAYPQGE
                     YPTAPMAGELPDSLGPSSPVRREPEPPRHDDSFRRDPEVFRRETESLRREPEVRRREP
                     EPRHDPEPLRGEHDVPHHPQESMHREPDPRGSGHLGQESLFGPEPEIPPAPRSNAGSD
                     VDEPVVNARNSWPTYFAKSPEPTPTAPATSSASLNAKYTFETFVIGASNRFAHAAAVA
                     IAEAPARAYNPLFVWGASGLGKTHLLHAAGHYAQRLFPGMRVKYVSTEEFTNDFINSL
                     RDDRKVAFKRRYRETDILLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVVSSDRPP
                     KQLATLEERLRTRFEWGLITDVQPPELETRIAILRKKARMDRLDVPHDVLELIASRVE
                     RNIRELEGALIRVTAFASLNGQPLDLSLAEVVLRDLMPDTTTIEITASTIMAVTAEYF
                     NTTLEELTGPGKARPLAQARQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAEKKVRK
                     EMTERRRVYDQVQELTARIKQRSR"
     gene            2933..4087
                     /gene="dnaN"
                     /locus_tag="NONO_c00020"
     CDS             2933..4087
                     /gene="dnaN"
                     /locus_tag="NONO_c00020"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="AHH14825.1"
                     /translation="MKFRVAREDFAESVAWVARSLPSRPPVPVLGGVLLVADEDGLTV
                     SGFDYEVSAQMRVAAEVAGPGQVLVSGRLLADITKALSNKPVDVSVDGTRVLIACGSA
                     KFSLPTMPVEDYPQLPELPPQTGELGVDLFSEAVGQVAVAAGRDDTLPMLTGIRVEIE
                     GSRVVLAATDRFRLAVRHLEWQPGNPDVETAVLVPARTLSEAAKTLGASDAPVQLAFG
                     TGTDGLLGIVNGGRRTTTRLLDAEFPKFRQLLPKEHTSIATLQVGALIEAIKRVALVA
                     ERGAQVRLEFSDQGLLLSAGGDDAGRAEEWLEAEFRGESLTIAFNPSYLNDGLAALRS
                     DRVTFGFTTPSRPAVMCPTGAEEPEPSESGAFAALAGDYIYLLMPVRLPG"
     gene            4254..5453
                     /gene="recF"
                     /locus_tag="NONO_c00030"
     CDS             4254..5453
                     /gene="recF"
                     /locus_tag="NONO_c00030"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecF"
                     /protein_id="AHH14826.1"
                     /translation="MYVRTLTLRDFRSWEQVDLELPTGRTVFLGSNGNGKTNLVEAVG
                     YLSTLGSHRVAGDAPLIRLGQQRSRIGATVVNSGRELRIDLELNQGAANRAQINRSPV
                     RRPREILGILHTVLFAPEDLALVRGDPSERRRFLDELATARLPRLAGVRSDYDRVLRQ
                     RSALLKTAGRQARSRSGAPAELGTLDVWDGHLAVHGAQLLAHRLRLVHDLHPYLEQAY
                     RSIAPESRPAAIRYRSGSLPAEFLDPQRAPQPDDVEALESNMLSELASARPKELERGV
                     CLVGPHRDDLDLMLGSAPAKGFASHGESWSFALSLRLGAFELLRSAGTDPVLLLDDVF
                     AELDRRRRAALAAVAADAEQVLITAAVPEDVPPELEAWPVHVETREDDGARTSHLAEV
                     PDSDSRV"
     gene            5629..5793
                     /locus_tag="NONO_c00040"
     CDS             5629..5793
                     /locus_tag="NONO_c00040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14827.1"
                     /translation="MVVKTVESDLITDSGFKIEELDEFNVATGANCQGTVSSPIGSLL
                     SYCFVEEDGK"
     gene            5919..8207
                     /locus_tag="NONO_c00050"
     CDS             5919..8207
                     /locus_tag="NONO_c00050"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriocin biosynthesis protein"
                     /protein_id="AHH14828.1"
                     /translation="MSNLRFARYFDVRVVPGDAVYLTSERSGQTRLPGPLAEKAAPYL
                     LGGHDRGDIFDQLAGTSDPGSIDSVLTALRTSGKIVDADPDQDCGIAGYWEAAGVDGD
                     AAIGTLRSGTVGIRPVGAGAAELEAAAAALGLETTGARPDLTIVPVDDYLDPELEQIN
                     RTMFDSGAVWMPVKTTGTVVWIGPIFEPGESACWDCMAVRMRSNRMVDHYLKQRHNTK
                     LSFAAVTGLPTTRAVAADLAILQAAKWLGGVALEPTVVGRRSRPLRRSELITFDTIEM
                     TTGKHILTRRPQCPVCGDADLQARLHRVPLTVGSVPKAVTADGGHRATSPEDMVAEFE
                     PLVSSITGPIKQLVKMKTARGIHAYTSGQNFAIPMADISDLRAGLRSASAGKGMTDVQ
                     AKASALGEAIERLSGIYCGDEARIAASYRELGAGSAIAPNELHLFSEKQFAHRSEWNA
                     RGAHFERVCDPFDAEQRIDWTPVWSLTRSEFRYIPTASLFYGCPMRPGNVYSGADSNG
                     NAAGTSVEDAIVQGFMELVERDSVGIWWYNRLSMPRIDLDSFDEPYFGWWTEAYRKLG
                     RETWVLDVTADLGIPAVVAVSRRFDKPVEDILIAFGAHFDVHIAISRAMSEMNQFVSS
                     VADVEDGAEGTGGPGDYNFTGREQLNWWMSATIENQPYLAPAADRVRTAADYTNMSTD
                     DLGEDVRVAQRLVEGAGLEMLVLNQTRPDIDLPVVKVIVPGMRPFWTRFAPGRLYDVP
                     VAMGWLREPTAEDDLNPVAMFL"
     gene            8218..9753
                     /locus_tag="NONO_c00060"
     CDS             8218..9753
                     /locus_tag="NONO_c00060"
                     /codon_start=1
                     /transl_table=11
                     /product="SagB-type dehydrogenase domain-containing
                     protein"
                     /protein_id="AHH14829.1"
                     /translation="MTVETSALPHTAVRFRADVELIAADGELRIRGALGSLKISGAGA
                     EIVAELRGLTTESRSVETIAENLSPEDRAKLAAILDRGASLLIATVTSDGHPMLEIEA
                     TAQGRAWSPVPVPGDASIRLSKFALLRMRADTLVLESPLAAHRVRLIDSSSRAVVGDL
                     AAGTFVADLAARHGGPVVHEIVAHLVALGFVEVGEAGTDDPGSVRFPSDTRPLLRQWE
                     FHDLLAHSRGRAGRFDEPFGGIFPFEGEIAPQPAVKRCPDGPRIPLHRPDFTEVARRD
                     PTLIASMEGRMSIRRYAAEPLTVVQLGEFLYRTARVRAFHDLTSALPYEVTTRPYPCG
                     GAAYELDLYLTVERCAGLAPGVYYYDAMAHHLVLINESDSDRRALLRMASTATAFEAD
                     PQVLLTMTARFQRLSWKYRRIAYAVSLRHSGVLYQTMYLVATAMGLAPCGLGSGDSDL
                     AARVFGLDYLEESSIGDFLLGAPGPGETDRLLADQLAWTDVNDRDWAGDARVLLDGCE
                     GVG"
     gene            9756..12215
                     /locus_tag="NONO_c00070"
     CDS             9756..12215
                     /locus_tag="NONO_c00070"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lantibiotic dehydratase"
                     /protein_id="AHH14830.1"
                     /translation="MAANVPGGGRTECEDGERITPGRAQVAELFIVRRAGLPRNVLDD
                     LRAPDTVAALRELLTVRAAIEVRGRGLSDTLYRVVPALPDKTMRRKVIGLRRDIRNVR
                     RIESVVADAHSMVARLGTEFVSRVESWAELCGTADALWRFAQTSLDTESAGIVTEVRR
                     HLAGPVIASGLVWASPAFSRRLESDLDAAVDARSARTATAYLTRIAAKPSPFSTFSTV
                     SVTGTDRRPGIVPPNASHVVTNRSIAVALFLACIAHAAAAKAMDVVRVSGLRQLGDRP
                     HAVLTTRTVRGSVALRFDEITDCGDLAGVLARLPLEPVPLADFTSADEMAQARRLLDI
                     GLLQPVLPWAADCSDDYAALAEWVRHKGIADSGNLGAALDDLAAQRPASTTGTPAARR
                     TAIEAATRAAEQAFTALDAPMPAWIPTTPPFHELVAHRPDESDRLPATITADLSEIAR
                     RLAPATGLDPRYERLVRYFVRRHGRGARDVDLLDMLYPVLAHGLDRLPGAPPASVVES
                     APRLRGHGTVGIASHTVFFQVDRDSDADYRVIVNAVHGGAIGLLARWSVHPQMNAWSA
                     EYLSDWVTSGFPGSTVYQVVPYADWSTLQRPALADLPRVALPGDLPDTSAAADLTRMV
                     VSHDIGTNTLQVVDRHGRSVSFAHLGVVPQPDLTGIPALLCLLSNPWTTLPRGKDRIG
                     TRAAADGVVSRPRREQGRIVWARATWVFAAHDVPRRRGNRLEFLRDILNWQRARGLPD
                     EVFVTRIEGGGPRARRGKPQWVGFDHPHAIWIAFGELDTSVTSVEVVEALPRMLDHAR
                     SAGGHPAPEYTTEYIGVVRHG"
     gene            12208..13056
                     /locus_tag="NONO_c00080"
     CDS             12208..13056
                     /locus_tag="NONO_c00080"
                     /codon_start=1
                     /transl_table=11
                     /product="thiopeptide-type bacteriocin biosynthesis
                     domain-containing protein"
                     /protein_id="AHH14831.1"
                     /translation="MGDIDATSTDSRWIYYRIYADDFGSLEPLLTELVAPVVREARPR
                     VREFGWFFLRYLDPIGFQLRVRLRGTPAALPMMEEMFDARLRAALAPGGRDRLGCRQF
                     GRYVYAPEYAKYGSAAEIRRAERIFEASSELALSRHGTDDPASPVVWAAACLLAVIAD
                     WPDDTRLGFLYHYTWYWTGGVEPGEWRLPWTEDDTIAHRASSLAQRARDLLGTESGRD
                     IACYSETLWRLAGRGHHPDARNSDHLTAFHHVHLTNNRLGVQPWQEAQIARLLWHFLR
                     NERGGR"
     gene            13053..14294
                     /locus_tag="NONO_c00090"
     CDS             13053..14294
                     /locus_tag="NONO_c00090"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="AHH14832.1"
                     /translation="MTEISTEYRGEALGPRFFADPHRVYQEWAERGDVHGVGAPGGGR
                     SWVVTGYTECRRALTDPRLRKDFDGANKLLRSGRNDPPVDSNFPDLASHMLNADQPDH
                     TRLRRIVGRYFTPRAAEQMRPWIRETADRLLTDLAGHDEVDLIEAYAGALPMHVMCKV
                     LGMPYAEGNELRRWIPAVQSVGTDERRTEALTKLVDHLTALIHRRRVEPGDDVVSALL
                     HADSDERLTENELMSMIFLLLVAGHETTVNLIGNAVLALLCHPAHLAALIAEPAGIPT
                     AIEEFLRYDGPVNIASVRYTNCPVEFGGREIPADEFVFVSLSAANRDPRKFTAPHSLE
                     FERNTTGHLAFGHGIHYCLGAPLARVEADVALTALLARYPDIRLGCDYDDVRWQQSVM
                     RGLVRLPVRLGSSSCPVGSSE"
     gene            14307..14846
                     /locus_tag="NONO_c00100"
     CDS             14307..14846
                     /locus_tag="NONO_c00100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14833.1"
                     /translation="MTDEPVDPELRGVDLARRALEEARAAARASGKAVGQGRASPRKG
                     GVRALRRRSGWSGARPDDRDPQLLSALTGSLARSRGWSVKVAEGTVFGRWAAVVGEDI
                     AGHADPVSLTDGVLSIQAESTAWATQLRMLQGQLLAKINAAVGQGVVTSLKITGPAAP
                     SWRKGERHIKGRGPRDTYG"
     gene            15253..17298
                     /gene="gyrB"
                     /locus_tag="NONO_c00110"
     CDS             15253..17298
                     /gene="gyrB"
                     /locus_tag="NONO_c00110"
                     /EC_number="5.99.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="AHH14834.1"
                     /translation="MAANDSNASGSSKAKAGNKDYGASNIKVLEGLEAVRKRPGMYIG
                     STGERGLHHLIWEVVDNSVDEAMAGYATRVDVTLLADGGVEVVDDGRGIPVETHASGV
                     PTVEVVMTQLHAGGKFDSDAYAVSGGLHGVGISVVNALSTRMVVDIDTDGYHWTQEYK
                     DAKPGKLVQGEPTKRTGTTQRFWADPDVFETTTYNFETISRRLQEMAFLNKGLTITLT
                     DERVSEAEVTDEVVSETAEAPKHDEGTSVPEQKVKTRTYYYPGGLEDFVKHINRTKQA
                     IHNTVVAFTSKGTGHELEVAMQWNSGYSESVHTFANTINTHEGGTHEEGFRAALTTVV
                     NRYAKEKKLLKEKDGNLTGDDIREGLAAIVSVKVSEPQFEGQTKTKLGNTEVKSFVQR
                     TCNEHLAHWFEANPADAKTIVQKAVSSAQARVAARKARELVRRKSATDLGGLPGKLAD
                     CRSKDPSKSEIYIVEGDSAGGSAKSGRDSMYQAILPLRGKIINVEKARIDRVLKNNEV
                     QSIITAFGTGIHDEFDISKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLVEHGH
                     VYLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLAAGKKINKDDGVQRYKGLGEMNA
                     KELWETTMDPSVRVLRQVTLDDAAAADELFSVLMGEDVEARRSFITRNAKDVRFLDV"
     gene            17360..19858
                     /gene="gyrA"
                     /locus_tag="NONO_c00120"
     CDS             17360..19858
                     /gene="gyrA"
                     /locus_tag="NONO_c00120"
                     /EC_number="5.99.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
                     /protein_id="AHH14835.1"
                     /translation="MTETTLPPNGGAGDRIEPVDIQNEMQSSYIDYAMSVIVGRALPD
                     VRDGLKPVHRRVLYAMYDNGYRPDRGYVKSARPVAETMGNYHPHGDASIYDTLVRMAQ
                     PWSLRYPLVDGQGNFGSRGNDGAAAMRYTECRLTPLAMELLREIDHETVDFTPNYDGR
                     SQEPVVLPSRVPNLLMNGSNGIAVGMATNIPPHNLNELAEAIYWALDNYDADEESTLA
                     ACMERVKGPDFPTYGLIVGGQGIHDAYTTGRGSIRMRGVVEIEEDNRGRTTIVITELP
                     YQVNTDNFINSIAEQVKDGKIAGISDIHDESSDRAGMRIVVTVKRDAVAKVVLNNLYK
                     HTQLQTSFGANMLSIVDGVPRTLRLDQMIRLYVDHQLDVIVRRTRYLLRKAEERAHIL
                     RGLVKALDALDEVIALIRRSANTDTARTGLMQLLEIDEIQATAILDMQLRRLSALERQ
                     KIVDELARIEAEIADLKDILEKPERQRAIVRDELAEIVEKYGDDRRTRIVAADGDVAD
                     EDLIAREDVVVTITATGYAKRTRTDLYRSQKRGGKGVQGAGLKQDDLVKHFFVTSTHD
                     WLLFFTNLGRVYRAKAYELPEANRTARGQHVANLLAFQPEEKIAQVIQIKTYEDAPYL
                     VLATRNGLVKKSRLTDFDSNRTGGIVAVNLRDTDELVGAALCSADDDLLLVSAHGQSI
                     RFAANDEVLRPMGRATSGVQGMRFNTDDELLSLNVVRDGTYLLVATAGGYSKRTAIEE
                     YTAQGRGGKGVLTLQYDPKRGSLVGALIVDDDDELYAITSGGGVIRTAARQVRKAGRQ
                     TKGVRLMNLGEGDTLLAIARNADEPDQVSGEEEA"
     gene            19938..20921
                     /locus_tag="NONO_c00130"
     CDS             19938..20921
                     /locus_tag="NONO_c00130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14836.1"
                     /translation="MTTPNQPNDERNHANGVTERIAPSPIPPRPAPRSGSSAENGSGN
                     SSASSEPKGDSAKAGGSAPDIADNGDGRGSRFEEGWSQLPQREPQSNLNRPGQAPVQG
                     RSAAQSGLGGGVSNARTTTDLAAKAARKEAAMVKSVGIDGPTRSIARPELIKDLPDLS
                     DLRHPLPQSETAAAQQVPMAAMPPSHNAAPGVSPAAPAAVAQAVSSGDPLRATVQVRH
                     IDPWSTLKVSLVISVAMFFVWMLAVGFLYIVLSGMGVWDRLNSTFTDMVNDNNSSATT
                     IIDAGSVFGYAAVVGLINVVLFTALSTVGVFIYNQCTDLVGGVQVTLADPD"
     gene            21082..21155
                     /gene="trnI"
                     /locus_tag="NONO_c00140"
                     /note="tRNA-Ile-GAT"
     tRNA            21082..21155
                     /gene="trnI"
                     /locus_tag="NONO_c00140"
                     /product="tRNA-Ile"
     gene            21188..21260
                     /gene="trnA1"
                     /locus_tag="NONO_c00150"
                     /note="tRNA-Ala-TGC"
     tRNA            21188..21260
                     /gene="trnA1"
                     /locus_tag="NONO_c00150"
                     /product="tRNA-Ala"
     gene            21375..21482
                     /locus_tag="NONO_c00160"
     CDS             21375..21482
                     /locus_tag="NONO_c00160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14837.1"
                     /translation="MKLLLTIGVLAAVVFAVTKVRKRNDEDLWHEVTAR"
     gene            complement(21499..22185)
                     /locus_tag="NONO_c00170"
     CDS             complement(21499..22185)
                     /locus_tag="NONO_c00170"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH14838.1"
                     /translation="MTTPKNVPRSQNPQDDSRPETAPQAEAAGQAPKAPLSRKAAAQH
                     RNRRQTTRLSYEDWVNGALDLLAREGVTAIRIPRLCQELGVTKGSFYWHFDDLEQLMA
                     AMADRWGAMQAEAVRALADLDSIPVEARIEKMAAMLVDARHWMVEASVREWSRTDVTV
                     AEAVRALDQRIFRTVQTIMLDLGFDPAQARQRAGAMVYLGIGLIHGRDNLPTPTPEEV
                     QGVVDLLIRP"
     gene            22363..24135
                     /locus_tag="NONO_c00180"
     CDS             22363..24135
                     /locus_tag="NONO_c00180"
                     /codon_start=1
                     /transl_table=11
                     /product="multicopper oxidase domain-containing protein"
                     /protein_id="AHH14839.1"
                     /translation="MYRPIGRRTILRGIGAGLTAATVGRAAADPPDIASPLLFHSPPL
                     RKFVDELPRLPILTGDRVDLIAATTEHRFHSDLPAAPAFGYNGRSYLGPTIEHTAGTP
                     LAVRFHNRLGAHPFAADIDTSLHGVPDGYRTTVPASLHLHGGVTPPASDGHPEQLVLP
                     GQQLDHEFPFRQSAGHLWYHDHAMGITRANVYAGLAGTVLLRDEFDTGGPDNPLGLPA
                     GEFELPLVLQEKIFTAEGRQSLRSTVVVPQGLWEGGGAGDVGVVNGMVWPELAVARGL
                     YRFRVINAASFSVWNLFFGNRMRFWVIGTEHGLLDAPVEVRHLRLAPAERVDLLVDFA
                     DLAPGDTVELRNDEQPVFQAAVLGEVAMPVFCRFRVLDRTGFRGPVPRTLRGGPRQPP
                     PLPPVREPALGRDLTVSQPYELRMPPAIMSLNNLRYSDPDIEMPRQGTTEVWNIVNIT
                     PDPHPIHIHLVTFRILSRTPLRTVDYQLAHPQPPVGVRWTPDPQGFLAGPPQPPAPWE
                     SGWKDVVRVDGGTVTRVVVRFPTADELGFDPDASFARLNPATAAHSDAHTAHGNSDLR
                     GYIWHCHLLDHEDHDMMLRFRTVR"
     gene            24140..25387
                     /locus_tag="NONO_c00190"
     CDS             24140..25387
                     /locus_tag="NONO_c00190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14840.1"
                     /translation="MTQTITSPHAFRYWEAKRTPTVRRLEAVVRKVTGANLFPTDDQA
                     RALTEDLFAGDPVAERFVAEVMHGPGGAPAGRRLLDRALTEGIEAVPEAPESMRELFA
                     EFDTVPEWVRPELVERGAAIWRRWGTMLFSFAGAETLEMYTESAVATPLSLAGGYAGN
                     SALRRYLETCRFWMDVSQPHALLTPGSAGRATALKVRVMHVSVRAKVAGHPEWDIDRW
                     GLPISQTYQLLTLIAGSVTPGLGLWALGYQTTPSEIRALLHFQRYMGYLLGVRLQWHP
                     ETIADSLRVLAMTIASRSYDAGEHGAELIESYPAAFAPRPEHRGWSRIRAAYNFRINS
                     VYSAIYMAPGTRRKYTLPPAFPWVLIPVLRLPLITAMEFARRVPPIGRMHERVMVWHR
                     DNWYRAQMQGREAEFDASGALRR"
     gene            25399..26460
                     /locus_tag="NONO_c00200"
     CDS             25399..26460
                     /locus_tag="NONO_c00200"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyneurosporene synthase CrtC family
                     protein"
                     /protein_id="AHH14841.1"
                     /translation="MNNDIIEAWNGPGRRDGELTVVEPRHNALHSATSSLAFEHWYFD
                     ARLDNGITVVGFLTKRRPEDPPYSRPWVELMVYQPDGTRRQISRKYPRGRASFDDHTM
                     DVRIGNNHAHTEFRPAGLPTHHLRLAEDGLDFDLRFDNELPSWMPGRGETHFGGGDSF
                     GWVVGAPRARVSGTVTVDGVRSEVTGRGYADHNWGVGDMRKIIERWHWGRLYVEDYSL
                     LFADVLTQRRRGAHEIAPLMLAHHDRIVLSTGEMRLREGPKRFDTTAGRDHPEWIELS
                     VPGQVELRLDVERVIHAHDLLDDVPLVRSRLLKPLAHRFIGHPGYFRFESAFELTVHG
                     DGEPVRRTGTTLHELVALT"
     gene            26534..28081
                     /locus_tag="NONO_c00210"
     CDS             26534..28081
                     /locus_tag="NONO_c00210"
                     /codon_start=1
                     /transl_table=11
                     /product="putative monooxygenase"
                     /protein_id="AHH14842.1"
                     /translation="MNETFDVVVAGAGPVGLMLACELRLAGVEVLVVERLSEMDRTIK
                     AGAINVPTAQAFDRRGLLPELLARQQAAIDAIKAFTGPVAVTDGRPPIGGHFAGIMLP
                     FDVVDGDDPAFAGVGPAAGAMLVNQQGIEEILGVRAAELGVVVRRGVELTDLSDDGDG
                     VTVRCGAESIRAAWLVGCDGGRSTVRKLAGFEFPGIDPEITGRQAVVEMTDTEGLQRG
                     WHDTDNGIYVYGPTPGRFLTVELDGPPVDRDAPITAAELEASLRRVTGVPVRVTAVHS
                     ATRFTDNTRQVPDYRKGRVLLAGDAAHVHSPFGGQGLNLGIGDAVDLGWKLGAVVAGR
                     MGEELLDTYTAERYPIGAWVLEWTRAQVALMRLDRRSKALREVMAELLSTGDGATAVL
                     KRISGVLHRYNLGGGHRLVGAVVPDLDLSDGSRVAGHFGAGAGVLFDFTDSAELRAAA
                     AGWQDRIRIVTAKPLDSVGFPDLAAALVRPDGYVAWAADDGGVTRDLPDLIAASRRWF
                     GAPAPVS"
     gene            complement(28101..28925)
                     /locus_tag="NONO_c00220"
     CDS             complement(28101..28925)
                     /locus_tag="NONO_c00220"
                     /codon_start=1
                     /transl_table=11
                     /product="putative C-5 sterol desaturase"
                     /protein_id="AHH14843.1"
                     /translation="MFDLIAHAIPVFVFCLIAEAVSFHFLPDDDELGYRFRDATTSVV
                     MGLGNVVVNIGWKLVVLTVFAAAYLITPLHLSAANPLTWIALFFADDFAYYWYHRTHH
                     TVRVFWASHVVHHSSEFYNLSTALRQPWTPFSSLPYWIPLALLGFPPWMILLQQSISL
                     VYQFFIHTERVGTLWRPIEWVFNTPSHHRVHHGSNDRYLDRNYGGILIVWDRLFGTFE
                     PESERVRYGLTKNIGTFNPVRVATHEFTAIWSDLVTARSWRDRWGYLLRGPGWAPD"
     gene            complement(28913..29650)
                     /locus_tag="NONO_c00230"
     CDS             complement(28913..29650)
                     /locus_tag="NONO_c00230"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="AHH14844.1"
                     /translation="MVTAMEFTAVSRTAVSDTVFGQLVEAILGGSIAPGEALPSEREL
                     AETFQVNRHAVREALRRVQQGGLVRIAQGGKTRVLDWRANAGLEVLSSLASAGALPPQ
                     RLLRDIAVMRRSVAADAARLAAATADAEQIAAIEQAARAYPDATADLTELTAADLDFW
                     YAVIDGSGNVAYRLAMNTLVHGYFDIGMPVIAELGLNKEYVDADVHRELARRIAARDA
                     DGAYALAHEFLGRFAAALGAEDRPCST"
     gene            29801..30844
                     /locus_tag="NONO_c00240"
     CDS             29801..30844
                     /locus_tag="NONO_c00240"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase family protein"
                     /protein_id="AHH14845.1"
                     /translation="MVAIAADLSRAARNVWAVSFGDGIEPYLPAPSTPISEEPHNRLL
                     RYDRAEPATGNPVLLVPPLAVTPACFDLRDGQSLVRYLLGIGKQPYVVDYGDFDYGDR
                     ELGLEHWTHGIVPDAVRRVAAAHDRPVDVIGWSLGGVLAMLAAAADADLPVASVTGLA
                     TPFDQRHTPFLVPVRMAGRVTGGRGVAMATRLLGGAPRELVRLGFRLQAFDRELTRPL
                     FIARHAADTEALARMEAVDRFMATMPGYPGRSLWQIYRSLVLRNELADGTVRLRSDLV
                     VELAKLTCRVLLIGSRTDMLVPARSVRRGPELLTGASEVRFTEVTGGHLGLMVGPQAA
                     VSTWPAIGEFLGD"
     gene            complement(30855..33479)
                     /locus_tag="NONO_c00250"
     CDS             complement(30855..33479)
                     /locus_tag="NONO_c00250"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="AHH14846.1"
                     /translation="MTASPRSTHSKFGSSNVANIRSGLQPGIPELRFTPLPLPVAEAR
                     IDEAAGGGRTVLICAPAGSGKTVLVADWVTRRCVDHVGWLTFTGRCGESADLWRAIAS
                     VLELPGETPAGEEFAAPLAEAARLIDRLAELRRPAVLVFDDAHLLTDPIALAGLEYFV
                     TNAPAELTTIITGRFDPPVRWHALDLAGRLTRLSARELELDERLTARLLDQHGLQLSE
                     SEIAGIQRLTCGWAALVRIAAIYLAADSHDHAAALATLAQTPHAISDFLVGELLAALS
                     DDALDFLLTTAIPQEFTVELATGLVGETAAATLEQLLRGNFPIMSVAHDGELWHSYHP
                     MLHTYLLAEAARRLPDRIREIHRGCAAWFVAARMPSAALHHVLAEPGRPNISRFIREH
                     GPRLVFGGDGPAFLARLDEIGELADDQFVQLLRIAESVGRADIAAAGAYLNRLLAEPY
                     PASALVPAAWLAILRDAVVADVANTTGEQTTMPDPATLPPTGQADLDCYIVLQAATAQ
                     LHRGEIEQAESGLWHALALAEHAGLGRFVVRAAADLALCGGFAGRFTVMSERAAHALD
                     LADNYGLRACPAVTQMRATIAYVRFLQGDPVEPGPVPVPDTGRLAPAPAGEQQALAVH
                     HLLESDSAADRFIAADALRLQLLEILTDRTPVAPCGNLLLHAVLVLLRIQSRVSAQTL
                     IERAAAVLGRTPEIVVAEAALSEYAQTSSTTLELLRPLLNRDDRLPPIAAITGWLLYA
                     SACDHLDRPVKTYEALSRALQHAAADRIVRPFVDVPGTVALLDGSVGRFGHHDRLVEL
                     IRAHPLARPAGHGPRLTETEISVLRQLPSGMTTLNIAEGMGVSINTVKTHLRGIYHKL
                     GSGSRADAISRARELGLI"
     gene            33737..34921
                     /locus_tag="NONO_c00260"
     CDS             33737..34921
                     /locus_tag="NONO_c00260"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH14847.1"
                     /translation="MRSRRVRSPREPAALPPPVSGATWSIPRGLIVVLAAAGAVVAIG
                     GMKVFSGVLGPAFLALMLTMAVQPVQTWVQRRGWRPWIGMVAALFFVVLILLILLGSL
                     VLSVAQLASELPKYTDKLNTMLDGIRHTLSDAGVDTDQIQNTLNGIDVGKVVDLLSAT
                     LSNALGIFSDLFFVLALLLFMAIDGMMIDRKLAVVARARPEIAYALTVFAQGTRKYLV
                     VSTVFGLIVAVFDGGALWLMGVPLPLLWALLSFITNYIPNIGFVIGLIPPALLALLDS
                     GPVLMIWVIVVYSVINFVIQSIIQPKFVGDAVGLSVTVTFLSLVFWSWVLGALGALLA
                     IPLTLLMKALLLDIDPTTRWVSVLIQDRAPDVDAFAEERDDGEQDAADEKVTGENSGS
                     PG"
     gene            35020..35430
                     /locus_tag="NONO_c00270"
     CDS             35020..35430
                     /locus_tag="NONO_c00270"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH14848.1"
                     /translation="MTTTPQEHPVRQGIAAGTSIGAAILLITVGVLSILEGISAVAND
                     KLFVAGLDYIYEFDTTTWGWIHIVLGILLVIAALGLMSGTTWGRVAAITLAALSILAN
                     FLWLPYYPAWSILVIALNIVVIWAVATWQPGRDL"
     gene            35549..36556
                     /locus_tag="NONO_c00280"
     CDS             35549..36556
                     /locus_tag="NONO_c00280"
                     /codon_start=1
                     /transl_table=11
                     /product="putative adenylate cyclase"
                     /protein_id="AHH14849.1"
                     /translation="MTSPELSKLLQSVVEPYLLDGPRRYNRYQVAELSGVPADLSRRL
                     WISLGFPVNPDDEAVDYTEADVRAVRNFRSLDALSDAHLRRQQAAARTLGQSMARLAE
                     WQVDLVAEEITDRIRTITANDPTVDETKVALEVTTEVVSALQEMQAYAWRRHLAAALA
                     RSLAGDGSGETLRELAVGFADMVGYTRLTRHLDPEELTELLETFETITTDAITVNGGW
                     VIKNVGDEVMFAAESAEAGARIALAIQEATGDAGTTPELRVGLAYGLVLQRFGDLYGS
                     VVNTAARLTGVARPGTVLVDDGMAGQLNSESEFALRHLRGVRVRGFNRLRSHVLRRSE
                     R"
     gene            37230..38234
                     /locus_tag="NONO_c00290"
     CDS             37230..38234
                     /locus_tag="NONO_c00290"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter, ATP-binding protein"
                     /protein_id="AHH14850.1"
                     /translation="MPDAIVAEGLVKKYGRLVALDGLDLSVPEGTVTALLGPNGAGKT
                     TTVRVLTTLLVPDAGKATVAGIDVLREPQRLRAHIGASGQYAAVDEYLTGFENLEMVG
                     RLYHLGIQRSKQRARELLDRFRLSEAADRPVKGYSGGMRRRLDLAGALVANPPVLFLD
                     EPTTGLDPRARLDLWDVIEELVAGGTTLLLTTQYMEEADRLADSIAVIDHGRVIARGT
                     ADELKTLVGGDRIELTVEHLDNLETARETLAGLAVGDIHVEPGLRRITIPVDDGSQAL
                     VDTIGRLSERGIRIQDVGLRRPSLDDVFLTLTGHEADESGDPGESAQTVEQLTEGQRG
                     "
     gene            38231..39073
                     /locus_tag="NONO_c00300"
     CDS             38231..39073
                     /locus_tag="NONO_c00300"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter, membrane protein"
                     /protein_id="AHH14851.1"
                     /translation="MITTTGDTGRRSVTARAAIVFGDSITIAKRNVIKIKRVPDVLIF
                     STLSPIMFVLLFAYIFGSAITVQGTSYREFLIAGIFAQTSVFGATFTGTSLAEDMQRG
                     IIDRFRSLPMAPSAVLVGRTVADVVINVVSLVVMSVTGLLVGWRIHGSILDTVLAYVL
                     LLLFAYAISWIMAVVGLLVRAPEVFNNASFMVIFPLTFIANTFVPSDVLPTPLRVIAE
                     WNPVSAVTQATRDLFGNTSPANPTPDVWSLQHPVATTLIWVVAILVIFVPLALGQFKR
                     SVSR"
     gene            39350..39877
                     /locus_tag="NONO_c00310"
     CDS             39350..39877
                     /locus_tag="NONO_c00310"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="AHH14852.1"
                     /translation="MTSPNQTAVAVLHTNLGDIKISLFGNHAPKTVRNFVGLADGSAP
                     YTTNNAAGESSGPFYDGSVFHRVIDGFMIQGGDPTGTGRGGPGYEFGDEFHPELRFDR
                     GYLLAMANAGPGTNGSQFFITVGPQGHLNRKHTIFGEVVDPDSRKVVDAIATTATDRN
                     DRPKEPVVISSITLS"
     gene            39894..40757
                     /locus_tag="NONO_c00320"
     CDS             39894..40757
                     /locus_tag="NONO_c00320"
                     /codon_start=1
                     /transl_table=11
                     /product="rhomboid family protein"
                     /protein_id="AHH14853.1"
                     /translation="MNPHPPASTCYRHSDRTTGLACTRCGRAACGECLRPAAVGQHCV
                     DCIAQGRSDIRPVTRAALASSARPVPYVTYALIAINVAIFAVTASQAHSIADNHVSRL
                     FLDWVLAPPYVAHGEWIRVLTAGFLHYGPLHLAVNMFALYILGRDTEAVLGRARFLAV
                     YLAALLGGSAAVMLLATHTATAGASGAIYGLFGAMTVILLRLRQSPVQMLILIAINLI
                     ISVSLPGISLWGHLGGLLAGTLAAGGILFLPEWLHARSRESVVRIGWAAVAGIAVLAL
                     VLIGAGAAALA"
     gene            complement(40773..41279)
                     /locus_tag="NONO_c00330"
     CDS             complement(40773..41279)
                     /locus_tag="NONO_c00330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14854.1"
                     /translation="MSASQSDHPESDHPAGGSDPAPRLEWSTPPVALFVVALGGIAFA
                     VAAFVASDGPSRLLIGLAAVLLLCLAALGLRQRPRLSVIPGDPARLVIRGLLGPVDYR
                     PEQILRARVQGFRRLGRSIPNLELDVEHKGEERLLVFGRWDLGTHPQDVLDVMAVHGL
                     VPPDPRQP"
     gene            complement(41374..41640)
                     /locus_tag="NONO_c00340"
     CDS             complement(41374..41640)
                     /locus_tag="NONO_c00340"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH14855.1"
                     /translation="MPKSKVRKKTDYTINPTSRTPVKVKGAGPSPVWYVSIMLGFMLA
                     GLAWLLVYYLGADHIQWMSDLNAWNFLIGFGLMVVGLIMTMRWR"
     gene            41723..42361
                     /gene="trpG"
                     /locus_tag="NONO_c00350"
     CDS             41723..42361
                     /gene="trpG"
                     /locus_tag="NONO_c00350"
                     /EC_number="4.1.3.27"
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase component II"
                     /protein_id="AHH14856.1"
                     /translation="MRILVVDNYDSFVFNLVQYLGQLGVEATVWRNDDPRLEPVDDVV
                     TDYDGLLISPGPGTPDRAGASIGLVHACARHNTPLLGVCLGHQAIGEAFGATVTRAPE
                     LLHGKTSSVFHIGSGVLAGLPDPFTATRYHSLTVLEDTLPAELEVTGRTESGIVMAMR
                     HRELPIHGVQFHPESVLTQGGHRMLANWLEVCGERPAERLVEMLESEVAALV"
     gene            42365..43093
                     /locus_tag="NONO_c00360"
     CDS             42365..43093
                     /locus_tag="NONO_c00360"
                     /codon_start=1
                     /transl_table=11
                     /product="putative reductase/deaminase"
                     /protein_id="AHH14857.1"
                     /translation="MTPRPYVVLSVATSIDGYIDDTGPERLLLSNAEDFDRVDRERAA
                     ADAILIGAETLRRDNPRLLVGDARRRRDRVAAGRPEFPLRVIVSASGDLDPELRFWHQ
                     GGARVVYTTTAGRARIGDRLTGYAEVVALGATVDFTALLDDLGERGIERLMVEGGGRI
                     HTAFLAGDLADEILLAIAPVLVGDSAAPRFLHPARYPGGSRRRMVLDDVTRLGDVAVL
                     RYRTDRHPTEPTPDGSPVTMENPQ"
     gene            43090..43599
                     /locus_tag="NONO_c00370"
     CDS             43090..43599
                     /locus_tag="NONO_c00370"
                     /codon_start=1
                     /transl_table=11
                     /product="putative reductase/deaminase"
                     /protein_id="AHH14858.1"
                     /translation="MTAESEAWRTSESSSRIPGEPGAHRFWMHHAIGLARLCPPSTTA
                     FSVGAVIVGPDGVELTHGYSRETDAKVHAEESALDKLGNDPRLATATLYSTLEPCSAR
                     ASVGRPPCTERILTAGIPRVVIAWREPGTFVENCVGVERLREHGVEVVEIPDLAAEAM
                     SMNRHLHLS"
     gene            complement(43686..45578)
                     /gene="pknB"
                     /locus_tag="NONO_c00380"
     CDS             complement(43686..45578)
                     /gene="pknB"
                     /locus_tag="NONO_c00380"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase PknB"
                     /protein_id="AHH14859.1"
                     /translation="MTTPKNLSSRYELGEIIGFGGMSEVHKARDLRLGRDVAIKVLRA
                     DLARDPTFYLRFKREAQNAAALNHPAIVAVYDTGEAEVDGGPLPYIVMEYVDGETLRD
                     IVRGKGPLPPRRAMEIIADVCAALDFSHKNGIVHRDMKPANIMINRQGAVKVMDFGIA
                     RAIADSSNPMTQTAAVIGTAQYLSPEQARGEQVDARSDVYSVGCVLYEILTGQPPFTG
                     DSPVAVAYQHVREDPKLPSLVHPGVPRELDSVILKAMAKNPANRYQSAAEMRADLIRV
                     LGGQKPHAPTVMTEEDRTTFLSSNEPEPRSYRRVDGDGDGDPEETPSRRRLWIGVGAA
                     VAVAVLFALFWVLLGPGSRPDQVAIPDLSSKPAQQAQDQLQGLGFKVTIQPKPDSKIA
                     SGNVVSTQPLGGARVDKGSTVTVLVSSGPQLVPVPDLTHRTQQQAQLDLNDAGLLLDG
                     NVQRDWSSPEDKDKVVRQEPQPNSKADSGSAVKVWLGKGPEQVRVPIVVGQQIDVAEP
                     NLSTSAGFKVVIQKVASSRPAGEVISTDPAGGSTADRGSTVTVQVSSDQIQMPNLYGL
                     TPSEAISKLQAAGWQGTAAQISQTTQGTLVASNIGRIIDQNPGTGSTVSRTGTISIVT
                     GALAPP"
     gene            complement(45575..47053)
                     /gene="pknA"
                     /locus_tag="NONO_c00390"
     CDS             complement(45575..47053)
                     /gene="pknA"
                     /locus_tag="NONO_c00390"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase PknA"
                     /protein_id="AHH14860.1"
                     /translation="MLNNGALIADRYRLQRLIATGGMGQVWEALDTRLDRRVAVKVLK
                     AEFSADPTFRHRFKTEAKTTAQLNHPGIAGVYDYGETYDPQAGETAYLVMELVQGEPL
                     NAVLNRLGRLSVGQGLDMLEQTSRALEVAHTAGVVHRDVKPGNILVTPTGQVKITDFG
                     IAKAVDASPVTKTGMVMGTAQYIAPEQATGEDATSASDVYSLGVVGYEALSGQRPFSG
                     DGALTVAMKHVREAPPPMPADLPPNVRELIDITLAKDPNQRYASGGEFADAVAAVRAG
                     RRPPRPRGGGGTTGATRVLPPGPTAVIPRGEYDGAATRHPAEPAQPGSTAMMPGRADT
                     PPEDPDDSRFTTAQKAMAGLGVGAVLIGGLAAWVLLSGKAPDSTNTPVKPTTTVVAPP
                     PPTTTAPPTTEEPTTTEAAPPPVVSTTHEPTTTTTPPPSTTTTAPSTTAPTSTGHWWT
                     RTTRPTPTIPYYPSLDLPLPGAGGAHDADSTTVPDTSSQGLP"
     gene            complement(47136..48602)
                     /locus_tag="NONO_c00400"
     CDS             complement(47136..48602)
                     /locus_tag="NONO_c00400"
                     /codon_start=1
                     /transl_table=11
                     /product="putative penicillin-binding protein PbpA"
                     /protein_id="AHH14861.1"
                     /translation="MNTPLRRVAIAVMVMIVALLINATYVQVIKADSLRNDPRNSRVL
                     LDEYSRQRGQISAGGAVLATSVSTDDRYKYLRTYPTDPAAYAPVTGFYSMQYGSTGLE
                     RSEDSVLNGSDSALFGRRLIDMISGRDPRGGNVVTTIDPAMQKVAYDQLTSKGYTGSV
                     VAIEPSTGRILTMVSTPSYDPNQLSTHDGARATQAWESLSADPSQPMLNRAVSQTYPP
                     GSTFKVVVAAAALSMGIKPEDTFTAAPNITLPGTSTTLENYNGTPCGSGATATMHDAF
                     RLSCNTAFAEIGMKVGAAKLKDLATAFGIGPHSGIPIPVADSTIGSITDNAALAQTSI
                     GQRDVALTPLDDAVIAATVANGGVRMEPHLVDQTQGPDLRELSTTKPVSVGQAISAPV
                     ASQLTGLMIDSEKATAGGTQPRGYQIASKTGTAEHGSDPRNTPPHAWYIAFAPAQNPK
                     IAIAVIVENGGDRALAATGGSVAAPVARAVLDAGLQGG"
     gene            complement(48599..50068)
                     /locus_tag="NONO_c00410"
     CDS             complement(48599..50068)
                     /locus_tag="NONO_c00410"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cell division protein"
                     /protein_id="AHH14862.1"
                     /translation="MSAPAPPSAGAFPSPPGGFAPAPPPATRRNVELLLLGFAVVITT
                     VALVLVEASQDQEITWDLAKLGLAYLALFGVAHLAVRRFAPFADPLLLPIAALLNGLG
                     LVLIHRLDLADEQTAIYNSWSLPSPDANQQVLWTALGITLFVGVLVLLRDYRTLARYG
                     YTLGLLGLIALIIPAVLPGKFSETNGAKIWIRLPGFSVQPGEFSKILLIIFFASVLVA
                     KRDLFTAAGRHFLGMELPRARDLGPILLVWATCLVVLFFEKDLGTSLLIFATVLAMLY
                     IATERVGWLIVGAGLLAIGFVLAYNAFGHVRVRVATWLHPFDDYNSTGYQISQSLFGL
                     ATGGVAGTGLGSGRPSQVPFAKTDFIVATIGEELGLIGLAAVLMLFAVFVVRGLRTAL
                     AVRDSFGKLLAAGLAFTIAVQVFVVVGGVTKLIPLTGLTTPFVSYGGSSLLANYALLA
                     LLVKISDAARAPAPSRRREAAPIAEAQTEMIRPEKGEQA"
     gene            complement(50068..51513)
                     /locus_tag="NONO_c00420"
     CDS             complement(50068..51513)
                     /locus_tag="NONO_c00420"
                     /codon_start=1
                     /transl_table=11
                     /product="putative serine/threonine protein kinase"
                     /protein_id="AHH14863.1"
                     /translation="MTQVLRYAARSDRGLVRANNEDSVYAGARLLALADGMGGHAAGE
                     VASQLMIAALAHLDDDEPGDELLGKLDRAIREGNAAIADQVEEEPELDGMGTTLTTIL
                     FAGKKLGLAHIGDSRAYMLRNGELAQITRDDTFVQSLVDEGRITPEQAHTHPQRSLIM
                     RALTGNEIEPTLVVREAHAGDRYLLCSDGLSDVVSDETIANTLREGSTDEAADRLIEL
                     ALRSGGPDNVTVVVADVIDLDYGQSHPIVAGAASGEDEDTPPPNTAAGRAAAMRPPRA
                     APRRAPVAAEPPAPSRSHKGRWIALAVALVVAVAIGLVVGYKMIRSNYYVGADNGKVV
                     IMRGLPGSILGYSIQDVDQLVCVDRNNKVTLVQSDAGLPGGCRQLQITDLQQTGRDKV
                     NNGLLPPGGFDSTRGQVEKLAATDLLPVCVKPAAPVTPPPAEGSGGSGTPAPAGPAPA
                     TPAPTSAPAQPTPTTTAPAPQTPGENCRKAD"
     gene            complement(51510..51977)
                     /locus_tag="NONO_c00430"
     CDS             complement(51510..51977)
                     /locus_tag="NONO_c00430"
                     /codon_start=1
                     /transl_table=11
                     /product="FHA domain-containing protein"
                     /protein_id="AHH14864.1"
                     /translation="MQGLILQLTRAGFLLLLWLFVWAVLRTLRSDIYAASGIRIQPRP
                     TRGSAVLPSFSRGQKGAKYLVVTQGSLAGTRITLGTQPVLIGRADDSTLVLTDDYAST
                     RHARLSPRGEDWYVEDLGSTNGTYLDRGKVTTPVRVPLGTPVRVGKTVIELRS"
     gene            complement(52164..53630)
                     /locus_tag="NONO_c00440"
     CDS             complement(52164..53630)
                     /locus_tag="NONO_c00440"
                     /codon_start=1
                     /transl_table=11
                     /product="FHA domain-containing protein"
                     /protein_id="AHH14865.1"
                     /translation="MGIVSRFERRLQGAVGDVFARVFGGSVVPQEVEAALQREASDRL
                     TELDGGHLLAPNVYVITVNPTDLQELDADHELTTRAFAKHLQDYIRDQGWQTYGEVHV
                     EFEPSPTLHTGQFRTHGRVDPDAGRRSPPAPRRPPERSGQPPQRTAHPQPGAGPMTQN
                     SGYDPSREPAESDPRNRGYAPPPGGRPAPGYQDDYGRGGQYPGGGEYAAPESQPAYGD
                     YQQGGDYQNGYDYQQGGAGYQQPGGAGYGQPGYEQGGYDQSSYDQGYGQQAYADQGYG
                     QQQAYEQGGYEQGGYDQGYGQQGYADQGYGQQQGYPEQNYGQQPGYGQAPGYDQGYQA
                     PGGYGQQGYADQGYADPGYADQGGYAAEDPAYGQQQAYGQQPPAYGAAPQAPQPPRGQ
                     SGYSATLHLDDGSGRTYQLREGSNIIGRGQDAHFRLPDTGVSRRHIEVRWDGQVAMLS
                     DLGSTNGTLVNGSPVQDWQLADGDVIRAGHSEILIRIV"
     gene            53911..53993
                     /gene="trnL1"
                     /locus_tag="NONO_c00450"
                     /note="tRNA-Leu-CAG"
     tRNA            53911..53993
                     /gene="trnL1"
                     /locus_tag="NONO_c00450"
                     /product="tRNA-Leu"
     gene            complement(54041..54271)
                     /locus_tag="NONO_c00460"
     CDS             complement(54041..54271)
                     /locus_tag="NONO_c00460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14866.1"
                     /translation="MTAPQKRSILARVSPTQWVALILIVLAIIFVFENRDKVSITVLM
                     IDITSPLWLVLLVLFVVGWIAGVLTVRRRNRR"
     gene            complement(54318..56081)
                     /locus_tag="NONO_c00470"
     CDS             complement(54318..56081)
                     /locus_tag="NONO_c00470"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH14867.1"
                     /translation="MNPISAASSGSQDRAPAAVDAGAAVDAPAAENTAAVPAASGRPA
                     RGSRERPGSSFTGAVLAVVMVWLSLTPSLLPRGQLFQGLVTGAAATIGYALGAALAAV
                     AVWSLHRDRGRPVPAWVWGALVVVALSGTVTMFILFAHWQRELRDLMGVSGLRWYAYP
                     LIVLVAAAVFLVLVGIGRMVRVLCRWAGRGLGRFLPPRIAVVGGAVLVVALIVALLNG
                     VVAQGSMSALNDMFKAVDSETVPDTTAPTASERSGGPGSLVSWDSLGRQGRIFVSAGP
                     TVAQLSAFNGRPAREPVRAYTGLASGPSIRADAELAVADLDRAGGFGRSVLAVATTTG
                     TGWINESTASALEYLYNGDTAIVSMQYSYLPSWISFMVDQERARQAGRALFDAVYARW
                     TTMPRDHRPKLVVFGESLGSFGGEAAFSGIGDITARTDGVLFVGPPNSNVLWGELTAR
                     RDPGSPEWLPVYDRGRNVHFVARPPDLDHPAPPWNSPRVVYLQHPSDPITWWSPHLLF
                     DEPDWLREPRGYDVLPSTRWIPVVTFLQVSADMAVSTDVPDGHGHTFHAAVADSWAAI
                     LQPPGWTTADTLRLRAVLTGD"
     gene            complement(56182..56517)
                     /locus_tag="NONO_c00480"
     CDS             complement(56182..56517)
                     /locus_tag="NONO_c00480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14868.1"
                     /translation="MTAEQHSDPVVTQAAERFEISVDDRLAGFTEYLDRAGQRIFYHT
                     EIDSDFAGRGLAGALVSQALARTRDAGLRIVPICPFVAGYLQKHEEFADITDPVTQDA
                     VDYVRSQRG"
     gene            complement(57227..58216)
                     /locus_tag="NONO_c00490"
     CDS             complement(57227..58216)
                     /locus_tag="NONO_c00490"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH14869.1"
                     /translation="MDVDAYSFAQRRHWDRLDHLTRQRRLTGAEVDEFVALYRRTSQQ
                     LARLQSHSPDPELINGISAVLARARGRLLGARTDTWSQIVHFVTRRFPAAVYRAWPWW
                     AGVAAAFLAVSTVIGIWVSGSGRARKALGLPRSADGLTAPGGRFESYYSEHPHDAFAA
                     QVWTNNAWVTAIALFTGVLILPAAYLLFMNALNVGVSGGLMADAGRLDAFFGFLLPHG
                     MLELTAIFVAGGAGMKLGWTLIDPGRMPRAAALARQGRATATVALGLVGVLLVSGIIE
                     GFVTPSGWPAPVRLGIGAIAELLFLAYVFGPGRRAATEQAALRSLADGERISG"
     gene            58262..59107
                     /locus_tag="NONO_c00500"
     CDS             58262..59107
                     /locus_tag="NONO_c00500"
                     /codon_start=1
                     /transl_table=11
                     /product="RDD family protein"
                     /protein_id="AHH14870.1"
                     /translation="MRRIRDTGVIMAEFTTGEAVSLHLPIARIPIRAAAFAIDLLLQL
                     ILGVLLMALIVLVLFRLEPDGAWIDVAALVTLVTVLAGYPIVSETLLRGRTVGKMALG
                     LRVVRSDGGPIDFRHALTRGLAAALVDFWNLGGFGFVAVVTSLCSPRARRVGDILAGT
                     VVVSDRAPIPVPALAVAPPWLVEWVARLDLSGLTEELALPVRRYLTRYPDLTPQVQVN
                     LGTALVIAVCEQLRVAPPPGCPPLQILGAVIGERQRRVLPPPPRLPFWPMRVPPAPVT
                     GHPIA"
     gene            complement(59085..60377)
                     /locus_tag="NONO_c00510"
     CDS             complement(59085..60377)
                     /locus_tag="NONO_c00510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14871.1"
                     /translation="MIVTGRLALCAAVAALIVGIAVPSWVGVVILTGVLVALVAIDVI
                     ACGSDDLALSRVPLTTVRVGRTATVELAVLNRGTRTVHALLWDDWPPSAHAPARTHRL
                     RLPANTRTTVSTTVRPSRRGDRIAGPVTVRSFGPLGLAGRQVRHEVPAKVRALPAFRT
                     ERILSSKVRRLQHLDGRSVANIRGPGSEFDSFREYVAGDDVRSIDWRATARATDVLVR
                     TWRPERNRHVLMLMDTGRISAARLGDQTRLDTGIEAALLLGGLAAAAGDTVDLLAFDR
                     EVRAEVRGVRGKAVQPKLMHALSGVVPALLDTDTAAMVRTAVQHTRRRSLVVWFTSLD
                     GAMVEENLLPVLPVLSRRHRVLLVSVTDPEIAAAAERRDDVTEVYAAAAAEHLLTERA
                     IVRETLQRRGIDVVAAAPDRLPEALADEYLELKRSGAL"
     gene            complement(60382..61380)
                     /locus_tag="NONO_c00520"
     CDS             complement(60382..61380)
                     /locus_tag="NONO_c00520"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATPase associated with diverse cellular
                     activities"
                     /protein_id="AHH14872.1"
                     /translation="MTETPLTTAQTNHTPTAEEALRALGDVRAEIGKAVVGNDHAVMF
                     LILALLCRGHVLLEGVPGVAKTLLVRALAAALELEHTRVQFTPDLMPGDVTGSQIYDP
                     HTTEFTFRRGPVFTNLLLADEINRTPPKTQSALLESMEERQVSVAGVPQPLPDPFVVI
                     ATQNPIEQEGTYPLPEAQLDRFLFKVDIHLPQREDEFRILQRHAAGFDPRDLSAAGVH
                     PVAGAAHIAAARASIAQVTINPEVLAYIVDLCRATRSSPAVQHGASPRGATAVLAAAR
                     ALAWLNARTFVTPDDVKTVAVTALRHRLQLRPEAELDGVTGEGVMSSLLSSVPVPV"
     gene            complement(61377..62411)
                     /locus_tag="NONO_c00530"
     CDS             complement(61377..62411)
                     /locus_tag="NONO_c00530"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14873.1"
                     /translation="MSEQFRPDEPAPAAPPPPALGPAAQHRAAAESAAGHHDFDTALR
                     ERFRAVVRGLEQGGVLEVQRSRTARETAAAAGRALPGTEGEFDGAAHSFDEIVYGGRP
                     ASPDEYQRLSAADRYSLAPPPPPDPVDQAESAPSDPSRRRLPPLPQLLRDKRFWAVVL
                     GILVVALIVYMLMRLSATPSAPPQPSHPPPPPDRPDLPDPDFGRGRDSIFDRFPPWLA
                     YGGAQALIFAAIVVWWRGRRRGAVVGEPRPVEVAAGELLTGQAALYRRTKDRDHVAAK
                     LRQATLRRIRGRLDLRTDTPPDRVCALIGGRIGADPRVVGAALYGPVPDDTTLEYIAA
                     QLDWIDSEIG"
     gene            complement(62408..63316)
                     /locus_tag="NONO_c00540"
     CDS             complement(62408..63316)
                     /locus_tag="NONO_c00540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14874.1"
                     /translation="MYPAVADRTGQPSGTGAPQSRGVPGPVASDSGDAERIPIRPLSW
                     RELADLPFAVLQYRIRAIAGLAGAGVVVALGIVLGVTALVTWATDGSSAGNAWAAVLS
                     TICCVWLLRLWTIGVTVPIGLGVVHRHPVTIRAACGQFRTVAARLAADQLISVLIVLG
                     ILIIGTPLLVTLIPAIIWIGRVMGNRWTVAPILYTESPPYRAAVARAKTLATGRGMPL
                     AGLWIYLRGVLLALAIPVAGLLGFLSDISGTHRWAVTALLSVAALLISAFAAAVDAAT
                     AVIIHIDRRCVREGADIRIPAGQAIR"
     gene            complement(63820..65619)
                     /locus_tag="NONO_c00550"
     CDS             complement(63820..65619)
                     /locus_tag="NONO_c00550"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH14875.1"
                     /translation="MSGPAAARSGRAPKSLTGVLTWLGGAEAERPDRRGSAHEGSAYA
                     VTGTVVLLFAVISGAVVSFAAAAAHRPGVIAVIAGIIAALLVGAVSRALATAPLSRRA
                     GPRARAERFGRIAVAVLTGVIVAELASTVILGGSVARTLDDRARRDAESAASVVTART
                     ELDRLTAERGALAATIAGAQTDMDQALIVARCEYNPTPQCPQTKITGVPGRGPETRTA
                     ESMLEDARGRLSAAQARVQPLDEQIAGAQTALDRARTAAFRTGDRGPGARWLAMNEYT
                     TGHAGGLLLRLLTLVVAVLLALLPLLLRIWRGESSFDRAVAAGAEIDRADRAADTAVA
                     VKRAQIRSETESLRAEQELTATRLAVDADTTIDRERQRTRVLAAIGNLEIGVTEPQQR
                     AVADFEALAALPPSTDPTTQEATVTAPRHLPAPVTPAALAPAEPARTPEKTGGLELPV
                     IGTVPFTDTAARWIRPLVPGFVTTALDRTIDTATSPLRTVRQVFEEAEEITFTLKRTR
                     KVTVNSEDSHGAAAGQVIEEQHLPPAAPRPPHYAYLDDPRYAYQHDPRYARYAPLPHQ
                     LPHANPDAALTGSHATELGYPDRRELPPGPNPS"
     gene            65913..66671
                     /locus_tag="NONO_c00560"
     CDS             65913..66671
                     /locus_tag="NONO_c00560"
                     /codon_start=1
                     /transl_table=11
                     /product="putative chorismate mutase"
                     /protein_id="AHH14876.1"
                     /translation="MRSNSDSVVTENWIFGSGGVGPVGDRAVGGTVPAGTRAARRARP
                     VLVAAAAALLLGLTGSVLPATAGHVLPAAAAAPVANDPESELSPLVDAVLRRLDTADA
                     VAAAKWESSQVTGQPPVVDDPAREAQVYDAMAAAGARSGLPQDWVRQVFTGQIEANKT
                     VQYGLLAGWRFDPAAVPATGPGLAAVRPIIDQVNGEILDQLAAQRAVLTGPDCAQRLA
                     SAVFPVLTSGRVDALHGAALVRATVTLCPTTFVK"
     gene            67419..72047
                     /gene="gltB"
                     /locus_tag="NONO_c00570"
     CDS             67419..72047
                     /gene="gltB"
                     /locus_tag="NONO_c00570"
                     /EC_number="1.4.1.13"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase large subunit"
                     /protein_id="AHH14877.1"
                     /translation="MGLYDPANEHDACGVAFVVDMHGRRSRDIVDKAITALLNLEHRG
                     AAGAEPNSGDGAGIMIQLPDKFFRAALAESGATFQLPPEGSYATGIAFLPQARREAAR
                     ACYRVEKIVKEEGLAVLGWREVPIDETSLGALSRDAMPTFRQLFIASPSDSSEQLSGM
                     DLERRAYVVRKRVEHELGKQGAGEGAVGRETVYFPSLSGQTFVYKGMFTTPQLRAFYL
                     DLQDDRVESALGIVHSRFSTNTFPSWPLAHPFRRVAHNGEINTVTGNENWMRAREALL
                     NSEIFGTDHEGANRLEKVFPVCTPGASDTARFDEVLELLHLGGRSLPHAVLMMIPEAW
                     ERAESMDPAQRAFYRYHSMLMEPWDGPASVCFTDGTVIGAVLDRNGLRPSRIWVTDDG
                     LVVMASEVGVLDIEPSKVVRKVRLQPGRMFLVDTSQGRIISDDEIKSQLASEQPYQEW
                     LDEGIIKIADLPDRPHEHMSHDRVLIRQQIFGYSIEELNLLISPMAKTGGEALGSMGT
                     DTPIAVLSSRPRLLFDYFAQLFAQVTNPPLDAIREEIVTSLRSTIGPEADLLHPGPES
                     CRHITLTQPIIDNDELAKLVHINDDGSRPELRSVVVRGLYPVKKGGKGLRKALDAIND
                     QVSAAIDGGARIIVLSDRESNEKLAPIPSLLLTASVHHHLVRERTRTKVGLVIEAGDA
                     REVHHMAMLVGFGAAAINPYMAFESIEDMLERGALEMPGSTGDKAADYIAAVKNYNKA
                     AGKGVLKVMSKMGISTIASYRGAQLFQVVGLSQELCDQYFTGLNSPLDGIGLDEIADE
                     VATRHKVAFLENRNERAHRELEIGGEYQWRREGEYHLFNPDTVFKLQHATRSGQYSIF
                     KEYTKLVDDQSERLASLRGLFKFKTESRHAIPIDEVEPASEIVKRFSTGAMSYGSISA
                     EAHETLAIAMNRLGGRSNSGEGGESVTRFEPEENGDWRRSAIKQVASGRFGVTAHYLT
                     NCTDIQIKMAQGAKPGEGGQLPAHKVYPWVAEVRHSTPGVGLISPPPHHDIYSIEDLA
                     QLIHDLKNANPQARIHVKLVAEPGVGTVAAGVSKAHADVVLISGHDGGTGASPLTSLK
                     HAGGPWELGLAETQQTLLLNGLRDRIVVQVDGQMKTGRDVLVGALLGAEEYGFATAPL
                     VVSGCVMMRVCHLDTCPVGVATQNPVLRQRFTGKPEFVENFFMFIAEEVRELLASLGL
                     RSLDEAIGRVDLLDTTKAKAHWKAAKLDLSPILDDVETAFMYQDRRNTKTQDHGLDKA
                     LDNQLIAQSADALERGKPVKFDTKITNVNRTVGTMLGHEVTKLYGGAGLPDETIDITF
                     TGSAGNSFGAFVPAGITLRVFGDANDYVGKGLSGGHLIVRPSLNAPESFVAEENIIAG
                     NVILFGATSGEAFIRGVVGERFGVRNSGATAVVEGVGDHGCEYMTGGRVVILGETGRN
                     FGAGMSGGIAYIYNPNGTFEANLNTELVDIEQLEGEDFTWLRDVVASHRDETGSAVAE
                     RILSDWSQQVNHFVKVMPRDYKKVLLAISEAEKAGRDVDEAIMEAARG"
     gene            72083..73573
                     /gene="gltD"
                     /locus_tag="NONO_c00580"
     CDS             72083..73573
                     /gene="gltD"
                     /locus_tag="NONO_c00580"
                     /EC_number="1.4.1.13"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase small subunit"
                     /protein_id="AHH14878.1"
                     /translation="MTIRGPLVGDAQGFLKHTSRELPKRRPVPLRLMDWKEVYEEKFA
                     HETLQTQASRCMDCGIPFCHNGCPLGNLIPEWNDLVYRGNWREGIDRLHATNNFPEFT
                     GRLCPAPCEASCVLGINQDPVTIKQVEVELIENAFDEGWVQPIYPTRLTGRKVAVVGS
                     GPAGLAAAQQLTRAGHTVTVFERDDRIGGLLRYGIPEFKMEKRFIDRRLAQMEAEGTI
                     FKAGVNVGVDITAEQLRERFDAVVLAGGATIARDLPIPGRDLDGIHQAMEFLPLSNRV
                     QLGDPITDDEGLPRIHAKGKKVVIIGGGDTGADCLGTSHRQGAESIHQFEIMPKPPEE
                     RAESTPWPTYPLMFRVSSAHEEGGERVFSVNTERFVGADGKVTGLQAHEVKNVNGRFE
                     KVEGTDFTLEADLVLLAMGFVGPQKPGLLEELGVGYDQRGNVKRDKDFQTTVPGVFVA
                     GDMGRGQSLIVWAIAEGRAAASAVDKHLEGETALPAPIAPTAVPQR"
     gene            73878..74798
                     /locus_tag="NONO_c00590"
     CDS             73878..74798
                     /locus_tag="NONO_c00590"
                     /codon_start=1
                     /transl_table=11
                     /product="cutinase domain-containing protein"
                     /protein_id="AHH14879.1"
                     /translation="MRLKKVVAAAGAAVAVLAGAVSGTALGSGTAAAAPGCPSLYVVA
                     IPGTWETGDHKPDHMVGPGMLSGVTRGLPSSAEVDYVSYAATAFPWEGDVYGASKKEA
                     TDNARGLIQAMAARCGGTRYALVGYSQGADAAGDLAAEIGTGLGVVPPDRLSGVGLIS
                     DPRRSPTDVQVGPFVGGAGAGGARVGGFGFVSDRVRTICAAGDLYCSTEDTDYVTRFA
                     GFLAQASGASAANLWRYQLEASSIVGDLMSHGGIPTLQSQLTEGANQQRVQQLENFYG
                     SGTHTSYGDYGVGGGQTAISWMHNWIAGMA"
     gene            complement(74879..75457)
                     /locus_tag="NONO_c00600"
     CDS             complement(74879..75457)
                     /locus_tag="NONO_c00600"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase-like domain-containing protein"
                     /protein_id="AHH14880.1"
                     /translation="MDPLDALRTPVDPVDPDPTFAEQLRERLRDAIANTGGVTMTDAE
                     TRTTATATGTDYPDLSPYIVVSDARRALTWYVTVFGAVRRGEPIVNADGTIGHAEVAI
                     GDSVLMLAEQSDLWPEVPVGAPTGPTHSHTLHLQVADVDETTRRAAEHGAHVERPPRD
                     QHYGRGAVVIDPFGHRWMLLVPPAAGSDDSGQ"
     gene            complement(75459..75956)
                     /locus_tag="NONO_c00610"
     CDS             complement(75459..75956)
                     /locus_tag="NONO_c00610"
                     /codon_start=1
                     /transl_table=11
                     /product="putative RNA polymerase sigma factor, sigma-70
                     family"
                     /protein_id="AHH14881.1"
                     /translation="MRPDPAFGLLELYDRALPHVYGYLLARCGERQLAEDLTAETFLA
                     AVDAVRKPGAPELSVAWLIGVARHKLADHWRRAEREQRGLRVLGGEPDRDDPWDVEID
                     AIRARDVLAELAPQHRAALTLRHMDGLPVPEVADQLGRTVHATEALLVRARNAFRRAY
                     TGEEG"
     gene            complement(76104..76400)
                     /locus_tag="NONO_c00620"
     CDS             complement(76104..76400)
                     /locus_tag="NONO_c00620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14882.1"
                     /translation="MQTTVKQKNRTRRIVGRVAVAGALVVVPLAAVAVPALADTPSAV
                     AVDRDNHNPGDRDNHNPGGPGQPGRDEHRDDHNQPAPAPGPQLPFQLPSTGSAG"
     gene            complement(76641..76928)
                     /locus_tag="NONO_c00630"
     CDS             complement(76641..76928)
                     /locus_tag="NONO_c00630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14883.1"
                     /translation="MIARVAIAGAVAAAPIAAVAVPAFADTPSATQVDWHDHNGPRHH
                     DHDHDHGWPGGPGGWPGGPGPGGWQGGPGPGPWQGGPGGFLPAPPPTGSFG"
     gene            complement(77099..77728)
                     /locus_tag="NONO_c00640"
     CDS             complement(77099..77728)
                     /locus_tag="NONO_c00640"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphoglycerate mutase"
                     /protein_id="AHH14884.1"
                     /translation="MRHAQPGRVLTTSGPADPELTELGIEQAGRVPAVITRFAGGEHR
                     IARVVSSPQRRALDTAAPTAEKLGLPVEVLDGLAEYDRDLPAYIPIEDAKRDFRDAYE
                     RIKAGHLPEQIDGPAFVERVLGTVSRIAAGTEPADTVVAFAHGGVVNVLLQDVLGLER
                     PLTFPIDYCSITRVLFSRSGKRTAATINENSHVWDLLPRNRPAAEGSTA"
     gene            complement(77804..81211)
                     /gene="lysX"
                     /locus_tag="NONO_c00650"
     CDS             complement(77804..81211)
                     /gene="lysX"
                     /locus_tag="NONO_c00650"
                     /EC_number="6.1.1.6"
                     /EC_number="2.3.2.3"
                     /codon_start=1
                     /transl_table=11
                     /product="lysylphosphatidylglycerol biosynthesis
                     bifunctional protein LysX"
                     /protein_id="AHH14885.1"
                     /translation="MTVHEQDSPADVRPSGDPGTHTGPVTSTQDQLHDRDTRSPSSPV
                     PHRAHGRLTEVPHVLGLVLGIFSILCALWSISPGLRFITSAPRHYIDAYYFDAPDTNL
                     MWAVIVGLLAGATASRKRIAWWLFVGYMTLFAVANALDLAEEQDPHALAALIVHIAVV
                     GVMIAAWPEFYTRVRRGAVWKALGVLISGLVAGCLLGWGLVELLPGSLPHGAQRPLWA
                     VSRVTATILVADNNFDGHPPHPVNLLLGLFGAVALLSAALVLFRSQRASNAMTGLDES
                     AVRGLLARSDVEDSLGYFATRRDKAVVFAPSGKAAITYRVELGVCLASGDPIGVREAW
                     PQAIDAWLRLADEYGWAPAVMGAGELGATAYRRAGLSALRLGDEAILDTRTFSLAGPD
                     MKQVRQAANRLRKQGFTARIRRHSELSPEAMAQMIARADSWRDTETERGFSMALGRLG
                     DRLDGDSLLVEAVDHDGRVWGMLSLVPWGRAGVSLDVMRRDPKGPNGIMEFMISQLAL
                     SSEQYGITRVSLNFAVFRSVFEEGGRIGAGPVLRLWRSVLMFFSRWWQLEALYRSNVK
                     YQPQWVPRFFIFEERRQLPRVALASALAEGFLPRIGKQPDAVSHTGLHSAVPPTITGL
                     HADGSPPEPPPSALEQAAARRPEQVRVRMDKVRRLEQAGVDAYPVAYAPTHSIADARR
                     SPKGTTVRICGRLLRIRDYGGVTFAMLRDWSGDIQILIDRERVGAHRSQTFGEYFDLG
                     DLIEVSGQVGTSRRGELSLLAQDWRMIGKCLHPLPDKWRGLADPEARVRQRYVDMAID
                     VQAREVLAKRSAVVRSLRDTLNDWGFLEVETPVLQQIHGGANAAPFITHINAYDLDLY
                     LRIAPELYLKRLCVGGMEKVFELGRVFRNEGVDYSHNPEFTILEAYEAHSDYERMMHA
                     CRQLIQNAAVAANGSCVALRPDSDGGLIEVDISGDWPVRTVHGAISAAIGETVTPGTD
                     VDRLRLLCDKADVPYQPGWDAGQIVLEMYEHLVEERTQEPTFYIDFPTSVSPLTRAHR
                     SIDSVAERWDLVAWGVELGTAYSELTNPIEQRRRLTEQSLLAAGGDPEAMELDENFLE
                     ALEFAMPPTGGLGVGVDRVVMLITGRSIRETLPFPLVKPRTGQGESR"
     gene            complement(81208..81381)
                     /locus_tag="NONO_c00660"
     CDS             complement(81208..81381)
                     /locus_tag="NONO_c00660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14886.1"
                     /translation="MGYIFTAALDGPHAAPTGRRAAHRARPALEHPAGVPSSESTRVR
                     LNRSARVRRESRK"
     gene            81398..81601
                     /locus_tag="NONO_c00670"
     CDS             81398..81601
                     /locus_tag="NONO_c00670"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding S4 domain-containing protein"
                     /protein_id="AHH14887.1"
                     /translation="MPIEDEIIRLGQFLKLANLVDGGSEAKTVIAAGLVRVNDEVELR
                     RGRQLHNGDVVVFAGHRVRVAGG"
     gene            complement(81611..82075)
                     /locus_tag="NONO_c00680"
     CDS             complement(81611..82075)
                     /locus_tag="NONO_c00680"
                     /codon_start=1
                     /transl_table=11
                     /product="putative regulator of ribonuclease activity"
                     /protein_id="AHH14888.1"
                     /translation="MATADLADEIGPEIRSCDTQFTQFGGHPVFSGRIVTIRCFQDNL
                     LVKQTLGEPGEGRVLVVDGGASIHTALVGDIIAGRGVDNGWAGVVVNGAVRDSAILRT
                     LEIGVKALGTNPRKSTQTGSGERDVPVEFGGVTFVPGEMLYSDHDGVVVRAE"
     gene            complement(82160..82618)
                     /locus_tag="NONO_c00690"
     CDS             complement(82160..82618)
                     /locus_tag="NONO_c00690"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14889.1"
                     /translation="MTAVKIVADCAAPAEIAFDYVDDYRHLPEFVSEVHAFRPITEHV
                     SGLGATFDTEIKLGPASLTSRLEIVRWEKNVAIAVKAVTGFEIESTFLFHPRDENSCT
                     VDAIVEYRVPGGIAGKVLGKTIEPFVKLSVKHTAHNLTTRIAEYRQARGD"
     gene            complement(82634..83575)
                     /locus_tag="NONO_c00700"
     CDS             complement(82634..83575)
                     /locus_tag="NONO_c00700"
                     /codon_start=1
                     /transl_table=11
                     /product="putative copper resistance protein CopD"
                     /protein_id="AHH14890.1"
                     /translation="MTSGTTGGGSATLRYALLLVVPAVLIGVVLGWALAAPDAVQAEA
                     PVRALADGLGATVLGLAALPRLHDRLRPAWRMLAVFGGLWAVTEFVLLATEAAEVVGV
                     SVFGLRAHDFGDYLAHVSGGQIGIAVLIGTVAVTGYSALAHRRPEHTTSDLVLVFAAV
                     TLVLRPITGHMSQQTLGSVLAAVHALAAAAWFGVLLALALVVRSRGEWAVILPRYSGW
                     ALPAVAAVTVTGVCNGLVRIGGPGALVDTGYGRIMVAKTVVVLALLGLGWWWRRTWVP
                     RASDHRMDAGSSLRRALIEVAVMGVAFGLAAALSVTA"
     gene            complement(83572..84120)
                     /locus_tag="NONO_c00710"
     CDS             complement(83572..84120)
                     /locus_tag="NONO_c00710"
                     /codon_start=1
                     /transl_table=11
                     /product="putative copper resistance protein CopC"
                     /protein_id="AHH14891.1"
                     /translation="MIRRILLALATVLALGGIATVVAGPASAHSTLVSTDPADGAKIA
                     TGPARVSFTFNENLQPSFPSLTVVGPDGNLWSKGKPVVDGPTVSVEVGELGPAGTYTM
                     AYRVTSADGHPVSGTRTFELTTPGHGTPGPKADAAKNSGGDSGGVPLWVFIVAAVVLF
                     GGGLAFALFGGRSRRSGSGGKS"
     gene            complement(84117..84782)
                     /locus_tag="NONO_c00720"
     CDS             complement(84117..84782)
                     /locus_tag="NONO_c00720"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14892.1"
                     /translation="MSSTLSRALVATGAAGAIALCATGTASAHVTADAPGAAQGGYGI
                     VTFRVPTESATASTTKLTVALPQLAAARTEPIPGWSAHIEKNDKNQITSVTWTADPGN
                     PGITPEQFQRFALAVGPLPKQDSVSFPATQTYSDGKIVNWNEPMPAGGDEPEHPAPTV
                     HLAAAGDEHGTAGSDSGTQASGDKDTKDADDTARWLGGIGLVLGALGAALGLGAVIRS
                     RRA"
     gene            complement(84868..85437)
                     /locus_tag="NONO_c00730"
     CDS             complement(84868..85437)
                     /locus_tag="NONO_c00730"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14893.1"
                     /translation="MRHRDRPPTGSPRGIRRPGADAVRGGLVGAAVAVLAVAAHGSAG
                     GGYPDSAALTLLVLIATAAGTFASLLPRRWGRVAVLAALGGGQVAAHLALSVLPAHGE
                     TSCGSGLLAAPNGWMTAAHAVATVVCALLIVAAERLYAAVSRSVRAITTRPHSLPVVA
                     TARWRPDSRRPGQRPSGRAVSSRAPPVFA"
     gene            complement(85453..86085)
                     /locus_tag="NONO_c00740"
     CDS             complement(85453..86085)
                     /locus_tag="NONO_c00740"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14894.1"
                     /translation="MGLFTKRKRRADRKAEAKALKHKAAMEAKLGARNERKRNRAELR
                     TQRDVAKAQIATLKAEEKAAVKTAERADRELLTASQMKKYLGVARVLIPVLAPLAYRA
                     ATYLRGQIDTRRARQLGIGVDELGNFTGHGARLQARIAGVESTLDGIADKNGEDKKFV
                     SATRDRLGSLSAAVRTAEQMPPQRRRSVHTSISNELSGVEADILARLGVH"
     gene            86172..87977
                     /locus_tag="NONO_c00750"
     CDS             86172..87977
                     /locus_tag="NONO_c00750"
                     /codon_start=1
                     /transl_table=11
                     /product="putative nuclease, RecB family"
                     /protein_id="AHH14895.1"
                     /translation="MMRLARLSGGGTILHSVYSGSGDRDGHEDGAGDETRAAASRAVT
                     AERIAYVDARALVGCRHRLHLDATHPDRLFGVSEDAGVKQRREAATAHRAKVRDTLVA
                     AAPEDWVVIDPDRPASVRAEATMSACAEGAQRIWGAVLPQEPDTGRRGGCEMLLRDTD
                     RGGYIPVIVVNHKVTDPRQPDPADFHPTTSDLYRWDPRPDRHVRIRTQPRDQQRLAHL
                     YRMLQRHGLASPALVGGAIGYHFDRILVHDLTSVLAEYDRRYADRIAVVRGELPTVPS
                     KVPECRQCPWWSRAPLSREGGEPAGPSCEGWLADHRDVSLVAPGSRAELLRRHGVQTI
                     DDLAGWTGDEPEDWQYEPFDETVVTARAWISGAPLVRRVDRVRVRRADVEVDVDLESY
                     QEYGAYLWGTLLDGVYRPFLTWDPLPTADEARSFAEFWTWLMAVRAEATAAGKTFAAY
                     CYSRTAEDKWLYESARRFAGMPDVPTEDEIRAFVDGPEWVDMFQAVSEQFICPNGKGL
                     KKIAPVAGFGWRDPEASGEASMSWYRLAVGYDAEPDMSQRTRLLEYNEDDVRATQVLR
                     EWMSPLVPAPHSADAEVPAMTDFREPEPVRRNICT"
     gene            87974..89944
                     /gene="htpG"
                     /locus_tag="NONO_c00760"
     CDS             87974..89944
                     /gene="htpG"
                     /locus_tag="NONO_c00760"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein HtpG"
                     /protein_id="AHH14896.1"
                     /translation="MTEHVEQMEFQAETHQLLELMIHSVYSNKDTFLRELISNASDAL
                     DKLRLESYRDKDLEVDTSDLHIELEVDKDARVLTVRDNGVGMSRAEVVDLIGTLAKSG
                     TAELRRQLLESKGDDSAVSSEDLIGQFGIGFYSTFMVADKVTLTTRRAGETEGTRWES
                     AAGSSTYTIETLDAAPQGTAVSLHLKSADEDDHLFDYTQEWKLREIVKKYSDFISWPI
                     RMTVERTVTEGEGEEKEEKTILEEQTLNSQKALWTRPRSDVSDEEYKEFYKHVSHAWD
                     DPLEIIPLKAEGTFEYQALLFIPSQAPFDLFMREHKRGVQLYVRRVFIMDNCEELMPE
                     YLRFVKGVVDAQDLSLNVSREILQQDRQIQMIRKRLVRKVLSTIKELQGAEIPEGESA
                     ADSKYRTFWNQFGRVLKEGLLSDFDNRDTILQVSSFESTHSESEPTTLAEYVERMAEG
                     QDKIYYMTGETRQQIENSPHMEAFKAKGLEVLVLTDPVDEMWVGSVPEFDGKAFQSIA
                     KGEVDLETEEEKKASEQLREQQEKDFGDVLKFLQEKLDDSVKEVRLTSRLTTSPACIV
                     GDVFDFTPQLERMYRASGQAMPESKRILELNPDHPLVTGLRDAYTKDKESEDLGATAE
                     LLYGTAVLAEGGELKDPAHFAQLLAERLTKTV"
     gene            complement(90028..91380)
                     /locus_tag="NONO_c00770"
     CDS             complement(90028..91380)
                     /locus_tag="NONO_c00770"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipase"
                     /protein_id="AHH14897.1"
                     /translation="MKLNARSPQSVRSGSSGTRRRGIRRAVAAGVAACAGAALSCGGI
                     GASGAAPVSEFYTPPAQFATAPGSVIKTEPMPVFVAPPGFGPWPANAQKIMYTSQTQD
                     GDPVAVSGTYLDATSPWQGTGPRPTVVIAPGTSGQGDQCAPSEAFATGLYAQITPPSI
                     SANQEAVSAMVWHAMGARVLVTDYIGLGTPGVHTYVNRVEEAHAVLDAARAANALSGT
                     GPQTPLAFWGYSQGGGSTAAAAELQPSYAPELNLKGVWAGAPTADLSAVLQKIDGNLI
                     GGVVAYALNGFLDRYPDLKPELDKRVTPQGAGLLAELKESCVGDVILKHPLLHGSDFT
                     RDHRSILDNLREVPAAMDILDRQRIGTLTPTAPVLITSGVNDDTVPYPQAKQLANDWC
                     GKGATVTFRSNGLPPILPGMALPNHFGPEIIDGFSPTGVIPYLMDRLNDKPISGCTID
                     "
     gene            complement(91743..92510)
                     /locus_tag="NONO_c00780"
     CDS             complement(91743..92510)
                     /locus_tag="NONO_c00780"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, SDR family"
                     /protein_id="AHH14898.1"
                     /translation="MEISGSAAIITGAASGLGAATAKRFADQGATVFGLDLPQSIERA
                     GDSVPAGVTLIPTDVTSNDEVAAAVAKVVESGVPPRIVVNCAGVGWAGRILSKNGPHD
                     LELFRTVITVNLLGSFNVMRLAADAIAKTEPVDEYGQRGVVINTASVAAFEGQIGQIA
                     YSASKGGVAGMTVPAARDLAQFGIRVNTIAPGIIDTPMLAGVTEEYRKGLESGVPFPS
                     RLGRPDEYAQLAQYITEHDYLNGETFRMDGALRMAPR"
     gene            92625..93278
                     /locus_tag="NONO_c00790"
     CDS             92625..93278
                     /locus_tag="NONO_c00790"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH14899.1"
                     /translation="MTTAAERRLPRGRHGIPRETVVRTQRDRILTAMADAMADNGYVG
                     TSVAAVIKRARVSRETFYEQFRSKEDCFEAAYEQAVESLLARIQESLRLPADDATADA
                     AVPPIGALLDAYLDGLAAEPAYARLFLVEVYAAGPKAIARRAELQESFVALVARTLDA
                     RTEQQRFACRTMVAALSALVTTHIAADDPDGLHALRAPLLELVERSGDLFGAATAPR"
     gene            complement(93286..93723)
                     /locus_tag="NONO_c00800"
     CDS             complement(93286..93723)
                     /locus_tag="NONO_c00800"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase-like domain-containing protein"
                     /protein_id="AHH14900.1"
                     /translation="MALDVQITFDCADPAALAEFWAAALDYRLQDPPAGFTSWEQALD
                     AMGVPPDQRNSASAVTDPDGAGPRLFFQRVPEGKQVKNRVHLDVRAAPGLTGDDRMAA
                     LEAAAERLIARGATRLRRIEPAPPMGNGHIVMADPEGNEFCLD"
     gene            complement(93724..94302)
                     /locus_tag="NONO_c00810"
     CDS             complement(93724..94302)
                     /locus_tag="NONO_c00810"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14901.1"
                     /translation="MTDHTWNSQLREQIGWHWTNQLRPRLEGLTDDEYFWEPAADCWN
                     LHARGTGTAPIQGGSGAMTIDFAVPEPDPAPLTTIAWRLGHVIVGVLAIRNSWHFGGP
                     ETDYFTFEYAETAADALKQLDTEYARWDAGVAALGEDGLARSCGTNEGPFADYPLSSL
                     ILHVNRELIHHLSEVCLLRDLYLHTHAQEAGA"
     gene            94365..95321
                     /locus_tag="NONO_c00820"
     CDS             94365..95321
                     /locus_tag="NONO_c00820"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="AHH14902.1"
                     /translation="MTVEGTTERVLRLLSLLQRRPSWTATELADELGVTDRCVRRDVE
                     RLRAIGYPVHATAGVGGGYQLGAGTRLPPLLFDDEEATATAVSLRLAAGGTIAGAGAA
                     ALRALAKLDQVMPPRLRAEVRAVHDATATLVGPGVEIDAEVLMILARACRDAVRVRFR
                     YQGRDGGAAERTVEPVRMVTTGSRWYLMARDIDRADWRTFRLDRMSEVRATTWHFRIG
                     EYPDPVAYVQRAVTAAPYRHLARVRIRARAEQVAELVPPQIGRVESDTDGWCVLVVGG
                     DDLDWLAMHIARLGFEARVLEPPELRAAAARAARRLTAIAES"
     gene            complement(95503..96246)
                     /locus_tag="NONO_c00830"
     CDS             complement(95503..96246)
                     /locus_tag="NONO_c00830"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH14903.1"
                     /translation="MIAAIALSFGVLFLAELGDKSQLMALTFALRYRWWIVLGGITVA
                     SIAVNLIAVGVGHFLGAALPTDLIALCTGVILLAVGLWTLWDSRKEETAEDAPAATGP
                     ATPLRAFFLVISAFLLAELGDRTMFATLALASNHSWPAVWIGSVAGMVAAGGLAIAIG
                     ITVGKHIPERAIAVASGLLFLYIGAATLLGAVAPDLGKAGEYSIAAVAPVVAGAVWAL
                     VRQRAARADEDTESPALPADQHSESAERH"
     gene            complement(96592..97119)
                     /locus_tag="NONO_c00840"
     CDS             complement(96592..97119)
                     /locus_tag="NONO_c00840"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14904.1"
                     /translation="MRANNQVGVTPFQARGTLCGFVISGRWPDTTKEWAQLLALAVRV
                     ASLPGLLSTSTVFGAREELPDDPQPGTVGLVMAEGPVLGEEAVEPGRFAGHLPPALMM
                     LHPPSETSPSLPECVGAASGCVLLPGVPHLGLAHRAAWVEAELDGTVTSMVSRVGVDP
                     ISDPDTAVLAMLLAA"
     gene            complement(97330..97953)
                     /gene="sodA"
                     /locus_tag="NONO_c00850"
     CDS             complement(97330..97953)
                     /gene="sodA"
                     /locus_tag="NONO_c00850"
                     /EC_number="1.15.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe/Mn superoxide dismutase"
                     /protein_id="AHH14905.1"
                     /translation="MAEYTLPDLDYDYGALEPHISGQINEIHHSKHHAAYVAGVNTAL
                     EKLEAAREAGDHGAIFLNEKNLAFHLGGHVNHSIWWKNLSPNGGDKPVGELAAAIDDQ
                     FGSFDKFRAQFTAAANGLQGSGWAVLGYDTLGQKLLTFQLYDQQANVPLGIIPLLQVD
                     MWEHAFYLQYKNVKADYVKAFWNVVNWADVQDRFAKAVAQGKGLIFG"
     gene            complement(98157..98765)
                     /locus_tag="NONO_c00860"
     CDS             complement(98157..98765)
                     /locus_tag="NONO_c00860"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14906.1"
                     /translation="MDASRALLDGLDTAGLNTALSEATCLGLAVDAADARLRIELEVL
                     TLPGDGKSADNRVLLTLSGVSRVAASLRQQRWDDLEPHIFPLTLDTLGDAIAGFGGSA
                     MHGWDFIDVDDSGWALWRELLSFDTTIGDHPVGHVLEFSQQEGTDPRELDVRIWFEEL
                     TVETAAGTLLGVDEFVAGARRWWKAHDSCDPRTMLPDVAPPM"
     gene            99224..99598
                     /locus_tag="NONO_c00870"
     CDS             99224..99598
                     /locus_tag="NONO_c00870"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese-like domain-containing protein"
                     /protein_id="AHH14907.1"
                     /translation="MTSSEIPSVPVQDLPAEFDAAPVAGVESGAAAILLDVREDDEWQ
                     LGHAPAALHIPMVDVPARLDELDYDCDVYVVCRQGGRSIEVAKYLAHVGFEVYQVVGG
                     MVAWQQAGRPLHADGDHEAKIY"
     gene            99654..100655
                     /locus_tag="NONO_c00880"
     CDS             99654..100655
                     /locus_tag="NONO_c00880"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14908.1"
                     /translation="MSSTVVQPCARCGARWAVHGAPMHWCPRCRGVLLSPAPVDAPPE
                     RRNYRWVARPPGRGPRPERRRSGGAIEPPTPHYTEIPRWGLHDVPRPERDVEHTRAQR
                     ALRWATERVAGLMLAAIILFALAAVSELGRYLILLRNRTRLIEPVVLFLSDLTVYATA
                     LAALICALVAAVGLLGWLARARADAYAANGHRDPRSLRALLCGGLIPVVNLVWPGVFL
                     TELVRQQGGDPRTLRAVRIWWSLWVLNGVMVIAALFWRLADTLQARANGVIFTVYTDL
                     VAVAVAVSALWVLRMCEGRDLRGRIRMPKRWLPAPGPAVQVIEPVHPVADKEEVMAK"
     gene            100652..101419
                     /locus_tag="NONO_c00890"
     CDS             100652..101419
                     /locus_tag="NONO_c00890"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glycerophosphoryl diester
                     phosphodiesterase GlpQ"
                     /protein_id="AHH14909.1"
                     /translation="MSQGNRAPFVVAHRGASGTRPEHTLAAYEQALEEGADGVECDVR
                     LTRDGHLVCVHDRTVDRTSSGTGLVSEMTLDELRDLDFGEDGAPAPVLTLSELITLVL
                     DWRSRPTKLFIETKHPVRYGALVENKVLAELQRFGIATPASADHSRAVVMSFAATAVW
                     RIRRAAPLLPTVLLGESSRYLGGGAATTVGATAVGPSVKTLREHPELVDRAAAAGRAT
                     YCWTVDEPQDVELCAELGVSWVATNHPGRTKNVLDGI"
     gene            101489..102415
                     /locus_tag="NONO_c00900"
     CDS             101489..102415
                     /locus_tag="NONO_c00900"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14910.1"
                     /translation="MGKSKRNQPKPDSNRAQRLAERRAAQQEAAAVVTRPFAGLAAEC
                     DLVALREFVPSATATLSLAPGVTAERPVTLATVLPGAVAALVRAGDQPTGFVGAQVQF
                     QSADPAADLAASVLWTQAAEPGESLNAASEYELDPVPALTEVIDPKAELDLTVHQNFQ
                     WWVPEGVQPDPQVAATIEQADQAIMPSDRLALGPESVGAAWWVDAGEKAHVRWVRPED
                     EDALMLALARVHAAGGLHLGEGSRFAGSFRTHGLLVPVFDLDRERHPSEWVAPATEFG
                     ARLAEALASDTPLTSEERRSRDGLRSRQVTLR"
     gene            complement(102502..103086)
                     /locus_tag="NONO_c00910"
     CDS             complement(102502..103086)
                     /locus_tag="NONO_c00910"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ferritin"
                     /protein_id="AHH14911.1"
                     /translation="MTVALTSANVGVMFSDTDSSHTKFHALLHDQIRHEFNAEHQYIA
                     IAVWFDNADLPALSKLFYAQAVEERNHAMMIVRYFLDRDMAVELSGVDGAVSQFDSAR
                     EPIHLALQQEKTVTEQMIQLASTAREEGDYLGEQFMQWFLKEQVEEVARMSTLLTVAE
                     RAGTNLFDLENFVVREMSGPSDSTGAPAAAGGNI"
     gene            complement(103245..104297)
                     /locus_tag="NONO_c00920"
     CDS             complement(103245..104297)
                     /locus_tag="NONO_c00920"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="AHH14912.1"
                     /translation="MPYREGREAPPPPPPSRPRKADRPPREPRQPRARRKRHWGRWLL
                     ILLLIIILLPAAGVIYLDRSLHRIDALSGYADRVGQTAGTNWLLTGSDTRVGLTPEQE
                     QQLSTGGAADAGGDRSDTIMLVHIPKSGKATIVSLPRDSYVNIPGVGKDKLNSAFSAG
                     GQKLLVQTVETATGLRIDHFAEIGFGGFAGMVDALGGIDMCLPDPIDDPKAGINLQAG
                     CQRLSGAEALGFVRTRATPRADLDRMNNQRLFLSALLAKATSTSTLVNPLKLWPLATG
                     IASSLQVDNGDHIWDLGRLGWALRGGTVATTVPIGGFADESGSGNVLLWDKSRASQFF
                     DALAHDRPVPDDLITK"
     gene            complement(104778..105572)
                     /locus_tag="NONO_c00930"
     CDS             complement(104778..105572)
                     /locus_tag="NONO_c00930"
                     /codon_start=1
                     /transl_table=11
                     /product="CAAX amino terminal protease family protein"
                     /protein_id="AHH14913.1"
                     /translation="MVPAARSAPSWPAPASDRERFAIRVEIAIVLVITFGSSGLSAAL
                     SLLESALAPGGVGGQKVALNPSRATQSTIDLLFQLLSVTRLVAWGALGLYLLWRSGIG
                     PRLVGLARIRLRGDVVPGLVLAAVIGLPGLGLYLAAHALGLSVTIVPSSLHDHWWRLP
                     VLVLSAIANAVAEEIVVVGYLITRLRALGWSENRSLAASALLRGSYHLYQGLGGGLGN
                     LVMGVIFGRYWQRTGRLWPLILAHATIDSVAYIGYTALHGHVSWLP"
     gene            complement(105670..106443)
                     /locus_tag="NONO_c00940"
     CDS             complement(105670..106443)
                     /locus_tag="NONO_c00940"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14914.1"
                     /translation="MRRTITSAAPSAAERIRSACAHAENSVLALPGTDPIPTTVHHLR
                     ACGDVVIAVARNSAAVAAAAAEVGSPGVLELTDHAPLRLREPVRALVWLRGRVRAVPG
                     HAQRALASQVASEFPHPGLLDVGHTATLLRVVLESAVVADSTGAESVCPHDLRSADAD
                     PFWELESAWLQHMDSDHADVIARLARHLPVRLRSGSVRPLAIDRYGVTLRVEGPDTDH
                     DVRLPFHAPVDDVQSLSRAVRILAGCPFFDRLHGSDRPA"
     gene            106525..106983
                     /locus_tag="NONO_c00950"
     CDS             106525..106983
                     /locus_tag="NONO_c00950"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14915.1"
                     /translation="MRKHCARYGEKVPHDSTPAPEPVLVSLSVPVARADLVRDLVRSP
                     SAQPRVPVLDLDLPDERIAEFLVGAAHAAPSESGFVAITNSGERAVALVAATVAALCG
                     EDIRAALTTPDIAFLRGLGGPAIQALREILLAIETEQVDAVTEALDVLRP"
     gene            107132..108052
                     /gene="pheA"
                     /locus_tag="NONO_c00960"
     CDS             107132..108052
                     /gene="pheA"
                     /locus_tag="NONO_c00960"
                     /EC_number="4.2.1.51"
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydratase"
                     /protein_id="AHH14916.1"
                     /translation="MPRIAYFGPSGTFTEMALAQLESARTFDGPVERIAAPSQGATLE
                     MVRDGAADGAVVPIESSVEGSISATLDALATGPRLQIVAETELDVAFTIVGRPGIELA
                     QVSTIAAYPVAAAQVRLWLADRLPQARLYTSASNAAAAEDVVAGHADAAVSTTLAGER
                     LGLTTLATGVADHDQAVTRFVLVTAPRQAPARTGTDRTSLVVLELANEPGSLMRVFAE
                     FATRGVDLTRIESRPTRTGMGTYRFYLDCVGHIEDTAVAEALKALHRTAGRIRYLGSW
                     PASSPSGSPPPADGPAAAWLDDVKKGVDAS"
     gene            108049..108774
                     /locus_tag="NONO_c00970"
     CDS             108049..108774
                     /locus_tag="NONO_c00970"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphoglycerate mutase"
                     /protein_id="AHH14917.1"
                     /translation="MSEFRESAAISDPGRVPGRLVLVRHGETEGNVAKVLDTRVPGLP
                     LTERGVAQAKSFASRLIVPPTRLYSSVALRARQTATYIESGTGVSAEVLDGVYEVQVG
                     ELEGLGSDAAHQEFQRVYRSWHVGELNSRLPGGESGEEVLERYLPVVEQLRANHLGPA
                     SRSGDEGSGDVLLVSHGAVMRLVARELTGVAPPFTTNNHLDNTETIELLPTADGGWTC
                     VRWGRYTPPFGPSTQPSPDDPMG"
     gene            complement(108776..109609)
                     /locus_tag="NONO_c00980"
     CDS             complement(108776..109609)
                     /locus_tag="NONO_c00980"
                     /codon_start=1
                     /transl_table=11
                     /product="EspG family protein"
                     /protein_id="AHH14918.1"
                     /translation="MTILGEGRGSAALESVVLSLDEFQFLMEELELDEMPVVLDSIGR
                     YDNDLDHNAAMKAAAESLTARDLLVDGAVHRDLEDRMRGLYRPHWVIAMRWYVGDRVN
                     RFCLAKGDDIDVVVLRGPDSYTIDEAGHDLPGTIMAALGPAEPLELDGMNVLTEELKP
                     ILGDAGDAAATTQRLSRVGRPPRDAQALGSALVEILSHASIVGVVYNDASRDVSDGMI
                     AVYNTRNGRFIGVTTRSDDEIMWTSLAGGTPGRLRTAIRDLIEKLPLREDFKPITPGV
                     I"
     gene            complement(109610..110770)
                     /locus_tag="NONO_c00990"
     CDS             complement(109610..110770)
                     /locus_tag="NONO_c00990"
                     /codon_start=1
                     /transl_table=11
                     /product="PPE family protein"
                     /protein_id="AHH14919.1"
                     /translation="MTAGLTGIYFMPRLAEGNSSLLTAGPHAIPASAAATAWGGLTAA
                     WVDATATAARVMAELGVGMVGVNGTVALAKLAGFTGWAEQQGVQAAAMAAKASAHATA
                     NTVASLAMPSLPEIAAVDSARVAAHAHGGDLDGSAEIAESAKLALDIQAALVMDTYES
                     TVEAMMATPAEFAPPPPIAAGAGLADSGAESAAQTNGDPVQTAVAAAQALASNPSVIS
                     TATQVANAAGSVASTGVSTVGNAAGTAIAAATHTGTASTMSPMMMGGIGGVAVAGGAA
                     ATRAVSFSGATVGIGNGAGTLKLPEGWGAGNVIGETAAPQVAATSPSQLSAPAPARAG
                     NPSGNPLLGRQVHGDDDEGEHSGNDYLRGEHFADGRIIAAGVIGGGNPVEDR"
     gene            complement(110822..111133)
                     /locus_tag="NONO_c01000"
     CDS             complement(110822..111133)
                     /locus_tag="NONO_c01000"
                     /codon_start=1
                     /transl_table=11
                     /product="PE family protein"
                     /protein_id="AHH14920.1"
                     /translation="MVGLLGVQPEVVLAASAELDLLAERLAAASALSGPATHVIPAGA
                     EEVSAMAATHLNEGALSHDRAVAQAILELHHAAAILRTQLASFIADDAIEAAGTAAIQ
                     F"
     gene            complement(111335..111676)
                     /locus_tag="NONO_c01010"
     CDS             complement(111335..111676)
                     /locus_tag="NONO_c01010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14921.1"
                     /translation="MSPSRFEELVGDALDTIPSALTAAIDNVVILIEPRDPDDPHLLG
                     VYRGIALTDRVDSQYGGALPDTVTIFRDTILELCEDERQVVEEVAITVIHEIAHYFGI
                     DEERLHELGWG"
     gene            complement(111694..112878)
                     /locus_tag="NONO_c01020"
     CDS             complement(111694..112878)
                     /locus_tag="NONO_c01020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14922.1"
                     /translation="MSSDDGAPEAPEPENETSDMLRRGRAGAKRRRSSTGGRRRSRPG
                     DDEPDGPLDAEAEKALHPHRLRWGLLAVAVGAVVAALVTLSITGFRSSHGLAAHDPGS
                     GKPPGRADAAFGAAKTGDCLTWTSAKTLDLTKVNCADKHLFEVTSDIDLGRYPGREFG
                     PGSAFPDSLRFAELRDEHCAPAAAAYLGGRLDPRGRFVVGMVNPGEPGWRNGDRTIRC
                     GLQLVSATGNATQQTVGRVRDSDQSRIFDPGTCIGINQNLPTNEPVPCGQPHAYEVMS
                     TVDLGTHFNGGPPANSDQDSFMQDECARASGDYLGGQDALINKTLTIFWDNLDARSWL
                     VGSHKLNCLVGKGSQDGFSTITGSAKGDVLIDGQAPVPPPSSGRSTPAPLPGAAPAPV
                     PN"
     gene            112965..114227
                     /gene="serS"
                     /locus_tag="NONO_c01030"
     CDS             112965..114227
                     /gene="serS"
                     /locus_tag="NONO_c01030"
                     /EC_number="6.1.1.11"
                     /codon_start=1
                     /transl_table=11
                     /product="serine--tRNA ligase"
                     /protein_id="AHH14923.1"
                     /translation="MIDLRFLRENPDAVRASQRTRGEDPALVDALLEADAARRAAVAT
                     ADNLRAEQKALGKKVGKASPDERPALLAHAQELSAKVKEAEAAENAADAELDTAHRAI
                     SNVVQEGAPAGGEDDFVLLETVGTPTEFDFTPRDHVDLGESLGLFDMERGAKVSGARF
                     YFLTGYGALLQLGLLQLAAQRATANGFTMMIPPVLVRPEIMAGTGFLGQHSAEVYHLD
                     DDDLYLVGTSEVPLAGYHSGEILDLSAGPKRYAGWSSCFRREAGSYGKDTRGIIRVHQ
                     FDKVEMFVYCRPEEADAEHRRLLDWEKEMLAAIEVPYRVIDVAGGDLGSSAARKFDCE
                     AWVPTQQTYRELTSTSNCTTFQARRLSVRYRDENNKPQIAATLNGTLATTRWIVALLE
                     NHQRADGSVRVPAALVPFVGREVLEPPR"
     gene            114373..116169
                     /locus_tag="NONO_c01040"
     CDS             114373..116169
                     /locus_tag="NONO_c01040"
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain/EAL domain-containing protein"
                     /protein_id="AHH14924.1"
                     /translation="MVMARTTGAFYVMGGVLGLLITAIAPGDEGNRPLVGSAAAVALL
                     LGVSLLIWGPRLPHSVHHAYVAVATVLVTIAVHWFPNTVGGITLAAFYVFVAADAAIF
                     FAWRQAAAHVVFAMALCLWVVPSRGLPWWSGIIPAGITVGVGIVVGILTRMAADADID
                     TLTGLLNRRGFDRALNSAIGNAGRNGHGLALVLVDLDRFQKINDHLGHRAGDAVLQRV
                     ADSWSKLLTPDQVLARYGGDAFALLLPGTTEQAAILLTEELRAAITTGCSAGVTSWQP
                     GESGSLLVSRADVGLYRAKQAGRNRTVLESSRQQPLAVELREAIDTGALDVHYQPIVS
                     LGEDGAQAVGVEALLRWSSNAQPDVTTEGLIRVAEEYDLISDLDELVLRRACADAARL
                     QETFAQLDLTLNVNVSGLELAESDYAERVSGILADTGWPADQLVLEVTESELAAESQT
                     AIQNLHQLRDNGVRIAIDDFGTGYSSLSRLATIPSDILKVDQSFVAAIRSDSPAPPLL
                     GVIAALSKSLDLQVIAEGVETEYQAAVLTELGFALAQGYHYSDSHPVSELIGDMNANR
                     GLVGAVDKDFAAQGWIPMDNNGFDPKGLGHPG"
     gene            116242..117234
                     /locus_tag="NONO_c01050"
     CDS             116242..117234
                     /locus_tag="NONO_c01050"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH14925.1"
                     /translation="MIARAVRTSPRFDVRRRLGVVLGLSCGAGVAVQARINGDLGDRL
                     NDGIAAAVISFGSGLVVLLIACCFSRRMRSGLDAIRRSIRTGPLRWWQLLGGLCGAFF
                     VASQGLSVATIGVTAFTIAVVAGQLTSGLVVDRLGVGPAGVTPVTPVRFGAAALAIGA
                     VGIAALGRSEGASGPTGGVAYLLLVLPALAGLGLAWQQAVNGRIGTVGGPLPATTINF
                     ATGTAALLVVEAVQIARIGWPTSFPTAPWLYAGGVIGVFFIAVAALIVRWIGVLVFGL
                     TSVSGQLVTSLILDVVLPAGPGLSIAAVIGCALTLVAAVIAVSRRPDSAANERE"
     gene            complement(117246..117842)
                     /locus_tag="NONO_c01060"
     CDS             complement(117246..117842)
                     /locus_tag="NONO_c01060"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH14926.1"
                     /translation="MPETEKSGSSRRSERSRQAILAATRELLSEVGYRKVSIESIAAR
                     AGVGKQTIYRWWPSKGAVIFESFLAVGDADGDGVVLPDTGDIEADLKLVMRATVAEFA
                     DPEFERPIRALNTEIINDPELAEQYNRLLSTPMDEAKKVRLRSAQAAGQLPTDADLDL
                     LLEVLYAPLYQRWLLRSGPLDETYADALVETALRAFRP"
     gene            117957..118778
                     /locus_tag="NONO_c01070"
     CDS             117957..118778
                     /locus_tag="NONO_c01070"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, SDR family"
                     /protein_id="AHH14927.1"
                     /translation="MTTAKVWFITGASRGLGRAFTEAALAAGDRVVAAARDIEPLAAS
                     AAEYPGHLVPLALDVTDRKAVFAAVERAVSAFGRLDVVVNNAGAMLYGMVEEATEEQA
                     RAHLDVNFFGAVWVVQAVIPHLRAQGHGRILQITSMGTAGGMAAVGFYGAGKAALASL
                     TEALAMEVEPFGVRVTNVEMGGYSTGLFTTGTTATAARPEYESLRAELARMWGDEAGP
                     DPSTAAPVITKLAELPDPPRYLVVGGTSFDQVRDLYTARAEGYREWEELSRLAPG"
     gene            complement(118856..120412)
                     /locus_tag="NONO_c01080"
     CDS             complement(118856..120412)
                     /locus_tag="NONO_c01080"
                     /codon_start=1
                     /transl_table=11
                     /product="rieske (2Fe-2S) iron-sulfur domain-containing
                     protein"
                     /protein_id="AHH14928.1"
                     /translation="MQITSVGHAGFHIRTAAGTILCDPWVNPAYFASWVPFPDNTGLD
                     WDELGNCDYLYVSHLHRDHFDAQNLLDHVNKDATVLLPDYPVPDLQRELEKLGFHKFF
                     ETQDSVKHTITGRDGHELDIMIIALRAPADGPIGDSGLVVSDRETVCFNMNDARPVDM
                     DVLHEQFGHIDIHLLQYSGAIWYPMVYDIPAKTKANFGKQKRQRGMDRARSYIEQVGA
                     TWVVPSAGPPVFLDDELRYLNDDGENRYSTDNGNIFPDQMVFLEQMRIHGNDGGVLMI
                     PGSTADVRGKELELTHPFDPAEIYDDKAGYIERMAQRLAPAIEREKASWASADGAPLL
                     PQLKELFEPIMAQSDLICDGIGYPVGLVMGDETVVLDFPKRVVREPIAGEGKYRYGFR
                     IAPQLVRTVLRDNEPDWVNTIFLSTRFTTWRIGGYNEFLYTFFKCLTDERIAYADGWF
                     NEAHDDSASCEIAGWEIQRRCPHLKADLSKFGVVEGNTLTCNLHGWQWDLESGRCKTS
                     KGHELRSRKV"
     gene            120626..121189
                     /locus_tag="NONO_c01090"
     CDS             120626..121189
                     /locus_tag="NONO_c01090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14929.1"
                     /translation="MRDEVLPTLADMPGCIGMSLLVDRQSGRCIATTSWESEDAMRES
                     TDRVRSVRDSAVRLFGADNARVEQWEVGVMHRDHHLPEGACAQLTWAKATDPSRFDMA
                     VESYRSMAAQQLEQLPGFCSTSLLVDRVGGRGVACETFDSRDAMEHNREQLATLRREG
                     TRRAGVDVLDVGDFEIALAHLRVPELV"
     gene            complement(121250..122119)
                     /locus_tag="NONO_c01100"
     CDS             complement(121250..122119)
                     /locus_tag="NONO_c01100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14930.1"
                     /translation="MAVGVAIVVAGVLAGCDSNVGIEGTDYHRDSGSAATQSAAPRPT
                     TAAMDPVAPGPAPADRPAVTVALATDDAQATAAVGRWAADLENLTPAELEAKCWTMAP
                     RNVDEMYSDKAAITAALARPGIDNGTAIEWKSVPGATSPVTVVAEHTDIATGYACPRV
                     YPSGTEIGFGTSTESQTADARHLVRRYLARRTGHPLDAADQESTHPLLCASGTGWDPN
                     GTGRAARAPLASNPNKLAAPTAFSDQSLSSTQLNNAYLSITATVTADGVQQDRTYTVK
                     ATEQGYCIGDVSA"
     gene            122249..123037
                     /locus_tag="NONO_c01110"
     CDS             122249..123037
                     /locus_tag="NONO_c01110"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 1-acyl-sn-glycerol-3-phosphate
                     acyltransferase"
                     /protein_id="AHH14931.1"
                     /translation="MEPVYRTIIGLARTVFFVQGLKFEVTGAENIPAEGGAVITINHT
                     GYMDFTYAGLPARTPKRYIRFMAKKEVFDNSISGPIMRALRHIPVDRGAGADSYKAAV
                     DYLRRGELVGVYPEATISRSFEIKEFKSGAARMAVEAGVPIVPMTIWGAQRVWTKGYP
                     KRLGRTNTPISIAVGKPIVPPVDADEKAIAELTETVHATMQEMLLGLQQGYQHEPGAY
                     WVPARLGGGAPTLAEADAMDAAEAKAKAEARAARRAEEAGNTDT"
     gene            123065..123820
                     /locus_tag="NONO_c01120"
     CDS             123065..123820
                     /locus_tag="NONO_c01120"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 1-acyl-sn-glycerol-3-phosphate
                     acyltransferase"
                     /protein_id="AHH14932.1"
                     /translation="MTREPVFDVLTGLVRTIFLVQGLKIDIVGGEHIPRTGGAVLAVN
                     HTAYLDFMEVGLVGRESGRNVRYMMKAELEHGIVGWLMKQCKAIGVDRTAGAESFGRA
                     VTSLRDGEIVVVYPEATISRSFELKEFKSGAARMAIEADVPIVPMTIWGAQRVWTKDI
                     PKQLGRNNFPVNIRIGEPIPPHEPADALTAELRSSMEKLLDLAQQDYDMPKGARWVPA
                     RLGGTAPTPERAKVLEQEELERRRAAKARRAQQ"
     gene            complement(124005..125468)
                     /locus_tag="NONO_c01130"
     CDS             complement(124005..125468)
                     /locus_tag="NONO_c01130"
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="AHH14933.1"
                     /translation="MVVGMERSFQSAEELLAALRAGAVTSVELTDEAIDRIERDDKAI
                     NAICVPTFERARAEARAADEARARGEDRPLLGIPVTVKESYNMAGLPTTWGLPAFRDY
                     VPAEDAVQVTRLVEAGAVILGKTNVPPMLQDLQSFNEIYGVTNNPWDHGRSPGGSSGG
                     SSAALAAGFGALSIGSDIGGSLRTPAHFCGIYAHKPTLGLVATRGMVPPNVPALPTEQ
                     DLAVAGPMARTARDLTLLLDVMAGPDPLTRGIAYDLALPAARHERLGDFRVLILEDHP
                     LVPTGSAVRAALHRVSDALTTAGARVERTSPLLPDLAEAATLYTQLLVANVSANMPAE
                     RFEQIQTAAAALPADDRSSAATWLRTMTSTHRDWLVANTRREQFRDAWRQFFTQFDVV
                     VCPITPTPAFPHDHEVDLLEREIDIDGTRYPFRDQIAWAGLATMPGLPATAIPAGRSP
                     EGLPVGVQLVGPMFEDRTPLRLAELLEPVLGGFEQPS"
     gene            125776..126639
                     /gene="dhmA1"
                     /locus_tag="NONO_c01140"
     CDS             125776..126639
                     /gene="dhmA1"
                     /locus_tag="NONO_c01140"
                     /EC_number="3.8.1.5"
                     /codon_start=1
                     /transl_table=11
                     /product="haloalkane dehalogenase"
                     /protein_id="AHH14934.1"
                     /translation="MLIDFVPDRTLYPFESRWFDSTAGRMHYIDEGDGPPILFCHGSP
                     TWSFLYRDIVRNLRDRYRCIAVDHLGFGLSERPAEFGYTIAEHTVVLGELIDHLRLDG
                     LVMMGHDWGGPIGLGAVTARADRVRGITLGNTMFWPIDALANRAFSAVLSSGPMQRRI
                     LERNFLIERVLLAQVGSKLSAAEADHYRAVQPDPPARPGLAVMPREIRAARPFLDRLA
                     REVPAQLGDKPTLAVWGMRDMAFRPKTCLPRIRDTFSDLEVLELPNASHFIQEFEPDT
                     ISAAIARRFPH"
     gene            complement(127312..127791)
                     /locus_tag="NONO_c01150"
     CDS             complement(127312..127791)
                     /locus_tag="NONO_c01150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14935.1"
                     /translation="MNQSPISEPTDTAFGRRDYYRKRFDLPASVEPYANRIIVKVGAI
                     AAITMPEILGKWVLEALVARGTESGPVILHTRTRRWTFLLEPDIAFEDYELYAEMYRR
                     SVTIAPVGASVALPAPTDPEDGYRTWKVLPPSMFRPSAALLVEIIRDCARQHRGGNE"
     gene            127920..128036
                     /locus_tag="NONO_c01160"
     CDS             127920..128036
                     /locus_tag="NONO_c01160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14936.1"
                     /translation="MGTRKNDVKVQVRSRKACETVPDSGADDDPKGEHHDRA"
     gene            128023..128976
                     /locus_tag="NONO_c01170"
     CDS             128023..128976
                     /locus_tag="NONO_c01170"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding protein"
                     /protein_id="AHH14937.1"
                     /translation="MTERDSSITRRQLGRYLREAREAVGMRLEDAAALMEWGKSSLHR
                     LEKGQNQKVRIGDLDGLIEIYGIEDELADALRRLAQQTAGKSWWDEIGGFVPANFSVY
                     LGLEAGASTLRSYQSCIVPGLLQTADYARVLVRDCCPNENDDQIGGRIAIRMRRQTLV
                     SRKRKPVRLEVVLSESALYRTVGSHRIMAHQLRHIADMSTRPNISVQVLPFDAGMPTG
                     YQVGPFVILDFDTGPRGRTAPPTTVYSEGFTSDMYSEKVGVIKEYSRAFDTFRKAALS
                     EVDTRGLLRAAARNHASAPRRSGPQGLCATTEEGASIASLL"
     gene            129011..129205
                     /locus_tag="NONO_c01180"
     CDS             129011..129205
                     /locus_tag="NONO_c01180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14938.1"
                     /translation="MSTNEVWFKSSRSGGDKECVEVAFLGGGLTGVRDSKNPAGPALV
                     FSPRDWDAFVDNATHGMFDR"
     gene            129591..130826
                     /locus_tag="NONO_c01190"
     CDS             129591..130826
                     /locus_tag="NONO_c01190"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily transporter"
                     /protein_id="AHH14939.1"
                     /translation="MIEVLRHPQFRRLFTAQVVALAGTGLLTVALGLLAYDLAGRGAG
                     AVLGTALAIKMVAYVVVAPVVSAAAERVPRRGLLVSADVIRLGIALMLPFVGQIWQIY
                     VLIFVLQSASATFTPAFQAVIPAVLPDERDYTRALSLSRLAYDLESLLSPVLASVLLV
                     VASYHRLFLGTALGFAVSAIMVIGTPLPRLMPADRSIPLVRRMTRGAAIMSARPELRG
                     LLAMNLAVAAATALVIVNTVVYVRDLLHGPAWAVGFALAVFGGGSMVTALCVPGLVGR
                     VPDRQLMLTGCAILPVGLCAAMMLPVAPIGWRWVLLVAIWAALGAGTSLINTPSARLL
                     RAGSDSDTRTAVFTAQFSLSHACFLVTYPIAGWIGAALGQFTASAVLAMLATLATVTA
                     ARVWPVGIASDAERVSTGA"
     gene            130826..131191
                     /locus_tag="NONO_c01200"
     CDS             130826..131191
                     /locus_tag="NONO_c01200"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, ArsR family"
                     /protein_id="AHH14940.1"
                     /translation="MDAADGPVAPGASLEHPVSIDRAHLEAATSAFAMLADPTRLHIM
                     LLLAAGESDVTALTAACGASRTAVSQHLAKLRFTGMVDTRREGRHVIYRIRDGHLARL
                     VREGFNLADHIVTGEPPHA"
     gene            complement(131192..132586)
                     /locus_tag="NONO_c01210"
     CDS             complement(131192..132586)
                     /locus_tag="NONO_c01210"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily transporter"
                     /protein_id="AHH14941.1"
                     /translation="MRQEIHSRAAMIALALGVLSYGLMQTMLVPAIGIIQHGLHASST
                     AATWAVMSAPLLSSAILTPVASRLGDRFGRRRVLLWVLVAYLAATLLAMAAPDIGVLI
                     AARAGQGISLAILPLAFGTVPSVLPPERVHGGLGLLSGLVGGAAGIALVCGGLIVDHG
                     SWRWLFVVGAGLVASALVLTYRFIPADDGQPTGGSDPIGTVLLAAGLAGILLALTVGP
                     TSGWFSAAVWLLFLGGLGALAAFAAVERRSRNPLIDMELVLHRPVGIVHLAAFVLGAV
                     QFMYYVLVPRLTESPHAAGGFGDSVTIAGLVMLPSTLLVLPASAVTGRLIARRGPRVP
                     LTAGLLLTALGAAFLAAVHGHPWQLALCALPIGIGTGLVMAALPAQIHRTVHPSRAAT
                     ANGINTIARTIGGAVGSQLGAAMVLHSLGTGFPAAFWVATVIGLAGAATVFAGSASEN
                     DRAPVESVASAVRR"
     gene            132893..133483
                     /locus_tag="NONO_c01220"
     CDS             132893..133483
                     /locus_tag="NONO_c01220"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH14942.1"
                     /translation="MRAEPLSRAGIVAAARRIADAEGLAALTLRRVAQELGTGQASLY
                     RHIADRRELLALLNEDLARSFPVVHKGTPRARLTAQWLGAHRVLLEHPWAAGVVTDAS
                     TSTAAALPFAESALAALLAADLDPATAAHTYRALWHLLIGHVVNEHPLGHPGIDLDPE
                     TYPALTAARPYLSRDAATEFEWALRNLLDQVLRPRK"
     gene            complement(133783..134439)
                     /locus_tag="NONO_c01230"
     CDS             complement(133783..134439)
                     /locus_tag="NONO_c01230"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH14943.1"
                     /translation="MISGTGHPLAYPVLTTIGALVICLAWAPFADSEQLAALAAVGLV
                     VLAYSAFRFAVACGRVPWPTVPAGDFRVKRIRQQHRLSSRSWLECTSGGRTRWVPVYF
                     DPVLVTMVESDASFGDTAVVSGHHLFPAGRVRDAEPPGRLIDNPARTDPDGPTHAAAA
                     THFGRRLLLDAQSAVAAPFIALFWIYVAGGGLPGFVGATVVAAAVALWYAAISGSDPS
                     "
     gene            complement(134436..136115)
                     /locus_tag="NONO_c01240"
     CDS             complement(134436..136115)
                     /locus_tag="NONO_c01240"
                     /codon_start=1
                     /transl_table=11
                     /product="putative peptide ABC transporter,
                     substrate-binding protein"
                     /protein_id="AHH14944.1"
                     /translation="MRIRSTMTRIAIPAVAIGMLLSGCGGATTGTGTSNLGTTSDINP
                     HDVADLRDGGNMRIPITEFPQNWNTLNIDGNQIDFSTVERPMMPQAFRVDAAGVPQLD
                     TDYFTSVELTGTDPQQVTYTINPKAVWSDGSPITWEDIASQAEAMSGRNPEFAIAGNG
                     GFDRVAKVERGVDDRQAVLTFSKHYGEWKGQFAGNGFLYPKSVTSTPDAFNKSIANEI
                     KVTSGPFLVQSTDRTQGRITLARNPKWWGAPPKLDTITFTVLDQPAWVQALQNNELDA
                     TGISGIADRADLATAQSISDVSILRSPSVQWSHLTFNGAPGSILADPKVRVAIAKAID
                     RQGIANAIQNGLVADPKPLNNHVYVAGQKGYQDNALPFDPDAAARELDAAGWKLNGDV
                     REKDGRKLEIRDVMYNQPSWVQMAQIMQQTLAKIGVKLTIDTRPAQGLFTNVFQKGDF
                     DLAQFSWVGDPFPLGNINQIWGYDPNSMQGNFGRIGSPELNAQIERTVSELNPDKAIE
                     LANETDKQIWAEGHSVTLLQSPGIVAVRSNVANYGAFGLATPDWTKVGFLK"
     gene            complement(136148..137824)
                     /locus_tag="NONO_c01250"
     CDS             complement(136148..137824)
                     /locus_tag="NONO_c01250"
                     /codon_start=1
                     /transl_table=11
                     /product="putative peptide ABC transporter,
                     substrate-binding protein"
                     /protein_id="AHH14945.1"
                     /translation="MQIRTRALRLAVAVVAASVGIAVVGCAPIDTASGPNALGESNDI
                     NPQPRDAVREGGNLRLVVDEFPVNWNALSTDGNVLDTAEIVWPLMPRSYLIDAAGRTT
                     INHDYFTDIQLTGTAPQQVTYTINPKAVWSDGSPITWEDIASQAHALSSADTRYLIAI
                     NNGFDRVEKVERGVDDRQAVITFKQPYTDWRGQFAGNAMLYPKSVTADPESFNHALAD
                     KITLTSGPFVVQSTDRTQGRITLARNPKWWGDKPKLDTITYSVMDQSTYAAALQNNEL
                     DAARLTSIEDLATVRTNSDLVVRHAPGNLWRHITFNGAPGSILADPKLRVAIAKGVDR
                     QSIASAIQNGLVSNPKPLNNHIFVQGQEGYQDNSFPFDLDAAARELDALGWKLQGDVR
                     VKDGRKLEIRDVMYNDPTWVRVAQIIQGDLAKIGVKLNIDIKPAQGFFSDWMIPSNFD
                     VAQFQFSGDAFPIGAIPQIYAYNPDDEQSNFGRIGSPELNTLIEQTLDELDPQKAIAL
                     ANQVDQQVFAEGFSLPLTQDPGNYGVRSTVANYGAPGLASYDYTKIGFVS"
     gene            complement(137833..139686)
                     /locus_tag="NONO_c01260"
     CDS             complement(137833..139686)
                     /locus_tag="NONO_c01260"
                     /codon_start=1
                     /transl_table=11
                     /product="putative peptide ABC transporter, ATP-binding
                     protein"
                     /protein_id="AHH14946.1"
                     /translation="MTDRTTTTPLLEVSDLSVSFPGEQGRIDAVRGVNYTVADGEVLA
                     IVGESGSGKSVSSLAVMGLLPEQARVRGSIRLRGKELLGMGDKQLSALRGARISMVFQ
                     DPLSALTPVYRVGDQIAEALLAHKKMSKSQAADRAVELLDLVGIPEPAVRAKAFPHEF
                     SGGMRQRVVIAMAIANDPELIICDEPTTALDVTVQAQILDLLRKARDITGAGVVMITH
                     DMGIAATLADRIAVMYAGRIVENAPAAELFNAPRMPYTVGLLGSIPRMDGPARVPLIP
                     IVGAPPAMNALPPGCPFAPRCPVSIDDCEQAEPPLQDTTPGHRAACIRTAEVGTEALF
                     TAYRRETDSVTATAETADSDMVLKVSGLTKIFPITSGVVIKRRTGEVRAVDGIDFEVR
                     TGRTLALVGESGSGKSTTLTQVMDLVKPEAGSIEIFGRDVATLTKQHKREIRRKLQIV
                     FQDPSSSLDPRMPIFDALAEPLRIDGRSRDEIRKRVPELLKQVGLRAEHADRYPADFS
                     GGQKQRINIARAMALDPRLLVLDEPVSSLDVSIQAGVLNLLRDLQAERGLSYLFVSHD
                     LSVVRNLAHDIAVMYRGKIVESGPAEQIFAAPQHEYTRALINAVPLPVVSR"
     gene            complement(139683..140624)
                     /locus_tag="NONO_c01270"
     CDS             complement(139683..140624)
                     /locus_tag="NONO_c01270"
                     /codon_start=1
                     /transl_table=11
                     /product="putative peptide ABC transporter, permease"
                     /protein_id="AHH14947.1"
                     /translation="MTDAEIIVQGAPEPVAAGRRKLVWRRFIRNKPAVIAGFVLILLV
                     IGAFAIPPFLSYDYQQRDSLALLQPPSPQHPFGTNEIGQDMLAQTLHGLQKSLLIGFC
                     VAIVAALIAVATGAVAGLLGGWVDRLVMWLVDLLLVVPSFIIIAIFAPRMKGSGSILL
                     LIALLAAFGWMISARIVRSMTLTLRDREFVRAARYMGASTRSLIVTHIVPNIASILII
                     DTTLAVGIAIMSETGLSYLGFGVQPPDVSLGSLIAFGTKSALTFPWLFLFPGGFLIAI
                     VLCANLVGDGLRDAFDPTSRRARAGRKMKKAEKVEAA"
     gene            complement(140621..141598)
                     /locus_tag="NONO_c01280"
     CDS             complement(140621..141598)
                     /locus_tag="NONO_c01280"
                     /codon_start=1
                     /transl_table=11
                     /product="putative peptide ABC transporter, permease"
                     /protein_id="AHH14948.1"
                     /translation="MTGFLLRRALNYVVLLALASFLAFSLASLTFRPLDSLEQRNPRP
                     PQSVIDAKAHELHLDEPIPQRYVTWVGGVVHGDFGKTLAGQPVSAELGRRVGVSLRLL
                     IVGSVVGTLLGVLIGAAGAIRQYRISDYFTTIVSLLVLSTPVFLLATLLKYGALEINT
                     ATGQQIFLYTGETSATAVHGFWNQFVDRLQHMIVPTLGLALAAMASYSRYQRNAMLDV
                     LQSDFIRTARAKGLTRRRALYKHGLRTALIPMATLFAYSFGALITGATFTEKIFGWHG
                     VGEWLVDGINRQDVYIVVTVTVFVGFVVLVSGLLSDIAYAILDPRVRVS"
     gene            141738..142565
                     /locus_tag="NONO_c01290"
     CDS             141738..142565
                     /locus_tag="NONO_c01290"
                     /codon_start=1
                     /transl_table=11
                     /product="putative hydrolase"
                     /protein_id="AHH14949.1"
                     /translation="MTRLPKPKMVATDVDGTLLDGWERVTPRTRAAVTALIADGVPFV
                     LATGRPPRWIDPVIEGLGYAPLCVCGNGAVIYDSAGDRILHSSTLDVPSLEWIADLAE
                     RILPGCGLATERVGSSAHDAATPQFVSSPEYEHAWLNPDDTQVSRREVISAPAIKMLI
                     RLRGVPSGEMQAALAPHLTGRADITFSTDNGLIELSAPGITKASGLALVAQRLGVEPA
                     AILAFGDMPNDIPMLRLAGHGVAMGNAHPEARAAADEVTTSNADDGVARVLERWWER"
     gene            complement(142925..145204)
                     /locus_tag="NONO_c01300"
     CDS             complement(142925..145204)
                     /locus_tag="NONO_c01300"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase
                     domain-containing protein"
                     /protein_id="AHH14950.1"
                     /translation="MPYRRPKRSVVLPVVATLAVAAPLATLTLHDSPGYRMADDSNLA
                     AIPAELAEVALSSAPDVVLPLRELTGLNLPDLHLSDLRKLPLPKAIPVPPGLPAPPGV
                     RLPSEIPLPQFGDRSDAPAPQPAHSGPGFIAAPLDPAQVPDGDPSEPALAPGAVPPDL
                     SDQVGAEVKQLTRDTPFSMVALTADQLADTTSLIRAQQADGTWGAWYPTDQVDTNRDD
                     RSPAPARTGTEPIYVGATKAVQVLTTHKVAAPAAGRSDDPAQAADQLSAVLIDPGRGA
                     IDDKLSSVAAPLPGGGPKVISRAQWGADESLRCEEPTYDDGLGGITVHHTAGRNDYSK
                     SESAGIVRAIYAYHAKTLGWCDIGYNALVDKYGQIFEGRYGGMDRPVEGAHAGGFNEN
                     TAGVAMMGDFESQPPTDAQLQATGQYVGWRAKVAGLDPEGHTTMYSEGTDFTPYAEGE
                     AVQLPIVFAHRDVGNTTCPGDAAYARMDQIRQIAAGVTAGAPSEAKKQGPRTDLAALA
                     NLTSQLLGMVDKNIIAKYWAAQGGPNGRLGAVAAEPAPTHDGGQYAKFVNGYVYAAPD
                     GAITELAGRILDRFEQLGSDTGLLGTPQRSTYPVPGGERADFQLGSLILNTATGVVTT
                     LLKHSGPQQNPSADPIPAPLPDAAGPQAPSQPAAPAPGPVTPEAQGAPPVEGQVAPPP
                     EPQAAPVPEAQAPGPEATAPAPEAQTPGPEAQAPGPDAQAAPPPESQAPAPDSQTAPA
                     PEAQAPDPQPAPEAPAPEA"
     gene            145584..147128
                     /locus_tag="NONO_c01310"
     CDS             145584..147128
                     /locus_tag="NONO_c01310"
                     /codon_start=1
                     /transl_table=11
                     /product="putative stage II sporulation protein"
                     /protein_id="AHH14951.1"
                     /translation="MTRTENRARYPHQDDPSSNRCASRFRRGRGQLLHRRRIRRGALI
                     GLVALPVTGGTVIAFALSASGGSAPRNASYEAVAGPGHGRGMSQDGAFDQAAGGATAD
                     SILQHYYPGAQLGTIAPTTVRVRLTVYDNETLDVYSDSGLTVAGRRVVAGQAAHLTPT
                     PDGGANVVVTIGCDGDVLWQGSTDDPWAYPVDPGSDRPAAEQLKVCDGSGFRGALGVT
                     EDNGAPVTVNQLDVDDYLQGVVPAEMQANWADKGAAEALRAQAIAARSYALAEHRYPY
                     AQTCDTTDCQMYPGTDKEDPRAADAVHSTAGQVLLRDGRILRTEYSAAPGGGQPIDIA
                     TLEVGPAPAQLQSIPVPAAPVPAAPTPVDPEKAVRASTVIDTKYAESGGAAGPLGDPM
                     GPESLLPGRGGTFRLYRGGVIIATPTLGAQIVDYARLLQLAPGATRSAGPDAADRVTP
                     GDTPAPGTAATPTPPGTSAAQVATGRPDAAGAESAEQPPTDPPAAGVAPDHTASDPVA
                     GPQPGE"
     gene            complement(147140..147640)
                     /locus_tag="NONO_c01320"
     CDS             complement(147140..147640)
                     /locus_tag="NONO_c01320"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, MarR family"
                     /protein_id="AHH14952.1"
                     /translation="MSDAVDRIVADWEKVRPDLDVWPTHVIGRIKRMGRRLDLEMKDF
                     FAGHGLEYWEFDVLSTLRRSGGPDGLTAGDLIKATMVTSGAITNRIDRMAAKDLVRRA
                     PDAKDRRTIRVQLTDHGREVIDELMPLHVDNEMRLLAGMDRADLDQLGDLLRQLAESL
                     DDTSLG"
     gene            147749..148693
                     /locus_tag="NONO_c01330"
     CDS             147749..148693
                     /locus_tag="NONO_c01330"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH14953.1"
                     /translation="MTRTVARGSSAAVLAVTGLAPLVWGSTYAITSEFLPPDRPMFTA
                     LMRALPAGLVLLAVTRTLPHGRWIGRAALLGVLNIGAFFPLLFLAAYRLPGGVAAVLG
                     SAAPVFALGFAGLLLQARPSGRKVLAGVIGIAGVALVVLRANAALDTVGVIAGLAGAA
                     SMAAGTVLTGHWGRPEGVGPLAFTSWQLTAGGLVLLPLALFTEGAPPALDGAAVTGYL
                     YLGVLGTAAAYAIWFRGLARVPATSVAFLGLLSPVSATVIGWAALGQSLTALQLLGMV
                     IALGATVLGQIGVRAREAKTADPVPAVDPPVDSGIRAA"
     gene            148735..149376
                     /locus_tag="NONO_c01340"
     CDS             148735..149376
                     /locus_tag="NONO_c01340"
                     /codon_start=1
                     /transl_table=11
                     /product="putative NADH-flavin reductase"
                     /protein_id="AHH14954.1"
                     /translation="MRITVFGAAGTAGSRIVGEALARGHEVTAVGRTAAGPDGLPAEV
                     MTRSGDATDPDQVAAAAAGTDVVVSATRPRPGHEYELAVVAQSLLDGLRGTGVRLLVV
                     GGAGDLIVPGTDGGRVMEQPDFPPDWLPIALACRAQREVFTSAATDVDWSYLSPPALL
                     EPGQRRGTYRLGADELLSDHAGISRISMEDLAVALLDEAEEPRHRRRRFTVAY"
     gene            149589..150182
                     /locus_tag="NONO_c01350"
     CDS             149589..150182
                     /locus_tag="NONO_c01350"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14955.1"
                     /translation="MSYPYGQPEYPGYGYPPAGYPPPGYAPGYAPYGYPEPRPSGGAA
                     ITAGVFSLLIALLAGFGVLALISAANNLNDEYSYSHSYGSSSNSGDIFFAIAAADGLI
                     ALLWAIGGIMLMNHKNAGRIIVVILSSLGLLGGIAGMITAFANGVPAASIGGIVGLAF
                     AVLMLSLTLSGSAKRWCGVGMPAYPPAAYYGQPPYPY"
     gene            150193..150687
                     /locus_tag="NONO_c01360"
     CDS             150193..150687
                     /locus_tag="NONO_c01360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14956.1"
                     /translation="MGYPYATPQYAQPVPKPGGGTAITAGIMTLLQGVGITVFTIFGA
                     IETRTDRLDGSDTDADMIALVLFGALSALLLAGAILLLARRTAGRVIVIGITTLVLVV
                     IPTIAVVAAVAGGIRRDDVVPFSVMLAILVAIELPILVCAVSSSTGRWIAARNAPVAH
                     YPYY"
     gene            complement(150735..151964)
                     /locus_tag="NONO_c01370"
     CDS             complement(150735..151964)
                     /locus_tag="NONO_c01370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14957.1"
                     /translation="MRLSRAYSPALAALVLSGALGAGLLSPASVRADPPDVLAAVTVA
                     DGTGICGKQAPTFDDITVSAAAALRPSIPADQLSAYDDQVARFRHDLSALRVHRDMLP
                     VDPNTLGGYAAELDNPIVTYLVNGLDAVRTGRIDRTVPVSRLTVADVIEVFILANRIV
                     KIPAQLAVSLVPTAGFFLKFLVGGVFSGVQWLARRVQDQMRDRCPADAPGNRLDLNDD
                     ADFPAEHIDVPAPITDLARQVRAADGACTPIADLTTATVVARTREFLAHSDLPIDRAQ
                     LDTAASSVQEFLRDNRIAKAALLRKTEQLGPLVDYMDYGPVTFLTNLGFDIYEGKALD
                     TVALADVNVQNALDLTTLALDVTSLLLTAANGIGSLAGVSSAVLTPLGIAETLAFAPA
                     TYGAPILRGVLRSMCTA"
     gene            152157..153359
                     /gene="glf"
                     /locus_tag="NONO_c01380"
     CDS             152157..153359
                     /gene="glf"
                     /locus_tag="NONO_c01380"
                     /EC_number="5.4.99.9"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-galactopyranose mutase"
                     /protein_id="AHH14958.1"
                     /translation="MTVAAPFDLIVVGSGFFGLTVAERTANLLGKRVLVVERRYHLGG
                     NAYSEPDPETGIEIHKYGAHLFHTSNKRVWDYVNQFTEFTGYQHRVFALHKGQAYQFP
                     MGLGLISQFFGRYFTPEEARALIADQSAEIDTENAANLEEKAISLIGRPLYEAFVRDY
                     TAKQWQTDPKELPAGNITRLPVRYTFDNRYFNDTYEGLPRNGYTAWLEKMAESDLIEV
                     RVNTDWFEVRDEIRAQNPDAPVVYTGPLDRYFDYSEGELGWRTIDFETEVLETGDFQG
                     TSVMNYNDADVPYTRIIEPRHFHPERDSYPADKTVIMREFSRFAQTGDEPYYPINTPE
                     DRAKLLAYRERAKNETATAKVIFGGRLGTYQYLDMHMAIGSALSAFDNVLRPHLESGA
                     PLTDAESR"
     gene            153402..155333
                     /locus_tag="NONO_c01390"
     CDS             153402..155333
                     /locus_tag="NONO_c01390"
                     /codon_start=1
                     /transl_table=11
                     /product="putative galactofuranosyltransferase GlfT"
                     /protein_id="AHH14959.1"
                     /translation="MTAQLTVEDMTTETRAKSLLARIILPRPGEPLDVRTLYLEESAT
                     NARRAHAPTRTSLSIGAESEVSFCTYFNAVPASYWRRWTILESVVLRLELSGHGRVDV
                     YRSKADGSRIHVQGNEFATSAPSDTTTVEFEVELAPFEDGGWIWFDITTDSAVELRSG
                     GWYAPIEAPGEGSIAVGMPTFNRPTDCVKTLAALGSDPLVLEKIQAVIIPDQGNRKAV
                     DEPGFAEAAAVLGDRLAIHDQPNLGGSGGYSRVMYEALKTTDAQYIVYMDDDIEIEPD
                     CILRALAFARFSRTPTLVGGQMLNLQERSHLHTMGEVVDRGIWMWTAAPNVEYDHDFS
                     KYPLRDRDNSKLLHRRIDVDFNGWWTCVIPRSVAEEIGQPLPLFLKWDDVEYGLRARA
                     AGYPTVTLPGAAVWHMAWSDKDDAIDWQAYFHLRNRLVVAALHLGNDGRPMIVNTVKA
                     TLKHLLCLEYSTVAIQNQAIRDFLAGPDKLFELLPTALGEIATMRKEFSDAVIVGSST
                     ELPLPSGADVGAVGEPSNPIAKIVRLGKGVLHNLRGAKTEHHDRPQLNVPTLDARWFL
                     LSQVDGVTVTTADGRGVVYRKRDPRQARELFAEAMRLRRELAARFPELRERYRSAHAR
                     LTSTAAWENAFGINPSEDK"
     gene            155330..155926
                     /locus_tag="NONO_c01400"
     CDS             155330..155926
                     /locus_tag="NONO_c01400"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphatase"
                     /protein_id="AHH14960.1"
                     /translation="MSAPAASDPAGAPHLRVVSDPASSPAEVKILNAVQGAIGTPPVI
                     KAARGMSHFGEHALGWMAIGAAGALVDKSRRRQWAGVAVGAFGAHAASVVIKRIVRRP
                     RPHDPSVQVNVSTPSKLSFPSSHATSTTAAAVLLGKLTGLPLPAVLVPPMLLSRVVLG
                     VHYPSDVLAGSALGAASAAAVLAAEKRFTSDRTGKNPR"
     gene            155928..156875
                     /locus_tag="NONO_c01410"
     CDS             155928..156875
                     /locus_tag="NONO_c01410"
                     /codon_start=1
                     /transl_table=11
                     /product="UbiA prenyltransferase family protein"
                     /protein_id="AHH14961.1"
                     /translation="MSEEPTGTDLDDAVLKGPPKTLAGGIVKAVRPRQWVKNVLVLAA
                     PLAAGKDAATGAYVLADAGVVAHIIIAFVVFCLAASGIYLVNDALDVDADRAHPTKRF
                     RPIAAGVVPVNLAYSLSAVLLVASLALSFVASWHLAVVMAVYIGIQLAYCFGLKHQAV
                     LDICIVSSGFLLRAVAGGAAADIRLSQWFLLIMAFGSLFMAAGKRYAELKIALDTGAK
                     IRKSLQYYTPTYLRFIWTLSATALVIFYGLWAFETDHKHTQWFAISMIPFTIAILRYA
                     VDVDGGEAGEPEEIALGDRILQLLAIAWIGAVGVAVYLT"
     gene            156853..158850
                     /locus_tag="NONO_c01420"
     CDS             156853..158850
                     /locus_tag="NONO_c01420"
                     /codon_start=1
                     /transl_table=11
                     /product="putative arabinofuranosyltransferase AftB"
                     /protein_id="AHH14962.1"
                     /translation="MSLSISPDEMLVAGDEHEEGAAAQSPNRARDRDAARRFSLLSRS
                     VFVGGVIVTLLLFGIGAWQRRWIADDGLIVLRTVRNLMAGNGPVFNAGERVETNTSAA
                     WTYVIWFFGWISDARLEYVSLVVALTLSLLAIVFAMVGSARLWRPVTGAAPTLLLPAG
                     ALVYIAVPPARDYATSGLENCLVIFWLGVLWWLLLRWSQDERPRLLNLLLAGFWAGLC
                     WVIRPEMTVIGGLALVVLFFSRMPRTRLRPLFTRALLVLVGGLVPVGYQIWRMGYYGL
                     PYPNTAVAKEAGGAKWQQGLKYLWDLVGPYYLWIPLLVLIVVAVALLVRARRGRAVAD
                     AGKAPATGRLTRLQRWLRSPAAVVTVLVGGGLLLVIFNIRVGGDFMHGRMLLPQLFCL
                     MLPVSVLPVRLPVASAGSDRPGWLRWSFALPLIAWAGTVGWALFAANTTANTAGGQIS
                     ASGIVDERIYYVLNSGHDHPVLAEDYLDYPRMRAMVQDIAANPNGGLLINSPSYMMWY
                     VAPPPLPIPPAGYGHTVYFLNLGMTSMNVPLSVRVIDQEGLAYPLAAHTDRLVDGRIG
                     HDKNLYPDWVVVDTGMVDQHPWMPWFLDEKWVIQARTALTCPATQDLLASYRAPLTLD
                     RFKHNLIQSLHFAKYRIDRVPKYEIQRCHLVDPTTPPPVPN"
     gene            159030..160133
                     /locus_tag="NONO_c01430"
     CDS             159030..160133
                     /locus_tag="NONO_c01430"
                     /codon_start=1
                     /transl_table=11
                     /product="putative mycolyltransferase"
                     /protein_id="AHH14963.1"
                     /translation="MRGVTVRWVQQRRRRGAQQSTSRRSGWLRRSAVGVALATLLPFG
                     VSVAEAGHAAAAFNPTGIDFWVDSSMGPIKSRIFRAADGNTNRVVYALDGMRARGDLS
                     GWEIETNIIPALVNANMNVVMPVGGPSSFYADWNAPSNFFGIDTASAGSAGSSTGSAM
                     TGSSNYNETLGKVNTYKWETFLTSDLPNALAGRLGFSSHRNGVFGLSMGGSAALTLAA
                     YHPDQFSYAGSYSGYLNISAPGMREAMRVAMLSAGGYNIDAMAPPWGPQWLRMDPFVF
                     APRLKANNTRLWIAAGSGIPSAQDTTSPLDIIQGSPLEALALANTRAFQVRMMTLGAS
                     NVTYDFPNVGVHNWHNWEAEVYRMIPDMSPNIG"
     gene            160545..161615
                     /locus_tag="NONO_c01440"
     CDS             160545..161615
                     /locus_tag="NONO_c01440"
                     /codon_start=1
                     /transl_table=11
                     /product="putative mycolyltransferase"
                     /protein_id="AHH14964.1"
                     /translation="MPGSRSATKSRSLLRRSALGVAFAVLLPLGVSVLGQGASASAAF
                     DPAGFDFMVDSPVMGPIKSRIFRAKDGNTDRVVYALDGLRAPETLNGWEIETNVAQML
                     TDWNINVVMPVGGQSSFYADWNAPSSFFGVPPSGSGAVGTGSGATEALLGGPGKSYRY
                     DWETFLTSQLRSALRDRLGFRADRNGVFGLSMGGSAALTLAAYHPDQFSFAGSFSGYL
                     NISAPGMREAIRAAMIDAGGYNVDSMAPPWGPQWLRMDPFVFAPQLIANNTRLWIAAG
                     SGVPSQQDLGLPLPAATDHIVRGAPLEALALANTRSFQVRMMTLGAQNVVYSFPNVGV
                     HDWFNWQDEAYRMAPDLSANIG"
     gene            161926..162948
                     /locus_tag="NONO_c01450"
     CDS             161926..162948
                     /locus_tag="NONO_c01450"
                     /codon_start=1
                     /transl_table=11
                     /product="putative esterase"
                     /protein_id="AHH14965.1"
                     /translation="MRFGRSAAPVSQQRRGAQRGWRTRLLAAGAVLALPIAVGAVAPA
                     AVAAPIHAPVHQTPAGGYDELMVPSSMGPVKVQVQWARNGGNAALLLLDGLRARDDRN
                     AWSFETNAQQMFGNDNVTLVMPVGGQSSWYADWASPSNLNGQKFTYKWETFLTQELPD
                     FLANYGVSKTNYAVAGLSMSGPAALRLAAFHRDQFKYAASFSGPLNWNAPGMREAIRV
                     MMLDAGRFNVDSMAAPWSPQWLRSDPMVFAPQLRGLPMFISASSALPGPYDHPTSPVG
                     LFNTGNAMGIELIAMVSTHSFKARLDSLGIPATYDFPAVGTHSWHYWQDELGNARAGI
                     LAALNA"
     gene            163123..164985
                     /locus_tag="NONO_c01460"
     CDS             163123..164985
                     /locus_tag="NONO_c01460"
                     /codon_start=1
                     /transl_table=11
                     /product="putative esterase"
                     /protein_id="AHH14966.1"
                     /translation="MASERRGTLRRGRWGRRRLAIFAAAAVLPLASGIALAPAPGLAQ
                     PAAVPAPAGPVIQRVDWLSDRRVALWIASPSMGSPVQVQLLLARDWNSRPDARFPVLL
                     MLDGLRAQDDESGWTKDAGAVDFYADKDVTVVLPIGGQSSFYSDWLQQDNGKNYQWET
                     FLTKELPPLLESQWRATNVRGVEGLSMGGTAAMFLAGRNPDWVKYAASYSGFLTTTSV
                     GMPQAIMFAMRDAGGFDANDMWGPPTNQQWADHDPYELAPKLKGTSLYVSAGSGATGA
                     YDKASDIPGISTNYAGMGLEMLSRLTSQNFVEKLNKLSIPVQVNYRPSGTHSWPYWDF
                     EMRQSWSQAAAALGVEADKPPCQAGGAMAAALQIDTWLGDCVTPEYPVTNGSAQDFKG
                     GRLFWSQATGAHGVAGMIGGVYQATAGPAGPLGLPTDAERPLPDGHGRFQNFQGGAVY
                     WTPETGAQVVRGAILTEWGRQGFERGPAGYPTGPEAETPNSVGVVQGFQGGPMYFSDK
                     TGAHRVQGLILGKYGQMGFENSWLGFPAAEEQPTKDLGRYSAFEGGNIYWSPLSGAWA
                     VRKGPIMDAWGQNGFENGRLGYPISDEFPVPGGVQQNFQAGFIVLPDGKPPEVH"
     gene            165141..165683
                     /locus_tag="NONO_c01470"
     CDS             165141..165683
                     /locus_tag="NONO_c01470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14967.1"
                     /translation="MLRTRPVGERYIAGGKVAGVVVALAATGLLAACGGNDSTASSTP
                     TLKPSATTSAAAPTKSADAPPPAPESAPEQAPATTDAEEHPEPAPTSAATPPLSEKDK
                     AYLDELNKRGVTPSSPDIALTAANYICQSKASGASDQEVKTFVNAMAGTDPGYDPQKM
                     PVDQAGQIYIDVATQTYCNK"
     gene            165680..166672
                     /locus_tag="NONO_c01480"
     CDS             165680..166672
                     /locus_tag="NONO_c01480"
                     /codon_start=1
                     /transl_table=11
                     /product="cutinase domain-containing protein"
                     /protein_id="AHH14968.1"
                     /translation="MNARRRSGYGGRGPGRRRRPGCLIFLLVAVLVVIVAVVAWFVLA
                     GRLHVPKPTPPKPTKPSSQPASCPDVQLLSVPGTWESNSNDDPHNPTANPASLMLHVT
                     NPVRQQFPDSRLDVYTVPYVAQFSNPIALPPDGQESYNKSRSEATTRAVAELTEMSKN
                     CPLTNYVIAGFSQGAVVAGDIAAQIGAGQGPVAEDQVLGVTLIADGRRVLGPGQATEV
                     GTSPGGVGAEVALKGLSVPGITMTGPRAGFGTLTGRVNTICAPGDLICDAPPQATNPL
                     NILPSLMTLVRAVGNPVHSMYNSFEVDSDGTTATQWTSAWAEGLITNAPHPAHG"
     gene            166844..167878
                     /locus_tag="NONO_c01490"
     CDS             166844..167878
                     /locus_tag="NONO_c01490"
                     /codon_start=1
                     /transl_table=11
                     /product="putative F420-dependent oxidoreductase"
                     /protein_id="AHH14969.1"
                     /translation="MTEAAVVGATSGVEMTALGVPARAFRFAAAGEGNQQEGGARKFV
                     KLAQQAEEYGYDSFAIPDHLGPQVGPIAALGALAVATDRIRIGTSVLANGFRHPVVLA
                     KDAATIDVLSRGRLELGVGAGWIKSEFEAAGIPYESPGVRLEKLDETLTILDVLLRGQ
                     ECHFEGKHYQVRGIKGTPRPRQGPRPPLVTGGGGPKMLRLAAKHADIISVVPRTTRTG
                     KGLLSGITLEKTIEKVNLIKEAAGDRFADIELNWTITAVVITDDRERTAEMALTALDK
                     GLHPDLEVDVQLTVDDILNSPYVAIGTFEEIAEQIRNVRRSTSMSYVGVFPTQMDAFA
                     PVIPLLREEP"
     gene            168123..170045
                     /locus_tag="NONO_c01500"
     CDS             168123..170045
                     /locus_tag="NONO_c01500"
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain-fatty-acid--AMP ligase"
                     /protein_id="AHH14970.1"
                     /translation="MTDETFDDYLDATGNIAIPEGRTLVDYVEKHTRNDANDLAYRYI
                     DYSRERDGEYQDLTWKEFGVRLRAVAARLQQVTQPGDRVAILAPQGLDYVISFFAAIY
                     AGTIAVPLFDPDEPGHTDRLHAVLGDCKPAAILTASSSAAGVRQFFRPLPAAQRPRII
                     AVDAVPDTLGESWVRPDLAVDDIAYLQYTSGSTRTPAGVEITHRAVGTNLLQMVNAIN
                     LDWNSRGVTWLPLYHDMGLLCVILPAIGGKYITIMSPSAFVRRPGRWIAELAAVSDGA
                     GTFAAAPNFAFEHAAARGLPKNGESLDLSNVIGLINGSEPVTTSSMKKFNEAFAPYGL
                     PKTAIKPCYGMAEATLFVSATRAEDEAKVVYVDRNELNAGRVVKVDQSATDAIAQVSC
                     GYIALSQWAAIVDPETIDDPAGAQELPEGRVGEIWLHGNNIGIGYWGREEETRKTFKN
                     LLTNRLPEGSHAEGTPDDAIWLRTGDYGVYVDGELFITGRVKDLVIVDGRNHYPQDLE
                     FSAQEASNMLRPGFIAAFSVPANQLPAEVFTADSHAGLKYDADDASEQLVIVAERGPG
                     GHKADPQPIADAVRGALSQRHGVTVRDVLLVPAGSIPRTSSGKLARRACRTAYLEGTL
                     RGGYQQQAFPDAPDEE"
     gene            170284..175635
                     /locus_tag="NONO_c01510"
     CDS             170284..175635
                     /locus_tag="NONO_c01510"
                     /codon_start=1
                     /transl_table=11
                     /product="polyketide synthase"
                     /protein_id="AHH14971.1"
                     /translation="MADNEGTKTTATSGADDVEVTTADAAVAEQAGQDGSGTPDMSVA
                     ELREWLQRWVADATGQPIEQITVDRPMEEFGLASRDALALGGDIEERTGVLLNATIVY
                     QHPTIASLAERIINGEPDAPEELADDAFYTAGYQPGEAHDIAIVGLSTRLPGAGSTPE
                     STWDFLINRGDAIRERPEGRWSEFTGDPDIAAAVENGNTLGGYLDQDVVKGFDAEFFA
                     MSPVEVERVDPQQRLMMELTWEALEHARIPANTLKGEAVGVFIGTSTNDFQLIAALGL
                     GKSDPDAPASADAYALTGASTSIVANRVSYFYDFRGPSVAIDTACSATMVAVHDAVRA
                     LRNGEADLALAGGVNMLLAPAISLGFDSIGAVAKDGHIKAFSSDADGMVRSEGAGLVV
                     LKRLADAERDGDRILAVVKGSAVNSDGRSNGIFAPNPDAQADVLRRAYRDAGIAPSTV
                     DYIEAHGTGTPIGDPIEADALGRVVGRGRDEDKPALLGSAKTNFGHLESGAGAASLAK
                     VVMALQHNVIPPNLGYAGPSPYIPFEQAHLKVVDEPTEFPRYSGTATVGISGFGFGGT
                     NAHLVIQEYVPSAGESEPSGAQEDSGSDELAAKLDDESTDVLAGAEAIVEGTDPLAPA
                     AAEVPEWTQERTEPLPVILPVSAYLPSRRRRAASDLADWLESEAGQATPIEDVARALA
                     KRNHGRSRGVVLATTHEEAVAGLRAIAEGKPGPGVFTADSPAVEGPMWVLAGFGSHHR
                     KMGKQLYLENSIFARTVDEVDELVVDEAGYSVKEMILDDAQDWDVGTSQVGVFTIQLG
                     LAALLRAHGAEPHGVVGHSQGEAAGAYISGGLPLEDAVRVICARSRLMGEGEQMITDD
                     QVRNMALVEYSAEDIEKVLPDYPDLEVAVYAAPTNTVIGGPPDQVHAIVARAEAEGKF
                     ARVLQTRGAGHTSQMDPLLGELAAELAGIEPTRPTTDLYSTVHKATVYKAGSDPVHNE
                     DYWVTNMRGSVYFTNAIRQAVDNSITTYLELAPNSVALMQVMGTTFAAGVHNAALIPT
                     LKRKEDEAAGVLSALAQLYVHGHAVDLSSLLTAGEYADVPRTAFVRKEYWPKVSVAAG
                     SGSGRVPGAHVALPDGRHAWEVQSAAVTDLAALVNAAAAQVLSDVAVGATVAHAAAPT
                     AGTLTTTLTPHPGGASVQVHVREGDAFRLVFDAVVTGTAPTGAAPVVQPAPAPAEKDS
                     GAADLVVAESFGERWDPNGTQTVEERLATIAAESMGYSVEDLPMEIPLMELGLDSLMA
                     MRIKNRVEYEFDIPSLQVSAVRDASLNEVGKVLHYAIEHRDQVAAMAEKQAAEGGSLT
                     VDDNFVAAARAAMEAGEDPATALAQAEDKGAEPESVPAAADTEATSSAEATAAAEDST
                     VATAAESSEASSVKSASEKDPAAAILGGQAAGTKDAESDVPPRDAAERLTFAAWATVT
                     GKSAGGIFNTLPILDDETARKLAERLSDRVGAEIEVDEVLDCETIEQLSDIVRNHQDS
                     ATEVDGYIRPLRPVAEGSNAVPVFVFHPSGGNTLVYEPLLKRLPENTPMYGFERIEGS
                     IPERAREYADEIRKIFPSGPYVLYGWSLGAVFALQVGQIMRADGDDVRLVGLIDLAIP
                     VADEDTSPEGRRARIERFQSFAQKTYGIEAQLDDEMLQELADASDEEQYEIIMSLLKF
                     ADVKIPGGVLEHQRTSWLDGRDLQKAQPSKYDGAVTLYLADRYHDGIIELEPRFADRR
                     PNGGWDGYIPNLEVIHIPGDHLQIIDEPRVSQIGADLTRKLAAISDEAHDAPGKGEQ"
     gene            175632..177176
                     /locus_tag="NONO_c01520"
     CDS             175632..177176
                     /locus_tag="NONO_c01520"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA carboxylase beta subunit"
                     /protein_id="AHH14972.1"
                     /translation="MTTTAERLADLRKKLELAQEPAGEAGAAKRAKKGIPSPRERINM
                     LMDPGTFVEIGALVRNPSDKNSLYSDGVVTGHGLVEGRPVAVFSHDQTVYGGTVGEMF
                     GQKVASLMRFAAKMGCPLVGINDSGGARVQEAVTSLRWYGEMAIAMEALSGAVPMVSL
                     ILGNCAAGAVYQPICTDVVIATESAHMFVTGPQITREATGEDVSADELGGAYRQADWG
                     NIHHVAKDEKAAFEWAREYLSYLPSSCQEEPPIVNPGLEPEITDSDRELDSFVPDSDN
                     ASYDMHEVLLRIFDDGGFHEVGSDMARNIITGFARVDGRPVGVVANQPMYLAGALDAK
                     ASDKASHFVRMCDAFEIPLVLVVDTPGFMPGLEQEKAGVIKRGGRFLFSFVEASVPKV
                     TVVVRKAYGGGWAVMGSKALGADVYFAWPTARIAVMGAEQAVSLVGRRQLEAAPEDQR
                     EAIRKQMIDFYNATAATPWPAAERGYIDAVIEPSATRLELRRALTLLRDKKLQRNPRK
                     HHLLPL"
     gene            177426..177626
                     /locus_tag="NONO_c01530"
     CDS             177426..177626
                     /locus_tag="NONO_c01530"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14973.1"
                     /translation="MGTSPKAVLEGGPADLPHRIVPITPPGIELRVQTTGGYERFKST
                     PRRQDTPEGNLPVYEWIEHVDA"
     gene            complement(177815..181186)
                     /locus_tag="NONO_c01540"
     CDS             complement(177815..181186)
                     /locus_tag="NONO_c01540"
                     /codon_start=1
                     /transl_table=11
                     /product="arabinosyltransferase"
                     /protein_id="AHH14974.1"
                     /translation="MPDAATAVLPEPTVTEEPVTSRDFRTARLIAVITGVLGALFAIA
                     TPFLPVQQTTAEVNWPQSGTVGNVEAPLMSQVPVDLRASIPCSAIAELPQGGMLLNTA
                     PPEGDRAALEGMFVRVTADSVDVVDRNAIVASAKRTELEGCTSITITSDINRTYAHFE
                     GLTTQVERPSATGGTETVTVPVEGTLQGDLRPQVVGVFSDLKGAAPAGLSFHMTVDSR
                     FSSSPTVIKLVAMLAAVLCTLIALAALGRLDTTDGRGHRRFFPAHWLKPTWADGAILG
                     TLLVWHFVGANTSDDGYILTMVRVAPHAGYLANYFRWYGVPEAPFGWYYDVIQIFAQI
                     STASPWVRIPALLCGMLCWMVISREVVPRLGRGVRNSKVALWTGGLVFLAFWLPYDNG
                     LRSEPIVALGALLTWVSIERAIATRRLLPAAVAILVAAFTLAAAPTGLMCVAALLAAI
                     RPLVRIVVQRKRDLQQRVGSGWRASGFVSSLPLLAPIAAAGFLVLTVVYSDQTFAGIQ
                     EANRVRRLTGPNLAWYEDYLRYYYLFVQTVDGSVARRFAFIVMILCLITTALVLLRRK
                     RIPGISSGPTWRLIGVVCGTIFFMMFNPTKWTHHFGAYAGIAGALAAVTAVAVSATAL
                     RSRKNRSIFLAALLFALALSFSGTNGYWYVSSYGVPWFDKTVSIKGFQSNTLMLVLFG
                     LALAVVAWQALREGYAKPPAGSKTARGRRIRRFAAIPLTVVAAAMVLFEVLSLAKGAV
                     TQYPAYSLARGNIDAVDGNRCGIADDVLVESDANAGRLNPILDPARPPKDNDPLAGAN
                     PTGFDPNGVPTDLKADAVEVKPGTGNTSNQSVGANFAEGQNAGTGGGTTEGAGINGSS
                     VALPFGLDPKTTPVMGSYQQGLQQPAHLTSSWYELPARTADSPLVVISAAGRIMSFDQ
                     TGAMQYGQDLKLEYGKRQPDGSVKFEGSYVPRDIGPAPSWRNLRIPFSEIAPDADAVR
                     IAANRNVLIGDQWLAFTPPRVPKMVTLNNFLGSEQPVLEDWAVGLQFPCQNPFPHRYG
                     VATMPNYRILPDRPLAVSSTDTWQAEEFGGPLGFTQMLASSTTVPTYLKDNWARDWGT
                     LERYDRYVEDAKPAKVDTGTEDRNGFWSPGRLRVF"
     gene            complement(181265..184516)
                     /locus_tag="NONO_c01550"
     CDS             complement(181265..184516)
                     /locus_tag="NONO_c01550"
                     /codon_start=1
                     /transl_table=11
                     /product="arabinosyltransferase"
                     /protein_id="AHH14975.1"
                     /translation="MRADSPAFPRIRLAALLSGLIAVVLAVLTPLLPVREDRTSLDWP
                     QPQSVPVTAPLVSYVPLQLDASVPCAAFRDLPAGTVLSTVPADAPDASAKGLIAKVTD
                     EPGGRTLSVLLRDIPLLSAPLTEVGGCAQLAIASTAQATTAEFTQVTRKDGTPFTNTV
                     GGDVRPQIVGVFTDLERAQLGDARVHAAIDSRFSSSPSALKLAAIIGAVVFTILSLIC
                     LHLIDTGDGRRARRFLPAHWWRFTVADAVVLGTLVIWHFIGANTSDDGYILNMARASK
                     HSGYMANYYRWFGVAEAPFGWPYEVLSWMTRVSDASWWMRLPALLAGIACWLVISREV
                     LPRLGSLVRRDRVARWTAGLVFLAAWLPYDNGLRPEPLIALGALLTWCSIERSIATKR
                     LLPAAIAVLIAAFSLAAGPTGLICIAALIAGSRPVLQHIISRARGGGSAGRAILRYGS
                     LLAPGVAAGTLVLVVVFADQTLASVMEATRVRKIIGPNVAWFDERTRWDSLLMLAPDG
                     SLSRRFGILGMLLCLLVCVLVMLRKSGRIPGTAKGPSARILGIVFMSLILMMFTPTKW
                     THHFGVYAGLAGSLAALTAVAVGVNGIRARYNRSLFAAAVFFLLAITFTGSNGWWYVS
                     SYGVPWFDKAPLVAGKGLSTLFLGLAVLCILLAAYQYYREPYRKPRERRRFDTWAIQP
                     LTIAAAVLVLFEVASLAKGAVTQYPSYSIAKSNFRALGGHPCSLADAVLTETDTADSL
                     LQPYSGSAADALGADSTGFTPDGVAKDLTADAEETTTGGANSIDKDSANKTTNTTTAG
                     TGGGTTEQPGINGSTVKLPFGLDPARTPVLGSYTTGTKQQAHLTSGWYRMDVAEARRD
                     PDHKLLVVTAAGRIKSVNADGVLTYGQDLTVEFANRAADGTVRPLGSFTPLDIGGAPS
                     WRNMRVPLDRVPDGTNAVRIVAVANDLTPRQWLAVTPPRLPKLATLDSVVGHTDPVLE
                     DWHVGLAFPCQRPFDQKDGVAEVPKWRILPDRVGSDASNAWQDDIGGGPLGWTGLLLS
                     AQTVPAYLNDDWSRDWGSLERFTPYVPEAEQATVAVTTQNRWGWVKDAPIKTK"
     gene            complement(184604..186526)
                     /locus_tag="NONO_c01560"
     CDS             complement(184604..186526)
                     /locus_tag="NONO_c01560"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14976.1"
                     /translation="MVLGGETDPHEPGVPGSSGAVAVETAAAVAPADIASGGRTALRP
                     RIAAAGDRIRAGRGDLAVALLYLLGAVIVMSGQWRDTAHGYLIDSGQDQSMWEWFFAE
                     TAHSVLHLHNPLGTDLQNFPDGVNMMANTAMFGVSVPLTPVTLLFGPTVTFVLVLTLG
                     LAGTGYAWYRLFSRELVTSRFAAALGGLFCGFAPAMISHASAHPNFVVLALLPMLALL
                     IIRMARRAVEADRDDRFRSTLPRIREAIVLGVLVALQIALGEEPLLIFALGFGVFALV
                     YYLHAPRTGLRVARALTPTLALGAVITVALTTIPLWWQFFGPQSYRSIDHGPMGNDLA
                     ALTQFPSQSLGGMFSPGRNIAINPTEENAFFGWPLLVLIVVTSLWLWRRREPEHRVVR
                     ATAAVIVVFTVLSLGVSLRIERTDTGITLPWHWLDQVPLLNTVLETRFTLAAVPAIAV
                     VLALATQRMLNYARASTADVRPVIWFVALALALVPLVPTVLPVTHRDPTPRFFTDGTV
                     DRYVDDGSVVIAPPPTRLNAGPLKWQVDADFRFPLAGGYFVGPTADKKGRYGPDDRAT
                     AALLMKAQSTDRIPAIDDRARAQAVADLAYWRADVVVLPPTEHGGAVRATLDQLLGFP
                     GKVVDGVVVWDVRTLR"
     gene            complement(186661..188682)
                     /locus_tag="NONO_c01570"
     CDS             complement(186661..188682)
                     /locus_tag="NONO_c01570"
                     /codon_start=1
                     /transl_table=11
                     /product="putative arabinofuranosyltransferase AftA"
                     /protein_id="AHH14977.1"
                     /translation="MRVLVRQVGGGLGEAVAGAVVAAVVAAIGLVAMSVVEWPAFNSS
                     NVTRALTTVGQAGAALLLVVSIALIRRKRWPWLAKLLSWAGISAFVTITLGMPLAATK
                     LYLFGISVDQEFRTEYLTRLTDTAALHDMTYADIPAYYPAGWFWIGGRVANLLGMSGW
                     ETFKPYAIVSLAVAAVLALVLWSKLVRWDWAVAVAAATTAVMVAFASPEAYSAVLVIL
                     FAPAMVLAWGALYRPMEFGAASRLPGRSDASGDTPSESGAEPAVSVARTAAGWGATIG
                     AGAFVGLSGMFYTLFFAVAAFTVGLMGLVAWVTLWWQQREFAVHQPRAPKLGIFRLLW
                     PILLRLIVMAVIAGLMTLIVWGPYAWKVLTGNLPSSNTALHYLPEAGSHLPFPMFDFS
                     EPLLGALCLLGTVWLVVRVASSRRAQALGISVVAIYLWSLGSMLVTAAGTTGLAFRLE
                     PILQVLLAAAGAFGFVEGARAIYQAVGEPRRFRAAAAAVAVLGALAFAQSIPSTLNNE
                     ITTAYTDTDGNGQRADKRSPSAVSHYAEIDRALTEQTGRPRDQTVVLTADTSFLSYYP
                     YFGFQALTSHYANPLADFPDRAAEIKRWSELKTPAELIDALNHSPWRAPDAFLFRRSG
                     ENYTLRLSADVYPNDPNVRRYSVEFPGTLFDDPHFQITQIGPFTLVVRH"
     gene            complement(188869..189630)
                     /locus_tag="NONO_c01580"
     CDS             complement(188869..189630)
                     /locus_tag="NONO_c01580"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, SDR family"
                     /protein_id="AHH14978.1"
                     /translation="MINAVGNPQNILLLGGTSEIGLAICQEYLKKGPARVVLAALPND
                     PLRAQSVAQLEAAGASKVEVVDFDALDTGSHPKVIEEAWADGDIDVAIVAFALDGDAE
                     ELWQNQAKAVRVAEVNYTASVSVGVLVGEKMKAQGYGRIIVMSSVAGERVKRANFVYG
                     STKAGLDGFYLGLGEALRPHGARVTVVRPGQVRTQFSAHVAEAPLTVNKEEVAALAVS
                     ASEKGKEIVWAPGAFRWVMVILRHVPRAIFRKLPI"
     gene            complement(189630..191123)
                     /locus_tag="NONO_c01590"
     CDS             complement(189630..191123)
                     /locus_tag="NONO_c01590"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="AHH14979.1"
                     /translation="MPMSTKAQTSTAAGPANSAGDGEVSQASTGADETATLPTHTRRL
                     TGWGRTAPTTSEVLSTGDPEQIVRAVAMVAEDNESKPPHLRRGVIARGLGRSYGDNAQ
                     NAGGLVVDMTALNQIHRIDRDTRLVDVDAGVNLDQLMKAALPFGLWVPVLPGTRQVTV
                     GGAIGSDIHGKNHHSAGSFGNHVRSIQLLTADGTVQTIGPKKNAKLFWATVGGCGLTG
                     IILRATIEMTPTETAYFIADGDVTSGLDETIAFHSDGSEDNYEYSSAWFDALSPMPKL
                     GRAVISRGSLAKLDQLPKKLRKNPLGFTGKTFLTFPDVFPNGLLNNKTFTLATEIWYR
                     KGATYRQKPQDLTAFYHPLDMLGEWNRAYGSRGFLQYQFVVPPEAVEEFKQILIDIQA
                     SGRYSFLNVFKYFGKGNQAPLSFPMPGWNVCLDFPIAPGLNEFVTELDRRVLEFGGRL
                     YTGKDSRTTAEAFHQMYPRIDEWIKIRRSVDPTGVFMSDMARRLELQ"
     gene            191133..191690
                     /locus_tag="NONO_c01600"
     CDS             191133..191690
                     /locus_tag="NONO_c01600"
                     /codon_start=1
                     /transl_table=11
                     /product="GtrA-like protein"
                     /protein_id="AHH14980.1"
                     /translation="MGGGIRVRLRVECVVAHSAKPVTLVRVSAEPHLPLPVELPLVDE
                     PGGTDVDLKTQIVRFVLTGGLSAVVDFGLYVLLMAVGLPRDIAKACSFIVGTTTAYLI
                     NRRWTFKAPPSRSRFVAVVILYAVTFAAQVGINAVLNDQLPDMAVDIAGHSLKGAVLL
                     AFVIAQGVATVINFVVQRAVIFKMR"
     gene            complement(191695..193905)
                     /locus_tag="NONO_c01610"
     CDS             complement(191695..193905)
                     /locus_tag="NONO_c01610"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase"
                     /protein_id="AHH14981.1"
                     /translation="MTSVTPDSRIAYRTCPLCEAVCGLEITLDADDRVTRVRGDRADP
                     FSHGFICPKGASLGALDIDPDRLTEPIIRDRATDTWRPASWPEAFALIAERAPEVLNQ
                     YGRQSAALYLGNPNAHTIAGALYVPALIRALSTRNLFSASTADQMPKQVSSGLMFGDP
                     LTVAVPDLDRTDYLLMLGANPLESNGSLCTAPDYPGRLKALRKRGGRLVVVDPRRTRT
                     ADLAGEHLFIRPGSDAYLLFGIVHVLFAEDLVDARAGEFHGVEQLRSAAIPFTPEAVR
                     ERTGVPAETVLRLARELAAAPSAAVYARIGTCTAEFGTLTQWLVDVINALTGNLDRPG
                     GALFATAAALGIVRSRPFRLGRWTSRVRELPEAMGEFPIATLADEIVTPGEGQVRMLV
                     TVAGNPVLSAPAGARLGDALAGLEFMVSVDRYLNETTRHADVILPPPRTLQAPHYDFA
                     LLQFAVHNYARYSPPVLPLAEDRPSESEILARLALSLSGQEASADPVAAVDELIIAGT
                     LHKAGLDTRRAELIGANSTEQRIDMMLRLGPYGEWNPDREPIEVAPGGMNLRVLLYNP
                     HGVDLGALRPRLPGALRTASGRVELAPQQLLDDTTRLVAGLSDPRPEVVLIGRRQLRS
                     NNSWMHNVATLVGGSNTCTLHIHPDDVARLGLGEVAAIESATGKLTVPVEPNDKIMPG
                     VVSLPHGWGHSGSSQSVAREHAGVNANTLTDDSRVDVLSGNAVFNGIPVTITPA"
     gene            complement(194050..194535)
                     /locus_tag="NONO_c01620"
     CDS             complement(194050..194535)
                     /locus_tag="NONO_c01620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14982.1"
                     /translation="MRTTFPTSVSAAARLAATAQDYIQRGWTVAETANGICLITDTKV
                     SGIEVAGELAADVRRFLRANNLSGPVIEIPGAERREIHLVTGLAKATRALEALRAAGA
                     IVHTDGAGIPLPPTQLSAGEACWGVAPSEARWVPPVVAIAAAVRSAISGRKPQLARIA
                     S"
     gene            194905..195543
                     /locus_tag="NONO_c01630"
     CDS             194905..195543
                     /locus_tag="NONO_c01630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14983.1"
                     /translation="MSEDPQPPGAGDAVDTPAIDTAGGERDMSYVTAESIPPDLARTS
                     LRLTWRESAQRRWASATADAEDVRPEPFRSPGAFRSWLVSALRALLDVQFRTSATRTL
                     LPLAYLLGLAFAIGIPLVLIVVLWRVSLPLGLIFAIVVAVPLGLTIAASVRLMLEFLV
                     NASRLATRVEHINTLADDLFRALSDVAEPVNQLSEDVRAVQFWRFRKRPPRK"
     gene            195661..196521
                     /locus_tag="NONO_c01640"
     CDS             195661..196521
                     /locus_tag="NONO_c01640"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding protein"
                     /protein_id="AHH14984.1"
                     /translation="MALPQGITGSTMPRRQLGRRLRDLRNRARMTTRVAARRLEWSEA
                     KIWRIETGQTSLRSLDVEAMCKVYGAGAEELEPLTALARETKARGWWSTYGDAIGEGF
                     DVFIGLEEAATTVSTFENEFVPGLLQTEDYMRAMLTAARPELTPVQIDRRIEVRMTRQ
                     QLLTREPDPVRLTAILGESLLWRRIGDSTVTAGQLAHLRRMCDRPNVDIRLVPTDSGY
                     HEGMDSGRFVLLEFGPAVEPPVVYVENFAGSAYFDKDADIDRYRAALASIRAASVDGR
                     GLLDEAIAAA"
     gene            complement(196568..197026)
                     /locus_tag="NONO_c01650"
     CDS             complement(196568..197026)
                     /locus_tag="NONO_c01650"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, MarR family"
                     /protein_id="AHH14985.1"
                     /translation="MTKASSVTEAPAHPQGSTGTTSKAAQPGQADARGTLVEEWRELL
                     TLHAEISCALEKELQREHHIGLSEFETLDRLVDASCDSYRMSDLANDIHLSQSALSRA
                     VARLEKDGLVDRTLCTDDRRAIFVCLTDEGRAVHDAAAPTHREILQRTLH"
     gene            197086..198588
                     /locus_tag="NONO_c01660"
     CDS             197086..198588
                     /locus_tag="NONO_c01660"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily transporter"
                     /protein_id="AHH14986.1"
                     /translation="MHVHVMFRDMTSTATLPAASVADTRWPIRLWGMLITLCIVLFLD
                     GLDVSMVGVALPSIGSELHIETSTLQWLVSGYVLGYGGLLLLGGRTADLLGRRKVFLI
                     ALAVFAIASLAGGLVSSAALLIATRFIKGLAAAFTAPTGLSIITTNFAEGPARNKALS
                     IYTVFGAGGYSMGLVFGGLMTGFGWRWTFLLPVPIAVAALISAAILVPRDKPGDAAEG
                     GHDLLGALFSTAGMLLLVYTVVSAPAAGWGSARTVGSFAAVVALFAAFVAVEKRVRHP
                     LVRLGILRKASLVRASLVIIAVAGSYFSWQFLVTLYLQDSLGWSPLTLAMALLPVGVL
                     VALSSVFSDKLVDRFGTGPIIAVTTGVMAVGYLLFLRIDTAPSYLAVILPAVLLIGIG
                     WVGFPAINIQATNGIEDDEQGLAAGVLQTSMQVGAAIVLAITTALISAGPHGNSPQAV
                     LDSYRPGLIFAGVAAIIGTLIALTHFLPTRRRRQVVEEEPETETEELAAA"
     gene            complement(198674..199231)
                     /gene="rmlC"
                     /locus_tag="NONO_c01670"
     CDS             complement(198674..199231)
                     /gene="rmlC"
                     /locus_tag="NONO_c01670"
                     /EC_number="5.1.3.13"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
                     /protein_id="AHH14987.1"
                     /translation="MRIRELAIPGAWEFTPALHGDDRGIFAETFKASEFEKATGRTLD
                     LLQVNTSTSAAGVLRGIHYTENPPGQAKYVTCVRGAFLDVVVDLRPDSPTYGRWDSVL
                     IDDVTRRSVFVSEGLGHALLSLADDSMVTYLCSLEYTPEFDRDLDAFDPDLGIDWPTV
                     GSDGRPLTFVRSAKDAAAPRLRNLG"
     gene            complement(199233..200144)
                     /gene="rmlA"
                     /locus_tag="NONO_c01680"
     CDS             complement(199233..200144)
                     /gene="rmlA"
                     /locus_tag="NONO_c01680"
                     /EC_number="2.7.7.24"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate thymidylyltransferase"
                     /protein_id="AHH14988.1"
                     /translation="MRGIILAGGTGSRLHPITRGVSKQLVPVYDKPMVYYPLSTLMLA
                     GVRDVLVITTPEDAESFRRLLGDGTQFGMSIDYVVQPEPDGLARAFVLGADHIGTDCA
                     ALVLGDNIFHGPGLGTRLRRFDGLDGGTVFAYRVSDPSAYGVIEFVGGKAVSIEEKPK
                     LPRSSYAVPGLYFYDNDVVEIARGLRPSARGEYEITDINRTYLEQGRLRVETLARGTA
                     WLDTGTFDSLLDAANYVRTIEERQGLKIGVPEEVAWRMGFIDDEQLSRLAEPLVRSGY
                     GTYLMDLLTRGKNDGTTADEYRDEQDD"
     gene            200379..201395
                     /locus_tag="NONO_c01690"
     CDS             200379..201395
                     /locus_tag="NONO_c01690"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase family protein"
                     /protein_id="AHH14989.1"
                     /translation="MTAIPIGEAEFRPGLEPGVVVNPESVSLHSQAVLLTCRSLVGPV
                     IRRYPITPMTMPVARVLVDRLASLRPRAQGVEREQVRMNGFRMEIIRPAGARRSLRDG
                     AVMYMHGGGFFLCGLDSHRPVAASLARRTGLPVINVEYRQLPDTSIAGSVADCLDAYR
                     WLLRHGAEPARIVFAGDSAGGFLTFATALRAAQAGLPAPAGLVGLSPLLDLDYQLKGE
                     YMNAARDAYIPMSAVRSMVRYGAEAEQALDPALSPVNGSLTGLPPALLIVGEDELLRY
                     DCELMAHRLTAAGVPNALELWRGQVHAFMSILPNMPESRAALARVARFVRARIEAEPT
                     ARTA"
     gene            complement(201517..202224)
                     /locus_tag="NONO_c01700"
     CDS             complement(201517..202224)
                     /locus_tag="NONO_c01700"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14990.1"
                     /translation="MMMRKFVATAAMLVAAVGVAAGTATADPAAPAAPESVYYKANVE
                     GDKAIVKTDSGSLVSEDGVFKIKAADGTTVAGTPLNFRVDDFEFPIAADIAGNTATLT
                     PQFDLQHAVYKPVALPFEDTAPWKTPYDREVAAFTRLKDTISTGATIGTLVGGIGGAA
                     IGCVAGAALGAAATGALLTLFGAGPLGGCVAGAAAVGFLGVLAGQIFVTAPVAIGAAI
                     QYYATINAPFNPPAPAK"
     gene            202511..203521
                     /locus_tag="NONO_c01710"
     CDS             202511..203521
                     /locus_tag="NONO_c01710"
                     /EC_number="4.2.1.46"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="AHH14991.1"
                     /translation="MAVVRLLVTGGAGFIGANFVHQTVAERPEVRVTVLDALTYAGNR
                     ESLAPIADRIEFVHGDIADSNLVDRLVAGADAVVHFAAESHNDNSLARPWPFVQTNIV
                     GTYTLLEAVRKYDVRYHHISTDEVYGDLAADEPAFTENTPYQPSSPYSATKASSDLLV
                     RAWTRSFGVRSTISNCSNNYGPYQHVEKFIPRQITNLIDGVRPRLYGAGHQIRDWIHV
                     DDHNRAVWDILDRGRIGQTYLIGARGELDNRSVVELLLAEFGRDPGDFDHVTDRPGHD
                     QRYAIDASLLRDELGWRPRYGDFRAGLAATIAWYREHEQWWRPQKENTERAYAAAGER
                     LL"
     gene            complement(203518..205134)
                     /locus_tag="NONO_c01720"
     CDS             complement(203518..205134)
                     /locus_tag="NONO_c01720"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH14992.1"
                     /translation="MTTRADEEAGDAGKPAADDAPAEQSGPENSAAPDIATEPHSDVV
                     SDSEAAGSASPIRRLWRGTGQHLGFAAAAFVVVAGIFGIVFAAITPPFWGHDEITQFG
                     RSYQVAHGGFTPERITDDRGISYGGQIPLSIDGMMSYAFTDYNRHPGEPDALAADEEA
                     YRRLGSAPVTGSATKQMWFTNTAAYSPVPYVPAAVGIRLAEAIGLDVGDTVSLTRLAG
                     LLAYLVIVAFALRALRGFRIQWLAFTVAVLPIALFQAGTVTADTVTNALAILVSCLLV
                     KGVFLDARLSRAEVVAALAATLALPLSKPTYVILAMLVVLIPARQYGFGRTLRWLPWC
                     FAALGAALFAVWMKIAAPTGDGMGLMRKPSEWHSVRPGDQLHGILSDPVHFLNTFGDS
                     VWFRDERWFDQFFGELGFAYIDVPALSMLACLLALAVSAGIADRLSGDRLRTWIVALA
                     VLASVAMIYVTLYMSFTPVGYWMIDGVQGRYFVPLAIAGLAVVLRWMPLRLTNSRGVT
                     PMRGPAITVVVATVIALAAAAIKYNVLVWG"
     gene            complement(205131..206099)
                     /locus_tag="NONO_c01730"
     CDS             complement(205131..206099)
                     /locus_tag="NONO_c01730"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glycosyltransferase"
                     /protein_id="AHH14993.1"
                     /translation="MDPTELRIAAIVPCHNEEAAVAKVVTDLKAAVPDIVVYVYDNRS
                     TDATAERAREAGAVVRIETVKGKGNVVRRAFADIEADVYLMIDGDDTYDAFAAPKMIE
                     ALLSGPYDHVLGVRKQDEGAQAYRAGHESGNRILNGVVGKVFGENVEDMLSGYRVFSR
                     RFVKSFPAVSREFEIETELTVHSLHLRVPQTQVRVGFRDRPAGSESKLRTYHDGFKIL
                     GLIFGLARHERPVAFYGLFGTLAWVVSIILTVPIIIQFYEIHSVPRFPTLFLAFTLLL
                     LGSLAWTAGLILDGIRRSRHEAARLMYLRYSAVGAELSEEAGQARR"
     gene            206221..206772
                     /locus_tag="NONO_c01740"
     CDS             206221..206772
                     /locus_tag="NONO_c01740"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH14994.1"
                     /translation="MRYRRRVASSETATESVDRTGDTWRRKAITALRRGAAFLVVGAI
                     GFLVDAGTYNLLVFWGGHGVMFDQPLAAKIIAILVATVVTYFGNKWWTFAHKKGGSPS
                     REYLLYALFNVVAIGLQLACLGFSRYVLHLSSPLSDNISGTVIGQIVAVIFRYWAYDT
                     FVFAESRSGDDVRNTRTESDPAA"
     gene            206869..208788
                     /locus_tag="NONO_c01750"
     CDS             206869..208788
                     /locus_tag="NONO_c01750"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glycosyltransferase"
                     /protein_id="AHH14995.1"
                     /translation="MDQSAGQAVTAIENDRRDAEPAPGIEPAVHRAPGRLVLARGVFT
                     GPAPKISDELYAVVKGKSHRARMSLRLEKGAHAHTNTYFGRFAASYWQRWTTVTEVEV
                     SFRIAVADRARVRLAASDIAGHRRIIDSADVNSDGVVVLRAPLDQYVDGGALWLEFDA
                     VGGELTISELAWTAPAPDRIRPVAIAICTFNRAEDCAHTVAALASDVEVLSAVDKVYV
                     VDQGTDLVSDRELFQRTQPRFGDKLRYIRQPNLGGAGGFTRGLYEVSSVDSFEGSDHA
                     DVILMDDDILCEPETVLRLNAFANLTVEPTLVGAQMLFLLNPDYLNVGAEEVHLHELR
                     HGQKVPKALRNTSMLKRNQERRVDAGYNAWWTCLIPAEVIARIGLPMPIFFQWDDVEY
                     GVRAREAGFVTVTLPNAAVWHADFYWKDFDDWARYFSMRNSLIVSSIHADLDPKAVTR
                     KLFRELSEYLVGMQYGLAHTTLQGIEDFLKGPKVLADGGIDALAAARTSRGEYGETKK
                     HAVATAPVRQSDVQMRRAGGEPSRPLLVLVKRAIQQWTGRTQHGVVGVTREDAHWWHL
                     ALFDHVVVTDASQSGVRIRQRDKEKARALLLRTWRVLRRLRRDLPELSRQYRTAQSEL
                     ISRENWARLYGISER"
     gene            complement(208849..209697)
                     /locus_tag="NONO_c01760"
     CDS             complement(208849..209697)
                     /locus_tag="NONO_c01760"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, SDR family"
                     /protein_id="AHH14996.1"
                     /translation="MTEAGKPLAGRTMIMSGGSRGIGLEIAKRAAADGANITLIAKTD
                     QPHPKLPGTIHTAAEELEAAGGQVLKFVGDVRDDEGVAAAVAQTVERFGGIDIVVNNA
                     SAIDLSPTETLSMKKYDLMQDINCRGSFLLSKTSIPALRESAEAGRNPHILTLSPPLN
                     LDPKWAGSSLGYTIAKYGMSLTTLGLAEELRKYGIGVNSLWPRTTIATAAVRNLLGGE
                     EMVQTSRTPDIYADAAYLVLTSPAKDTTGNFFIDDEVLAAHGITDLDKYRVVPGDGPL
                     STDLFL"
     gene            complement(210313..211071)
                     /locus_tag="NONO_c01770"
     CDS             complement(210313..211071)
                     /locus_tag="NONO_c01770"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH14997.1"
                     /translation="MSNPYGGQPPYGQPFQPNGAQPYPGAPQPPHGGAPYGAPQPYGG
                     NGAVAAPGYPPVQPHAGSQPHLAQPHNVSQPQPVPGWGAQPQPYGQPANPYGGQPQPP
                     MGGAPYGAPGPQFGAYGPPQFQPQPGPQGIVVDASYFPLAFMLALSGPKITVDGMPVP
                     VARWGQTHIPVGPGQHHVRVSTKWLWDMGPAQTAVPVAEGHTTHVFYKAPAIAFINGA
                     IGPVPQQAPGAIASYISLGLFGLLFVLRILLILV"
     gene            complement(211103..212047)
                     /locus_tag="NONO_c01780"
     CDS             complement(211103..212047)
                     /locus_tag="NONO_c01780"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="AHH14998.1"
                     /translation="MSGTDTAADPKDVNTHMVGSARIIAVVVTHKRRELLSESLKVLA
                     SQTRPIDHLIVIDNGNESDVGELVKQQPIESTYLGSEHNLGGAGGFALGMLHALTMGA
                     DWVWLADDDGRPEGPDVLAKLLDCAQRHGLSEVSPVVADIDDPDRLAFPLRRGVVWRR
                     LRSELGDEDFLPGIASLFNGALISAEALEVIGVPDLRLFVRGDEVEVHRRLVRSGLPF
                     GTCLQTAYLHPNGSAEFKPILGGRMHTQYPDDPVKRYFTYRNRGYLMAQPGMRKLLPQ
                     EWARFSWFFLVQQKDPAGLREWLRLRRLGRREQFHKPG"
     gene            complement(212044..212850)
                     /locus_tag="NONO_c01790"
     CDS             complement(212044..212850)
                     /locus_tag="NONO_c01790"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter, ATP-binding protein"
                     /protein_id="AHH14999.1"
                     /translation="MTGVSIETRDAWVEFPIFDAKSRSLKKAFLGKAGGSIGRNQSDV
                     VVVEALRDITLSLKEGDRVGLVGHNGAGKSTLLRMLSGIYEPTRGSAQVRGRVAPVFD
                     LGVGMDPEISGYENIIIRGLFLGQTRKQMLAKVDEIAEFSELGEYLNMPLRTYSTGMR
                     VRLAMGVVTSIDPEILLLDEGLGAVDAEFMKKARNRLRDLVARSGILVFCSHSNEFLA
                     QLCDTAMWIDHGTLRMQGEIEDVVRAYEGPEAGDHVAQILRELALEQKPA"
     gene            complement(212859..213683)
                     /locus_tag="NONO_c01800"
     CDS             complement(212859..213683)
                     /locus_tag="NONO_c01800"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter, membrane protein"
                     /protein_id="AHH15000.1"
                     /translation="MSDSQTFPRAFKDLREGFSQRELWLQLGWQDIKQRYRRSVIGPF
                     WITIATGVQAAAMGILYAAILNQDLWTYLPYVTIGLIIWNVINASILEGSDIFIANEG
                     LIKQLPSALSVHVYRLVWRQFLFFAHNIVIYLVMLVGFGVWKHLDWTVLLALPAIVLV
                     FLNSAWITIVFGILSTRYRDIAPILGSMTLMLFVLTPVMWTTKSLHDQGGAVSERAKL
                     VELVPTYHYLEIVRAPLLGDPVAGRSWLVVGVITVVGWAFAILALKQYRSRVPYWV"
     gene            complement(213811..214413)
                     /locus_tag="NONO_c01810"
     CDS             complement(213811..214413)
                     /locus_tag="NONO_c01810"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15001.1"
                     /translation="MDAMTQSDGAPDSIVVIGPEGRPLVIPAGAQGEAPFAGQVVGEG
                     DTAAEGERPGSEESLADMVEQPAKVMRIGTMIKQLLEEVRAAPLDDASRSRLKEIHKT
                     SVHELEQGLSPELRDELERLALPFGEDSIPSDAELRIAQAQLVGWLEGLFHGIQTALF
                     AQQMAARAQLEQMRHALPPGAQVPRDGGQGGSITGGGQYL"
     gene            214642..215847
                     /locus_tag="NONO_c01820"
     CDS             214642..215847
                     /locus_tag="NONO_c01820"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cysteine desulfurase"
                     /protein_id="AHH15002.1"
                     /translation="MTYDVARVRGLIPSLGDGWIHLDPQAGMLVPDSVSRAVSTGFRT
                     SAFSHTNRHAAARRSGAILEAAREAVADLVGGDPAGVVLGPDRAVLLAWLAESLSSRL
                     GLGTGIVLSRLDDEANVAPWLRIANRYGAHVRWAEVEIETCEMPAWQFEELIGPTARL
                     VAVTAASPIVGSAPSVRVAADRVHEVGGLMVADCFGAAPYALIDIDELNADVIALSAP
                     AWGGPQIGALVFRDPAFLDRIPSMSLNPYAKGAERLEVGGHQYALLAGLTTSIDYLAG
                     LDEQAAGTRRQRLEVSITSLQDYHDQLFEHLMEVLEHVPDLTVIGRASTRIPTVSFTI
                     AGMQAEKISAELADHRIGTISGAHGGSRLLDALGVNDEGGAVTIGLAPYTTKFEIEQL
                     GRALNSLEK"
     gene            complement(215923..216912)
                     /locus_tag="NONO_c01830"
     CDS             complement(215923..216912)
                     /locus_tag="NONO_c01830"
                     /codon_start=1
                     /transl_table=11
                     /product="putative quinone oxidoreductase"
                     /protein_id="AHH15003.1"
                     /translation="MYAVTLDGFGGPEVIRWSEVPDPAPPGPGEVAIDVLAAGVNRAD
                     LLQRQGFYPPPPGASDIMGLEVSGVVAQVGDGVKDPVPGTPVCALLSGGGYAQRVVVP
                     AAQVLPVPEGMDIAAAAALPEVAATVWSNLVMRAGLHAGQLLLVHGGGSGIGTHAIQV
                     AASRGVRVAVTAGSQYKLDRCTELGANIGINYREQDFVEMIGEMGGADVILDNMGAAY
                     LGRNVAALADDGQICVIGMQGGVKAELILSELLGKRGTIHATNLRRRPATGRSSKAEI
                     VAELRQHLWPLITAGTVVPVVHAEVPVTEAAQAQRLLDSPETVGKVLLRLDQA"
     gene            217028..217528
                     /locus_tag="NONO_c01840"
     CDS             217028..217528
                     /locus_tag="NONO_c01840"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, MarR family"
                     /protein_id="AHH15004.1"
                     /translation="MTRMAYEPNGHPASRPPWLSSAQQRAWRAFMDGHLRLMVELNRQ
                     LQDDSDMSLPEYRILVMLSESPGGSLRMSDLADGVLSSRSRLTHQIRRMEEQGMVRRT
                     SCEEDGRGVRAHLTEEGTRRLRAAAPGHVAAVRRTFIDLLSPDELTAVGDAFERVDTE
                     NDPRRT"
     gene            complement(217579..218547)
                     /locus_tag="NONO_c01850"
     CDS             complement(217579..218547)
                     /locus_tag="NONO_c01850"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipase, alpha/beta hydrolase family"
                     /protein_id="AHH15005.1"
                     /translation="MKYRSTENSSIRRVGVLAAAAALLGALHAGFATAHADPTPPQPY
                     PVPEQFLIDAIHGALQGGAASPPGTNDWSCKPSAAHPEPVVLIHGFLANRTDNWQTYG
                     PLLANNGYCVFALTYGSPDGNPDALLGGLTSMQSSAATLDAFVDRVRQATGADKVDLV
                     GHSEGATMPYWYIKLGGGAAKVGKMIGLAPAVHGLGGQAATGTGISTGSANGPAAFQF
                     LGTSDFVRQLAEGGITVPGVTYTQIVTRYDDVVIPYTTGIIDEPGSTNYVVQNLCPQD
                     YADHLSINSDPATARLVLNALDPDHPQPVECTLVLPAIGVPPGPGR"
     gene            complement(218636..219037)
                     /locus_tag="NONO_c01860"
     CDS             complement(218636..219037)
                     /locus_tag="NONO_c01860"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15006.1"
                     /translation="MTQANGAAARPRKRRPAADTQSRRLNAGIGGAGGGAALISIAQH
                     LGADTWPGLILMYAAPAIAVGYGGVVAQIQLWGDWTRERSLIRQARKTIEKAMHDPHT
                     SDEHKSELRMKLEQLDQAVTENHLERIKALR"
     gene            complement(219034..219294)
                     /locus_tag="NONO_c01870"
     CDS             complement(219034..219294)
                     /locus_tag="NONO_c01870"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15007.1"
                     /translation="MSGSFDVLVVAVGAAGTATVLSSSLRAWLSYRRSATTMQIAQGD
                     RIIELDSTNLRDALQIAELLTKRSGDSEIEAGAERVAPERAE"
     gene            complement(219403..219475)
                     /gene="trnR1"
                     /locus_tag="NONO_c01880"
                     /note="tRNA-Arg-ACG"
     tRNA            complement(219403..219475)
                     /gene="trnR1"
                     /locus_tag="NONO_c01880"
                     /product="tRNA-Arg"
     gene            complement(219514..219603)
                     /gene="trnS1"
                     /locus_tag="NONO_c01890"
                     /note="tRNA-Ser-GCT"
     tRNA            complement(219514..219603)
                     /gene="trnS1"
                     /locus_tag="NONO_c01890"
                     /product="tRNA-Ser"
     gene            complement(219690..220466)
                     /locus_tag="NONO_c01900"
     CDS             complement(219690..220466)
                     /locus_tag="NONO_c01900"
                     /codon_start=1
                     /transl_table=11
                     /product="putative carboxymethylenebutenolidase"
                     /protein_id="AHH15008.1"
                     /translation="MSGIYRDKAPLRDSEPTDGGSRQEAAGPVPITVIEPEGNARGGI
                     VVLHESRKFADVLLDMMKSLAGEGWIMVAPNLFHRVDQPATVDGAEPGTPAVEHVFGA
                     DLFADFDACFDWLVGRGVFADTIGILGFDQAGTAALLVATNRPIGAAVSVAAPGITAP
                     LTADATALLQAAPDLQAPWLGLYGDDDPTTPADDVERLRDAAARAAVATLVVSYPGLH
                     HRPDHPGFEMSDFEQLAEEEKRMLIDAQTRIFDWFDSHLR"
     gene            220630..221709
                     /locus_tag="NONO_c01910"
     CDS             220630..221709
                     /locus_tag="NONO_c01910"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phenylalanine aminotransferase"
                     /protein_id="AHH15009.1"
                     /translation="MSARIRPDLESIPAYAPGRSRPDAVKLASNESTSGPLPSVAKAI
                     AEAAELINRYPDNSSGELRAALADFHGVDVTNIAIGCGSVALCQELVQITCSSPADEV
                     MFAWRSFEAYPIVTQVGNATAVPVPLTEDYAHDLDAMAAAVTERTKLIFVCNPNNPTG
                     TAYGRRDLVRFLDAVPKHVLVVLDEAYFEYLRLPADDFADGVELGRDRPNVIVLRTFS
                     KAYGLAGLRVGYAVGHPDPITALLKVHIPFSVSRLAQAAALACLEAGPELLDRTDHVV
                     AERDRMRESLLAAGYRVPPSEANFVWLPLGEDSVAFGEASAEAGVLVRPYGTDGVRVT
                     AGDAHENDLFLRFATAPETVARFVG"
     gene            complement(221714..222766)
                     /locus_tag="NONO_c01920"
     CDS             complement(221714..222766)
                     /locus_tag="NONO_c01920"
                     /codon_start=1
                     /transl_table=11
                     /product="putative esterase"
                     /protein_id="AHH15010.1"
                     /translation="MDRRRIRRRLSGVAIAALLLCAAICSAPLTTAAPAPPADSGSAE
                     GPAPSVDNPPPSTPSIDHIEPSGDRRVRVFVRSPAMGRTLPVDVLLPADRSRPHPTVY
                     LLDGRSADAEYNNWIERGGAVQFFADKDVNVVLTLGGPAGYYTDWQHPDPVLGTNRWE
                     TFLTRELPPLIDATFDGNGTNALEGVSMGAEAAMMLTMRHPQLYRAVAAHSGCYAMGS
                     DVGQAQARAVVRTYGGDPDNMFGKENDPDWLSHDVMMHAETLRGKAIFLSAGSGLPGP
                     HDGPDNPESTTAIGFGGPLEAGASACTMALEDRLERMQIPATVDLYPVGTHSWPYWKD
                     ELPKAWPTLAGALGVR"
     gene            complement(222823..223872)
                     /locus_tag="NONO_c01930"
     CDS             complement(222823..223872)
                     /locus_tag="NONO_c01930"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity nickel transport protein"
                     /protein_id="AHH15011.1"
                     /translation="MRGVVGMAGAIVVLHVLGWGTLLLVVVPQHHSVNGAVYGVGLGV
                     TAYTLGMRHAFDADHIAAIDNTTRKLVVQNGRARSHTVGFWFSLGHSSVVLVLVCLLA
                     LGVRALAANLEDDNSTLERWTGLWGTSVSGAFLILIGLLNLASLIAIWRVFLRMRRGE
                     FDEARLEQHLQTGGVLNRILGPVLRLVRRPVHMYPVGVLFGLGFDTVTEVGLLVVAGG
                     AAATGLPWYAILVLPVLFSAGMSLFDAIDGSFMSYAYDWAFARPVRKIYYNLVITGLS
                     VAVALLIGGQELVSILVERLDVHSGVVAWIGNLDLGHVGFIIVAMFVLTWAVALAIWR
                     FGGVERRWEKTLTSD"
     gene            223994..224078
                     /gene="trnS2"
                     /locus_tag="NONO_c01940"
                     /note="tRNA-Ser-TGA"
     tRNA            223994..224078
                     /gene="trnS2"
                     /locus_tag="NONO_c01940"
                     /product="tRNA-Ser"
     gene            complement(224534..224845)
                     /locus_tag="NONO_c01950"
     CDS             complement(224534..224845)
                     /locus_tag="NONO_c01950"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15012.1"
                     /translation="MNDGPPIALGWVDPEAPALDWSMAQVRRLARRLGYHLVWAPDRS
                     RIPLVDQVREVGAEAVIAPSTMHFDFMTLNSLMAIADVETVHPRLSFARWATKPPAED
                     R"
     gene            complement(224998..225192)
                     /locus_tag="NONO_c01960"
     CDS             complement(224998..225192)
                     /locus_tag="NONO_c01960"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15013.1"
                     /translation="MPSSKPTIPKGVRNQWAVEHHDCYALPAVMDSTRAQFVLSLHAG
                     HGSSCLQYATALKAISTVLD"
     gene            225332..226165
                     /locus_tag="NONO_c01970"
     CDS             225332..226165
                     /locus_tag="NONO_c01970"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15014.1"
                     /translation="MPTADEFEQVRNDPDPIRRGLRAAELMIEYQQRATELARLRKVA
                     IEEAHQGGSSYTEIAEKLGVTKGRISQIRSSAPRRERAFFGVGPVAIGIPRRFGLEEG
                     RERPFFDANDQATQRAVEAMLAQLSLATTTFPIDPDRSDPPTGDCVIICGPKSAPVAR
                     NLLSGDPFLGFERDDDGWFIADARTGDHHRSPYCHDTSVRTDIGYFSRRSDGGRVIIH
                     IAGITSVGSLGVATWLSNNLTHVFDSGSRLVDGVVECEFDDDFAVTGSRVIVGPYMEQ
                     A"
     gene            226162..226959
                     /locus_tag="NONO_c01980"
     CDS             226162..226959
                     /locus_tag="NONO_c01980"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15015.1"
                     /translation="MKFTVAQLQEDSAGDRVIAADDYVVVLDGATSFDPDMPEAGTYV
                     DVLGSELSERLSSSAGNLRAILAEAIRGTAGKLSLVPGCAPSSTVAIARQHRGVIDTL
                     LLGDSYLVVGSSSDSYTVVTDSRLAQLNLEESREYRLRLSAGSGYGNHHRRILRSLQR
                     KQCSHRNRLGGYWIAEADPNAAEHAISSEYRVEDVPWMVLATDGAADCLAALDISWLQ
                     VAQSDADGISDLLGECHRWEEEDDPTGRLAPRAKKHDDKTLVVVTPG"
     gene            complement(227037..227870)
                     /locus_tag="NONO_c01990"
     CDS             complement(227037..227870)
                     /locus_tag="NONO_c01990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15016.1"
                     /translation="MAELVLTADRREELAGLLGDEQRLRTEYPKVAEYLDTAPMLTGT
                     GDDRADAAFDLRFVHYMTGGRTISTNPYWDIVAPSVFEHEGRRVTNGGRAKGSARLGF
                     AQTILQSAYAYAIPSPETIDWLSQFCAGRSVVELGAGRGYWAAQLANAGVQVAAYDSE
                     PPDSTENPSFGQAVGQPDVWLAVGDLDDYTARTVNGSDVLFLCWPPGWGNTMASEALA
                     AFEAAGGERLVYIGEPKGGKTGDDAFFDALSAGWTLSSEDSQFVSWWNLSDRAQAWVR
                     K"
     gene            complement(228654..228758)
                     /locus_tag="NONO_c02000"
     CDS             complement(228654..228758)
                     /locus_tag="NONO_c02000"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15017.1"
                     /translation="MSKKKHRPKTAPAVVVGAVVEVPGQVLLLLLLLH"
     gene            complement(229298..229918)
                     /locus_tag="NONO_c02010"
     CDS             complement(229298..229918)
                     /locus_tag="NONO_c02010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15018.1"
                     /translation="MIPGIIAAIAALAGVFLGGRLTQQREANNWSRDQQLKAYTELLA
                     VVEESSEAFTLLAAWFRGVDYEWSRIEKEPAKVRQLIADWDAGLAKLGKAVTAAELVV
                     SRELCPKVMSTRFASHRQQMVLMKFDYLKQIDAVEWKAVEDQAHTTVLKLRSALRDDI
                     QRTLGGYRLPLTARLRRVGRRATKLYRRRRAKLARPEYVIASEPES"
     gene            complement(230065..230700)
                     /locus_tag="NONO_c02020"
     CDS             complement(230065..230700)
                     /locus_tag="NONO_c02020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15019.1"
                     /translation="MHRRRGAYQYRYASVAFTIAMRVASGRCERHFRLSADAFTRIPA
                     PGGGSAATLVDPTAADPTTAATTIPKRASRAIWTSPRTVGPTPTPPTGTSTRAKGNSS
                     PATGESGTRLHRSTVACHSAASAKPHEGAHLERLKLQPSDGFNRPWLSVCRYPLVAVF
                     RNSFRHNGSAAVRPGPDLYADVCAVKVNGSSNRVPAFCSGGSPGPNLEVGQ"
     gene            230987..231265
                     /locus_tag="NONO_c02030"
     CDS             230987..231265
                     /locus_tag="NONO_c02030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15020.1"
                     /translation="MWNEYDLCAALTIRDYLDVAIDMLPIALAAKVSEYVRGPDSRFR
                     AVTVADSGNRMAAIAQVDPTGRGWWWYRVPDSGPILEDLARWDRFESE"
     gene            complement(231296..232072)
                     /locus_tag="NONO_c02040"
     CDS             complement(231296..232072)
                     /locus_tag="NONO_c02040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15021.1"
                     /translation="MTSEVPESTIPTDLIETVDSATRSLLDAVKTLRDSDIAEPSLLP
                     GWTRGHLLAHLARNADGLVNLLLWARTGIETPQYASQLLRDSDIEEGAPRPLAEQLDD
                     LRASATRFSGMSRAMPPERWEFRVRARTGKELPASVIPWLRLREIEIHRVDLNIGYLP
                     EDWPAPFVARLLPEVARSFHHTASAHRPPDAKPMTHDPDQPPPPSFTLEATDTDFTTT
                     VGPDPTDTISGPAAELLAWLIGRNDGVALKGYLPNLPPWL"
     gene            232186..233739
                     /locus_tag="NONO_c02050"
     CDS             232186..233739
                     /locus_tag="NONO_c02050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15022.1"
                     /translation="MRNRRLLPIALLGAALCAAACSSSGDAAGLHTDRDKPLTISLDD
                     LAARTGGTAVGFGRPQHGRLERTENGSLRYVPDSGFQGSDTFTVTTSDAVQLYTTDIP
                     ELGRFGGTTVQGSGFGSAWTPVPGSPDEFYGLTDRGPNVDGPDKDEKLVPIPDFVPKI
                     GKFRLTGTRAELESTIDLKNRAGVAFNGLVDSAASTGETIRDLDGHPLPPTDHGLDPE
                     GLVALPDGTFWISDEYGPFLVHVDASGKEIERLAPGSGLPKELSLRTPNQGMEGLTVT
                     PDGRTLVGIIQSALQTPGLGSAREVPMTRIVTVDLASRAVAEYVYPLEDPKSKLAVSD
                     IAALDDHTFLVDERDGELAPKANKKLWTIDLAGATDIGPRARIPGTRYDPELGLLIGD
                     QPLETHIGKVSTADAVTALRAAGITPVAKKSNLDLAGLLAELNPRGEFFGHDKIEGVA
                     TTDGGATLYLSDDSDFGLAGSTGKEPPFGLKAKTLPDGQQDTGEILRIDTRALPAKTK
                     TETVTVQVG"
     gene            complement(233913..234644)
                     /locus_tag="NONO_c02060"
     CDS             complement(233913..234644)
                     /locus_tag="NONO_c02060"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH15023.1"
                     /translation="MTAHEKDVGSVAVLERKDAPARGRLRIVRSLIAAAVAVAGICYS
                     SWILEFVLPIHLNPITSFLSELDAEGRPYRWVFDLGDTISGSLTVVSAVAALFVFSRR
                     RLWVVAWVALGCFGAATIADAQWPLHTCSAPCPPSDSGLFPQLHQIHALTSSLAVISI
                     FVAMIAFSVAAFRYRRWPILRHSGLWILLIGSAATAWMLIADNLAGNFALGIAQRIQV
                     GSMSLWLIALAVQIWVAERVSASAP"
     gene            complement(234733..235149)
                     /locus_tag="NONO_c02070"
     CDS             complement(234733..235149)
                     /locus_tag="NONO_c02070"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA mismatch endonuclease"
                     /protein_id="AHH15024.1"
                     /translation="MTSGRPLTDTATSARMSRQRRVGTAPEIALRSELHRRGLRYFVD
                     RAPLKGLRRRADLVFPRRKVAVYVDGCFWHSCPEHATRPKNNAQWWADKLAGNVARDR
                     DTDARLTAAGWTVVRIWEHEDATAGADRVQSALSGR"
     gene            complement(235284..236441)
                     /locus_tag="NONO_c02080"
     CDS             complement(235284..236441)
                     /locus_tag="NONO_c02080"
                     /EC_number="2.1.1.37"
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine-specific methyltransferase"
                     /protein_id="AHH15025.1"
                     /translation="MTNTRMVGLFAGIGGLELGLGYHGWTTELLCEIDPGARAVLSAH
                     FPDVESHSDVTRLRALPARTELVAAGFPCQDLSQAGRTAGITGDRSGLVDEVFRLVRR
                     KRGPRWLLIENVPFMLQLGRGQAMRHITTALEDLGYTWAYRVVDARAFGLPQRRQRVL
                     MLASRSEDPRPVLFGTDAGPRELGDPATDPCGFYWTEGVRGLGWAVNAVPTLKGGSGL
                     GIASPPAVRLPAGEIVTPGITDAERLQGFSRDWTEPALTAPGVRPGHRWKLVGNAVSV
                     RMASWIGGRLAAPDSAPLPPSTPLTAHRWPTAAWGHAGHAYRVPVSTWPVHAPYEDLR
                     WFLDDARLLSSRATAGFLRRAARGTLRFPPGFIADVENHLQRMGGLPEEAA"
     gene            236686..238587
                     /locus_tag="NONO_c02090"
     CDS             236686..238587
                     /locus_tag="NONO_c02090"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter, ATP-binding/membrane
                     protein"
                     /protein_id="AHH15026.1"
                     /translation="MSVVTSEAVSDSESDRTATADENSRVTGAGSLRRLWPQMRPYRA
                     ALFGSAVLSGLGMLCDIALPLVTAKIVDGPVAHRDFGAIWPPIGVIVVLALVSTLTSW
                     WRRHIIAAPASRLEVSLRGQLFERLQVLSVGVHDGMESGQLTSRAITDMSTLRRFFAF
                     VAPSLLSLSATLGIGVALLFVLSWQIGLVELLIAVPLVVLALRFEQGYGAASRAAQDQ
                     SGHLATTVEESAQGIRVLKAFGRGPWFGRRFRDQARGLRNLELVKVRLAARLWTALNT
                     FSMLGIAAALAIGGYLQTQQAMTVGALVAGITLTTYLQWPTMGLGFLLAETNHARTAA
                     QRFWEVIDTPIEITDPDDPIEPPERLRGELRFDRVRFRFPDTDRDLLHDISLRLRPGE
                     TVAVVGATGSGKSALLGLVPRLFDVAGGAVTIDGIDVRSMRLSRLRSQVSVAFEDPVL
                     FSASVRENITLGCPDATEEQIRDALEVACAAQFVDELPWGLRTRIGEQGLSLSGGQRQ
                     RLALARAVLDRHNRPGGHIVVLDDPLSALDVSTEEQVQRRLHAALAGATVLLVAHRPS
                     TAAWADRVAVLDEGRIIADGPHELLLETCSRYRELMGGDLNAGTSGRIGERVAAGGRD
                     RTHDLAHER"
     gene            238661..240502
                     /locus_tag="NONO_c02100"
     CDS             238661..240502
                     /locus_tag="NONO_c02100"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter, ATP-binding/membrane
                     protein"
                     /protein_id="AHH15027.1"
                     /translation="MPSSDTAPGPADSEWRGVAAEEGEQSDTVNLALAARSRRLLWSL
                     VRPYRLSAALALLLIVVDNAAMVATPLFVAHGVDTGVARAVHGDWLPLSLAVGGIVAC
                     TAVGGTTTFLFLRISGRLSQQVLFDLRMRVFTQVQRLSIDFHENYTSGKIVARLTSDL
                     ESLEDLLERALNDALSAVLSVATIAVILVWLDIPLALVVLAGFVPLVFVTRQAQRRQR
                     AGYRRTRTAIAKVVVHFVETMGGIRAVQAFRRERRNDVLLADSDAEYRAANTAALHGM
                     AGYIGSVRLISNTTNVVILVVGAWRVIHGHTEIGVLAAFLLYLRQFYGPIDELAQVFN
                     SYQSAAAALERISGVLEERPSVVEPETPHRLGRVRGELTLNEVDFGYPGREGAVLPRF
                     SLTVPAGQVVALVGATGAGKSTLAKLISRFYDPTSGTVSLDGIDLRAVADADLRRAVA
                     MVTQESYLFSGSVADNIRLGRPEATDTEVHAAARAVGLYDFAMSLPDGFDTDVRKRGG
                     RLSAGQRQLVAFARVFLADPAVIVLDEATSSLDIPGERQVQHALETVLRGRTAVIIAH
                     RLSTVAIADRVLVLDGGRIVEDGSPAELAESTGRFAALHTAWRESLV"
     gene            240519..241196
                     /locus_tag="NONO_c02110"
     CDS             240519..241196
                     /locus_tag="NONO_c02110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15028.1"
                     /translation="MRRDRAAASIVAYGRGVSKPAEGKSDVARASDGGVDAPPRWPAV
                     LTWRAHDASRMESVRVVLTGNRIRASGRIIAGDCGEHPAFSASYDLVTDELGRTKRLS
                     LRSTVASGERHASIARDEENYWLVDAGNTHVRSMFGGALDVDVVLSPFFNTLPIRRFG
                     LAHITEDVQVPVVYVRVPDLLVAEAILTYSSGADGIHVLSPVSSATVTVDDDGFVLDY
                     PGLAQRF"
     gene            complement(241197..242123)
                     /locus_tag="NONO_c02120"
     CDS             complement(241197..242123)
                     /locus_tag="NONO_c02120"
                     /codon_start=1
                     /transl_table=11
                     /product="putative prephenate dehydrogenase"
                     /protein_id="AHH15029.1"
                     /translation="MCVLGTGLIGGSLLRAAVAAGYRAWAYNRSETGARAARADGFDA
                     GSDIAAVLGRAADENALIVLAVPMPAVETVLADVRTFAPGCPLTDVVSVKEPVRAEVH
                     RQELGTYYVGGHPMAGTAESGWAASSPDLFRDAAWAVGVDPGTRAEPWARVARLALDC
                     GAVVVPVVAAEHDRAVARISHLPHVLAEALAVAGAAGGDLALGLAAGSFRDGTRVAAT
                     APELVRAICEPNAPALTEALDDALRLLTAARDSLRADGSLGELIDAGYSERDRYDTLR
                     RWDITDIRPGDENWLERLREAGQRGGVIRALD"
     gene            242206..242742
                     /locus_tag="NONO_c02130"
     CDS             242206..242742
                     /locus_tag="NONO_c02130"
                     /codon_start=1
                     /transl_table=11
                     /product="putative tRNA adenosine deaminase-associated
                     protein"
                     /protein_id="AHH15030.1"
                     /translation="MAQRSSTNRAASDDYDDVEGFAVAVVREDSTWKCTPLSAEALNS
                     LSTAEDELRELRSTGAVFGLLDVDDEFFIVLRPGPTGSRLLISDATAAIDYDIAVEVL
                     EALNIEVPDIDPDELDDIEPWEEGDLGVLADLGLPEPVLSVILTETDLYPDEQLGMIA
                     QRLGFADEFSAALDKLHR"
     gene            242739..243212
                     /locus_tag="NONO_c02140"
     CDS             242739..243212
                     /locus_tag="NONO_c02140"
                     /codon_start=1
                     /transl_table=11
                     /product="putative tRNA-specific adenosine deaminase"
                     /protein_id="AHH15031.1"
                     /translation="MSPASPGTTDEDLIRTALAAAAAADPRDVPVGAVVFDAHGRELA
                     RASNAREALGDPTAHAEILALRRAAEVVGDGWRLEGTTLAVTLEPCTMCAGALVLARV
                     GRLVFGAWEPKTGAVGSLWDVVRDRRLNHRPEVRGGVLESECAAVLDAFFRTHRP"
     gene            243259..243349
                     /gene="trnS3"
                     /locus_tag="NONO_c02150"
                     /note="tRNA-Ser-CGA"
     tRNA            243259..243349
                     /gene="trnS3"
                     /locus_tag="NONO_c02150"
                     /product="tRNA-Ser"
     gene            243828..244424
                     /locus_tag="NONO_c02160"
     CDS             243828..244424
                     /locus_tag="NONO_c02160"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase (GNAT) family protein"
                     /protein_id="AHH15032.1"
                     /translation="MRTATRDDIAGMVRVLAMAFAHDDPIEEYVFPDESVRHRRAPRM
                     LRTMITQRFLPAGGAEVAELDGRIVGVLLWYPDGYRPGGMREFLAGPAFLAAMGTAVG
                     RGIEVDRMMDRASPAEPHLFNVYLGTDPSLQRSGVGRALYESFTHKADSQGLSLCGIC
                     KDDNIAYYEFYGAERVGTVRLGTDGTEMNVMVRRPRPL"
     gene            244514..250876
                     /locus_tag="NONO_c02170"
     CDS             244514..250876
                     /locus_tag="NONO_c02170"
                     /codon_start=1
                     /transl_table=11
                     /product="polyketide synthase"
                     /protein_id="AHH15033.1"
                     /translation="MGVNAMNSEDDIAIVGIGCRYAGGIDSPESFWDFVINKRDGVTE
                     IPADRWDWRRYYDADRRTPGRMYTKRAAFMTGDPWEFDPDFFGISPREAAAMDPQQRL
                     VLEVVWEALDDAGVAGRSAGSGLGVYIGAFTLDQLAVSVGGPALPHVDMHTAAGASYT
                     MLSNRIAYALNLTGPAVTVDTACSSSLVALHLACQAIASGDCEYALAGGVTVMAQPEP
                     FVSMCKGGFLAADGRSKPFDAAADGYGRGEGAGIVVLKKLADAERDGDRVYAVVKATG
                     SNQDGRTTAITVPNADSQEALAKTVIERSGIPAHEITYVEAHGTGTPVGDPLELRAIG
                     RAYGAATGRQRPVGVGSVKATLGHTEAASGIASVIKSALAITHRTIAPQGWLDTPNPD
                     IPFEELGIRLQTEAEPVGPEVERMTVAVNGFGYGGTNAHAILQEYRSDAESDRAPRHF
                     GVLPLSARTENAVRQLARGVTELIAEGADPGRLAEAAWRRRQHHNHRVGVTFGDDTEL
                     VRALVELASGEGRVGRTVAKRTAEPVYVFTGMGPQWWGMARELLTTAGTFADEARRID
                     AVFTEIAGWSIVEEMLRPEEESKVTSTAIAQPANFLVQVALHAALREYGIEPAVVVGH
                     SVGEVSAAYVTGMLSLRDALLVSYHRARLQATTAGSGGMLAVGLAAEQARELIAGDAS
                     VDVAAINSPSAVTLAGDVDRLDEIAEKLTADGVFARRLQVEVPYHSHLMDPILDELRT
                     VLAGLTVAEPRIPLYSTVTGEQVTAADWDAEYWCANVRQPVRFADAISALVSAGNRVF
                     LELGPHPVLGANVREILIGAGETGTSVATLHRKQQDADSLRQTLAGLYAAGVLDIDRL
                     FGETPDATPHIDLPRYPWQRTRLRNELPEFRLLRHGTPDAHPMLGDQHPDEAGTWRVE
                     LSLAALPWLADHVVGGTRILPGAGYLDAALSAAAVRTESDQVAVADVRFVAPLVVDEG
                     EAPIVELHVEDSTRRFTIRSRGAAGTIWTVHAMGRLVEGGYAPLTADVPDTEQMVEVD
                     PAEFYAGLAARGLEYGPTFRRATAIRLSPTTVVAQLDGAIGQGERHLAHPAIVDAALQ
                     SVAALLAGRGGAQEGAMVPVGVHTVRRLAALPAEVTAVARLREGERPLADIDLLDAER
                     AVVMQIRGMEFGSLTPGRGPLQQMTDMFYEELWEQREPVDTAELPGDDGLYTLVLGYG
                     ENIDSRIERVRDAVASGSAGSAVVILDPSDTELEPQLAQRLRDIAGTDGVRRLHVCVV
                     PGHSPDGDVAALWMLRRIAVTLDGHLEERVTDHEIEIPLTGDGSVHATVVAAHAYALP
                     ADATPPDPSQAAIAGARRVLLNEQSRLRWRLVDIDAETTVADLSAELAIPGGFQYDQV
                     DEAVLRNGQRWTTVVTRTLPDRLDILDTAEPLTDPEANFELELPRSRSFARLGWRRCD
                     RRAPGAGEVEVRMRAVGLNYKDALKVIGVLGERELSETFFGMVPGMEGGGEVVRVGPG
                     VTDYAPGDPVSLTSKGMVARYHTTTTDALTHVRPDTDAARCSSVTAFTTAEYSLLELA
                     RIRAGDTVLVHGAAGGVGSAAVQIAKLHGATVIGTASTEQRRAQVLAEGADHAIGSRT
                     LDFVDQVLAWTGGRGVDVIISTAPGEILRQNFTVIAEFGRIVEIGKADIYTGGVLDLS
                     VFDKNISYFSFDLDRMLRRRRDEVMELGRKVNARFDDGTYRPLPFQKYGTAEVGRAFE
                     EVARSTRPVRVALDLTEEQPMVRPQLPEIEIDPAAQYLITGGFGAFGLAVGRWLAGHG
                     ARRLTLLGRGGATTDAAIAQLAAWSAQGIEVTVERVDITDAEAVAAVVARAHRPEHPL
                     RGVFHTAGAIDDKRITVMDEQSLAKVFRAKADGARALVAGIRAAGVRLDQFVLWSSGS
                     AMFGGVGQYAYTAANIALQAIGDSVLREGGSALVVGWGHMSGGGMADDEHIARYLRNT
                     GFDSITMDEGTEYLEQALRLGVTQASIIPVDWAKVNATAPFFAQTGRTRTLIAAAAQD
                     DSAAARLRVQLAELDESKRNEVVAFMLAEQLAEVMGVAVDSIDLTVPVPELGLDSLMA
                     VEFGALVTKSLGVELMSMKMGRSFSLEQAGARVAEAIVQGAGKSAA"
     gene            251025..252395
                     /locus_tag="NONO_c02180"
     CDS             251025..252395
                     /locus_tag="NONO_c02180"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 2-amino-3-ketobutyrate CoA ligase"
                     /protein_id="AHH15034.1"
                     /translation="MSESARDLARKLLAGTGSEASSPAAATAVAERKPAPARPRRGPG
                     RQFADHPEVAAMVQKRAAIAAVHEHSGTPNPMFLVRESPNDTVIRWQGRDLVNFSAYN
                     YLGLGNHPKVVQAAKDALDTYGASASASRIVAGEIPIYAELEQRLAGMYDVGDAMVTT
                     SGYLTNAGVIGFLLGAADVAICDSLIHGSVISGVQWSGARRLSFRHNDPESLRSVLQN
                     SRGSFDRALVVIEGHYSMDGTVGRVDEIAAIAREFDCAVMVDEAHSLGVFGARGHGIR
                     EHYGMTGESVDIWMGTLSKALGSCGGFIAADADLIAAMKAGAPGVAMLTGGPAPSTIG
                     AALAALDILDAEPERLHRLWSNAARFRTLLTERDLDLGISEATPIVPVIVPGELRAGY
                     VATTLLQRGFYAGAISSPAVPAGQERLRFFLTSEHEPAQLEAVADLLKESVTAAAQLP
                     DLGVTG"
     gene            252419..253360
                     /locus_tag="NONO_c02190"
     CDS             252419..253360
                     /locus_tag="NONO_c02190"
                     /codon_start=1
                     /transl_table=11
                     /product="putative F420-dependent oxidoreductase"
                     /protein_id="AHH15035.1"
                     /translation="MHVELRIFTEPQQGASYDDLLRVAKVTEDAGFDAFFRSDHYLKM
                     GDVSGLPGPTDAWITLAGLARETSRIRLGTLVTAATFRHPSVLAISVAQVDQMSGGRI
                     ELGLGAGWFSDEHRAYGIDLPEIGERFDRYAEQLAIVTGLWQTPLGETFDFTGKHYVL
                     QGSPALPKPVQQPGPPVIIGGAGKKRTPELAARYAAEFNLPFTPAEAAAAQFDRVAAA
                     ARDIGRDPAEIVRSAAQVLCVGRDEAEIARRAEAIGREVDELRSNGLAGTPSEVADKI
                     ARYRETTGITRLYLQVLDLSDLDHLELVAAEVAPQLG"
     gene            complement(253367..255676)
                     /locus_tag="NONO_c02200"
     CDS             complement(253367..255676)
                     /locus_tag="NONO_c02200"
                     /codon_start=1
                     /transl_table=11
                     /product="MMPL family protein"
                     /protein_id="AHH15036.1"
                     /translation="MSVYLFRWGRFAFRHKWIVLPVWLVLFVIIAGLGAQLKKPMNDD
                     FTIPNLPSERATEIMDKHFPGTSEAFSFEAVTGTYVIAAAPGQKLTDESQRAQIDGMV
                     AKLNGLNIVDHTTALVDPVTATEQMGCLGGDRTAPEFSSRCSAAPLNVLNKEQPDTVA
                     VLTVPFTIAKFADITDSDRKAAFAVGDDARAAGLQVEMSGSLAMEQQQPSGQAEMIGM
                     GVALVVMVVAFGAIVAAFVPIITAIVGLGLATSVIFLGTSFMSVPSFTTFLASMIGIA
                     LSIDYALFIVSRYKHELAVQSSPERAAGTALGTAGSAVVFAGATVIIALVALAIVNIR
                     FLTFMGLGGAIAAAFAVLTAITLMPALLGAFGRFLFKPKIPLIAQHDPEDDSMVTNGM
                     RVARVIGRMPVLTLILSIVILGLLAAPALDLNLGLPGEDSQPKTTTIRKAYDLRTEGF
                     GAGSNGKLEIVADLSDVPADRKQAALTALHDELAAYPGMDYVTQPQLSQDGGGALMTA
                     VPTTGPNDQATKDLVRDARDAESTLHDQYGIEYGITGTTAIYADVDHALLSKILPYLA
                     IVAGAAFLLLIAVFRSVLVPFTAALGFLLSMAATFGATVLIFQKGALGLISEPRPIVS
                     FLPIMLIGLVFGLAMDYQVFLVTRMREEYVHGKDPKEAMISGYHHGARVVTSAAIIMI
                     SVFGSFLLESDATAKSMGFALAAGVLFDAFLVRMVLIPSLLVLMGRSAWWIPRWLSKI
                     VPDIDVEGARLRDLEVDDPDEPKDPVRVS"
     gene            complement(255900..258290)
                     /locus_tag="NONO_c02210"
     CDS             complement(255900..258290)
                     /locus_tag="NONO_c02210"
                     /codon_start=1
                     /transl_table=11
                     /product="MMPL family protein"
                     /protein_id="AHH15037.1"
                     /translation="MSVYLYRWGKFAFRRKWIVLPVWLLIFVIVGSVGVLLKTQSQDN
                     FNMPNLPSQKATDILDKEFPGASEAFKFDAVTGTYVVKPTQGKLTDEENHKQLTTLIQ
                     KINDLRVDDQDIIDRDKIKGDPQHPGVLVDPVAATAAMGCTSGDRSNPDFVAKCGLAP
                     LNVLGKNNNADTVTYFTVPFKIKSFSDLTEAQKDAAYHVADDARAHGLEVELSGTIAA
                     QQMETGGASEMIGYVVAFIVMMVAFGALLAAFVPIVTGVVGVGMAGALIMAGTSIADI
                     PNFTTVLASMIGIALSIDYALFIVSRYKHELAVQDSPEEAAGVAIGTAGSAVVFAGMT
                     VIIALCGLSIVGVSFLTWMGLGGALAAFFAILVALTLLPAIMGATGRFLFKPKLPLVA
                     RTDTEDDAAVTNGKRFARIIAKAPWLTLGASVIVLGLLAAPAVNLSLGLPGDDSQPKT
                     STVRKAYDLRTEGFGEGSNGTLMVVADLSKVKPEQRKEAVTALHDKLAAYPGMDFVTS
                     PSTNKVDQKTKTPDYVNSTGAQMTAVPTHGPNNEDTQDLVKHARDAESELNAKYGMEY
                     GITGTTAIYSDVSNALLGKIVPYMTIVAIAAFLLLVLVFRSVLVPLTAALGFLLSMAA
                     TFGTTVLIFQQDKLGLIGDQHPIVSFLPIMLIGLVFGLAMDYQVFLVTRMREEYVHGK
                     SPKEAMISGYHHGARVVTSAAIIMISVFAGFVLMPDVTAKSMGFALAAGVLFDAFLVR
                     MVLIPSLLVLMGKWAWWMPKWLDRILPDIDVEGTKLRELQQRNRDEETVKEPVPVG"
     gene            258497..259084
                     /locus_tag="NONO_c02220"
     CDS             258497..259084
                     /locus_tag="NONO_c02220"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH15038.1"
                     /translation="MSARSTSGSVVAGQSTKDAIREAAIRLFSHKGFEQTSLREVADA
                     VGITKASLYYHYASKLDLLLAIIEPIFDDMNSVVDDLEGIPYSPQRSREVLDRQLRTL
                     MRHRTAGAMCVRDTVAIINAIGDRHPDLMEMHERLCRWLAGPEPTDEALLRASSALEV
                     LSTVLWSKGLVPDAPDEVIERVLLDAALTVLTGPR"
     gene            259084..259560
                     /locus_tag="NONO_c02230"
     CDS             259084..259560
                     /locus_tag="NONO_c02230"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="AHH15039.1"
                     /translation="MHITARVDHAVRILLEIARAEPNSVKAETIATAQGISPKILESI
                     AAELRRADLVISRRGPDGGYRLARPAERISVADVIRAVEGPLASVRGQRPEDVEYSGA
                     AAPLQRVWIALRVNIRAVLEQVSIADVAADELPDFVTELVADPGAWTRRPAPVAGA"
     gene            259696..261432
                     /locus_tag="NONO_c02240"
     CDS             259696..261432
                     /locus_tag="NONO_c02240"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter, ATP-binding/membrane
                     protein"
                     /protein_id="AHH15040.1"
                     /translation="MLIRLLRAFLAPYRTQLAGVVVLQVISVIAMLYLPSLNADIIDN
                     GVTKGDIGYIWTTGLWMLLVSGVQIVASAFSVYLGAQAAMGAGREMRAALLHRVGTFS
                     AREVGIFGAPSLITRNTNDVQQVQLLIVMSVTIVVMAPIMCVGGIVMALRQDLGLSWI
                     LLVAVPILGLTMALIISRMVPGFRRVQERIDVVNRVLREQITGIRVVRAFVRERQEVA
                     RFGVANDELTSASLFVGRLAALMFPAVMLISNLTTVAVIWFGGHAIDDGTMQIGSLTA
                     LLSYIMQILMAVMMASFLAMIAPRAAVSAERIAQVLETDSSVVPPAAPQSFTADPGIV
                     ELRGAQFKFPGAEEPVLRDISFRVEPGQTTAVVGSTGSGKTTLVNLIPRLIDATDGSV
                     RVGGTEVRDVDMDLLRSQIGLVPQKAYLFSGTIAENLRYGDPEATDEQLWEALEIAQA
                     ADFVREMPEGLQTPVAQGGTTVSGGQRQRLAIARALVKKPKIYLFDDCFSALDVATDA
                     RVRDALRPRTREAAVITVAQRISTVRDADQIVVLEDGAMVGLGTHEQLLRECEEYREI
                     VESQFSPEEAAR"
     gene            261503..263449
                     /locus_tag="NONO_c02250"
     CDS             261503..263449
                     /locus_tag="NONO_c02250"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter, ATP-binding/membrane
                     protein"
                     /protein_id="AHH15041.1"
                     /translation="MRPGAPMPGAPGQKAKSFGPTLKRLLARLAPDRIVVILILLLTV
                     AAVVMNTLGPQILGKATNLIFDGVISKQLPAGLTKDQAVASLRDQGQDRLAGMLSSMN
                     VNPGHGVDFSAVSRVLMLVLVLYIVAAVFNWLQAYLLATVINRAVQRLRSEVEDKIHR
                     LPLSYFDTNARGDVLSRVTNDVDNVAQSLQQTMSQLVMSVLSVIGILIMMFWISWLLA
                     LIALLTVPAAIIVTAQIAKRSKPHFVDQWKYTGLVNAQVEEAYTGHEVITAFGRVNEV
                     GAEFDKRNDKLYQASFKAQFISGLIMPVMMFIGNLNYVLIAVVGGLRVASGSLSLGEV
                     QAFIQYSRQFSQPLTQIGSMINLLQSGVASAERIFEILDAEEQIPDPAVQDQRPIDRG
                     RVEFDAVSFRYEADKPIIDELSLVAEPGHVVAIVGPTGAGKTTLVNLLERFYELDSGA
                     ITIDGVDITTVGRDRLRSRIGMVLQDTWLFGGTIRENIAYGNPEASEDDILDAARAAY
                     VDRFVHSLPDGYDTVIDEEGSGVSAGEKQLITIARAFLAKPTILILDEATSSVDTRTE
                     LLVQQAMAALRRDRTSFVIAHRLSTIRDADLIVVMEAGHIVEQGTHDALLENRGAYFR
                     LYNAQFAGAAVDQDLVDEETVDAV"
     gene            263531..264805
                     /gene="tgt"
                     /locus_tag="NONO_c02260"
     CDS             263531..264805
                     /gene="tgt"
                     /locus_tag="NONO_c02260"
                     /EC_number="2.4.2.29"
                     /codon_start=1
                     /transl_table=11
                     /product="queuine tRNA-ribosyltransferase"
                     /protein_id="AHH15042.1"
                     /translation="MIAAAWQDDGVSDPAQFAFTIGTRLPGRHGRTGVISTPHGDIAT
                     PAFVPVGTKATVKAVLPETMAEIGAQALLANAYHLYLQPGSDIVDEAGGLSRFMNWPG
                     PTFTDSGGFQVMSLGVGFKKVLAMEAVGVRSDEVIAEGKERLAVVDDDGVTFRSHLDG
                     SKHRFTPEVSMGIQHRLGADVMFAFDELTTLFNTRGYQEKSLRRTHEWAQRCIDEHER
                     LTTDRSHRPYQALFAVIQGAQYEDLRRKASRDLDAMRGSGGTAFDGFGIGGALEKANL
                     GTIVGWCCDELPEEKPRHLLGISEPEDFFVAIENGADTFDCVNPSRVARNAAIYVRAG
                     RFNINTSRFRRDFTPIDDECDCYTCAHYTRAYIHHLFKAKEMLAATLCTIHNERFTIR
                     LVDDIRASIDGGHYDEFKTEFLGRWQGRIRFD"
     gene            complement(264839..265516)
                     /locus_tag="NONO_c02270"
     CDS             complement(264839..265516)
                     /locus_tag="NONO_c02270"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH15043.1"
                     /translation="MIVTLFTATLMISNICATKGVQFFTGHEVSLGPIEVLPITTDGA
                     FFLFPLAYVIGDVLSEVYGFKAARRTIYYGFGMLILMVVCFWIAIGLPAAGFYDGQDA
                     FRSVAGTTPQLVAAGLAGYVVGQFLNSMTLVLIKERTKEKHLWARLLGSTVAGEFGDT
                     LIFCSIAATAIGINTWGAFINYVIVGFVWKTLCEVLVMPISYRVIAYLKKKEPSYAPL
                     DKSALFS"
     gene            265662..266189
                     /locus_tag="NONO_c02280"
     CDS             265662..266189
                     /locus_tag="NONO_c02280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15044.1"
                     /translation="MTNPGDSDEWWKQYGGEGVSSDSDAHPSVPSQPTPPPASPPPAA
                     GYPSAPGQPMPNQPAPPSYPSYPQPQPHQPQPYGQPNYGYPGGAMPYQPYGYAQPQQG
                     TNGLAIGSLIASVLGLCTCIGSIVGIILGIIALNQIKERGQQGRGMAIAGICIGAGAI
                     VLFIVWIIINVVASS"
     gene            complement(266197..267117)
                     /gene="gluQ"
                     /locus_tag="NONO_c02290"
     CDS             complement(266197..267117)
                     /gene="gluQ"
                     /locus_tag="NONO_c02290"
                     /EC_number="6.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-Q tRNA(Asp) synthetase"
                     /protein_id="AHH15045.1"
                     /translation="MIPHTAGAGRFAPSPSGDLHLGNLRTALLAWLFARCSARNFRIR
                     MEDLDRVRPGAAERQLADLAAIGLDWDGPVTWQSDRTRHYDEAIDRLTAAGMTYECYC
                     TRKEIQQAATAPHGPMGAYPGTCRDLGAAERAAKRAEGRPPALRLRSRTTEFEIVDEI
                     HGRYRGVVDDFVLRRGDGTAAYNLAVVVDDAAQGMDQVVRGDDLLPSSPRQAYLATEL
                     GLAVPRYAHVPLVLNTGGARLAKRDGAVTLRDRTALGETPGQVFALLAESLGYHGDTP
                     RALLGQFTPESVPRAAWILDPEHPNPLRHH"
     gene            complement(267114..267497)
                     /locus_tag="NONO_c02300"
     CDS             complement(267114..267497)
                     /locus_tag="NONO_c02300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15046.1"
                     /translation="MGVARIPDDLDLPPDETLDYAQRLLDEGLAFNAHEVLEAAWKNG
                     PFAERMLWQGLAQYAVGLTHIQRGNPKGARTLLERAIGRLDALDDPPYRIDASGLIAH
                     AEGLLSELDAGRNVPESALCPRLRG"
     gene            267985..268194
                     /locus_tag="NONO_c02310"
     CDS             267985..268194
                     /locus_tag="NONO_c02310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15047.1"
                     /translation="MEVDLSGAVWRKSKYSGPDGNCVEVAFLGDGNVGVRDTKDRGRG
                     PILAFEPDAWDAFLSGVTDGRFSPA"
     gene            complement(268250..269863)
                     /gene="qcrB1"
                     /locus_tag="NONO_c02320"
     CDS             complement(268250..269863)
                     /gene="qcrB1"
                     /locus_tag="NONO_c02320"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinol-cytochrome c reductase cytochrome b
                     subunit"
                     /protein_id="AHH15048.1"
                     /translation="MTVREFRAAGRADAIDQRYRAAAFVKRSINKVFPTHWSFLLGEI
                     ALYSFVILLLSGIYLTLFFDPSMTEVVYHGSYQPLRGVTMSRAYESALNLSFEVRGGL
                     FVRQVHHWAALLFAASIIVHLLRIFFTGAFRKPREGNWVIGCLLLILAMFEGFFGYSL
                     PDDLLSGTGLRAAFAGITMGIPLIGTWLHWLMFGGDFPGTIILSRLYVAHVLLFPGIM
                     LALIAAHVAIVWYQKHTQFPGPARTEKNVVGTRIVPVFVLDQGAFFMFTLAVVAVLGG
                     VLQINPIWNLGPYNPAQVSAGTQPDFYMMWTDGFLRLFPPWELYLFGHTVPAAFSVVV
                     LMTLVFTVLIGYPWIEKRLSHDRAAHNLLQRPRDVPVRTAIGAMALAFYLVLTLACVN
                     DIIALKFQVSLNATTWFFRIAMLTVPPLAYFVAYRMCLALQRADRAVLTHGIETGILR
                     RLPHGEYIEIHQPLGDVDASGRPAPLAYQGAPVPKKMNRLGLAGAPGSGSFLRPDPAE
                     QRERLDAAEHDQERRRMSALRGGRPSDLH"
     gene            269984..271567
                     /locus_tag="NONO_c02330"
     CDS             269984..271567
                     /locus_tag="NONO_c02330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15049.1"
                     /translation="MDCLTPQDATRFWLSRRACNDLFLLYCFDDTGCADERLRSAVIA
                     RSSRIPDLRLRIHEYRFAYPAWEPCDFDDSQFIVHSLGEPLWTNVEAALDALLGEGLP
                     AERYVWRLHILRGIRDAPGGEGPAVVVVLQLSHALADGRRAAAIARELLSGLGETGRG
                     TVVDGPRSVRAGTDAARDEVIRPDGDRLELRSSARDESVSNGELDRAALSTHVARASG
                     GGANLGGVRIGDIRQVEWKRLCHNMLRTLTAEVPALLSLPLDLVRTVARGFAAARAES
                     ELARLSDTGDIPGAARDFAPSLVNLGPAPTHRAVRMIVGEDLRVPGYTVTVVALTAIS
                     VALGDYLTGRGAPAADLGAQVSVAGTPDDPEKSRKAHPRNNYRDISVDFDIAEPDLRL
                     RADRIARTLVERRTRATHPLQSARGRVSEALPAPILRRDLANFPLDLVPDRISGHTVL
                     SSVHRGRADLSIAGGAVRFTAGFPALGSVMHLTHGLHGLGSGVTVSIHTDPQVLPDVD
                     EYARLLRTALREVADQLRD"
     gene            complement(271614..271886)
                     /locus_tag="NONO_c02340"
     CDS             complement(271614..271886)
                     /locus_tag="NONO_c02340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15050.1"
                     /translation="MNDIDDTGTYLDDRVRELHAALDRTDAHSAMQALGDIRRAVRPD
                     HTGNLGRLGDHDVESLSGNRESTYKITLIAITIVLFVGALIAILAS"
     gene            272152..274344
                     /locus_tag="NONO_c02350"
     CDS             272152..274344
                     /locus_tag="NONO_c02350"
                     /codon_start=1
                     /transl_table=11
                     /product="putative helicase"
                     /protein_id="AHH15051.1"
                     /translation="MPNQEYDDELRSEDRYVAGLYERLDAERARARAGYKAALRGGAA
                     LVERDAEVRALAREVRRLDIADNGLCFGRLDSVEGERSYIGRIGLFDQANEFEPMLLD
                     WRAPAARAFYVATAASPENMRRRRQFHSRGRRVVEFTDEVFGRPGAGERGDAALLAAV
                     NAPRGAGMRDIVATIQAEQDEIIRLDHPGVLVIEGGPGTGKTVVALHRVAYLLYTQRK
                     QMERHGVLVVGPNPEFLHHIGRVLPSLGETDVVFTTTGDLVPGLHCTADDTPEAARLK
                     GSLDILEVLAAAIADRQRLPEQPLTVELADVTARIDAETAEWARSEARASGLPHNEAR
                     AKFREIITYVITERAIARIGKGWLTRDDRDAWEDMRSDLTAELAENEQFTAALDQLWP
                     ILTPRELLAGLYSSPERLRSAGADSALWREQGDAWTVSDVPLLDELVDLLGPDRPADD
                     TAERERAAEAQYAAGVLDLMTGRADSMDDEDHLFATDLLYAEDLAERFTERDTRELAE
                     RAAADRDWTYRHIVVDEAQELSAMDWRVLMRRCPGRAFTVVGDLAQRRSPAGATSWDA
                     VFEPYVPGRWRYRTLSVNYRTPAEIMAVAAALLAEFAPGVQPPDSVRACGVRPWSRCV
                     TADELPDVIAEFVRDEADREGTSIVIGPPGVPGTVPASATKGLEFDAVLVVDPERILD
                     SGPRGAAELYVALTRAAQRLGVLHEGPLPQALTGLTEIDAGSGNRQLA"
     gene            complement(274512..274850)
                     /locus_tag="NONO_c02360"
     CDS             complement(274512..274850)
                     /locus_tag="NONO_c02360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15052.1"
                     /translation="MFEHWPERGEQALHRVVVPPMPVQVDVAAAIPTHPQIGRDAVAG
                     GIRSGGLDMTGRIPGRLHAWARAGDGTWLGLVEFELTTGNRRSRLPVTQWCPAHALIM
                     RGGSGPPGTG"
     gene            complement(274971..275861)
                     /locus_tag="NONO_c02370"
     CDS             complement(274971..275861)
                     /locus_tag="NONO_c02370"
                     /codon_start=1
                     /transl_table=11
                     /product="putative RNA polymerase sigma factor, sigma-70
                     family"
                     /protein_id="AHH15053.1"
                     /translation="MSERNEDATEAFVTHRNLLFTVAYEMLGSAADAEDVLQETWLRW
                     AEVDLDEIRDQRAYLVRITTRQALTRLRTLGRRKESYVGPWLPEPLLTTPDVAEDVEL
                     ADSVSTAMLLVLETLTPTERAVFVLREVFDLGYDEIAAAVDKTSAAVRQIAHRARAHV
                     AARRPREVVSAEESHRAIEAFRQAIETGDLQNLVDMLAPDVVLLGDGGGLVQAIQRPI
                     TGAARVARVLKTGLPRLRGLATMETAQINGRPALLFRVDGQIDDVLTVRVDDGLITGL
                     YVVRNPEKLSRVEQQTAVTR"
     gene            276023..276508
                     /locus_tag="NONO_c02380"
     CDS             276023..276508
                     /locus_tag="NONO_c02380"
                     /codon_start=1
                     /transl_table=11
                     /product="alkylhydroperoxidase AhpD family core
                     domain-containing protein"
                     /protein_id="AHH15054.1"
                     /translation="MEPRIDLTTDEFGAKFGKRFGNAAMLILQSELPAATRELVSLRI
                     SQINGCGWCVDMHTKDAAAAGETPVRLALVAAWRETTVFTEAERAALALAEEGTRIAD
                     AGPGVSDDTWARIREHYDQDQASALVSLVAMTNAANRLGVITHMRGGSYEPGVMAQAL
                     A"
     gene            complement(276678..276765)
                     /gene="trnS4"
                     /locus_tag="NONO_c02390"
                     /note="tRNA-Ser-GGA"
     tRNA            complement(276678..276765)
                     /gene="trnS4"
                     /locus_tag="NONO_c02390"
                     /product="tRNA-Ser"
     gene            complement(276810..277775)
                     /locus_tag="NONO_c02400"
     CDS             complement(276810..277775)
                     /locus_tag="NONO_c02400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15055.1"
                     /translation="MTGSNPPHGGPDQPGQGNRPNETVHWWSTPGTSEQPLTGTDPTM
                     MGGPPGPGPVTGTDPTVLGAGFDAYHSGGQWPNQQPPSQPAYPQQQFPPQYAPPQPGY
                     PQPPQKNNTPWIIGGVVGLIVVIGIVIGVVALTGGDSGGGSGSSSKKDGVDGNYSMSN
                     VTDACSLVDVTVLSKWAPTPKTPEHTERAPESYGGGNLSCRASYDGAGKYGSNGSDLD
                     FEADFKSKYGEPQYNSWKNSDTKTTGSGRTSGDIAGIGQSAYYAAYQQDYSSFVTLDY
                     TCAALDSNVSAKVELRIQSDSTINTTDVGTTCKDQLTKALAGMRK"
     gene            278157..279443
                     /locus_tag="NONO_c02410"
     CDS             278157..279443
                     /locus_tag="NONO_c02410"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aminotransferase"
                     /protein_id="AHH15056.1"
                     /translation="MPRQTQIGLMSHAELVSEHETQTANYAKLQTEKLTLDLTRGKPS
                     PEQLDLSADLLALPGAGDYRDGSGTDCRNYGGLHGLPELRAIFGELLGIPVENLLAGN
                     NASLELMHDVIVFAMLHGTVDSPRRWADEPIKFLCPSPGYDRHFAITESLGVEMIPIA
                     IGHDGPDVHAIAELVAADPQIKGLWAVPNYSNPTGVVFSEEVVRELVSMPTAAPDFRL
                     FWDNAYAVHPLTETAAPVIDVLGLAAAAGNPNRPFVFASTSKITFAGSGVSFFGSSTE
                     NLTWYLKYAAKKSIGPDKVNQLRHLRFFGDAEGVRRHMQAHRALLEPKFALVLRILED
                     RLGATKIASWTEPKGGYFISLDVLEGTAAKVVALAKAAGIALTPAGSAFPYGKDPEDK
                     NIRIAPSFPSLADLEQAMDGLATCVLLAATEKLLGK"
     gene            complement(279495..280370)
                     /locus_tag="NONO_c02420"
     CDS             complement(279495..280370)
                     /locus_tag="NONO_c02420"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methyltransferase"
                     /protein_id="AHH15057.1"
                     /translation="MPDTLATPTVEDMAPTHSSSADDYSASGLRPDRFDRAGRDQLTD
                     VNDLQAALPGIRDLRSWAHDALAVAPGESAVDIGSGTGSEVLVFADRVGPTGDAVGVE
                     PDPNLLAAAERRAAEQNSTARFVTGDAYGLPFGAGTFDAVLCERVFQHLTAPNRAAGE
                     IARVLKPGGRAVVVDSDWGTALVHPGDRGVVREVIETLISNTTNPFSGRRLPGLLTGA
                     GLVVDDIGSHALVQDATIGAGALVARISAMAVARGSITEAQRHELLAELEAGARSGDI
                     HLSVTMFAVLAHKPQ"
     gene            280407..280991
                     /locus_tag="NONO_c02430"
     CDS             280407..280991
                     /locus_tag="NONO_c02430"
                     /codon_start=1
                     /transl_table=11
                     /product="HhH-GPD family protein"
                     /protein_id="AHH15058.1"
                     /translation="MVSRKLCLAQEPEADELLSRDDFALLTGMLLDQQFPLEHAFRGP
                     KKIADRMNGFDIHKIAEADPQEFEELGATPPAIHRYGRSMARRTQDLARYVVEHYDGT
                     TSEIWTRDDPDGKEVLRRLKDLPGYGDQKARIFLALLGKQLGVRPAGWEKAAGAYSEE
                     NSRRSAADIVDNESLLEVRAFKKKMKAEAAAKKK"
     gene            complement(281004..281516)
                     /locus_tag="NONO_c02440"
     CDS             complement(281004..281516)
                     /locus_tag="NONO_c02440"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, PadR family"
                     /protein_id="AHH15059.1"
                     /translation="MSLRFAALGLLADGGPASGYDLLKIFEISLANAWPATQSQLYGE
                     LGKLTADGLIEIVEEGARGRKVYAITDEGRKQLRHWIIEEDPAPSRRDETMLRVFLLG
                     TVEPEERRAFLRKCAEALKQRLAAIDELEERIDWDDDDLSLYGHLVMDYGREFMRMRG
                     DWFAKTADRI"
     gene            281629..282213
                     /locus_tag="NONO_c02450"
     CDS             281629..282213
                     /locus_tag="NONO_c02450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15060.1"
                     /translation="MLKYYARSFLPWIVLAVGSGVDNRVGALGGLLTSVVLLAADRRA
                     GRRAEEIILDLSTAGFMAVFSAVAVALPDSRLLDYGAALAMVWLAVTAWTSLALRRPF
                     TLGIARRSVSAEIARLPAFVRINVVITTVWAVCFTCEAAALAYVQSHAPHNVAALVAC
                     KVGLVSAAAIFTARYPEYARRRAVAAASRMEEMA"
     gene            282210..283535
                     /locus_tag="NONO_c02460"
     CDS             282210..283535
                     /locus_tag="NONO_c02460"
                     /codon_start=1
                     /transl_table=11
                     /product="putative carotenoid oxygenase"
                     /protein_id="AHH15061.1"
                     /translation="MTSTTEPWLTGLLAPVPDEIDAYDLPLDGALPPELNGRYFRNGP
                     NPKPGETSGHWFVGDGMVHGVRLCDGRAEWYRNRWVRTSKFTEDAQFVRADGTFDRAA
                     VSANTHVIAHADRIMALVESGFPYELTPGLTTVGPMDFGGRLTTAMTAHPKRDPRTGE
                     LLFFGYGFAPPYLTYHRLSATGELVESRVVEVGGPTMMHDFAITDNHVVWLDLPVVFD
                     RELADGMPYRWDPAYPARLGVMPRAGGAVRWFDIDPCYVFHVGNAYEDVRGRIVLDAV
                     RYAPEDFSVIWSGIGGVADGERGDGSVGGTLHRWVLDPHSGTVTETRRDDRDVEFPTH
                     DDDRTGRPARYLYAAADSAIVKYDVEQGSSSAHELSADFAPGEAVFVPAADARGEDEG
                     WLLTIVSDRAGSASELVVLDAADLTRTAAVRLPRRVPAGFHGSWIPDAR"
     gene            complement(283595..284746)
                     /locus_tag="NONO_c02470"
     CDS             complement(283595..284746)
                     /locus_tag="NONO_c02470"
                     /codon_start=1
                     /transl_table=11
                     /product="putative alkanesulfonate monooxygenase"
                     /protein_id="AHH15062.1"
                     /translation="MSLSFHWFLPTYGDSRNLVAGGHGTSMAGDRPASLRYLNQIAGA
                     AEENGFEAVLTPTGAWCEDAWLTTAMLVETTETLKFLVAFRPGVVSPTLAAQMAGTFQ
                     RHSRGRLLLNVVTGGEPHEQQAYGDFLDKEQRYERTGEFLHVVRELWRSDEPVTFEGK
                     HIQVRGAQLNNRPDPLPPVFFGGSSAAAGPVAANYADTYLTWGEPLFAVSKKLEWIRK
                     LAVDQGRVLDYGLRIHVISRDTSEQAWAEADRLLSAVDPADVERVQANLAKSESEGQR
                     RMLELHGGSTDRLEIAPNLWAGVGLVRGGAGTALVGSHEEVAERLIEYSRLGITQFIL
                     SGYPHVEEAYWFGEGVLPILERKGLWTPPAHREKRVTTTPFATAAASSS"
     gene            285040..285741
                     /locus_tag="NONO_c02480"
     CDS             285040..285741
                     /locus_tag="NONO_c02480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15063.1"
                     /translation="MQIRKIAVLTALVATTLGSLAGTVNAAPAPAPDAVNYHATTTDK
                     GAVISTDSGSLVADNGVFEIKAADGTTVAGTQLKFRVDDFEFPIAADISGNTATLTPQ
                     FDLQHAVYKPVALPFEDSAPWKTPYEREVAAFTRLKDTVATGATIGTLVGGIGGAAIG
                     CVAGAALGAVATGALLTLFGAGPLGGCVAGASVVGFLGVLAGQLLVTAPVAIGALIQY
                     FTTINEPFNPPAPAK"
     gene            285985..286677
                     /locus_tag="NONO_c02490"
     CDS             285985..286677
                     /locus_tag="NONO_c02490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15064.1"
                     /translation="MVTAMAVAALTVTAGTVQADPGAESGAVNYQATTNEKSTIISTD
                     AGSLDAENGVFRIKAANGTTLAGTELKFRVDDFEFPIAADISGRTATLTPQFDLAHAV
                     YKPVALPFEDQAPWKTSYDREVAAWTRLTSTISAGATIGTLVGGITGGAVGCVLGGIA
                     GATVAAAAIVGLFGGFLPAAVVGCLGGIIAVGALGTLAGQLLVTAPVAVIAAVQYFTT
                     INAPFNPPAPAK"
     gene            complement(286745..287635)
                     /locus_tag="NONO_c02500"
     CDS             complement(286745..287635)
                     /locus_tag="NONO_c02500"
                     /codon_start=1
                     /transl_table=11
                     /product="putative beta-lactamase"
                     /protein_id="AHH15065.1"
                     /translation="MLAATAVLVPLAACDSDRSAGPSATSSMPEQFDNSAQDRLRGLE
                     AGLGGRIGVYAVDTGTGRIRAYRADERFPFASTYKALAAGAVLERNKPEALDSRIHYS
                     RDDLVAHSPITGQHVDDGMTLREILDAAVRYSDNTAGNLLFRAVGGPKPLQQQLHEIG
                     DDATSMDRTETDLNQTAPGDIRDTSTPRALGADLRYFALDAAVSQENRRILGGLLRAN
                     TTGDTLIRSIAPAGWDVGDKSGSGTYGTRNDIAVLWPPGRAPIVLAVLTTRDRPDAEY
                     DDTVVARAAAIAVTAMNAPQ"
     gene            287798..289009
                     /locus_tag="NONO_c02510"
     CDS             287798..289009
                     /locus_tag="NONO_c02510"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="AHH15066.1"
                     /translation="MVSSASQRISDRDLDDIFRPVFDRIAPGAVTREIDRRLAYEEVE
                     WLRQAGFGALRVPAEYGGFGVSVRQLFRLLIDLAAAESNLPQALRVHFSFVEDQLLAE
                     PGPAREHWLRSAGAGALVGNAITEPGVGAVDRYRTRLTPRGDGWLLNGTKYYSTGSLY
                     ADHILVAADRDGERLSVLVDATAEGVRRSDDWDGFGQRLTASGTTEFTDVEVSADRIL
                     GPGYGAPGPTYATSYLQLVQLAVLAGIAQRAESDVRDWVAQRTRSYTHSAADLPRRDP
                     LVQQVIGKLSAAAFSARSSVLAVADLLDEVLAAGAADETALDAVELAAAQAQLSVIDT
                     VLSATTELFEVGGASITSEDLRLDRHWRNARTISVHNPSIQKARAIGDHLLNGSPLPF
                     AWSAGSRAAQQ"
     gene            289006..290430
                     /locus_tag="NONO_c02520"
     CDS             289006..290430
                     /locus_tag="NONO_c02520"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-dependent oxidoreductase, nitrilotriacetate
                     monooxygenase family"
                     /protein_id="AHH15067.1"
                     /translation="MTRRIRLNAFDMNCVAHQSPGLWRHPADQSHRYKEIGYWTELAK
                     LLERGRFDGIFIADVLGIYDVYGGNDIAALRQGAQVPVADPLLLVSAMAAVTEHLGFG
                     ITTGTGFEHPFPFARRLSTLDHLTNGRLGWNVVTGYLPSAAANMGDAEHLDHDERYNQ
                     ADEYLEVLYKLWEGSWEDDAVVRDRERGVYVDPSKVHHIGHSGRHFSVPGIHLSEPSP
                     QRTPVIYQAGASPRGIAFAAGNAEAIFVAAPSKRVLAQTVTRVRDALEAAGRDRYAAR
                     IYALATIITDATDEAARRKYDEYRSYASVEGGLVFMSGWMGIDLSQYDLDAPIGEVRS
                     NAILSAVAAFQEFDDDGREWTVRDIAAWAGIGGMGPVFVGSGATIADRLQEWVDDTDI
                     DGYNVAYAITPGTFEDVVEHVIPVLTERGAYPREYVPGTLRNALFGAGDRLPDEHRGA
                     SYRLGGPGSTVLPEERVRPVVGSS"
     gene            290490..291866
                     /locus_tag="NONO_c02530"
     CDS             290490..291866
                     /locus_tag="NONO_c02530"
                     /codon_start=1
                     /transl_table=11
                     /product="putative monooxygenase"
                     /protein_id="AHH15068.1"
                     /translation="MTTQNTKRTAAIVGAGLAGVAAALGLQRAGFAVTIYSDRDQRAL
                     RDDIPATGTALIFGEAQAAEAALGLDTYADRAPNHTGLSVRIAGPGPERPELIGFDGH
                     FDGFVGLAVDTRLKVDERLTTFRERGGDFVVEAVTPERLDALAADHDLVLVATGRGGL
                     SDLFPIDTERTVYDEPQRRLLTVTVTGLGYGEDVFAHRSTAGGRHSGFSIFADQGEAW
                     WGPYLHKDAGPSWAFLGWARPGSDWEQRFATADSAESAHRVVTELYREYIDWDLPEVL
                     ATEVIAEDPHSWLKGAVRPVVRKGVGYTAGGHPVAALGDTAVAYDPIAGQGAQSGTIQ
                     AQRLVEAAAAHDGPFDSAWIEQQYAEFLAARSDAAAKVTRLFLSDPELADIGSRFFAA
                     AAVDQGVASALVSTLHQPQPLLGVNDLASADGLIEAIAGTGAEELVGRFEPAGRFERS
                     AYAETAPA"
     gene            292006..293124
                     /locus_tag="NONO_c02540"
     CDS             292006..293124
                     /locus_tag="NONO_c02540"
                     /codon_start=1
                     /transl_table=11
                     /product="putative alkanesulfonate monooxygenase"
                     /protein_id="AHH15069.1"
                     /translation="MTTEKIAEQTQFAYWVPNVSGGLVTSTIDQRTSWDFEYNKKLAQ
                     TAENNGFDYALSQVRYTASYGAEFQHESTSFSLALLGATERLKVIAAVHPGLWHPAVL
                     AKFGVTADHLSGGRFAINVVSGWFGGEFTALGEPWLEHDERYRRSAEFLEVVRKLWTE
                     DDVNFAGDFYRIRDLTLKPKPLNTPERPNPELFQGGNSTAARRNGGKHADWYFSNGKD
                     FDGVTEQIADVRAVARENNREVKFGLNGFIIARDTEAEARDTLREIIEKANKPAVEGF
                     RDAVQQAGASTRDGKGMWADSSFEDLVQYNDGFRTQLIGTPEQIAERIVAYRDLGVDL
                     ILAGFLHFQEEIEYFGAKVLPLVRELEAERKPELAASR"
     gene            293121..294335
                     /locus_tag="NONO_c02550"
     CDS             293121..294335
                     /locus_tag="NONO_c02550"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="AHH15070.1"
                     /translation="MTAVAAQRITSAAQARETAGALAAEFAVDAARRDRDRELPHREI
                     DRLSASGLLAVTVPAEFGGADLAPSEVAEVVRLLAAADPNIAQIPHSHFVYLNLLRLG
                     GTRSQREHHFGRVLAGARIANAQSERTGATVAEISTTLRPDDSEFRVDGTKFYCTGSL
                     FADTLAVLTRLDDPGERSGLSAGDYIAFLPADTAGVEIVDDWNGIGQRTTGSGTVTFT
                     GVRVRRDQLIPRAAAVNVPTGYGAFAQLLHVAIDVGIARGALDAAADFVRTRSRPWFE
                     AEVSRAADDPLLIQRVGELAVTVSAAEATFEAAGRAVDNVFTASAGAEAATASLAVAT
                     AKITADRAANEVSAALFEVSGTRSAAADLNLDRFWRNARTHTLHDPVRWKYQHIGRAV
                     LDGTPPPLHGVI"
     gene            294345..294857
                     /locus_tag="NONO_c02560"
     CDS             294345..294857
                     /locus_tag="NONO_c02560"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase"
                     /protein_id="AHH15071.1"
                     /translation="MSELTEIPADSADLRHAFAHFPSGVVAVCAENDGTPTGLVVSTF
                     VPVSLDPPLVSFCVQNSSTTWPKLLGARHLGLSLLGAHQDVAARNMSSRNGDRFRDLE
                     LRRGADGAIFVDGAVAWLEGAVHTQVAAGDHQVVLVRITRLATRSQHEPLVFHGSRFR
                     RLHPASAEVA"
     gene            complement(294840..295466)
                     /locus_tag="NONO_c02570"
     CDS             complement(294840..295466)
                     /locus_tag="NONO_c02570"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15072.1"
                     /translation="MVGLRDPVSGRAVEIVRPDDEDLPEALLRRIERLVFEWANLLTQ
                     YDAWSQIHALHRREPETVLRALSWLLALWAVVGETRVGKPADAIIRDLDYRGGWRDTE
                     TAEDERVWIGLTQRVRLGGIAALTEDPRAVRAYYEACTESVDIGPLLLQHTLIHLDAL
                     SQDMDRAGIRARGLATAVLDHTAPDPGPRRRLCFRPSRPGGSDLRDLG"
     gene            complement(295587..296207)
                     /locus_tag="NONO_c02580"
     CDS             complement(295587..296207)
                     /locus_tag="NONO_c02580"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH15073.1"
                     /translation="MKFGTFAATSIMAIAAVGISAGIVNASPPAASPAPAKEITASGI
                     DRGVGYHAVLSDFSRVLTTVVDHGRFEVNHDATAVDLKSDNGTSLVTVPLTYQVSGKT
                     VHVAQNISEDGHKIVLEPKADAKVIGEMQPIDSMTRLSNEINQNIVGMVVGGVIGGLI
                     GTVLGFGFLSIVTGPIGLVIGAIGGGYAMGGQPFMDALTAVVSGQP"
     gene            296408..297181
                     /locus_tag="NONO_c02590"
     CDS             296408..297181
                     /locus_tag="NONO_c02590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15074.1"
                     /translation="MHFSVVKNRKCSSIISRVVRSVTALEDGYVSRRRVQAGVTLTGF
                     VIAAALSAACLIAAVLSFTANRHESDQTKTAAAASATSVTTAAPTASPIAAEPSGAAT
                     TAPAAPEEPLILNKGADEKHPGETVTVGDCVAAVVAAPDGGAPVRKSACNGTDSRYKV
                     TAKVAEGGRCPADADRSVGETLPGGATDTVCLDYNWVAGNCMSVADSPEPIDCAATAP
                     GRVRVVEIKYGTTDVNTCTSGDRGFVYNERRFVVCVAHF"
     gene            complement(297186..298034)
                     /locus_tag="NONO_c02600"
     CDS             complement(297186..298034)
                     /locus_tag="NONO_c02600"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, SDR family"
                     /protein_id="AHH15075.1"
                     /translation="MKVLTGRKCLITGAASGIGRATATAAAEAGMRLILTDIDADGLA
                     GTVDRIRNAGGEVLAAQALDVSDYEAVTAWAKQVHEEHGSLDVVMNVAGIATWGTVEN
                     LEHRDWKSMVDVNLMGPIHIIENFVPPMVRAGRGGHLVNVSSAAGLLALPWHAAYSAA
                     KFGLRGVSEVLRFDLERHDIGVSLVVPGAVRTPLVGTVRIVGVDREDPKVRRMVNLFE
                     GYAVTPEKVAGQILNGVRRNKYLVHTSPDIRVGYWFARKFAWPYEMVARIANRQFPKL
                     LPGPGE"
     gene            298835..299218
                     /locus_tag="NONO_c02610"
     CDS             298835..299218
                     /locus_tag="NONO_c02610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15076.1"
                     /translation="MGAEETSKWQNFAGQARSGDLYLNDEAAARECLAACDARLLDLE
                     NLRNTVALTKRVSGFGDFDMGRALEEVFKKQAAGEPNSIDEVIKDNIEIVKNMREVMA
                     QSIKILTGQDVDNTGQINSTDPAGR"
     gene            299223..300554
                     /locus_tag="NONO_c02620"
     CDS             299223..300554
                     /locus_tag="NONO_c02620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15077.1"
                     /translation="MSYPMYNMPNLDLTMPTVRNWIGHNLTSWIAGEGIPDPTSPYSV
                     QETYNNERDSVRGKRSGIGFQGALRTPSVLSTDNFEQHDLETLRTKVDKIDIAAVGDL
                     SSAWGKIGTQEITSLTTFQQAMTKATSEGTWTGEASKAASQAVADHATQATAAAKAAE
                     LTGNKLAELNTGLDPTKKLVPHVPEHRTGWNNFRHLIAGRGWKNDDVAYHNAYAEAKR
                     VLSTVYAPVVHESDQGVPVIPKPNENQPKGPGDQPTPGPGPGPGPGTGNKVTGYPVGG
                     GDDPTKNQNPDQNPNSQDPNSQTPQSNSPEQSGESPNAGDQGPTTPAAATNAAGFDPT
                     SMGGGAGTPGGLGGGLGGGTGSGVPAGHGSAVPGTVGINAAGNAARAAGAGKAGTSGM
                     PGMGGMGRGGKGEKEDERTKKVADYLINQENGDELTGIPSLPKTIPPVIGE"
     gene            300570..301346
                     /locus_tag="NONO_c02630"
     CDS             300570..301346
                     /locus_tag="NONO_c02630"
                     /codon_start=1
                     /transl_table=11
                     /product="EspG family protein"
                     /protein_id="AHH15078.1"
                     /translation="MMEGKRWRFDAAQFRVLWDCTGRDVLPYPLAHRFVDEETLSDVA
                     RTRKRIAETLLPQLDSDLERAIEVLFDPEVRIEVAGFRGARREHKIRIHAAANDRKGV
                     LAVQEPGPEDTVGGTVHLSYLGTDALAAAVIAELPKCAAGQGKPMRIPIEDLDAPIPH
                     VRDPWKVDPKEQLSRFLSRPTSATFHIAAYPWGSPDNRHTKGRKDFQIIDFIDDGRYA
                     SFGDRVIQVKPTDSTKMTAQVRDMITRTIAEVRNGDHPKP"
     gene            complement(301376..301561)
                     /locus_tag="NONO_c02640"
     CDS             complement(301376..301561)
                     /locus_tag="NONO_c02640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15079.1"
                     /translation="MTREATENQLRRLADRADCAGYRLIRDHTRQPETWLLIDGEDGT
                     RVHSAPSLDRIEAWLNE"
     gene            complement(301637..301888)
                     /locus_tag="NONO_c02650"
     CDS             complement(301637..301888)
                     /locus_tag="NONO_c02650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15080.1"
                     /translation="MSIHLTEAAGWQAIWRRNPDQIRILAVHEIPSAAALFTEPEAIA
                     PDLAEMRDRMPELSPLWDAIRHDYWAGLTSDRPQSRHCG"
     gene            302607..303500
                     /locus_tag="NONO_c02660"
     CDS             302607..303500
                     /locus_tag="NONO_c02660"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding protein"
                     /protein_id="AHH15081.1"
                     /translation="MAGGSTLPRRALGRRMRELRATAQKSQLAAGLAIDVSKQGIGRL
                     EDGRPVRISRVQFRELLDFYAADEDAKAEVFGLLQEIKAARGDDQKFWWRPFTDVINP
                     NFNHFMSLESAASRMTSYRLTLVPGLLQTRSYRRWIVEASDPALSTAEVDHHVEVVAG
                     RKRKLSEPGFSFEVLLSECVFRHQLGGPEVMCEQLRHLVEVARLPNVSIRAIPFGAGT
                     HPGLVLGSFVLVEFPALHPGRMPEPPLIFTESFNGGLFVENEDVVKTYQGSLDELRAA
                     ASSEQDTIRLIEAIANEYCSM"
     gene            304458..305387
                     /locus_tag="NONO_c02670"
     CDS             304458..305387
                     /locus_tag="NONO_c02670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15082.1"
                     /translation="MAAVSITLRHMPSAPHEVVIDMFSEQPALVAALLTALGCPLPEY
                     ESVESQSEKATVLAPTEYYADAVLAFHRGGAPVLGVVVEVQLRRDPDKAWSWPVYIAS
                     LRARMRCPVLLLVICLDRRTARWAASPLEFGYGHPPATLCPLVLDPDVVPVVVDPGLA
                     VELPELVVLSAVAHSTHPQHMSIWKALVTALEATGSDPAMRYYDFVLAMLPAVVRPEW
                     EAFMSDLRNYEFRSDFARHYIAEGKAEGKAEGKAEGEALGEANSVLTVLEARGVAVSD
                     RVRELVVGCTDREQLGKWLRRALEVNRAEDLLA"
     gene            305443..305688
                     /locus_tag="NONO_c02680"
     CDS             305443..305688
                     /locus_tag="NONO_c02680"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15083.1"
                     /translation="MSSGLRDYEFRSDFARHYIAEGKAEGEALGEANSVLTVLEARGV
                     AVSDRVREVVMGCTDHEQLGKWLRRALEVNRAEDLLD"
     gene            complement(305734..306678)
                     /locus_tag="NONO_c02690"
     CDS             complement(305734..306678)
                     /locus_tag="NONO_c02690"
                     /codon_start=1
                     /transl_table=11
                     /product="putative erythromycin esterase"
                     /protein_id="AHH15084.1"
                     /translation="MTTSTTTVTQWIDQHARPLTSLDPSGPLTDLTPLREMVGDARVV
                     ALGASTRDAHEFFAIEHRVTRFLVEDMDFRSIALEGDDAASTALDEYVRTGTGDPRAI
                     FTQARSFWRFEELLAIVEWARHYNLDHPDDPVRIAHPDPDQHVTAQSGDLGDIEKMLA
                     DNVIEWQKRTGDKIVYWGGTAHTAGAATRTVLLGDQPVTHRNMGGYLRQHFGPDYVSM
                     ALTFDHGRTTYVFPSPPVDFAESALGGTNTAYVLNLHTAAPDEVREWLNSPAKTRLIG
                     PVYDPDHDADHHLSGGSLAEWFDVIVHQQTVTPAHPIG"
     gene            complement(306717..307937)
                     /locus_tag="NONO_c02700"
     CDS             complement(306717..307937)
                     /locus_tag="NONO_c02700"
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfotransferase (ASST) family protein"
                     /protein_id="AHH15085.1"
                     /translation="MARISQHLRHVVTAAIATSVGIGAASVPFAASAAPLPTFPVGAP
                     SYTVDVNTPAAAPGYIYYSNGVSAAALVPGAGRALAGIPAAAPANIVVDKSGREVWRY
                     TPPAGQDVSNFRTQTYQGKRVLTWWQGDTVGGHGSGTDYIADEHGTVLETLDAGGDST
                     DVHEFRLTPDGRALITSYREVDADLSAIGGPQHGKMFDTVASVVDVASKRVLMRWSAA
                     EHVPLTDTTAPGKLPGSDAYDPYHMNSIALDPDGNLVISMRDTSTVYDVDIHTGAINW
                     QLGGKNSSFELGPGVEFAFQHDAEFADPDTLRLFNNNSSGFETKGLSSVQWIHLDRAA
                     HRATLVRNQTHPDSLVAFAMGDAQPTANGNTLVGWGMAPHISEFTPSGEMVYDARLPL
                     GTYRAFPADWAPGR"
     gene            complement(308056..310755)
                     /locus_tag="NONO_c02710"
     CDS             complement(308056..310755)
                     /locus_tag="NONO_c02710"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase"
                     /protein_id="AHH15086.1"
                     /translation="MNIPELSDTVRLDCDVLVIGGGTAGTMAALTAAENGANVLLLEK
                     AHVRHSGALAMGMDGVNNAVIPGKAEPEDYVAEITRANDGIVNQRTVYQTATRGFAMV
                     QRLERYGVKFEKDAYGEYAVRRVHRSGSYVLPMPEGKDVKKALYRVLRQRKMREKIQI
                     ENRLMPVRVLTDNGRAVGAAALNTRTGEFVAVGAKAVILATGPCGRLGLPASGYLYGT
                     YENPTNAGDGYAMAYHAGAELSGIECFQINPLIKDYNGPACAYVANPFGGYQVNAAGE
                     RFVDSDYWSGQMMAEVSREIESARGPIYLKVSHLPEETLGALEGILHTTERPTRARFH
                     ANRGHDYRTHDIEMHISEIGLCSGHSASGVWVDEHARTTVPGLYAAGDLACVPHNYMI
                     GAFVYGDLAGEHASSTLTDVVAPEALPDDQLAAAHSLIYRPLRHPDGPPQQQVEYKLR
                     RFVNDYVAPPKTQTKLSLAVETFERMRADIAEMGASTPHELMRCAEVDFIRDCAEMAA
                     RSSLTRTESRWGLYHDRADLPERDDQDWRFHLNLRKSADGEMEFLKRPVAPYFVPVPE
                     WEDVPSQVAPVTVAQPELTAGPPRTGAADGAGTPRPGITVPAPADNAAAPRIAVLLSL
                     DAPSVADLRGFLDDADPRVRATALSVLTEGTPDGFADALIDALGDAEGSVRAAAVSGL
                     RELIEILPPADGLADHAGSPDPLVRAAVVDLLRAQRRGSADLFGKAAVDSDHRVRIEG
                     VRALVSVNDWSALTAVAFDENREVRVAVAHGLAEVGAGGAETVRGLAADRDPLVRAAA
                     LAAFAALGDDSDTALLSAALKDSAWQVREGGARGWTGLGPAAAAQALAPVLSDPHPDV
                     RKAAVLTLGNWPAHTEVRDALQVVLEDTDADVRAYARRTLEVA"
     gene            complement(310890..311645)
                     /locus_tag="NONO_c02720"
     CDS             complement(310890..311645)
                     /locus_tag="NONO_c02720"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter, ATP-binding protein"
                     /protein_id="AHH15087.1"
                     /translation="MTATAMGLRVDRVELRYGGAPVLADLSLDIRAGEILVLTGASGC
                     GKSTVLRALAGLLPPRAGRVLADGAEVTGPSRDRAMVFQDNALLPWRTVRSNIELALK
                     LRGEPRATRREQAERWIEEVGLTGFGDYLPKSLSGGMRQRVQLARGLAGAPRAVLMDE
                     PFGALDTPTRITMQRLLIQTWQTHPTTVVFVTHDVDEALTLGDRVAVLGGTERALRSL
                     IAVPQPRVKDVDRSAERAEILAALNYSAEGAAA"
     gene            complement(311642..312502)
                     /locus_tag="NONO_c02730"
     CDS             complement(311642..312502)
                     /locus_tag="NONO_c02730"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter, permease"
                     /protein_id="AHH15088.1"
                     /translation="MSATTLPVEAVPERAEAAPAAERGGVARIWSSRLVRVGSVVAAL
                     VAWQLLTANHIRLWVRFDTLPTVTQILHTLRSQLGTDTYWLDLGQSLIRILSGFGLAA
                     VFGVATGVALGRSRWFADVFGPLTELARPIPAIAIVPVAILLFPTDEAGIVFITFLAA
                     YFPIMVSTRHAVRALPTIWEESVRTLGGSRWDVLVRVVLPGSLPGVFSGLSVGIGVAW
                     ICVVSAEMISGRLGVGYRTWQAYTIVDYPGVFVGIITIGVLGFATSAAIELLGRRATR
                     WLPRAQEVSK"
     gene            complement(312499..313926)
                     /locus_tag="NONO_c02740"
     CDS             complement(312499..313926)
                     /locus_tag="NONO_c02740"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter, substrate-binding
                     protein"
                     /protein_id="AHH15089.1"
                     /translation="MKFRRARIAAAAALIASLAAGCSLEQTGSGDTVKVVVGYQSKTI
                     NTVTAGTLLRAKGFLEKRLNDLTAKGGPKYQVEWQDYDTGAPITAQMVAEKIDIGSMG
                     DYPLLINGSRTSASDRSATELVSITGYQPRGSLNMVVTAPNSTATTLSDLAGKKVSAS
                     VGSAGDGTLRQALSRAHIDPAHGVDVLNQQPQIGASALESGQVQALSQFVAWPGLLVF
                     QNKAKLLYDGAELNVPTFHGVVARRAYSAQHPEVLDAFLQAQLDATDFLHNKPLEAAQ
                     LVADNSGLPAEVVYLYNGPGGTSFDTPLKPQLIQAFKGDVPYLKSIGDFADFDIDKFV
                     DDAPLRKAFAERGANYDAAVANFANPAPIAGTDPSIGKPVADPATAGEIWYDGQPTAT
                     PAASPTDLLRAVKAARAAGKKVRAAYVPDAELGTRWFADKALWVHAGDTYLPFITPSA
                     VQRYQAAHPGAVAVSYDQAIGEVRS"
     gene            complement(313994..314221)
                     /locus_tag="NONO_c02750"
     CDS             complement(313994..314221)
                     /locus_tag="NONO_c02750"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ferredoxin"
                     /protein_id="AHH15090.1"
                     /translation="MASVNQRADVPVTIDESLCIEGCTLCVEICPLDSLAINPENGKA
                     FMHVDECWYCGPCAARCPTGAVTVNMPYLLR"
     gene            complement(314196..315065)
                     /locus_tag="NONO_c02760"
     CDS             complement(314196..315065)
                     /locus_tag="NONO_c02760"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, GntR family"
                     /protein_id="AHH15091.1"
                     /translation="MTADPVPLRQPAEGPHPASGSAHPASGADVANGARSIRKADRAR
                     QVADVLRQQIHSGRCPDPLPTEAELAAEFAVSRNAVREALALLRDEGLIGRVPRVGTY
                     VAQRKYDHDLDSLRGLKETLRGHGEVRNEVRAAVRLVPPPAVANRLALEPGESAVYLE
                     RLRYLGDLPLSLDHTYLAPDIGAQILDCDLRSEDIFALIERISGQSLGSADLAVEAIT
                     ADIHSAATLQAPEGSALLLLERLTYLADGRPVDLEYIRMRGDRITLRNSLVRTAEGND
                     WRLSPHGVGQSAG"
     gene            315564..316841
                     /locus_tag="NONO_c02770"
     CDS             315564..316841
                     /locus_tag="NONO_c02770"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="AHH15092.1"
                     /translation="MTSPTLERRSSSSTARPVRSVPRPVVPPELRITDNPAAAVLRAA
                     TRGPIFRDNAAQTTGLSIATVNRQVSALLSSGLLRERADLTASGAVGRPRVPFEIDTD
                     RFATLGVHIGANLTRIVAADLSGRILGGLEIATPQAAQDAAITIIARSAKAFLDRLPR
                     RRPLWVGVALAGRVDPVAGVVDHPRLDWQSAPVGPIFATVLDLPVSVAAHVEAMAAAE
                     LLLSTGAPERTGERPGSSLYIYGRETVGVAVTLHDRVYTPANGPGSIAHLPTGSDIDC
                     SCGRRGCLEASVGEAGVLARAVRAGIVPKREAPRKPMIAELYRAAEQGSAPARDILVE
                     RAEILGRTAALVRDMFNPDRVVLGGQAFTGYRPGLERVVQAFGQATTLAPADLRISRF
                     GGRVQEHAAAVTSLSVCYADPLSALRRATRAAR"
     gene            complement(317002..318618)
                     /locus_tag="NONO_c02780"
     CDS             complement(317002..318618)
                     /locus_tag="NONO_c02780"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15093.1"
                     /translation="MLNFRGGALGALLLVGTGLFATAPLAQAQEAAGVAITADVKLSD
                     EGLLEVSETVKVPEGGQFRMALPLRVALGDDGERRFSVTDISTTGPGSAQVSGDVFSV
                     EAPPGESSFKYTVHGAVSDAPGSQLFRWTGALNTDVSSFDGSVISPSYQMGIADCNVG
                     PVGNARKCKDARVEPDGVLTMHEDNLHKGDVLDVTLQLPPGTVKPNADIRDGKDSGPF
                     AVTAPVLIAFGVLLLALAAFGGYLAWARRQDAAALTTSETLDPLRRNGKHTEFVSPDG
                     MLPGEAGVLIDGSADAVDIAATVVDLAVRRYLWITPAGDSDWRITRVNAPDDQLRDYE
                     KHVYATLLPEGTDAVLVSELRAPGRVAADPARTALRRDAIERGTLIDHDRRGLSFWIG
                     VALLVIGVGATIGLAVSGGYALVGVAIALGGAAMLLLGRYLPMRTATGRALAAQVKQL
                     QNGLDAQRPDQIAPADHELVFSRALPFTIIGGRADNWIRTFRDVDLAADRQAGLYWFG
                     GFDRDRNLHRFAGHFPYFITALEGLFSAAD"
     gene            318967..319896
                     /locus_tag="NONO_c02790"
     CDS             318967..319896
                     /locus_tag="NONO_c02790"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15094.1"
                     /translation="MPPPQPYGPAGRRPPPRKRGGGRFASAIVVLLLIVTSGLIRVAV
                     RTGFDTATHSGDHSNYTYAPKPGSDSTGVDATSTNPLLAEPGSPLSPANCPYSSWSTQ
                     VDAARKFFESAATCLANAWQPVLQQAGLPFTAPKLLVSASTSGITTPCSGSSSNFAAF
                     YCGADQTIYMPISQLQTDMFGDHWEVYLSVFAHEYGHHIQALSGILGAANKQRRQNGL
                     YSTQGLELSRRVELQANCFDGMYFASSAGGKAVTPIQAQNARKDAYGRGDTASDMRDH
                     GTPEHAGDWWSAGFDKNATAQCNTFTAPSGQVS"
     gene            319901..321124
                     /locus_tag="NONO_c02800"
     CDS             319901..321124
                     /locus_tag="NONO_c02800"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15095.1"
                     /translation="MTQPPGFPPPGRGPYGPPPGYRPPPGYGPPPGYGPPPGYPPPGY
                     GPRPPYGAPLPPPGVYPMGPHGIRPLPPPGYYPPPRRGGGAAGAVFAVLAVFVVVGGL
                     VAFATMGGRDNSSSSYATSTPSFTYTTPSWPSTSESTTYTTSSAPTTTRSAYRTTTVV
                     TTTKPAGPQPVAATATNPLFGDQNSGLINVSCDYPRWGSTVAAATAFFQAAKSCLDRM
                     WQPLLASQNLPFSSPTVSVPASGANAVSPCTSSGGSYAAFYCSTNNTIYMPLDHIQTE
                     MYGDRWYVYLAVFAHEYGHHVQAISGISKKSNRDRYDAGVNSSTGLELSRRLELEAQC
                     FAGMFFGSSLYVGTITNDQGYFVKQDNYDRGDDHSDVRDHGTNQHYGAWYAQGEEHNR
                     TWMCNTWNSPSDAVS"
     gene            complement(321134..321814)
                     /locus_tag="NONO_c02810"
     CDS             complement(321134..321814)
                     /locus_tag="NONO_c02810"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH15096.1"
                     /translation="MSPRRQRSARGSGTELRAEILAATRELLARTGNADSVSIREVGR
                     LVGVTAPSIYRHFADKDDLIDAAVAEVFSELDAAIAAATDPADSPIARMREQGLAYVR
                     FALRHPGQYLVATGGVGSGPTTVDQVLGSGAFQRFSQTVRDAMDTGLITPGDPMPVVL
                     ELWSTVHGVVSLMIAKPYLPWGDPEQIADRVMAAACLGRAVLDVIGGDTPDPDEGARW
                     VARIREQR"
     gene            complement(321814..324066)
                     /locus_tag="NONO_c02820"
     CDS             complement(321814..324066)
                     /locus_tag="NONO_c02820"
                     /codon_start=1
                     /transl_table=11
                     /product="MMPL family protein"
                     /protein_id="AHH15097.1"
                     /translation="MLTRIARLTTRYPKRVLLAALALALLCGGFGATVAGHLQAGGFT
                     SSNAESTRASKLVADHFGGAEPNLVLVVHSDEGVNSKAARAVGTGLAERLGARQDTIG
                     VHSYWDSPPQVASALRGTDGKSALIMAYLTGGDDKAQRTAGDIEATLGDTPPGITVHA
                     GGSAAIFHDANDQVTKDLTLAEGIAIPLTAIALILVFGSVVAASLPLAVGIFAILCTL
                     ALLRGFTLITDVSIYALNMTTALGLALAIDYSLFIVSRYREELTAGANHQDAAVRAVQ
                     TAGRTVLFSALTVALALAVLSVFDLYFLKSFAYAGVAVVATAALASIVILPAVLVLLG
                     DRIDAWNLRVAARKLLRRPEPVPRAEEETVWYRTVTWVMRRALPVSIAIIAILLAVGA
                     PFLGVRFGYPDDRVMPAASTSRQAGDELRAQYPVVNSGTGVTIVLPGAPAGPAVVADY
                     AAALSKVDGVRAVLSSAGAYTNGASAGGAAAGMANDTGQYLTVTTKFDPYSQDGKDQL
                     QKLRDVPPPAPALFGGAAAMNTDSLNALGSRLPLAIALIVVATFLVLFLFTGSVILPL
                     KAVVINSLSLTAMFGMMVWIYQEGHFASLLGFTHTGFLVPTMPILMFCLAFGVSMDYE
                     VFLLSRIREAWLASDRSAAANEHSVALGVARTGRIVTAAALLMAIVLGAMITSKVSFM
                     QMFGLGLTITVLADATVIRMLLVPALMRLMGRANWWAPAPLARWHERFGLTEQAPAPV
                     VAEPEPAGRM"
     gene            complement(324158..325468)
                     /locus_tag="NONO_c02830"
     CDS             complement(324158..325468)
                     /locus_tag="NONO_c02830"
                     /codon_start=1
                     /transl_table=11
                     /product="ammonium transporter"
                     /protein_id="AHH15098.1"
                     /translation="MPSTIDPAATAWLLASTALVLLMTPGLAIFYGGMVRTTGVLNML
                     MMSFISIPLVTVVWLLLGYTLAFGDDAGGGVIGNLEHFAMAGIDPGTVRSGIPELLYA
                     TFELAFAILTVALISGAIADRAKFSAWMVFVPLWALVVFAPIAHWVWGPNGWLISFGT
                     LDFAGGLVVEIASGASALALALVLGPRIGFKVDAMRPHNLPFVLLGAGLLWFGWFGFN
                     AGSAFRADGMAAAVFLNTLVAGCLGMLGWLIVEQIRDGRPTTFGAASGAVAGLVAITP
                     SCGSVNTMGAVIVGLVAGVVCSFAVGWKFKAGYDDSLDVVGVHFTGGVVGTLLIGFLA
                     NRVMTGGPRGLLYGGGLGQLGKQAVGVIVVAAWAFGVSYLLGKLIDRLMGFRVSKEDE
                     VGGIDFALHAETAYVEGVHGHAPRGIFGHGHGHGGERPGGDADH"
     gene            complement(325562..326404)
                     /locus_tag="NONO_c02840"
     CDS             complement(325562..326404)
                     /locus_tag="NONO_c02840"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15099.1"
                     /translation="MTTMPSGDDIAAAWLAQTEFAGNRAATDLLSRAISPRDFSRNRD
                     SLPVAAAADPATAGAILELLDRGQVPTLPAIQTLIAQNGIRAEAERIERLGRRAQRSI
                     DEFGRVLADLTDEYWRTHEIGPTRRDILHTEPVLDLIRTRVGDISPAAVKHLWLIERA
                     QRAGWIAYAPTPRSLCAGRRFHAAKFGNRVSLRPVNILGTLVADFLDRYRTEHDRQPR
                     WSVLAHELRDDRGRRVFNDTADARAQQQWLMTAEWLAVEDDLPVPGARGRRALARQAR
                     KRGN"
     gene            326866..330018
                     /locus_tag="NONO_c02850"
     CDS             326866..330018
                     /locus_tag="NONO_c02850"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA polymerase III gamma subunit"
                     /protein_id="AHH15100.1"
                     /translation="MALYRKYRPATFAEVVGQEHVTDPLSTALDTGRISHAYLFSGPR
                     GCGKTSSARILARSLNCVEGPTSRPCGVCSSCVALAPGGAGNLDVIELDAASHGGVDD
                     TRELRDRAFYAPAESRYRVFIVDEAHMVTTAGFNALLKIVEEPPAHLIFIFATTEPEK
                     VLPTIRSRTHHYPFRLLPPATMRGLLGKICDQEQVQVEESVYPLVIRAGGGSPRDSLS
                     VLDQLLAGAGPEGVTYPRALALLGVTDIALIDEAIEALATDDGAALFATVDRVVEAGH
                     DPRRFATDLLERIRDLILLRAVPDAAQRNLVTGPGDVIDRMAAQADSIGPATLARYAE
                     LLHEGLGDMRGATAPRLLLEVICARMLLPSVSEAESAALQRLERLERRVESGVPTAPA
                     GPSTASAASAGAPAAASAPPARSGAPAGESRRRGAEALAAMREKKSAPHPAQRAQSPA
                     GPPETSAPARSAADAPADRAAGPGSIDHAANNTAAEQNSSAVPGSVVEPPADAGTTTS
                     AEPSRSQVGAPSAGTDRSGGTASADVAPAADGAEQGAADRDTTAPAGGASGATAHAAD
                     EARPSDDQDVPDSRTATGGSSSAAAAHPADDAQPGAPDSAASVAADNAASVSATAPAQ
                     GPTGATAPTADDAGLIGADPDAVVSGADGDRTTSAADPRDRAAPADSRESAHAGAADG
                     PDAVERSDGGSEHPAADAGLSGTGTAGDAPACGSGAAATPPSSAGDPLSDGTTGPAPG
                     GVADTEHSADTAQPVESGPAQEEAAASDPAQSPATEDATPASEQISAGASGADILREI
                     EAAWADIRAKARESSAALNALLSGSAGAVRVEDDTIVFAHPHAPLAQRLSTPQNVDAV
                     RAAVHAVIGRQYGVRWEVGSGAPADAGGAGKASGRPQARGGAEQSGGRGVRGDSSGQS
                     QPPRFVRPSQNQAQSPDGDTRGGQTDTRGAAVDRRDNPAQGQRREFRPPRSAAGADRS
                     APDDDIPPPDAPDYPDDPGPSDYSPVGYDGVPPALTPEEEQEMLAESARPVPPEQRRD
                     PDEVALELLRTELGATRMGG"
     gene            330351..331562
                     /locus_tag="NONO_c02860"
     CDS             330351..331562
                     /locus_tag="NONO_c02860"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 3-ketoacyl-CoA thiolase"
                     /protein_id="AHH15101.1"
                     /translation="MTTEAYIFEAIRTPRGRNKKGSLHSVKPIDLTTGLVQELRNRFP
                     NLDEDRISDIILGVVSPLGDQGADIARTTVLTAGLPDTVGGVQINRFCASGLEAVNMA
                     AQKVRSGFEDLVIAGGVESMSRVPMGSDGGALFADPATSYDLYIAPQGIGADLIATIE
                     GFSRDDVDAFAARSQELAAAAWSGGYFAKSVVPVKDINGLTVLDHDEHMRPGTTVADL
                     AKLKPSFAGIGEMGGFDAVALQKFHYVEQIDHVHHGGNSSGIVDGAALVLVGTEEAGK
                     ASGLTPRARIVATATSGADATIMLTGPTPAAHKALAKAGLSVDDIDLFEINEAFASVA
                     LKFQKDLKIPDEKLNVNGGAIAMGHPLGATGAMITGTMVDELERRNARYALVTLCIGG
                     GMGVATIIERV"
     gene            331600..333762
                     /locus_tag="NONO_c02870"
     CDS             331600..333762
                     /locus_tag="NONO_c02870"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="AHH15102.1"
                     /translation="MTENMIGWEKDADGIVVLTMDDPNQGANTMNELYKSSMHATVER
                     LVAEADDITGVVITSAKKTFFAGGDLKNMMKTTPENAPDIMEELTTIKADLRQLETLG
                     KPVVAAINGAALGGGLEIALATHYRIAADVKGVQVGLPEVSLGLLPAGGGVTRITRML
                     GIADGLMGVLLQGNKFTAQKAKAKGLVNEVVGSIEELVPAAKAWIKANKDNAEAATQP
                     WDRKGYKIPGGSPSTPALAANLPAFPANLRKQLKGQNMPAPRAIMAAAVEGAQVDFDN
                     ASLIESRYFVSLLTGPVAKNMIQAFFFDLQAINNGGSRPKDVPKREIKKVGVLGAGMM
                     GAGIAYVSAKAGFEVVLKDVSQENADRGKDYSVKLEEKALSRGKTTEEKSKALLDRIH
                     PTADPQDLAGVDFVIEAVFENPDLKAKVFGEIEDVVDADALLGSNTSTLPITLLANGV
                     KRAEDFIGIHFFSPVDKMPLVEIIRGEKTSDEALARVYDYTLAIRKTPIVVNDSRGFF
                     TSRVIGTFINEAIMMLEENIDPQTIEQAGLQAGYPAAPLKLSDELNFETMQKIFKETK
                     EAAEKDGLKISESSLASGRVVETMIDKFDRKGKLHGAGFYNYVDGKTAGLWEDLRSTF
                     NSNRELPTGVTLQDLKDRMLFIEAIETQKCFDEGVLTTTADANIGSIFGIGYPAWTGG
                     VHQFIVGYPGGQAGFVARADELAAKFGERFGVPDSLRK"
     gene            333969..337565
                     /locus_tag="NONO_c02880"
     CDS             333969..337565
                     /locus_tag="NONO_c02880"
                     /codon_start=1
                     /transl_table=11
                     /product="putative serine/threonine-protein kinase"
                     /protein_id="AHH15103.1"
                     /translation="MNPQTGKVRDADTPAADSEPVSEDDGSGANTARYQPINIAEELE
                     AMGLFDAEEIGRGGFGVVYRCTQRALDRVVAVKVLSSEIDQESRERFLREEHAMGRLS
                     GHPNIVDVLQVDVTPSGLPFIVMPYATHGSLERLIRDHGPLSWSDTLRVGVKLAGAIE
                     SAHRVHVLHRDVKPANVLLSRYGEPQLTDFGIARIPGGFQTSTSMITGSPAFTAPEVL
                     KGEEPTVRSDVYGLGATLFALLTGHAAFERRSGERVVAQFLRITTQPVPDLREQDIPA
                     DVAAVIESAMAPDPADRPASALAFGEALRSVQRAHGEPPDDMALLDGDSTDRHRPATD
                     TAAHPITQRRSRSVLGPAALRTPGPLTGTAPPATLPPTAATKFRPPTPTREPIDRPRL
                     LDILRSGGRRRLAVIHGPAGFGKSTVAAQWRGELAAERIPVAWISIDRDDDNEVWLLA
                     HLIQAIRRVAPDIGAGLEEVLEERPAEAVPYAISTLIDEIHAGGQTIVVVIEDWDRVT
                     DEGAHRVLDTLLDNGCHHLRFVVTTREQAGLPLSRMRVRDELVEIGSSELRLTLAETR
                     RILVERNDFGLTDDQVEQIYTATDGWPAAIQLVSLSLRASAADESVDPAMLISHLCGG
                     NHAIREYLAENVLDGLEPRMLEFLMSISVAEKLNGALAVALSGEPDAEQLLEQAQQRE
                     LFVTRADHEQDTFRIQPLFAEQLRARLERVHPGKLKSLHRKASRWYAEHQQLRKSVDH
                     ALAATDLKMAVDLVENGGMDLIDTSRLATLLGTVSKLPVQQVTSRSKLLMTLARANIN
                     LQQSGAARTALGRLSNMLARSPADADSTRQRCEAAVLAAADLVARDRTDGVLDKVLPC
                     LEEPDELPAWTVSTAANLVSFVRLCDFDFDGAVAIQDWAAPYHSRSKDPLGVVIGLLG
                     TGAVAYERLDIDTATRCFEKGWQIGRERSGPRSHAVRVSAALLGELTYRRGDLQSADR
                     LLEQSHQLPARIGAVDFMITTFVVGARVKAVLGDTDTARARLDEGARMAAERKLPRLA
                     AHIRAERLRLGLVDPPAVPPPAPVLRNSTGPAALTAEAEEVAAVRVLLARHYRGMDGA
                     SADADGIESAVKRARALYGRMVEQARPRAELDAALLLAECLAVAGWNGEAITILLPVL
                     DRCAQLGWTRPLLDAGPELNSLLQTLRDDVLLSGEGTGSFDIPRPFLASLLR"
     gene            complement(337566..338894)
                     /locus_tag="NONO_c02890"
     CDS             complement(337566..338894)
                     /locus_tag="NONO_c02890"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclopropane fatty acid synthase"
                     /protein_id="AHH15104.1"
                     /translation="MTTFRESAGSQLPPISDLGTKLSIAEIFETLVDGGVPIRFSAYD
                     GSSTGPDDSKFSLEITTPRGINYIATAPGDLGMARAYISGDMEVEGVHPGDPYDILKA
                     MTDLKFRRPSALALVTIARSLGWDALKPIAPPPQETLPRWRRIALEGLRHSKNRDAEV
                     IHHHYDVSNRFYELVLGPSMTYTCACYADENQTLEQAQENKYRLVFEKLNLKAGDRLL
                     DIGCGWGGMVRFAARRGVKVIGATLSKEQAEWAQAKIVEEGLQDLAEVRHSDYRDVSE
                     SGFDALSSIGLTEHIGVQNYPSYFGFIKSKLRDGGLFLNHTITRPDNTRTTKAGDFID
                     RYVFPDGELIGSGRIISDIQNIGLEVVHEENLRPHYALTLHEWCKNLVANWDACVEEV
                     GEGTAKVWGLYMAGSQLGFERNVVQLHQVLGVKLGEKQTWDVPLRPWWNA"
     gene            complement(338891..340348)
                     /locus_tag="NONO_c02900"
     CDS             complement(338891..340348)
                     /locus_tag="NONO_c02900"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding domain-containing protein"
                     /protein_id="AHH15105.1"
                     /translation="MAVSLLGKAGRAPAARESGFAAHREGVERLLASYRAIPSNANVR
                     LAKKTSNLFRARAKNPAPGLDVSGLTRVIAVDAQNKTAEVAGMTTYEDLVAATLPYGL
                     APFVVPQLKTITLGGAVTGLGIESTSFRNGLPHESVLEIDVLTGSGEIITATPDGEYA
                     DLFRAFPNSYGTLGYSTRLKIELESVQPYVALRHVRFHDLRELEEVMARIVTERSYAG
                     ERVDYLDGAVFTAEESYLVLGRQTDEPGPVSDYTGMDIYYQSIRHDGAEPKRDRLTIH
                     DYLWRWDTDWFWCSRAFGTQNPNIRRFWPKQYRRSSFYWKLIALDHKYNIGDKLEARK
                     GNPPQERVVQDIEVPIEHTADFLHWFLREIPIEPLWLCPLRLRDGAETPGTPENPARP
                     WPLYPLEPERTYVNVGFWSAVPKQPGQIEGAANRAIEDEVARLDGHKSLYSDSFYEED
                     EFARLYGGDHYVNIKKRYDPDHRLLDLYSKAVQRK"
     gene            complement(340850..341425)
                     /locus_tag="NONO_c02910"
     CDS             complement(340850..341425)
                     /locus_tag="NONO_c02910"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15106.1"
                     /translation="MSGFVSGATRVKNILKWVGMTAIGIVMLVGSFSMFNSHGKVDCG
                     GETMHAGDKCVVTGKHGSTPRSMDEQSSSNTTTAWILLGFGIVFTGVGALLLVGELTG
                     VRGGGKARQGVQVVPNAAPPYPPMNNAAGYPPAGPNPAPYPPGGHPGYHPGYPHPAQP
                     PAGYPSAPPNFAPGPAGYSNTPTGYPPPGPR"
     gene            341575..342009
                     /locus_tag="NONO_c02920"
     CDS             341575..342009
                     /locus_tag="NONO_c02920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15107.1"
                     /translation="MGQVSASSSTVVAAEPQRALEAIADYENVRPRILSAHYRDYKVL
                     EGGQGAGTVAEWTLQATEKRSRNVHAVVTVSDSMVTERDSNSTLVTTWTVSPSGEGSA
                     VTVRTTWKGAGGVPGFFEGIFAPLGLKKIQAEVLENLKRELS"
     gene            complement(342312..342659)
                     /locus_tag="NONO_c02930"
     CDS             complement(342312..342659)
                     /locus_tag="NONO_c02930"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase-like domain-containing protein"
                     /protein_id="AHH15108.1"
                     /translation="MTLTLSNITFDCTDAAALATFYAGLLDRPVNPEANRYFATVGAP
                     EHGTTLMFTAVPDRTPGKNAVHLDLSAPDWRVQIERAVSLGAKHIGDFDEHGVQWATL
                     SDPEGNLFDIGRG"
     gene            complement(342692..343528)
                     /locus_tag="NONO_c02940"
     CDS             complement(342692..343528)
                     /locus_tag="NONO_c02940"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="AHH15109.1"
                     /translation="MCMTATVSIGEFSRLTCLSVKTLRYYHEIELLEPVAVDAGSGYR
                     RYSTDQVERAHLIRRLRDLDMPMPQVRAVLTAPDRAARDAALREHLARMESELMRTRD
                     VVASLRSLLSPSAPIEVTYRAAPECTAVAVAAVVARDEIGEFCGREFGRLYGLLAAAG
                     IAPAGAGAATYSPEFFENDRGEVVIFVPVPATTAAADIAAFTDHADIGIRRFAPRRFA
                     VAVHAGLFTDFDRTYGALGSHVAEHDVALAEPIREIYVVGPQDTDDPTAQRTEVCWPI
                     AD"
     gene            complement(343614..344207)
                     /locus_tag="NONO_c02950"
     CDS             complement(343614..344207)
                     /locus_tag="NONO_c02950"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15110.1"
                     /translation="MNRSRRTRMFSGSSRLFRGAALTIVAAAALAPAITAPAASADTD
                     FGGGCVLYPGDPAATVAALHDRCNFQQQYDIYRAAARGNVPTGVTNGWVTTPPVMEVV
                     SPPFWIGKIFYTGPDGGTLTNRITGAGIEGFPANVFSGPSRIDGAPAWLLDYAPSITP
                     QILDEIRQVTPEVWLGYSWWRGYFQTTPLLTFALTEQ"
     gene            344262..344690
                     /locus_tag="NONO_c02960"
     CDS             344262..344690
                     /locus_tag="NONO_c02960"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding protein"
                     /protein_id="AHH15111.1"
                     /translation="MLIVRLWADTGLVRNVTRLVCIRIPQRGTPVEPGGQFDMQALLA
                     QAQQMQQAVMEAQAEIAATEVAGEAGGGLVKVTIKASGEVQTLQIDPKVVDPDDVDTL
                     QDLVVGAINNAMANAQQLAAEKLGPLAGGMGGGSVPGLPF"
     gene            344710..345318
                     /gene="recR"
                     /locus_tag="NONO_c02970"
     CDS             344710..345318
                     /gene="recR"
                     /locus_tag="NONO_c02970"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein recR"
                     /protein_id="AHH15112.1"
                     /translation="MYEGPVQDLIDELGKLPGVGPKSAQRIAFHLLSVEPPEIDRLQS
                     ALQKVRDGVRFCVVCGTVSDGELCRICADPRRDRTMICVVEEPKDVQAIERTREFRGR
                     YHVLGGALDPLSGVGPDQLRIRELLGRIGNQEDGVDVTEVIIATDPNTEGEATATYLV
                     RMLRDFPGLSVTRLASGLPMGGDLEFADELTLGRALSGRRTL"
     gene            complement(345328..345969)
                     /locus_tag="NONO_c02980"
     CDS             complement(345328..345969)
                     /locus_tag="NONO_c02980"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15113.1"
                     /translation="MSYDHVLLPAGAATSADAVEAYLAGQQGQAETEIVAAVAAELNR
                     RNEELPEQDAFLSVTVGGEGTGAALYVASPYDAIGHVRALLFELATPRDYALYDPQLN
                     WLIDPTGRIDVTVTHGGAGEFPYLTEKLVRQWVPELAEPNPYLIVERADQTYIQTYRD
                     EPGRYMLEFRDGGPDRHFGTQLEDGDRVAELIWEWTAGDTARLDALGWEPVSF"
     gene            346169..347971
                     /gene="leuA1"
                     /locus_tag="NONO_c02990"
     CDS             346169..347971
                     /gene="leuA1"
                     /locus_tag="NONO_c02990"
                     /EC_number="2.3.3.13"
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="AHH15114.1"
                     /translation="MSPADAFVSGTRTITAPSKPAPADQPAWNQQKNSSMPTFRYRPF
                     AEEVEPITLPDRTWPNQVVDRAPGWCAVDLRDGNQALIDPMSPARKRRMFDLLVRMGY
                     KEIEVGFPAASQTDFDFVREIIEDGAIPEDVTIQVLTQCRAELIERTFEACQGASNVI
                     VHFYNSTSILQRRVVFRADRDAVKKIATDAAALCLETQRRYPDTNWRYEYSPESYTGT
                     ELEYARDVCDAVSEIIAPTPDKPLIVNLPATVEMATPNVYADSIEWMSRNLARRDSIV
                     LSLHPHNDRGTAVAAAELGYQAGADRIEGCLFGNGERTGNVCLVTLGMNLFSRGVDPQ
                     IDFSDIDEIRRTVEYCNQLPVHERHPYGGDLVYTAFSGSHQDAINKGLDAMKASADAA
                     GADIDDIVWEVPYLPIDPKDVGRTYEAVIRVNSQSGKGGVAYIMKTDHGLVLPRRLQI
                     EFSQAIQKITDGEGGEVTPKVMWDVFADEYLNPIVPLERIRQKMKAAETDSGTDTINA
                     VVKVDGVEQEIVGSGNGPLASFVDALGTIGYDVRVLDYTEHAMSSGDDAQAAAYVECA
                     IGDKVTWGVGVATSITTASLRAVVSAVNRAQRTR"
     gene            348258..350387
                     /locus_tag="NONO_c03000"
     CDS             348258..350387
                     /locus_tag="NONO_c03000"
                     /codon_start=1
                     /transl_table=11
                     /product="AAA domain-containing protein"
                     /protein_id="AHH15115.1"
                     /translation="MNSLPSQDESDAQSPASSASEPDPGAVAPEGGDGEHAASGIIPP
                     VPEGIEQTTFMSGPQFGPDGSQFQPGPGGFAPPGQFPHGGPYPPEQGFAPGGFPMNEQ
                     QGFAPPPDPNGFPPPEQQGFAQAPDPNGFPPPGDPSGFAPPWAPGPDGFAPPGNFPGQ
                     PGFPGQPGFAPPGQPGGFAEQGYAPPGPDGFAPPGQPGGFAEQGYAPPGPDGYAPPGP
                     DGYAPPGSDGFAPPGPDGYGPPPGQDGYAPPGNPGDPGGFASGYPGPQGPGESGDFAA
                     PGGYGEVRQETPYGEIRQEIGADGMVRRVFDEQQAPPPAPAQPAENEPGGQVFSWAPP
                     PLPANPSPQQQQPQQQGGWQQGGPGQQQYQPQQSNFQPQHMGQPGQPGHSVNDLNLLK
                     RAKRSPRSGWRRAVHKMSGGAINPGESSSDVVYRELVDRVNQPVRGDYRIAILSLKGG
                     VGKTTTTVGLGSTFASSRGDRVIAIDANPDLGTLAHRVPRQTRSTVRNLLEDQHISRY
                     SDVRAHTSQAPSRLEVLASEQDPAVSEAFSEADYRRAIGILQQFYNIILTDCGTGLMH
                     SAMAGVLDMASSLILVTSPAIDGARSASATLDWLEHHGYSKLVERTVVVVNASRRGAS
                     TVDLDQLRKLFLDRTRAVQVVPFDDHLAEGAEIDLELVSKPTRRALLELAAMVADDFG
                     FHVPQPPFPGPQTQYPGQGQYPGPQGY"
     gene            350488..352245
                     /locus_tag="NONO_c03010"
     CDS             350488..352245
                     /locus_tag="NONO_c03010"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase"
                     /protein_id="AHH15116.1"
                     /translation="MAEQYGAVSRRTVLRGAAVGAGVVTAGALMRPGRANADPGRRVA
                     VFGGGVAGLTTAHELAERGFGVTVYERRALGGKARSIPVAGSGRGGRGDLQGEHGFRF
                     FPGFYHHLPDTMRRIPFAGNANGVWDNLVAAAEARFSRAGADDTILPMNPKAQPWVDP
                     DGFRQTVASVISTSMKMPMTDALYFANRLLVFDTSCDERRFGQWENLAWRDFLGTDHH
                     SQEFRMLMSRTLTTLLVAAKDDHASTRTIGSMGEQFLGNPLMTGNDGPLDRLLNGPTN
                     EAWLDPWVAHLRGLGVRFETAELRGLEVRDRRISGARISGAAGEQAVDADYFVLAVPV
                     EVARALWTPDILAVQPELAAMNNLVVNWMTGLQFYLNRPIDIARGHVAYVDSPWSLTS
                     ISQGQFWSRTKLSDLGDGSVRDCLSVDVSDWNTPGMLYGKPAIECTHDEIAREVWAQI
                     GKHLEGASALRDSDLVSWFLDTGVTWNAAERRNANADPLLINTAGSWASRPNVHGGLE
                     NLFLAGDYVRTNIDLATMEGACEAARTAVNALLDVAGSDAARCRLFQLYRAPQLEPMR
                     QADRARYAAGQPNMFDVQM"
     gene            352296..352913
                     /locus_tag="NONO_c03020"
     CDS             352296..352913
                     /locus_tag="NONO_c03020"
                     /codon_start=1
                     /transl_table=11
                     /product="putative pyridoxamine 5'-phosphate oxidase"
                     /protein_id="AHH15117.1"
                     /translation="MSEITSPAELRELLGEPSPRAATKERTRLHPLDREWIASAPFAI
                     LATSDADGNCDASPKGDPAGFVHVIDDLTLAVPERPGNRRGDGYFNILSNPHIGVLFL
                     IPGRNETLRINGRARLLRDAPYFDDMVVKGHRPILAIEVAIEQIFYHCAKALMRSDLW
                     RPERWPQDPLPTHAELVKEVQRNTPESLEQLQDYYSPENYRRMLY"
     gene            352986..354242
                     /locus_tag="NONO_c03030"
     CDS             352986..354242
                     /locus_tag="NONO_c03030"
                     /codon_start=1
                     /transl_table=11
                     /product="putative
                     UDP-N-acetylmuramoylalanine--D-glutamate ligase"
                     /protein_id="AHH15118.1"
                     /translation="MVADISVRGRLALRAAAAASWASQKAGRGKGSMIGGLIALQIAP
                     DIMTQLGRGRRTVLVTGTNGKSTTTRMTAAALAELGRVVTQADGANMDAGIVAALSVD
                     RTAPVAAIEVDELHLPHVADALNPAAVVLLNLSRDQLDRVGEINMIERKLREGMARHP
                     DAVLIANCDDVLITSIAYDHPNVVWVSAGSGWAVDATSCPRSGEPIVWEGTHWRSTGA
                     DFERPEPRWWVDADYLCGPDGLKLPLRLALPGRANRGNAAQAVAAAVTLGAKPETAVQ
                     AAGTVREIAGRYRTVRVGEHSARLLLAKNPAGWQEALSMIDPAATGLVIAVNGQVPDG
                     EDLSWLWDVRFEHFEGTQVVAAGERATDLGVRLTYAGVEHTTVPNPLRAIASCPPGQV
                     EVLANYTAFRDLNRDLDARGQDASDD"
     gene            354235..354945
                     /locus_tag="NONO_c03040"
     CDS             354235..354945
                     /locus_tag="NONO_c03040"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cobyric acid synthase"
                     /protein_id="AHH15119.1"
                     /translation="MTESTVRIGLVLPDVMGTYGDGGNALVLRQRLRMRGIEAEIVEI
                     NLDDPVPESLDLYALGGAEDSAQRLATRHLQRYPGLQRAAAKGVPVLAICAAIQVLGN
                     WYETSAGERVDGVGLFDVTTTPQRVRAIGEVATTPILAGLTQPLTGFENHRGGTTLGA
                     AAAGLGRVTKGVGNGVGDSLEGVVQGSVIGTYMHGPALARNPELADHLLARALGVSGL
                     EPLELPEVDQLRRERLRA"
     gene            355097..356713
                     /locus_tag="NONO_c03050"
     CDS             355097..356713
                     /locus_tag="NONO_c03050"
                     /codon_start=1
                     /transl_table=11
                     /product="GMC oxidoreductase domain-containing protein"
                     /protein_id="AHH15120.1"
                     /translation="MHRRAFLQAAGAATVLGVTGAVRGVGPAAADPVWNELFRNWVPE
                     IFAPLPDPPEHTEAIVVGSGFGAAVAALRLAEAGVANTVLERGSRWPNDPQREIFTGD
                     DLPDGRGFWHRTSFTGVTKVPMNFADFGGVLDVTPFGGIDVWRGAAVGGGSVVFTGCM
                     IAPQQRHFDQIFRGTVDYGELDRTYYPRVRQMLRLSPMPADIYNSEPFTHSRMWNSQV
                     SKAGYQPMTSDSIFNWDILRGELAGASRASATAARSNLGNSNGAKFDLNQNYLKYAQD
                     SGRSKVFPGHRVDSIGRDGDRYVVRVTKLDPTGAILATRTLTCDKLFLGAGSVGTTEL
                     LVRARDTGALPNLNEHVGAGWGTNGDVVLARSASQLAGLGQGVPSAGRIFDESEMPLS
                     LESWYIPGIPVETGGLASLGLVIDPTRATITYDAARDAAAMNWPRAAQDAIVAACRTV
                     DRRIGERAGALVDYGPIGYDANAPFTAHPLGGAVLGQATDNYGRVAGYQGLYVVDGAA
                     IPGSTGAVNPSLTITAVAERNLEAIIRSGR"
     gene            356778..357575
                     /locus_tag="NONO_c03060"
     CDS             356778..357575
                     /locus_tag="NONO_c03060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15121.1"
                     /translation="MWKGPFVAQYSYPRKPPALWTDLVMLALAVVSVILVAWITFFPV
                     SGHTYHAIMVVDYSICAVFAAEFLWRWRRADWSWTFPFVYWYEVLGMIPVTSPFFRGF
                     RLLRVVVILVRLARVADRAFGDRVTAAVVNRSVGVIVDAVKKPVTMAVLEEVAEVLRR
                     GRYTSNIAAALEENRDELDAMILELIKNDPAVGRVRYVPFHDEIIRAIADTSFRIIFQ
                     VLADPRTDELVGDVLRENIDQMRDAVRAGGDIPPVAVDHKLGGQLTS"
     gene            complement(357560..358018)
                     /locus_tag="NONO_c03070"
     CDS             complement(357560..358018)
                     /locus_tag="NONO_c03070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15122.1"
                     /translation="MRTKTDHRFIIEVDADQVQEALLAVERIPEWSPAHRDVRVASRD
                     EFDRPRRVYATVTTLNNSDRQVLEYTCKPDRITWEVVESAAGGGGRGWFDIEETAEGT
                     EVWYHSEVYLPIPVPGLLLKRTLSRANDEAVHNLIEYIEKFPFGENYEVS"
     gene            complement(358298..358513)
                     /locus_tag="NONO_c03080"
     CDS             complement(358298..358513)
                     /locus_tag="NONO_c03080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15123.1"
                     /translation="MSITSIDNGGMQASVGDRIRVHSNAVGIPERTGEILEARGSEGA
                     PPYVVRFEDGHESLVYPGPDCEVLHHS"
     gene            complement(358550..359131)
                     /locus_tag="NONO_c03090"
     CDS             complement(358550..359131)
                     /locus_tag="NONO_c03090"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH15124.1"
                     /translation="MRTNPERRQVMLDAAIEVLAQEGARGLTFRAVDKQAEVPMGTAS
                     NYFANRDDLLIQVGSRFYERLTPDAPTLAEMASGPHSRAAVTDLLTGTVDRITSFRTG
                     YLAQLELRLEATRRPELQRMLTERVRADIEFNVTNHLASGQPGDANSVLLLYLALSWL
                     IVERLTLPEIFDEEQVRDLIRIAVERTIPADPD"
     gene            359209..359784
                     /locus_tag="NONO_c03100"
     CDS             359209..359784
                     /locus_tag="NONO_c03100"
                     /codon_start=1
                     /transl_table=11
                     /product="ribD domain-containing protein"
                     /protein_id="AHH15125.1"
                     /translation="MRKLVYYVGVSLDGYIAGPAGEVEFYPRSDEMTEWMCGRHPDSI
                     PTHIRPHVGMSVDLPAREWDTVLMGRGTYEPGALEGVTNPYAHLKQYVVSKTLDPARY
                     PDVEIVADDPVALVRKLKQQEGKAIWLCGGGSLAGALIDEIDEMIIKSYPVLAGGGVS
                     VVSGTFSPTAFRPVQRREFDNGAQVTWFERA"
     gene            complement(359893..360321)
                     /locus_tag="NONO_c03110"
     CDS             complement(359893..360321)
                     /locus_tag="NONO_c03110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15126.1"
                     /translation="MGPMKSIEIELSTGGREVVHDLTPQCAMFLREAAAGRDGLLHIF
                     VPHATAGVALIELGAGSDDDLLTALRDLLPADDRWRHAHGSPGHGRSHVMPALIAPYA
                     TVPVLNGELALGTWQSVAFVDLNVDNPIRRVRLSFLRESS"
     gene            360708..361973
                     /gene="ask"
                     /locus_tag="NONO_c03120"
     CDS             360708..361973
                     /gene="ask"
                     /locus_tag="NONO_c03120"
                     /EC_number="2.7.2.4"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartokinase"
                     /protein_id="AHH15127.1"
                     /translation="MALVVQKYGGSSLESAERIRRVAERIVETKKQGHDVVVVCSAMG
                     DTTDELLDLAQQVAPAPPARELDMLLTSGERMSNALVAMAIHSLGADACSFTGSQAGV
                     ITTGTHGNARIIDVTPSRVRDALDEGMIVLVAGFQGVSQDSRDITTLGRGGSDTTAVA
                     LAAALEADVCEIYTDVDGVFTADPRIVPDAQKLDQVSFEEMLELAATGAKVLMLRCVE
                     YARRYNVPVHVRSSYTDRKGTYIYGSMEDIPLEDAILTGVAHDRSEAKVTVVALPDEP
                     GYAAKVFRAVADAEINIDMVLQNISKVETGKTDITFTLPRSDGPRAVEFLTKRQGELG
                     FTQVLYDDHIGKVSLVGAGMKSHPGVTATFCEALAKAGINIDLISTSEIRISVLVKDT
                     ELDEAVQVLHKAFDLGGDEVAVVHAGSGR"
     gene            361977..363011
                     /gene="asd"
                     /locus_tag="NONO_c03130"
     CDS             361977..363011
                     /gene="asd"
                     /locus_tag="NONO_c03130"
                     /EC_number="1.2.1.11"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="AHH15128.1"
                     /translation="MGVRVGVVGATGQVGAVMRKLLEERDFPADEVRFFASSRSAGKK
                     LPWRGGEIVVEDTETADPSGLDIALFSAGATMSKVQAPRFAAAGVTVIDNSSAWRKDP
                     EVPLVVSEVNPEQTRNLVKGIIANPNCTTMAAMPVLKPLHDEAGLRRLIVSSYQAVSG
                     SGLAGVEELASQARAVIDDAEKLTHDGSAVQFPAPDKYVAPIAFNVLPMAGAIVDDGS
                     GETDEDQKLRNESRKILGLPELLVSGTCVRVPVFTGHSLSINAEFDRPLSVARAQEIL
                     AGAAGVRLVDVPTPLQAAGADESLVGRIRQDPGVPEGRGLALFVSGDNLRKGAALNTI
                     QIAEVLLAQR"
     gene            complement(363085..363666)
                     /locus_tag="NONO_c03140"
     CDS             complement(363085..363666)
                     /locus_tag="NONO_c03140"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH15129.1"
                     /translation="MAENQTAEPAAEPRRTLRADARRNRERVLTAAREAFAAEGISVP
                     LDEIARRAGVGPGTVYRHFPTKEALFQAAIVDNIERMIEYARGLEAADDAGAAFFELL
                     DHMVNQGSVKRDLADALGGHEMAEITGPTKEFQATIARILERAQRRGAVRADIGIDDL
                     MRILKGTFTVTHTATADQRARAFAVVFDGLRAC"
     gene            363763..364176
                     /locus_tag="NONO_c03150"
     CDS             363763..364176
                     /locus_tag="NONO_c03150"
                     /codon_start=1
                     /transl_table=11
                     /product="SnoaL-like domain-containing protein"
                     /protein_id="AHH15130.1"
                     /translation="MTSPSVRSPREIVEQLFETLPVRDPDAFTAALAADAVFEIPFPI
                     PGMPQRIQGREAIREHLAQRWSGLSGIEIHGIYPTVYETTDPAVLFVENDVDMTRAGT
                     RARVHTSVNRVHVRDGEVTLFRDYMDTARIAGLSG"
     gene            complement(364189..365532)
                     /locus_tag="NONO_c03160"
     CDS             complement(364189..365532)
                     /locus_tag="NONO_c03160"
                     /codon_start=1
                     /transl_table=11
                     /product="putative beta-lactamase"
                     /protein_id="AHH15131.1"
                     /translation="MGRLRGWVIGVLVTVLISGVCAATAVAEPAEPSCAVTSGRDFAT
                     AAPESEGMDSARLASALNFAAERNRLNVKIFRNNCLIGSGPDNAATGGVPWNVWSVTK
                     SVVSLIAGIAWDQGKLDIDAPIGRYLPPGLGDAAHRAITVRDLLTETSGLRVGVINEG
                     VSGVIPIDPNSAVQALGVPFDNPPGTEFSYSQRNVDLLAYVVELAAGEPLQEFAQREL
                     FTPLGIGRDDYYWARDRSGHTYGYAHLLIPPDDLAKLALLVSDDGQWDGQRVVSSDYL
                     RQARQPGPTHTCYGFLFWARPGCIEMPSFLPSDVFAMSGMGLQNAFFIPSLGLTVVWT
                     GVFGNRSSGGPTGILQNPTELTWEFFRRLLAAFDRPPIPDPGPYVEPPVTLDPRTYFD
                     PNITLALFGVGPDTYHGCNVLSCLNIPLAQPFSDAPPGCLVLVCLGPDPRTPGIH"
     gene            365954..366397
                     /locus_tag="NONO_c03170"
     CDS             365954..366397
                     /locus_tag="NONO_c03170"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ferric-uptake regulator FurA"
                     /protein_id="AHH15132.1"
                     /translation="MHTEGFDPRERLRSVGLRITKPRVAVLDAVVAQPHSDADRVAAA
                     VRAQLGTVSTQAVYDVLRACVDAGLLRRIEPAGSAALYEARIADNHHHLVCRKCGTVA
                     DVDCAVGRAPCLDPSDAHGFTVDEAEIVFWGLCPDCRRDDDAPSR"
     gene            366481..367959
                     /gene="katA1"
                     /locus_tag="NONO_c03180"
     CDS             366481..367959
                     /gene="katA1"
                     /locus_tag="NONO_c03180"
                     /EC_number="1.11.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="catalase"
                     /protein_id="AHH15133.1"
                     /translation="MAESTTAVTTTNTGTPVPSDDESLTAGTEGPILLHDHYLIEKLA
                     QFNRERVPERIVHAKGAGAYGELVVTGDVSRFTKAALFQPGARTESLVRFSTVAGEQG
                     SPDTWRDPRGFAVKFYTPEGNYDLVGNNTPVFFIKDPIKFPDFIRSQKRLPGNGLRDH
                     NMQWDFWTLRPESAHQVTWLMGDRGIPKTYRHMNGYGSHTYQWINASGERFWVKYHFK
                     TDQGIDFLTQAEADRLAGTDPDYHRQDLWDAIERGDHPSWTLYVQVMPVGEAANYRFN
                     PFDLTKVWSHKDYPLIEVGKWTLNRNPRNYFVEIEQAAFEPSAIVPGIGYSPDKMLLG
                     RVFAYADAHRYRIGTNYHQLPPNRARAAEVDSYSKEGAMRYEFNAPDVPVYAPNSYGG
                     PHADPGRAPEEAAWTFEPEQVRAGYIQHAEDSDWAQPGTLVREVYNDDQRDRLVGNVV
                     GHVLGGVREPVLSRVFDYWKNVDPDIGKRIEEGVRAGLNGNG"
     gene            complement(368496..369107)
                     /locus_tag="NONO_c03190"
     CDS             complement(368496..369107)
                     /locus_tag="NONO_c03190"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH15134.1"
                     /translation="MGSQRSQPDSPAPHPRTHTGRRRNEATHQAILDAALNLLATSEG
                     RPVTVDSIAAAAGVGKQTIYRWWPSKGAVLLEALLDRARRAVPTPDTGSVRTDILTIA
                     DTTFTGAQHPSTAPALRALVREAARDPHLAELLRDFTETRRAVVRDVLERGIARGELP
                     ADTDTALLADLLYGLFWYRFLLGHAPLDHATAAHLVDTLLPPE"
     gene            369209..369949
                     /locus_tag="NONO_c03200"
     CDS             369209..369949
                     /locus_tag="NONO_c03200"
                     /codon_start=1
                     /transl_table=11
                     /product="putative enoyl-(acyl carrier protein) reductase"
                     /protein_id="AHH15135.1"
                     /translation="MSAPSTNHTPRVVVMGGSSGIGEATAALFAGAGAEVVVTGRGQD
                     KLDAAVARLGGKTTGHRLDATDAAQIAAFFEQSGPIDHLVIAVSGSAGSGPFAELDLD
                     HLAAGFDGKFWPQVRIVKAALPHMDSNGSITLITAASAHAAFPATAGLAAINGALNAM
                     VAPLAVELAPLRVNAVAPGVIDTEWWERVPEDRRRALFHGLAATTPVGRVGDPAEVAR
                     AVHLLATNGFVSGVVLDVTGGANLPTGR"
     gene            complement(370216..370968)
                     /locus_tag="NONO_c03210"
     CDS             complement(370216..370968)
                     /locus_tag="NONO_c03210"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH15136.1"
                     /translation="MAARQPSDAQDAAPLASVWTRPHRARREQPALSRDQIVAEAMAL
                     LDAEGFDALSMRKLGSRMGAGATSLYTHVANKDELLELVVDEAFGEITLPTDPAPGDW
                     RATMLDLCGDIRRIMLRHPWIPVTMSSAGLVYLGPNMLRLSEAMLEILERAGFDDESA
                     DRALNAIFAYTIGTTSTEAAALSSIARSGLDEQRWFEQMMAAAELASRPYPRVYRRYT
                     EYKDRDANRAREDNFEHELGLIMDGLHSRRRA"
     gene            371136..372662
                     /locus_tag="NONO_c03220"
     CDS             371136..372662
                     /locus_tag="NONO_c03220"
                     /codon_start=1
                     /transl_table=11
                     /product="putative drug resistant transporter, MFS family"
                     /protein_id="AHH15137.1"
                     /translation="METPESAAPVVGATRRWLILVVLCLSSLVLVIDNMVLTVAIPQI
                     ATDLHADAQQVQWIIDGYLLVFAGLLLTSGSLSDRFGRRLVMVAGLVVFGAASLLAAY
                     ASSPEMLIAGRVLMGIGGVAIMPSTLSILITVFDDRERPKAIAAWSAVATLGMVGGPV
                     VGGALLDHFWWGSVFLMNVPIAAVAILAAVLLMPESKGPWRRPDLPGAVLSIAGMTAL
                     VWTIIAVPQRGWTDTGTLVGSALTVIALGGFVIRELTTDSPMVPLDLFRNRTFTGSSF
                     SLVLVTFANGGLVLVLTQYLQFVLGYSPMRTAVAFTPMAVAILAFNGLGAGVVAKLGT
                     KVVTVTGLVIVAAGFGVLATLDTGSGFWLPALAMALLGAGAGLAMPAAIGALMSAVPG
                     EHAGVGSALNDTIQQTGGALGVAVLGAILAGTYSAAMPDSAPAGARESIAGALGTGDS
                     GLAGLARDAFSSGMQAAFAVGAASAVVAAVVAVLLMRNTKRPAAQQDPGPADELVGTR
                     "
     gene            complement(373073..373738)
                     /locus_tag="NONO_c03230"
     CDS             complement(373073..373738)
                     /locus_tag="NONO_c03230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15138.1"
                     /translation="MTSQEEFLRRVRDALEALPDDERTVPVPRNYQRHAPVTSAADQA
                     EIIELFTARLKHHGAEVHRVEPDEVPAVLDLALRTHGATSALAPEGLPEDWLLFWSAD
                     ANHRVLDDQPQRSILDRERTDAVVTACAGAVADAGTLILDGGPGQCRRDATVLADCHI
                     CVVRAEQIDYSLPQALDKLDPRRPITWFGGPAVMTDPAAESARVGGVIEETERRLVVV
                     IVG"
     gene            complement(373826..374860)
                     /locus_tag="NONO_c03240"
     CDS             complement(373826..374860)
                     /locus_tag="NONO_c03240"
                     /codon_start=1
                     /transl_table=11
                     /product="putative C4-dicarboxylate transporter/malic acid
                     transport protein"
                     /protein_id="AHH15139.1"
                     /translation="MDESFGRRVRFVANLGPGWFASVMATGIVSRAVGAAGWPWGGSA
                     LLIIGLIAYAVLLIATALRIIYYRDRVVADAKNPATGFTYLAFVAATGVMSAGLSRHD
                     QVGGALVLLLVAVLAWIVLCYTVPALLMLNHGAPTAVTGANGTWFLWVVGTQAVAVAA
                     TALPRPWGDRFAVPALLCWSVGVVLYGIVATVVLGSLFSVAMTAERLAPTYWIFMGAT
                     AISVLAGTQIMDRDDVHLIATVRPMLEGSVLVLWAFGSWLVPLLLAAGIWRHLVRHFG
                     LTYEPGLWSIVFPVGMYGVGTAELGRATGEQWMVGFGHAEAWVALAVWAATAADLIIT
                     VVRRRRESPG"
     gene            complement(375586..377373)
                     /locus_tag="NONO_c03250"
     CDS             complement(375586..377373)
                     /locus_tag="NONO_c03250"
                     /codon_start=1
                     /transl_table=11
                     /product="putative chloride channel protein"
                     /protein_id="AHH15140.1"
                     /translation="MSARHPRATHLGDFQVSPRLLVIAGLAIPVGGAAALAAYGLLQL
                     IGLITNLVFYQRISTAMVAPGASHHPWWLVLTAPVVGGLIIGVMARYGSEKIRGHGMP
                     EAIEAILTGGSRVAPRVALLKPASAAISIGSGGPFGAEGPIIMTGGAVGSILAQLLKL
                     SADERKTLLVAGSAAGMAATFNAPLAAILLAVELLLFEWRPRSFIPVVAAVVTGTICR
                     WALLGNGPVFAVGTDGGKPGALSDGLALIPGITGGLLAIAATALVYFAEDTFAKIPVH
                     WMWWPAIGGLIIGIGGLFEPRALGVGYDVIDQLLTGHATTSLIVGILVVKTLIWSLSL
                     GSGTSGGVLAPVFMIGAALGAAEGGLLPHVTAGFWAMCGLAAVVGGVMRSPLTGIVFT
                     CELTQAWNDVLPLAVASVSAYAVSVLLLKRSVLTEKIARRRLHLTREYTTDPLETFFT
                     HEVMTADPLILHIDEPIEPALPHTHYAGLYPVVDESGRLTGVTTRQVLQHHHRDTVRA
                     ATLPIRTSVHPDNTLREVANALALAHVTSAPVVDRDDPTTLRGIITLEQLLHARRRDL
                     HEEHHRERLLVVRDDRPAHSPEPKETATV"
     gene            complement(377370..377885)
                     /locus_tag="NONO_c03260"
     CDS             complement(377370..377885)
                     /locus_tag="NONO_c03260"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, MarR family"
                     /protein_id="AHH15141.1"
                     /translation="MQGDEGSVAAAERAVAAGQNPAGEIAALEALTRVLVSIAWDSAH
                     AAPPGVTFPQMRFLLILQALGRVSSSRLAAALGVNASSVTRLADKLEARGYVVRGTDS
                     HNRCVVTVEVSEAGREVVDQVLRRRQAAFGSLLDQLDAGSRAQIVDAARELVRAAAAT
                     PFVSSTGPGSL"
     gene            complement(378084..378428)
                     /locus_tag="NONO_c03270"
     CDS             complement(378084..378428)
                     /locus_tag="NONO_c03270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15142.1"
                     /translation="MPANSLPHGPDGKAEFQAVLTYILTVSEATEADLMPMTDRIGPQ
                     AKEVLMTTAERLRAEGHAEGRAEALIESLTLKFGPLPTATTTRIRTATPEQTHTWNTR
                     IFTANTLDEIFA"
     gene            complement(378676..378882)
                     /locus_tag="NONO_c03280"
     CDS             complement(378676..378882)
                     /locus_tag="NONO_c03280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15143.1"
                     /translation="MKVDLARATWFKSSRSAGGKDCVEATFLDGGLVGVRDSKNPTGP
                     ALVFTPAEWDAFTTNLRNGGLDRA"
     gene            complement(378879..379769)
                     /locus_tag="NONO_c03290"
     CDS             complement(378879..379769)
                     /locus_tag="NONO_c03290"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding protein"
                     /protein_id="AHH15144.1"
                     /translation="MTTIGEDQSTTLPRRQLGRYLKDARLAMGLKLEDVAPLMQWSAS
                     KLSRIESGKSPAVRLLDVEALCRIYEIDDPEVSAGLLGLAKQSTGTSWWQAFDDVITG
                     NFDLYVGMETSARQLSIFRPDMLSGLFQTPDYSRALDRTYFPGITREELERGVQLKLK
                     RQIVITRKTKPAQVDLVVHEAALRTVVGSPGAMAGQLRFLADMPANVTVRVLPFAAGF
                     PAGISTGPFTILDFGHDSKGREISPTVVYIESYAGDMYLERSKDVARYRQAYSILEQA
                     ALDIAESKRFLRHTAREFRA"
     gene            380105..380290
                     /locus_tag="NONO_c03300"
     CDS             380105..380290
                     /locus_tag="NONO_c03300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15145.1"
                     /translation="MHGLRPIDHSALPAMTTGLAHQIMQEHIECPITVCARKLQAKLW
                     LVAIGAMQPAGRPQFGI"
     gene            380297..380563
                     /locus_tag="NONO_c03310"
     CDS             380297..380563
                     /locus_tag="NONO_c03310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15146.1"
                     /translation="MDNPVLHGPLGNPISPERMHKEIHADRHAHCTPQTCEMLTTCRN
                     ILTTLGHDPDADGPETCPACQERAQSESTRSQEPPLMPEFGFRQ"
     gene            380628..380795
                     /locus_tag="NONO_c03320"
     CDS             380628..380795
                     /locus_tag="NONO_c03320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15147.1"
                     /translation="MTPELPQRVPGVRTAPTVSGDPNWYAAVARALRATPSDRFPRLA
                     DTAPGWSSRST"
     gene            381018..381584
                     /locus_tag="NONO_c03330"
     CDS             381018..381584
                     /locus_tag="NONO_c03330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15148.1"
                     /translation="MTDEIATPAWMDRQITATKYASWSEEGCAGIEIVDGMVVVRPSA
                     SKRHNRLARILANALDAAAGPEWNADTDFDVRLQDVPLTNRRPDVVVYRADTIDTAPT
                     RPEHVLLVVEVVSPGSETTDRIVKVDQYAKAGIAFYWRVEQTATGVPLVYTYILDPAI
                     RTYRTGEMYTGTVTVAAPFAVEIDLGEI"
     gene            complement(381639..383255)
                     /locus_tag="NONO_c03340"
     CDS             complement(381639..383255)
                     /locus_tag="NONO_c03340"
                     /codon_start=1
                     /transl_table=11
                     /product="putative choline dehydrogenase"
                     /protein_id="AHH15149.1"
                     /translation="MTDTSAADYIVIGAGSSGATVASRLAEHGASVILLEAGRKDNTK
                     LVSVPGMITTVHTVPQLKHQVTWSQYSVPQKHAAERRVPMTRGKVLGGSSSVNGMLFV
                     RGNKANFDSWAAEGCEGWSYEDVLPAYKRLENWEDGASEFRGAGGPIEVTRQKELTPI
                     AEEWMQAASETFGVPVIEDYNGESQEGISIFQQSVRDGLRYSSSRGYLTNRPNPNLQV
                     VTHAHVTRVVIEKGRAIGVEVIEKKGRRIIRANKEVVVSGGVMGSAHILMLSGIGPAG
                     HLRDLGIEVNADLPVGQNLHDHLFVPMTFVSKKALHRGIPTHFAAGFLKELRKPGSSW
                     MGRTVFESAGFVRTSFAKDVPDMQIHTLPWSYPSPNQDEDKLHLVDRREALTVFPTLI
                     YPKSRGELRLASTDPLTSPIIDPGYLSDPADMDFLVEAIGMIREAAANKGIAPDITEE
                     LSPGPAYTDETALRRELPMRVHSVYHPVGTCRMGVDERAVVDPQLRVRGIEGLRVADA
                     SIMPSITGGNTNAPCYMIGEKAAEFITAAV"
     gene            383570..384058
                     /locus_tag="NONO_c03350"
     CDS             383570..384058
                     /locus_tag="NONO_c03350"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione peroxidase"
                     /protein_id="AHH15150.1"
                     /translation="MTDIREIPVQTLAGDPATLAGLAGDKSLLVVNVASKCGLTPQYT
                     GLVELQKTYGPRGFSVIGVPCNQFMGQEPGTSEEIQEFCSTTYGVDFPLLAKADVNGD
                     DRHPLYAELVQTADAEGGAGDIQWNFEKFLIDRDGKVVGRFRPRTEPQDASVVAAIEA
                     TL"
     gene            complement(384061..384621)
                     /locus_tag="NONO_c03360"
     CDS             complement(384061..384621)
                     /locus_tag="NONO_c03360"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH15151.1"
                     /translation="MKATRRRLTEKQADTVDRLTKAALEVLSREGFAGLTVRMVASAA
                     GVGTATAYTYFSSKEHLVAEVFWRRLAADPPPNPAAGADSTARVVAVLRQIAMLVADE
                     PALAGAVTSALLGTDPDVAHLRTRIGTEIRRRLLDALGADADPDVVETLELLYAGALV
                     RAGVGYASYAEIADRLEKSALQVLQN"
     gene            384810..385478
                     /locus_tag="NONO_c03370"
     CDS             384810..385478
                     /locus_tag="NONO_c03370"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase domain-containing protein"
                     /protein_id="AHH15152.1"
                     /translation="MTRADSVISADTGRLFELAEQAVGFMPVDEGRALYEAVKRYAGD
                     GIVVEIGTYCGKSAIYLGAAARETGATVYTIDHHGGSEEHQPGWEYHDTSLVDPETGR
                     FDTVTTFRRTMVRAELTDTVIGIVGRSATVARHWSSPIRLLFIDGGHTEEAAQRDYDG
                     WAHWVAGGGVLAIHDVFPNPEDGGQAPFHIYRKALDSGNFREVAAIGSLRLLERSAGC
                     GGKG"
     gene            complement(385868..386941)
                     /locus_tag="NONO_c03380"
     CDS             complement(385868..386941)
                     /locus_tag="NONO_c03380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15153.1"
                     /translation="MPGAELPSIPGVLTSRQILRTAESIAAQQYGDGSIPWFRGGHTD
                     PWDHVESAMALTVAGLRDAARAAYIWSADTQRADGSWPLQFRADVIENPDTDTNFCGY
                     IAVGIWHYYRCTGDRGFVEAMWPTVRSAVDYVLSMQKGPNGEIYWLRSEYGILAEAML
                     TGCSSMFHSIGCGLAIAGLLGIEQPEWEVAALRLGHALRHHPESFAEKDRYSMDWYYP
                     VLCGALRGAAGAARIASRWDDFVVGEIGIRCVSDRPWVTGAETCELVMALDALGDGDR
                     AHRLLANMQHLREDDGSYWTGLVFADGKRWPEEQTTWTGGAVILAADALTRTSGGNGI
                     FREVVPAADLRSGLACDCERSRG"
     gene            complement(386928..387659)
                     /locus_tag="NONO_c03390"
     CDS             complement(386928..387659)
                     /locus_tag="NONO_c03390"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methyltransferase"
                     /protein_id="AHH15154.1"
                     /translation="MLTVDFDRLGVGPGARVIDVGCGQGRHSYEAYRRGADVVAFDQN
                     AGDLADVKIMFGALAEAGEAPEYATAETVQGDALAMPFEDGEFDVVIASEILEHIPAD
                     EAAIAELVRILKPGGALAVTVPRWLPERICWALSDQYHANEGGHVRIYKADELRAKIA
                     SRGMRFIHREHAHALHAPYWWLKCAVGVEKPDALPVRLYHRMLVWDMMKQPRLTRIAE
                     SALDPMIGKSVALYFTKPAVSGARR"
     gene            complement(387653..388912)
                     /locus_tag="NONO_c03400"
     CDS             complement(387653..388912)
                     /locus_tag="NONO_c03400"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glycosyltransferase"
                     /protein_id="AHH15155.1"
                     /translation="MRIALLSYRSKTHCGGQGVYVRKLSHGLAELGHEVEVFSGQPYP
                     ELLDPRVRLTEVPSLDLYRDSDPFRTPHPRELRDRIDVLELATMWTAGFPEPRTFSMR
                     AARLLRSRAADFDVVHDNQCLGSGLLDIARQLPLVATIHHPITRDREVDLAAAPWRRK
                     PFVRRWYGFLGMQQRVARTIPDLITVSSSSAADIADDFGVDASQLRVVPLGADTELYR
                     PRERRVPGRIVAVASADKPLKGISHLLQALARLRTAHDVHLQLVAKLEPNGPTEKLIA
                     ELGISDIVTVSSGLSDEALAELLASAQISCIPSMYEGFSLPAVEALASGTALVASRAG
                     ALPEVVGDCAELVEPGNVDELTATLTSLLDSPRRVAELGAAGRHRALTVFSWEAVAAQ
                     TVSVYEHAIARRQGTDLTPVTQEANVC"
     gene            complement(388932..389792)
                     /locus_tag="NONO_c03410"
     CDS             complement(388932..389792)
                     /locus_tag="NONO_c03410"
                     /codon_start=1
                     /transl_table=11
                     /product="putative F420-dependent oxidoreductase"
                     /protein_id="AHH15156.1"
                     /translation="MRFGIVLFTSDRGITPAAAAKAAEERGFSSFFVPEHTHIPIKRE
                     AAHPLTGDESLPDDRYTRTLDPWVALGTAAAVTERIELSTAVALPVEHDPITLAKSIA
                     TLDHLSGGRVSLGAGFGWNTDELTDHGVPPKKRRTVLREYLEAMRSLWTDEEAAYDGE
                     FVKFGPSWAWPKPVQAKIPVLIGTAGTEQGFRWIARSADGWITTPFETETLLERLRLL
                     NKVWEESGREDTPRVVALDGKPDVDRLATWKAAGVTDVLYGLPDKSEAEVLAYLDRLA
                     GKLAPAGLGA"
     gene            complement(389805..391280)
                     /locus_tag="NONO_c03420"
     CDS             complement(389805..391280)
                     /locus_tag="NONO_c03420"
                     /codon_start=1
                     /transl_table=11
                     /product="putative FAD-binding dehydrogenase"
                     /protein_id="AHH15157.1"
                     /translation="MSDTQGVRPQSAAEISDWDFEADVVIAGYGIAGVAAAIEAAEAG
                     ADVLVLERTGGWGGAASLSGGFIYLGGGTPLQKALGFEDTPENMEKFMLAALGPGVDE
                     AKIHDYCQGSVEHFNWLVAQGVPFKEEFWGEPGWEPPHDEGLMYSGGENSAPFKDIAT
                     PAPRGHLPQMQNKRIGEQGGGYMLMKPLTDAAEKLGVRAEYDIRIQRLIVDGDRVVGV
                     VAKRYGKLLNIRARRGVVLATGSFAYETKMIEGYAPRLIGRPAAAIEEHDGIGIRVAQ
                     ALGAELAHMDATEVAFFGDPQTMVRGIMVNGRGQRYIAEDTYPGRIGQATLIQQDNQA
                     FLIIDEDGLEEAQKTETSSPYFRQPPTWAAETVEELESDMGLPAGSLQATVEVYNRHA
                     ASGSDPLLGKKEQWVRPIGTPVAGFDMRGFTAGFTLGGLRTDLDSRVMHVTGEPIPGL
                     YAAGRCTSGVCAGGYASGTSLGDGSFYGRRAGRAAAHDASN"
     gene            complement(391294..391707)
                     /locus_tag="NONO_c03430"
     CDS             complement(391294..391707)
                     /locus_tag="NONO_c03430"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 4-carboxymuconolactone decarboxylase"
                     /protein_id="AHH15158.1"
                     /translation="MTASDNGADRRARGLAKMSQVYGWEVSDGPGEHFAVTVDHLFAD
                     IWSRPQLSDRDRRLLLLGALTAQGHLDVTEIQVSAALRNGELTEEQLREIAIFLCHYT
                     GWGPGTKFDSVVGKVVAAEEKAARRAAREQASSEQ"
     gene            complement(391775..392677)
                     /locus_tag="NONO_c03440"
     CDS             complement(391775..392677)
                     /locus_tag="NONO_c03440"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase"
                     /protein_id="AHH15159.1"
                     /translation="MSGSTNDSTTAAGFIGLGNMGAPMAERLLNRPGGLIVCDTRTEA
                     LQPFVDGGAEPAKTAAEVAERARVISVVVLNDAQVRSVLTGPDGILSTARPGTVVAVH
                     STISDQTAVELARICAEHEVEFVDAPVSGGAAAAKKGTLAVMVGGTDSAFEKVREPFG
                     HWAELVVHAGEVGAGTRMKLARNLLHFVSFTATAEAQRLAEAAGLNIVDLGKVVRHSD
                     AITGGAGAIMLRDTTAAVAPDDFWHPIFTHTRDLGEKDLSLALALGERLGVELPFARE
                     ALGGLGDGLGVGPGPIAESFQEHR"
     gene            393071..393634
                     /locus_tag="NONO_c03450"
     CDS             393071..393634
                     /locus_tag="NONO_c03450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15160.1"
                     /translation="MTETAKSGFDRDELDEMVRRWVVANEEAEKAGDWRPLADMYTED
                     ATYGWNYGPTQEFMSVGREEIRELALGQEMEGLEGWTYPYQDFVIDERSGNVIGLWKQ
                     VNERTRADGSNYTVDGIGGSWFRYGGNFQWSWQRDFFDFGNVSALFMEMITANALSDG
                     MQKRIERAGAGPLPGWYKIGESPVPLW"
     gene            393640..394896
                     /locus_tag="NONO_c03460"
     CDS             393640..394896
                     /locus_tag="NONO_c03460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15161.1"
                     /translation="MSVRAVPTSRFAELSREQLAILVPELLLCGHLIDRSGMAHSIGA
                     FGRDGMAEVAIEEWQLASPIYTRRMRAALGIPGDGVVTIFKGLQLDIGAPPQFMDFRF
                     RVEDDRNGEFWLDHCGALADVEPMGEDYVVAMCHTIEDPTFDATALATNPHAQVRPIH
                     RPPRQPADRVPVCAWTVRIDPANEPPKEPANAGRMSRFAAVDIELAPIEPGGPGRSDY
                     AGPLLSDIDFTEFSHSALVRMADEVCLQQHLLNLAFLIAVEERADLEKMADIARKQFA
                     GIAGLTSERLRETLGLGTGFDDLAQVLRVHPAWNPLPYVDMEIDAYHDSAVLRIGRDS
                     PGVRDGGWPAAIDADHLEPLAAMVRGVNPRFDVHARAGDESELVVEITLAATPFKEIP
                     EVSITRFSTGADFHFSPRQSLPLTVV"
     gene            394932..396545
                     /locus_tag="NONO_c03470"
     CDS             394932..396545
                     /locus_tag="NONO_c03470"
                     /codon_start=1
                     /transl_table=11
                     /product="putative long-chain-fatty-acid--CoA ligase"
                     /protein_id="AHH15162.1"
                     /translation="MPNNFADLFEHAVDAMPDRVALVQGDRQVTYQDLENRANQLAHH
                     LASVGLGEGSHIGFQMHNSIETMETLIAAFKLRAVPININYRYGADELRYVYDNADLE
                     AVVHHRCYSPVVDQVRPQITTLRHAFVVDDDQGGDGLPSESTPYAEAFESSSTARDFA
                     ERSPDDLFMMYTGGTTGMPKGVMWRQEDMWRVLGGGIDFYTNVPVADEYEQSRVGSGN
                     DPLRWLILPPLIHAAAMMPTFTALWSGQTVIYEPRFDPDRVWQVVAEQGAHIMVMTGD
                     AMARPLVTSYQRTPVNASTLVALASGAALLSQPVKNDMLELFPNAMITDSIGSSETGF
                     GGIGVAEKDADPGRGPRVQTGRGAVVVDDEGRPVEPGAEGWMAKTGSVPLGYYKDQAK
                     SDKLFRTVDGVRMVITDDRARVEPDGHITLLGRGNMVINTGGEKVFVEEVEAVVKSHG
                     GVFDVVVIGVPHERWGHQVAAVVSVDGSGSLDFADLEAHVRKHLAGYKLPRSIWVVDV
                     VGRTPSGKPDYRAAKAHAEKHTPDFVVGS"
     gene            396627..397301
                     /locus_tag="NONO_c03480"
     CDS             396627..397301
                     /locus_tag="NONO_c03480"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acetoacetate decarboxylase"
                     /protein_id="AHH15163.1"
                     /translation="MHSVLGDKVSMPVEIRDADACAATFLVDARAAREIIAPTGLQPL
                     LVAGRAVASLVFVRYVDGDLGPYHEFGLTLMVRGGDGGLGVYIPWLPVNQSFTCAAGR
                     EIWGFPKEIADIEVTPVRRGKRCEVRIDGRLVVAMETAGGVPSPGGMGGASIAAYTLM
                     DGVLRRTPWVMNPAQVRMGLGGTRIELGDHPVAEQMRALGLPKRALFSSRIGLLRMTF
                     EDAVIV"
     gene            397421..398188
                     /locus_tag="NONO_c03490"
     CDS             397421..398188
                     /locus_tag="NONO_c03490"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase, SDR family"
                     /protein_id="AHH15164.1"
                     /translation="MTKTALVTGAASGMGRMAAQRLAAAGYRVAALDINETGLAETAR
                     RSPNMSTYTCDVADEQTVRTVVEKVRADLGPIDHVVHAAALCRVGSALTHDVSEMRRL
                     MDINYGGTINICQAIVPEMKQRGRGTLVLFASVAGWLPSPGLAAYSASKFAVVCYHEA
                     LAQELHDTGVRVISICPPIVETPLLDGIRSQNESVVAGQKGVTPEKVLDAAEQAVANP
                     KAPLFIFPGPAKPLVLARRFVPNFLRKQVIRMVKPEL"
     gene            complement(398353..399174)
                     /locus_tag="NONO_c03500"
     CDS             complement(398353..399174)
                     /locus_tag="NONO_c03500"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase/isomerase family protein"
                     /protein_id="AHH15165.1"
                     /translation="MTTAATETGSNTEPHALLERRGATLIVTMNRPAVRNALSGEMLE
                     LMVQAWDTVDNDPEIRSCILTGAGGAFCAGADLKAMTKQDPAKNMSEGGAFDPTNIPG
                     LLKGRRLTKPLIAAVEGAAIAGGTEILQGTDIRIAGESAKFGVSEARWSLFPMGGSAV
                     RLPRQIPYTVAADILLTGRHITAAEAKEYGLIGHVVPDGTALDKALEIAEKINANGPL
                     AVQAILKTMRDTEGMHEDEAFKIDAELGLTVFRSDDAKEGPRAFAERRKPEFKGR"
     gene            399321..400964
                     /locus_tag="NONO_c03510"
     CDS             399321..400964
                     /locus_tag="NONO_c03510"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="AHH15166.1"
                     /translation="METTTQGGADTASHDDQPTTSHGASTLPPRVTKTLIDRLTGMIT
                     AGTAGEKRAPYEMIEVYTGAVVGELPQSSPEDVAAAADKARAAQREWAGRSVKSRLQV
                     FAKAHELILSELDTIADLIQIGCGKTRRMAIEESCDPPMVISHYLKHAERILKPVKRG
                     GAMPIISSSIEQHRPKGVVAVIAPWNFPFAISISDSVPALIAGNGVVIKPDNKTALCT
                     LYGVELLCRAGLPRDLIQVVCGTGPDVGPALIDNSDFVMFTGSTATGRTIGERAGRNL
                     ISCSLELGGKNPMLVLEDAVLDDVIPGAVFAVFGNSGQACMHIERIYVHDRVHDEFVR
                     RFVAAAEELGAKAGASYTSDPEFGSLVSVDHMRRVASHVDDAVAKGATVLTGGKPRPE
                     IGPAFYEPTVLTGVTPEMEHATLETFGPVVTIYRYTDENEAIRQANATTYGLNASVWS
                     ADLARAERIADRLEAGNVNINDGFVATYSAKMTPSGGVKQSGVGTRHGDAGLLKYTDT
                     VNVGVQKKQVLSARAGMPFEKQLKSTLITLRLSRRLRIR"
     gene            complement(401062..402453)
                     /locus_tag="NONO_c03520"
     CDS             complement(401062..402453)
                     /locus_tag="NONO_c03520"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipase"
                     /protein_id="AHH15167.1"
                     /translation="MIEQWTRRVGRSAGVLMATLAVLTTTGIGATASADPPPVAPAAP
                     IPLPPELDPGFYHPPADIVAAKAPGEIIAAREVHVANLGVVPVNVDAWQVSYRSNNSR
                     DQAIPAVATVLKPRGSTPDKLVSMQIAEDSLAGYCAPSYAIQHLSASTFLGQIVAPAE
                     FVIAQGALQQGWAVVIPDHEGPDNAYAAGPLAGRITLDGIRAARDFAPMRVAPDARIG
                     MYGYSGGAIATGHAAELKSSYAPELNIVGTAEGGVPADLGMTLNVANGQMTSGLVLAA
                     VMGLTHEYPEFGQFVGEHMDPLGRAVTTVQSGLCVQYVSSLLPFLNIKGMLQVPGDPM
                     RQPPVADVLDKTRMGKTVPDMPMYIWQGNPDEIIPVGQVNNLVDTYCQSPSATVQYTR
                     EHFAEHVATEISGAGPAMLWLRDRLDGVPAQPGCHTGDAGWLLLDPNGFQMLASTFGE
                     TFASFFGKPIGVK"
     gene            402559..403188
                     /locus_tag="NONO_c03530"
     CDS             402559..403188
                     /locus_tag="NONO_c03530"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH15168.1"
                     /translation="MTTAQRRYGGRAVAERKAERRDRFLRAATRIFAERGYPNCSLAD
                     VCAAAGLSRRQFYEEFATREDVLVAAYDRIQDEAAAAVTTALAEAGGQPTGRAAITTA
                     LTAYLASIDSDPYRAKVAFVEVVGVSERMERHRRDRRHLWAQVIDTAIVPLSGPGART
                     AGPPGLAAGTLIGAVNGLADEWLFRQPRPPVGDLVELLVRVADSLIDRE"
     gene            403296..404129
                     /locus_tag="NONO_c03540"
     CDS             403296..404129
                     /locus_tag="NONO_c03540"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methyltransferase"
                     /protein_id="AHH15169.1"
                     /translation="MTQPAAAYPSVVPVGVDTARASIARVYDAALNGKDNFEVDREVL
                     AQVRTVAPQVNDLAWANRDFLIRACRFLASQAGIDQYLDLGSGLPTAENTHQVVQRVQ
                     PGAKVVYVDNDPMVLAHGRALLSDNPDTTIVAGDIFRPHEVLTESTVRAELDFTRPMA
                     LFHIGTLHHYLGDDAAALMRTYVDALPSGSYFSIAHFYDPEEPELSDLARRMEDKFVH
                     SPMGSGRFRTRDEIQAMFGGLEMVEPGLVLADEWWPDGPRLAPLSEVRRCIVAGIGRK
                     P"
     gene            complement(404130..405134)
                     /locus_tag="NONO_c03550"
     CDS             complement(404130..405134)
                     /locus_tag="NONO_c03550"
                     /codon_start=1
                     /transl_table=11
                     /product="2OG-Fe(II) oxygenase superfamily protein"
                     /protein_id="AHH15170.1"
                     /translation="MVDRALPVLDLASAESAPQRFRAELRAATHEFGFFYLTGHGIAS
                     ERAAELLGLARRFFALPDAAKQEIAQLRSPQFRGYSRLGGELTNGRVDWREQIDIGPE
                     AEVIPGARGYWNLQGPNLWPSALPELRPAVHAWDESLATVGRALLRHWAAALGANDDF
                     FDPAFTDRPATLIKIVRYPGNRDNPQGVGAHKDSGVLTLLLVEPDSRGLQVESSSGGW
                     IDVSPLPGAFIVNIGELLEVATGGYLRATRHRVLAPEPGADRIAIPYFHNPALDARIP
                     LLPLPPELAAAARGVTADPANPIFDTYGENAWKSRTRAHPDVAELHHGIRPSAPASAY
                     "
     gene            405394..406437
                     /locus_tag="NONO_c03560"
     CDS             405394..406437
                     /locus_tag="NONO_c03560"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter, substrate-binding
                     protein"
                     /protein_id="AHH15171.1"
                     /translation="MSGRIRTALSIVAAGSVAAMLLSACGSSGTAHTENGVTSLKYLG
                     WSDQVTPPELAENLGFFDGKIKLDYAGNTISGPQEIQTAATGQIDFGGAFAGAVAKLA
                     GAGAPITAVVNYYGSDEKSFQGYYTLDSSPIHTAADLVGKKVGVNTLGGQNEADIHDA
                     LKKAGLSVDQIKSVQLVALPPPNIEQALRQGQIDAAALNGQFQQRALATGGIRPIFTE
                     LDEYGGPINGGPYVFRNDFIAKNPDVVRTFTTGVAKALEWERTTPRDQVIAKFTDIIN
                     ARHRAGEDTSTLKYWLSVGVPAKYGKLSDEDFTRWQSWLEDTGGIDHKLEPGKFYTNK
                     FNALVQPQDAAGK"
     gene            406480..407760
                     /locus_tag="NONO_c03570"
     CDS             406480..407760
                     /locus_tag="NONO_c03570"
                     /codon_start=1
                     /transl_table=11
                     /product="low temperature requirement A-like protein"
                     /protein_id="AHH15172.1"
                     /translation="MLGMSDSEPSTSAGLAHRLVPMIGRDPDERGRVSSPLELLFDLT
                     FVVAVGTAASYFAEMVAAGHAGKAVLAFLLAMFAIVLAWINFSWFASAFATDDWLDRV
                     LTMLQMIGVVIFALGLPAMFHSVDQGDHLELRVMVIGYVVMRVAMVLQWTRAARQSPR
                     FRDVGAANVRWTVIAQIGWVIIGFVHLPLGVVIGGVLVLGVLELLLPVITQGSAGGTP
                     WHPHHVAERYSLFAIITLGEGVVGTVASSGDLLGGVDGTHWSADAIAVVVAGVGLTFG
                     MWWVYFITPFGDILVHRRNRGYLFGYGHFPLYIGIAGAGAGLHVAGLQLEHHTRIGPV
                     AVVATLALPVGLYLLMVYLLHTLLLSAPDPFHILLLALTAIVLAVAMILAAVGVSIAI
                     CLIIVMISPFITVIGYETVGHRHQRQMLANLERA"
     gene            complement(407767..407979)
                     /locus_tag="NONO_c03580"
     CDS             complement(407767..407979)
                     /locus_tag="NONO_c03580"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15173.1"
                     /translation="MILGICILIVGMVFIGVTLARRPGKQPDTPALPMYPEALPMYPE
                     PGAQRNGLAHSARQQQTQWPQRPYDR"
     gene            complement(408082..408792)
                     /locus_tag="NONO_c03590"
     CDS             complement(408082..408792)
                     /locus_tag="NONO_c03590"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, MarR family"
                     /protein_id="AHH15174.1"
                     /translation="MGTDTIAAVAAATGYSVQQIRDLERLGVIPAARRAENGYRRFGA
                     IHLRDLRAYRDLAFAIGPVEARHTMSTIRSLPPDEAAARVCSLHAGLEAERRQTLAAR
                     TALSAIHDESATDTAEVDADVMTITELSRALGLRASTLRFWEHEGLLTPERIATRAGT
                     ARRYHLPAIREARITSALRAAGYGIADVREALTALRELHDTGRSLDALAGRLHSVAER
                     QLALLRAAATLAEIIQPQ"
     gene            408834..409313
                     /locus_tag="NONO_c03600"
     CDS             408834..409313
                     /locus_tag="NONO_c03600"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15175.1"
                     /translation="MSMDRILETIRGFDGVLELAPTAGDAFPEIAWGDHFFYYAPDGR
                     VPRSQPYATIVTKNYPDDTACDLGPGRWRLNIHVGSSAYTELVGASPREEPESVDYTA
                     VDTILPHPLYRAQGWIAIINPDNRTREQALALLRAAHDDARRRSGRRTAPGQAAVNE"
     gene            complement(409348..410130)
                     /locus_tag="NONO_c03610"
     CDS             complement(409348..410130)
                     /locus_tag="NONO_c03610"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methyltransferase"
                     /protein_id="AHH15176.1"
                     /translation="MRESAECPRMERTFEDLVDEAAAVSVAGWDFSWLDGRATEDRPS
                     WGYQRLMSARLATATAALDIQTGGGEVLAEATSLPATMVATESWPPNIAAATALLHPR
                     GAVVVATPDDAPLPFADRAFDLVTCRHPATVRWDEIARVLRPGGAYFAQHVGPASVFE
                     LVEYFLGPQPEARRGRDPRDEAAAARTAGLDIADLRTERLRVEFHDIGAVIYFLRKVV
                     WMVPGFTVDRYRTELRRLHERIEREGPFIAHSTRTLIEATAG"
     gene            complement(410230..410303)
                     /gene="trnP1"
                     /locus_tag="NONO_c03620"
                     /note="tRNA-Pro-CGG"
     tRNA            complement(410230..410303)
                     /gene="trnP1"
                     /locus_tag="NONO_c03620"
                     /product="tRNA-Pro"
     gene            complement(410360..411568)
                     /locus_tag="NONO_c03630"
     CDS             complement(410360..411568)
                     /locus_tag="NONO_c03630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15177.1"
                     /translation="MDTGSGRNRGGFEPEEDPAAWRAPASGGPESAPTEAIPYTPGGV
                     PNGAASQATPWSRPEPAFGGTDAPTTAFGWVGQAPGPEPAPAPNFPPQQQFPSPLGSE
                     PGWQPQQAGPQAHSFWNPEQQPPTAQFPSPQPPAGPPPKRRKALLLSGIGVLAVIAVG
                     VTVAIVTSGNSGDATAAKSGTPSMVSALSTENQPPPPQSPPAAPPSHPAPKPRPGQAP
                     PPGEAPPPTIPGYQVVQILDRGAAYDAPADWKPAEVPTAVWGSGSDTLEVAGLTQDGK
                     NYCPNYTRTNAFLTMSQQADPAVAAADVGKRIGAFGWTGAKITNSSAAEQMVSADGQL
                     HGMFVETTGSAPAPSPGCATTFSVYTFAFPSENGNFVMTVAADTGVDHAVDQATAKRI
                     LSTIRPLPAR"
     gene            complement(411608..412594)
                     /locus_tag="NONO_c03640"
     CDS             complement(411608..412594)
                     /locus_tag="NONO_c03640"
                     /codon_start=1
                     /transl_table=11
                     /product="putative calcineurin-like phosphoesterase"
                     /protein_id="AHH15178.1"
                     /translation="MPVFSSPALRRAALGSGAKIAAAAAGTAVAGIGYASLIERNAFI
                     LREATMPVLQPGSSSLRVLHISDLHMTPGQKLKQAWVRELDALEPDLVVNTGDNLAHP
                     KSVPAVVQSLSSLLARPGIFVFGSNDYFAPVPKNPLNYFDKNHKRRLGDPLPWQDMRA
                     AFTERGWLDLTHVRRDIEVAGIKIATAGVDDPHLVRDRYDTVAGTPNPLADLSIGLTH
                     SPEPRVLDRFADDGYDLVLAGHTHGGQLCLPGYGALVTNCGIDRSRVKGPSRWGAHTR
                     LHVSAGLGTSPWAPYRFCCRPEATLLTLVAAPPKRPVADSGHGVSESEAVAR"
     gene            412741..413205
                     /locus_tag="NONO_c03650"
     CDS             412741..413205
                     /locus_tag="NONO_c03650"
                     /codon_start=1
                     /transl_table=11
                     /product="GatB/Yqey domain-containing protein"
                     /protein_id="AHH15179.1"
                     /translation="MSELKSKLRADLTAAMKAKDSLRLNTLRMLLAAVQNAEVAGTEA
                     KELSDAEVIAVLGKEAKKRNEAAVVYEQAGRGELAANERAEQEVIDEYLPTPLTDAEV
                     ADLADTAIADVAEQLGERPGMKQMGQVMKIATALAAGRADGSRISAAVRSRL"
     gene            complement(413278..415719)
                     /locus_tag="NONO_c03660"
     CDS             complement(413278..415719)
                     /locus_tag="NONO_c03660"
                     /codon_start=1
                     /transl_table=11
                     /product="putative penicillin-binding protein"
                     /protein_id="AHH15180.1"
                     /translation="MTCPHGSPPTVHLACDSGPIRLGRVPISQTLARLAGACVLAAVL
                     LAGLLFPLAGGFGYMSNRAADAVDNVSSELVEGTAPAVSTMVDATGAPIAWLYEQRRF
                     EVPSDKIANDMKLSIVSIEDKRFAEHGGVDWQGTLRAFLTNTSSGEVQQGASTIDQQY
                     VKNFQLLVVAKTDAERRAAIETTPARKLREIRMALTLEKELTKDEILTRYLNLVPFGN
                     GSYGIQDAAQTYFGVDAKDLKVAQAAMLAGMVQSSSKLNPYTNPKGVTERRNTVLDTL
                     IQNIPSRAEEFRAAKEQPLGVLPEPKGLPRGCIAAQDRGYFCDYALQYLANAGISKDQ
                     IDKGGYLIRTTLDPNVQNSVKAAVNSVTDPNLPDIAEVQSIIAPGQDAHHILAMTSSR
                     TYGLDQGAHETVQPQPYSMVGDGAGSIFKIFTTAAAMEKGLGTSAQLDVPSFYAAKGM
                     GNGGAAGCPPATYCVKNAGNYKSPESVTEALAQSPNTAFVKLIQDVGVTPTVDMAIRL
                     GMRSYAEAGTSGHGNQSLGDMFKQQNLGSFTLGPVAINPLELSNVAATLASGGKWCPP
                     SPIAEVLDRDGKQVPLTQQACEQVIDPGLANTLANALSEDAPHGTAAGSAHATGWNVP
                     VSSKTGTTETHRSSAFLGFTNALAGAAYIYGDSPTPGEICSFPLRSCGDGDLFGGNEP
                     ARSWFAGLKPVLDKYPPSVLPPLDDKYVRGSNNAQIPDVNGMSESEARSVLIGAGFQV
                     STVTQPGSAAKGTVTATTPNGSAIPGSVITVLVSDGTQREIPRPGPAAPPPGLPGLPG
                     IPVPRLPPIPIPLPR"
     gene            415930..416253
                     /locus_tag="NONO_c03670"
     CDS             415930..416253
                     /locus_tag="NONO_c03670"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcription factor WhiB"
                     /protein_id="AHH15181.1"
                     /translation="MHMTTPIARLDVEQAEARIAWVSQARCKEVDPDQLFVRGAAQRK
                     AATICRHCPVLMECGADALDNRVEFGVWGGMTERQRRALLKQHPEVTSWSEFFRAQRQ
                     QKVAM"
     gene            complement(416357..417562)
                     /locus_tag="NONO_c03680"
     CDS             complement(416357..417562)
                     /locus_tag="NONO_c03680"
                     /codon_start=1
                     /transl_table=11
                     /product="anion-transporting ATPase"
                     /protein_id="AHH15182.1"
                     /translation="MSRPSPLVPPATPLLDIEAIIADRTARVVVCCGSGGVGKTTTAA
                     AIALRAAEQGRKVVVLTIDPARRLAQSLGVSDLGNAPQRVQLPETAAGELYAMMLNMR
                     RTFDEMVLEHTTPEKAEQIFANPFYQTVASSFGGTQEYMAMEKLGQLVAKRDWDLVVV
                     DTPPSRNALDFLDAPKRLGNFLNGRMIRVIMAPGRGVGRFVTGAMSLAVRGVSTIVGG
                     QMLKDASLFLQSLESMFGGFQDRAERTYAMLSRPGTHFVVVAAAEPDALREASFFVDR
                     LSTDSMPLAGLVLNRTHPVLCTLPAAQAITGADRLSPGAGSAADGTPAEAEAADATTD
                     PATLTADILRIHAHRAVTAKRERHLLHRFTGAHPRVPIVTVTALPFEVSDLEALRAVG
                     DQLAGNPTA"
     gene            complement(417562..418599)
                     /locus_tag="NONO_c03690"
     CDS             complement(417562..418599)
                     /locus_tag="NONO_c03690"
                     /codon_start=1
                     /transl_table=11
                     /product="putative anion-transporting ATPase"
                     /protein_id="AHH15183.1"
                     /translation="MGVPTAVPVSEEPGLELGWPDRADRARLHYVSGKGGTGKSTVAG
                     ALALALAAGGRKVLLVEVEGRQSIAQLFDLPPLPPTETKIATADGGGEVMALALDIEH
                     AFLEYLDMFYNLGFAGRAMRRMGAIEFVTTIAPGLRDVILTGKIKECAVRADKSGKPV
                     YDEIVIDAPPTGRIAGFLDVTKAMAEVAKGGPIAGQAEGVAALLHSEQTVVHLVTLLE
                     ALPVQETADAIAELTESDFRIGTVIVNRATEGFLPAPVRARVATGDLDLDAVRAGLAE
                     AGITLDDNDFQGLIREAVEHSATLQAQDDSSAELAKVDISRLYLPALPDGMDLGGLYE
                     LAAHLSAQGVR"
     gene            418765..418929
                     /locus_tag="NONO_c03700"
     CDS             418765..418929
                     /locus_tag="NONO_c03700"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15184.1"
                     /translation="MSDVTVWEYATVPLLTHATKQILDQWGADGWELVTVLPGPTGEQ
                     HVAYLKRPKQ"
     gene            418926..419396
                     /locus_tag="NONO_c03710"
     CDS             418926..419396
                     /locus_tag="NONO_c03710"
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP-like protein"
                     /protein_id="AHH15185.1"
                     /translation="MTASGIDWQANLDRLGLTLPPVAAPAGAYIPAIRSGSLVYTAGQ
                     LPFVDGALSATGKVGAEVNIEDAARAAGLCALNALAAVHDLVGLDEVVRIVKVVGFVA
                     SAPGFTDQPLVVNGASELLGEVFGAAGVHARSAVGVFELPKATPVEVELIAEVR"
     gene            419479..420270
                     /locus_tag="NONO_c03720"
     CDS             419479..420270
                     /locus_tag="NONO_c03720"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase-like protein"
                     /protein_id="AHH15186.1"
                     /translation="MPLTHPAYGQLRKVTETASVLLANNPNQMTLDGTNTWILRAPGH
                     SDCVVIDPGPKDKAHSEAIARETGGNIALTLVTHHHHDHTGGIDRLVKLTGTPVRAMD
                     PKYLSDSPDALAHGEVIEAAGLRLTVIGTPGHTQDSVSVLLDDAIITGDTVLGSGTTV
                     LESRDDALGDYLASLDRLAAQAPGRALLPAHGPDHSQAEPVISYYIQHRQQRLDQVRA
                     ALRDLGEDASPMKVVARVYADVDKKLWPAARSSVQAQLAYLRGAN"
     gene            complement(420305..420979)
                     /locus_tag="NONO_c03730"
     CDS             complement(420305..420979)
                     /locus_tag="NONO_c03730"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cAMP receptor protein"
                     /protein_id="AHH15187.1"
                     /translation="MDEALARAGIFQGVEPTAVAALAKQLQPVDFPRGHVIFNEGEPG
                     DRLYIITSGKVKIGRRSPDGRENLLTIMGPSDMFGELSIFDPGPRTSTATTVTEVRAV
                     TMDRDALKAWIDQRPEIAEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKALLQLAQR
                     FGTQEAGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWLRLEGKSVLISDSER
                     LARRAR"
     gene            complement(421194..421418)
                     /locus_tag="NONO_c03740"
     CDS             complement(421194..421418)
                     /locus_tag="NONO_c03740"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15188.1"
                     /translation="MVLFPVVLMLFALSMERVENRLRKLLEPGEEVQQYLDRASNAEV
                     NELAKLGVPAHAGAGGRRARSEELDVAQAS"
     gene            421711..422391
                     /gene="nth"
                     /locus_tag="NONO_c03750"
     CDS             421711..422391
                     /gene="nth"
                     /locus_tag="NONO_c03750"
                     /EC_number="4.2.99.18"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease III"
                     /protein_id="AHH15189.1"
                     /translation="MNRTLALAFPDAHCELDFTTPLELAVATILSAQCTDVRVNQTTP
                     ALFARYRNAKDYAEADRTELEEYIRPTGFFRNKTNSLIGLGQALLEQHDGEVPATLAE
                     LVKLPGIGRKTANVILGNAFDVPGITVDTHFSRLVQRWQWTTETDPVKIEHAVGALIE
                     RKDWTMLSHRVIFHGRRVCHARKPACGACVLAKDCPSYGIGPTDPATAAALVKGPEAE
                     HLLELVGR"
     gene            422388..423032
                     /locus_tag="NONO_c03760"
     CDS             422388..423032
                     /locus_tag="NONO_c03760"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin-like protein"
                     /protein_id="AHH15190.1"
                     /translation="MKSVPAAWRWAFVVLITVVALAVAVWPRDEHSAPSVTATAVQGG
                     PAAVSDGQRAAAALADCPRPAATDPAPARGPLAGMNVECLSDGRPIDLGAALAGRPAL
                     LNLWAFYCEPCARELPALQEFAKRAGDAVTVLTVHSDPAGSRGLDRLRALDIHLPGVQ
                     DGDQKVRSVLNAPQVLPISVLVRADGSIAKVLVQPFDSADQVAVAVEQGLGVRT"
     gene            423156..423896
                     /locus_tag="NONO_c03770"
     CDS             423156..423896
                     /locus_tag="NONO_c03770"
                     /codon_start=1
                     /transl_table=11
                     /product="putative hydrolase, NUDIX family"
                     /protein_id="AHH15191.1"
                     /translation="MPDRFSVSGSGSVEIPQWLRGVAEHEPADPTGINQVLHRTAGKI
                     ASAALRPREASVLVLFGGSPEADPGAPGGMPADADLLLTQRAATLRQHRGQVAFPGGG
                     VEPGDEGPIATALREAREETGLDPSGVEPFAVLPKIFVPPSRFDVTPVVAYWRTPGAV
                     GVVSETEAARVVRVPLADLIEPANRFVVRHPLGYMGPAFAVDGMLVWGFTAGVLAGLL
                     AVSGWERDWDHHDVRDLQASLAAVGMTL"
     gene            423893..425086
                     /locus_tag="NONO_c03780"
     CDS             423893..425086
                     /locus_tag="NONO_c03780"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Trypsin-like serine protease"
                     /protein_id="AHH15192.1"
                     /translation="MSSSGWLDLAVVIIALLAASSGWRQGAVASALGFLGVVLGAVAG
                     ILIAPHILQHISEGRKRVLVGVVLIVALVVVGEVAGMVLGRAARSGMRHPFTRSVDSV
                     VGAALQCVAVLVTAWLLALPLASSSQPGIAAAVNGSRVLSDVNTVAPNWLRRVPNEFS
                     KLLNTSGLPEVIGPFGRAPIAAVEPPDPSVLDTPVALNLQHSVLRINGVAPSCQRALE
                     GSGFVVAPERIMTNAHVVAGTSTVQVDTARGRLDATVVLFDPSKDVAILAVPGLNAPV
                     IPLAAAAGKSGESAIVLGYPGGGPYTASAARVRETLELTGPDIYKSNTVERQVYTVRG
                     RVRAGNSGGPLVDTDGQVLGVVFGAAVTDDDTGYVLTLKEVESDLQAAGGSTAQVGTG
                     DCVLN"
     gene            complement(425110..426015)
                     /locus_tag="NONO_c03790"
     CDS             complement(425110..426015)
                     /locus_tag="NONO_c03790"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase family protein"
                     /protein_id="AHH15193.1"
                     /translation="MHANGIRFHIAEGGGEDAVGDPARPLVVLLHGFGDFWWSWRHQL
                     TGLTEAGYRAVAVDLRGYGDSDKPPRGYDGWTLAGDIAGLVRALGHTDATLVGHAEGG
                     LVCWATAVLHPRVVRSIALLASPHPVALKRAVLRDHRQRTAYLPNFLRYQLPRYGEHL
                     LTRQDGFEVERLVRDRVDPRWAATEEFVETVQHMRSAIRIPGAAHCALEYQRWAFRSQ
                     WRPDGRRFLSAMREPVRVPTLILHGESDHYILESTLRGSARLAPDRRVVRIPDAGHFA
                     HQENPAAVTAELAELLGDPATAQYV"
     gene            complement(426103..426600)
                     /locus_tag="NONO_c03800"
     CDS             complement(426103..426600)
                     /locus_tag="NONO_c03800"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH15194.1"
                     /translation="MSVTNGGNGNDAGRNRTITSIPLSEVDTTAGASVGDLVRDAAEQ
                     MSTLVRAEVELAKAEVTGEIKKGLQGSVFFIGALTVLLFSSFFFFFFLAELLDVWLYR
                     WAAFLIVFALMIVVVVVLALFGYLKVRKLRAPAKTIESLKETRSVLPQGFGSHAEDTA
                     DKRTA"
     gene            complement(426640..427851)
                     /gene="nhaA"
                     /locus_tag="NONO_c03810"
     CDS             complement(426640..427851)
                     /gene="nhaA"
                     /locus_tag="NONO_c03810"
                     /codon_start=1
                     /transl_table=11
                     /product="Na(+)/H(+) antiporter NhaA"
                     /protein_id="AHH15195.1"
                     /translation="MIVALRSELARYLRTETVGGALMLIAAAVALLWANSPWHDGYSR
                     MLDATVSIPPLDLHLTLAEWTGDGLLAIFFFVAGLELKRELVVGELADRKRAVLPVLA
                     AAGGVITPALIALAIGWGVPGMDRGWAIPVATDIAFALAVLALTGSRIPAGARVFLLS
                     LAVVDDLIAILLIAILFTTTVAIGWLAAAAACFGAWALAQHRRVRTPLVYVPLALIAW
                     YALHEAGIHPTLAGVICGLLTRVRPDPDEDEAPAARLEHLFQPVSAGVCVPLFALFAA
                     GVPLSAKVFGEMFTSRLSLAIMAGLLIGKTVGIFGTSWLAIRFGIARRPAGLGNRDMS
                     ALSVLGGIGFTVSLLVAELALTDRDAAELAKAAVLTTSLAASLLGSALLLRRGRAHQA
                     RRDARAATADE"
     gene            complement(428053..430008)
                     /gene="acsA1"
                     /locus_tag="NONO_c03820"
     CDS             complement(428053..430008)
                     /gene="acsA1"
                     /locus_tag="NONO_c03820"
                     /EC_number="6.2.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="acetate--CoA ligase"
                     /protein_id="AHH15196.1"
                     /translation="MTDTTAEHRDVYPPTAEFAAAANADVSIYDRAAADRDGFWAEQA
                     QRLHWHQPWTRVSDWDNAPFARWFVDGKLNVAYNCVDRHVADGYGDQVAIHWEGEPGD
                     SRAITYSQLQAEVCQAANYFTELGLQAGDRVAIYMPMVPEAIVSMLACARLGLTHSVV
                     FAGFSPSALRQRVDDAEARLVITTDGQWRRGKAAPLKEAVDEALYAHGDVPHSVEHVL
                     VVRRTNIEVAWTEGRDLWWHDTVAKASTEHEAQPFDAEHPLYILYTSGTTGKPKGILH
                     TSGGYLTQVAYTHHYVFDHKPGADVYWCTADIGWVTGHSYIVYGPLANRATQVVYEGT
                     PNFPDEHRHWQIIEKYGVTIYYTAPTLIRTFMKWGREIPDAHDLSSIRVLGSVGEPIN
                     PEAWRWYREVIGAGTAPIVDTWWQTETGAIMISPLPGITAAKPGAAMAPLPGISATVV
                     DEEGNSVERGSTEANGYLVLDQPWPSMLRGIWGDNERYKATYWERFAAQGWYFAGDGA
                     KIDADGALWVLGRVDDVMNVSGHRISTAEVESALVGHHHVAEAAVVGASDATTGQGIV
                     AFVILTGGSDNSGQQLVDELKAEVSREISPIARPREIHIVPELPKTRSGKIMRRLLRD
                     VAEGRELGDTSTLVDPNVFEAIRASNA"
     gene            430314..431057
                     /locus_tag="NONO_c03830"
     CDS             430314..431057
                     /locus_tag="NONO_c03830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15197.1"
                     /translation="MSDVLQPLVDLPGVRDAADRTRDALAEVHRHKANRRGWPTTAAE
                     ASVRAARSSAAIDGGATELPADGRVADPILAGSLRVGQALDGDALRNMTGVWQRAPLQ
                     ALARLHLLAAADLVGADIELGRPRAESGVADRLDLLVQTVVSSKAPAPVLAAVVHGEL
                     LSLRPFGSADGVVARAASRLVTVASGLDPHSLGVPEVFWLRRRQAYLDAAAGFATGTA
                     EGVGGWVLFCCGALEDGAREARSIADSAA"
     gene            complement(431509..432258)
                     /locus_tag="NONO_c03840"
     CDS             complement(431509..432258)
                     /locus_tag="NONO_c03840"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-superfamily hydrolase"
                     /protein_id="AHH15198.1"
                     /translation="MIAKSSAFVFSRPFFDQGLIDRRTVLESSYAHFLFMLSGADHDQ
                     MERMREHLTKMCAGWDVSQVRAIVAETLHELVDPLIYAEASDLIADHRIRGHDVVIVS
                     ASGEEIVAPIAAALGATYTAATRMVVDNGKYTGEVEFYCYGEGKVEAIEKLAATEHYD
                     LSQCYAYSDSITDLPMLSAVGHPTAVNPDRALRREAVAREWPILAFSNPVSLWSRIPA
                     PSSTTVAATAIVGLSAVLAGAVSYRLLRRGR"
     gene            432809..433858
                     /locus_tag="NONO_c03850"
     CDS             432809..433858
                     /locus_tag="NONO_c03850"
                     /codon_start=1
                     /transl_table=11
                     /product="helicase/secretion neighborhood CpaE-like
                     protein"
                     /protein_id="AHH15199.1"
                     /translation="MLVGDQRLREEVRRVAAAADRALDERSMPTGRHAWAAAALVVLD
                     AAAARTCVASGYPRRPGVVLVGGGEPELEQWQAAARVGAERVVALPAGTETLIESFAA
                     HAWRDPGDGLVLALVGAGGGAGTSVFAGALALAAADRRFRPQTLLVDGDPLGGGIDLL
                     LGIESVPGLRWPELSVRDGRIGAQALHDALPAAAPGLAVLACSRPGGTVPDEIGTGAV
                     RAVVAAGRGAGDLVVCDISGSRGRHVDHFLDIADLVVFVVPARLRSVAAAGAVVADIA
                     RRNPNQALVVRGPAPGGLRGREIADTLGLPLLTTMRAQPGLAGTLERGGLELARGPLF
                     AGAQAVLDVLPDGAR"
     gene            433855..435039
                     /locus_tag="NONO_c03860"
     CDS             433855..435039
                     /locus_tag="NONO_c03860"
                     /codon_start=1
                     /transl_table=11
                     /product="helicase/secretion neighborhood ATPase-like
                     protein"
                     /protein_id="AHH15200.1"
                     /translation="MSGVVNPELLDRVRERLAAQPGEHDPARLAAAIRAEAGRVLGDT
                     DLLRALRLLQTEMTGAGVLEPLLHDARVSDVLVTAPDAVWVDRGNGLERAPVRFSDEA
                     AVRRLAQRLALAAGRRLDDAQPWVDGRLPEYERAPGESFGVRLHAVLAPIAQGGTCIS
                     LRVLRPVGHSLSDLRASGTLTAESARLLDAIVRARLAYLVVGGTGAGKTTLLSALLAR
                     VDPAERIVCVEDAAELAPPHPHIVQLVARVPNVEGAGAVTVRDLVRQALRMRPDRIVV
                     GEVRGGEVVDLLTALNTGHDGGAGTVHANSPREVPARLEALAALGGMSREGLHSQLAA
                     AVQVVLAMRRRSDGNRVLGEIGLVVRGDAGVRIETAWCADAGATPARAALSDLLRERE
                     RR"
     gene            435036..435827
                     /locus_tag="NONO_c03870"
     CDS             435036..435827
                     /locus_tag="NONO_c03870"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH15201.1"
                     /translation="MTTSLLCGAAALLTLPTPIRTHRLRALYGGSDKRRNMPRAWIIR
                     GLTVTTVVVTIAFGPGPAGAVALAVATGVVRSRSRHRERRHDDECRKLLEGLDVVIGE
                     LRTGAHPGTAAAVAAGEIGGPIGNAFAVSAARARLGGSAAVGLRTHKCAVTTELGRVA
                     DAWEVAERHGLALADLLRAARADLVGRRRFGERTTAALAGARASAAVLAGLPLLGIAL
                     GQLMGAHPLQVLLGSGIGSFVLPLGTGLIAAGLLWADAITRRVTA"
     gene            435824..436423
                     /locus_tag="NONO_c03880"
     CDS             435824..436423
                     /locus_tag="NONO_c03880"
                     /codon_start=1
                     /transl_table=11
                     /product="putative type II secretion system protein"
                     /protein_id="AHH15202.1"
                     /translation="MTAIPAALLGAAVALLLVPGHVTPSRRLRAARGIPPLESPRRSR
                     PSAGDPLEIASALDLLAACLRAGLPVATAARAVAPGAPDPFRTALRRAADLLALGADP
                     VAAWERAAREAPTAEMDALARLVRRSARSGAALSGAVADLADQCRSAVEDAAAARAER
                     AGVLISGPLGLCFLPAFVCLGIVPVIAGLAGRVLGGGLW"
     gene            436481..436708
                     /locus_tag="NONO_c03890"
     CDS             436481..436708
                     /locus_tag="NONO_c03890"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15203.1"
                     /translation="MLTATRSAVRELRVRELRSRLIQAAVADEGMSTAEYAIGTIAAA
                     AFGAVLYTVVTGDSIVNALTKIIDKALNTTV"
     gene            436705..437079
                     /locus_tag="NONO_c03900"
     CDS             436705..437079
                     /locus_tag="NONO_c03900"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15204.1"
                     /translation="MRPIGRERRPLPDIADQRGAVTVEAAIALAALVVVVVLCLGALL
                     AASMQVRCIDAAREAARLAARGATAEAVPIARQVAPPGAVIDVHEVDDRIVATVSARV
                     PVLPMLRLRAEAVAAREPGEPR"
     gene            437076..437456
                     /locus_tag="NONO_c03910"
     CDS             437076..437456
                     /locus_tag="NONO_c03910"
                     /codon_start=1
                     /transl_table=11
                     /product="helicase/secretion neighborhood TadE-like
                     protein"
                     /protein_id="AHH15205.1"
                     /translation="MRARTPLWRNCAGGVTVTACLALVALLLVTIMIVQIASVICARH
                     RAQSAADLGALAAAGALDSGVETACDRAESVVRAGRMHMVRCAAVDWDVTVTVDSEVS
                     PAIVGRRSVVAVARAGPVADEKRS"
     gene            complement(437759..440143)
                     /locus_tag="NONO_c03920"
     CDS             complement(437759..440143)
                     /locus_tag="NONO_c03920"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DEAD/DEAH box helicase"
                     /protein_id="AHH15206.1"
                     /translation="MNPNGAATRQTSGDTTGYGTSLLNRVLFGVSDGESRITHVTELP
                     ARAAQFSDWPSWAAPEAVEALRESGVQKPWSHQIHTAELAFGGGHVVVCTGTASGKSL
                     GYQLPILTELRRDPRATALYISPTKALGADQFRAAAELTADVPLRDIHPACYDGDTPP
                     EVRRWVRANARWIFTNPDMLHVGVLRNHQRWARIFRRLRYVVVDECHAYRGVFGSQVA
                     MVLRRLRRLAAHYGADPTFVLCSATSADPATAAERLIGAPVTAVTTDGSPHGARTVAL
                     WEPPLLTEFRGENGAPVRRAATTEAARIMTDLVVEGARTLTFVRSRRAAEVVAIDVRR
                     MVAEVDPDLADRVAAYRAGYLAEDRRELEDGLSDGSLLGAATTTALELGVDIAGLDAV
                     VIAGFPGTVASFWQQAGRAGRRTQGSLVLMIARDDPLDTYLVHHPHALLGRPVEAAVT
                     DPHNPHVAAPHLLCAVGEHPMTDAEIRELGTWEIALDLAEQGLIKRRAQGRGPARWYP
                     TSGIHPHDEVDVRAGIGTQIAIVDTSSGRLLGTADSGRAPATLHAGAVHLHQGETFVV
                     DELDPEAGVALVHAEQPGWTTSARAVTSVTVEQRLREHVHGRVTVALADVCVSRQVVG
                     YLRTLPTGEVLDLIELDMPEQILATRAVFYTVTPGLLAGAGIEPRRVPGALHAAEHAA
                     IGMLPLVASCDRWDVGGVSIAEHPDTGLPTVFVYDGHHGGAGFAERGFGRMRTWLAAT
                     HAAIASCSCPQGCPSCVQSPKCGNGNAPLDKAGAAALLTAILAELPDDTTEPDS"
     gene            440580..440786
                     /locus_tag="NONO_c03930"
     CDS             440580..440786
                     /locus_tag="NONO_c03930"
                     /codon_start=1
                     /transl_table=11
                     /product="cold shock protein"
                     /protein_id="AHH15207.1"
                     /translation="MAQGTVKWFNAEKGFGFIAPEDGSADVFVHYSEIQGSGFRTLEE
                     NQKVEFEVGQGTKGPQATGVRALS"
     gene            441103..444033
                     /gene="topA"
                     /locus_tag="NONO_c03940"
     CDS             441103..444033
                     /gene="topA"
                     /locus_tag="NONO_c03940"
                     /EC_number="5.99.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase"
                     /protein_id="AHH15208.1"
                     /translation="MATRDRGASPTPDAGSDGPDASVPAGRGRLVRRLVIVESPTKAR
                     KIAPYLGRGYTVEASVGHIRDLPRGAADVPAKYKGQSWARLGVDVDHDFEPIYVVNPD
                     KKAKVSELKTLLRDADELYLATDPDREGEAIAWHLLETLKPKIPVRRMVFHEITEPAI
                     RAAAADTRELDNDLVDAQETRRILDRLYGYEVSPVLWKKVMPRLSAGRVQSVATRIVV
                     QRERERIAFRSAEYWDIAAKFDAGGGESDQANPRIFGARLVTVDGSRVAGGRDFGSDG
                     QLKTRSGVTVLDEAAARRLAAALQNADFQVSSVESKPYTRRPYAPFMTSTLQQEAARK
                     LRFGSERTMRVAQRLYENGYITYMRTDSTTLSESAITAARAQATQLYGPEFVHPTPRQ
                     YNRKVKNAQEAHEAIRPAGDTFATPGQLHARLDQDEFRLYELIWQRTVASQMADARGT
                     TLTVRITGRAGTGEECVFSASGRTITFAGFLKAYVESVDEDSGSQSDDAESRLPALTE
                     GQNVSATELTPDGHTTNPPPRYNEASLIKALEELGIGRPSTYASIIKTILDRGYVYKR
                     GSALVPSWVAFAVVGLLEEYFGRLVDFDFTAAMEDDLDAIAGGREQRGNWLSSFYFGG
                     EHGAEGSVARSGGLKRMVGEQLDDIDAREVNSIKMFADDEGRDIVVRVGRFGPYLERM
                     VRNPDDPDGDPISQRANLPDDLPPDELTPAIAEKLFATPQEGRELGVDPETNHRIVAK
                     EGRFGPYVTEILPEPEPDPDAKKGAKKPAGPKPRTGSLLKSMDLSTITLDDALKLLSL
                     PRVVGKDPESGDEITAQNGRYGPYLKKGTDSRSLTTEDQIFTVTLEEALKIYSEPKRR
                     GRQAASAAPLRELGKDSATDKPMVIKDGRFGPYVTDGETNASLRKGDEVESITDERAS
                     ELLADRRARGPVKKTAKKAAKKAPAKKTAAKKTTTAKKTTAKKTTAKKATAKKAATRP
                     EADQ"
     gene            444110..445309
                     /locus_tag="NONO_c03950"
     CDS             444110..445309
                     /locus_tag="NONO_c03950"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA polymerase III subunit delta"
                     /protein_id="AHH15209.1"
                     /translation="MAGVFDRLVGQDSVESELTAAAVAARDGVASSAMTHSWLFTGPP
                     GSGRSVAALCFAAALQCTAEGTPGCGQCHACTTTMAGTHGDVRRVIPEGLSIGTKEMR
                     EIVQVAARRPSTGRWQVVLIEDADRLTEAAGNVLLKVVEEPPERTVFLLCAPSVDPED
                     ISVTLRSRCRHIPLVTPSVDAIARVLRERDGMPSGQAEWAASVSGGHVGRARRLATDE
                     QARTRRTRALSLVSAVARPAAAYAAGDELVKSAEEEAKQVSSERDERERDELATALGA
                     GGTGKGAASATRGSAGVLKDLERRQKSRATRTSRDAMDRALIDVAGLYRDALALRFGT
                     TGRTVTFTHPDLSAEIRDLADEVPPEGLLRSIEAVLACREALDLNVKPRFAIAAMVAG
                     LIAARSA"
     gene            complement(445407..446366)
                     /locus_tag="NONO_c03960"
     CDS             complement(445407..446366)
                     /locus_tag="NONO_c03960"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="AHH15210.1"
                     /translation="MFRKAMAPISWTHHVSANHGNLGYEFADSRDFEGLTRVQRLTSY
                     ELGDPQLIEFTSGQIRYRRTSRDARRDNDGSARLVISRGGRIGVVQDGKSALLAPGQM
                     ALIDWRRPMELAHGDGISARIVTVPGDVVPRDFRNRPSLSSDPESDPLLGSARDIVDQ
                     MVRHRDSLSAWQFAHLNSALADVLRSALDERGAPDRTTLIRIADAARLFVSTHYRDPD
                     LTVTSIANHLGCSRRTLEAALRKAGTTPANLLRDTRLERARQLLSNPFETRSLSDIAF
                     ACGFGSHSTFKRAFLERFGANPGQWRAEQRSNRRNHRTPVDAG"
     gene            complement(446995..447900)
                     /locus_tag="NONO_c03970"
     CDS             complement(446995..447900)
                     /locus_tag="NONO_c03970"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase family protein"
                     /protein_id="AHH15211.1"
                     /translation="MTTITGRTKVRFWSNGEECAAWHYPGKNGACIVMAGGLGVTKEP
                     ATDRFAPRFQEAGFSVLAFDFRYLGESGGKPRQFVSIDKQLADWRAAIDFASTLPEVD
                     PAKTAIWGFSLSGGYVLRLSARDHRIAAAVAVAPLVDGPASGRIAMRRGDTNLSEIRG
                     LTWRAFKDAGGALFGRDPQLVALNGEPGSASALTSPDARNGNAALNPDNRYPEWRQEV
                     SARSALTTVLFRPASKVTGIRCPLLVVAFDDDGVAYAEPAVRAAHRAPRGELVRLPGG
                     HYAAVLDQYEPAVEAQVKFLRQHLV"
     gene            448136..448711
                     /locus_tag="NONO_c03980"
     CDS             448136..448711
                     /locus_tag="NONO_c03980"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH15212.1"
                     /translation="MTRDALVAAARPLFARTGFSEVSVEAIVRAASVSRGALYHHFTD
                     KNELFAAVLEEIESEVADRIRAAAADGADADPIDVMRSGAAAFLDACAEPEIHRIMLV
                     DAPAVLGWVRWTEISAQNNMGLIQDLLAQSIETGRIPVQPVDPLAHTLLGALREAALY
                     LARSEDTARARREVGDVIDRLIRNLAADPSQ"
     gene            448987..449062
                     /gene="trnT1"
                     /locus_tag="NONO_c03990"
                     /note="tRNA-Thr-CGT"
     tRNA            448987..449062
                     /gene="trnT1"
                     /locus_tag="NONO_c03990"
                     /product="tRNA-Thr"
     gene            complement(449142..450212)
                     /locus_tag="NONO_c04000"
     CDS             complement(449142..450212)
                     /locus_tag="NONO_c04000"
                     /codon_start=1
                     /transl_table=11
                     /product="Htaa domain-containing protein"
                     /protein_id="AHH15213.1"
                     /translation="MNALMMRGLAVACTALAGAGIVQAAPAAADTTPSIEVFAADGTT
                     PLGAAVLHPGDRIVVRGHGFDPASNTSGLPVPVPPGVPHGTFVTFGAFAPHWKPSEGA
                     PAATRAADRSAVAWALSDSALRRVPQAPLDLQRTVRKQWVPLDDDGNFTATLTVKQPT
                     TVPADAAFGVYTYAAADAVNAAQELSVPVHYDPTPGPDTPRPPAADLRWAVSNNFAPT
                     VTGPLQGTLSGSGGAGVDNGTLTFELDRADLDPTSGLGTIRYRGTAVAATRFHLGEIA
                     LADPWIEFTPTGTWLSAETSTSDTIGADSLQRVRLARLDTEPTAGQQDWTDIPTHIEN
                     STQPASLRLLALGPTAPITFHR"
     gene            complement(450289..451002)
                     /locus_tag="NONO_c04010"
     CDS             complement(450289..451002)
                     /locus_tag="NONO_c04010"
                     /codon_start=1
                     /transl_table=11
                     /product="putative esterase, alpha/beta hydrolase family"
                     /protein_id="AHH15214.1"
                     /translation="MSTYLLIHGAWHSGQCWARVIPPLASAGHRVSTPTLTGYGDRRH
                     LLGPEVGLDTHVDDIVDLIVAEDLTEVILVGHSYAGLVISAVANRIPDRIAHLVYLDA
                     MVPQHGETAVDVLPVCQDLIDLARQSGTDWRIPPMAELPAPAGLFGVTDPTDLAWLRT
                     MLSDQPVRCLQQSVSLDNPGTDAIPRTHIHCTAGEPARRPIPATQPNGAPARVWELPT
                     GHDCMITMPRELTELLLQV"
     gene            451138..451728
                     /locus_tag="NONO_c04020"
     CDS             451138..451728
                     /locus_tag="NONO_c04020"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH15215.1"
                     /translation="MAEGDAGTGRVVRPRRADARRNQEALLDAAAAVFVASGVEAPIR
                     DIAVRAGVGTATIYRHFPTRADLIVAVYRHQVESLAETGPELLENAASPYVALGRWIE
                     LFTDFVVTKQGLAAVLQSDDPCYDPLHSYFLDRLVPVCTRLLCAAAESDEIAPGQDAY
                     ELMRGVGGLCAGAGGNLDYNARHLVGLLVAGLRQSR"
     gene            451855..452199
                     /locus_tag="NONO_c04030"
     CDS             451855..452199
                     /locus_tag="NONO_c04030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15216.1"
                     /translation="MGESDLGVRHGAGRSGGVGGVGVEGGRCHRDQGRVGDRRALDRG
                     GVLGFVRRPKATFDIPLLATATKTVVFASAAAALWNIGYGTTAVVFVLVLVANLMLIR
                     IGHLAAPVGALQ"
     gene            complement(452214..453590)
                     /locus_tag="NONO_c04040"
     CDS             complement(452214..453590)
                     /locus_tag="NONO_c04040"
                     /codon_start=1
                     /transl_table=11
                     /product="putative polyketide synthase"
                     /protein_id="AHH15217.1"
                     /translation="MPDGRTPVVVSAETPQLLTEEAAAVRSYLTAHPDAGIGRIADTL
                     LRTRTVRPYRAVITASGPEDLLAALDALVSNEPDPNLIRADGPATARRFGFVFPGQGS
                     QHPGMGTLFYEHSAAYRNKVDECAATLSDELSSPEPRRYLLGDETRADDIGVLQPALF
                     MHTVGLAAMWLAAGVRPSVAVGHSQGELAAAAICGYATLRDAVVATKVRADFIAEHAP
                     LGYTMAVLGIDTAECESLIAHDIGWLKLSVINSPHIVAVSGIRSDVLRLIETVRGTGR
                     FATEIRVPYPAHTDVVAPYRQPLAATVRDVLYERTFAESDIPLFAATIGDRIPQGLPQ
                     AEFWFLNLRNRVRFDRATVAAAGEADFFIELADNPMLSLAVQENLSVAQSSAALVATS
                     RREATDLSAFTRNLLTVAVHDLGFRWETLSVTTGRTESAVLRDFPKRGPVTTESTEDI
                     PTWVVPAT"
     gene            complement(453744..454259)
                     /locus_tag="NONO_c04050"
     CDS             complement(453744..454259)
                     /locus_tag="NONO_c04050"
                     /codon_start=1
                     /transl_table=11
                     /product="L,D-transpeptidase catalytic domain-containing
                     protein"
                     /protein_id="AHH15218.1"
                     /translation="MSCTSITRWTVRAAAATAIAAAGFAVTAPAGADPVWPGGPDIPG
                     IPQLVPAPPGLATAPCSAAARACLRLSTNEGWLMDNGRVVYGPTPISHGRPGYETPPG
                     TFHVAFKEPYHWSTMHNAEMRWAVFFNGDIATHIGPIEEKSHGCIRMTPEGAKAFYDY
                     VNPGDVFEVVP"
     gene            complement(454432..455220)
                     /locus_tag="NONO_c04060"
     CDS             complement(454432..455220)
                     /locus_tag="NONO_c04060"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, SDR family"
                     /protein_id="AHH15219.1"
                     /translation="MILDKFRLDGRVAVVTGAGRGIGAATALALAEAGADVALAARTQ
                     SQLDAVAEQIRATGRRALPVACDLSDLSAVTALADTTAAELGRIDIVVNNVGGTMPNT
                     FLTTSPEFLEEAFRFNVSTAHALTRAAVPHMLEKDGGAVVNISSMMGRAPGRGFLAYG
                     TAKAALAHWTRLAAADLSPRIRVNAIAVGSVLTSALEVVAQNPEVKARMEADTPLHRL
                     GDPTDIAAGIVYLCSSAGSYLTGKILEIDGGIAAPNLELGLPDL"
     gene            455350..455931
                     /locus_tag="NONO_c04070"
     CDS             455350..455931
                     /locus_tag="NONO_c04070"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH15220.1"
                     /translation="MAAGERLIAERGYLVPLRDIAAAAGQRNNSAIPYHFGSRDGLVE
                     AVVAQRLATLEVRRLELLARRPAPDDVHALLDALVVPMFELGAIDETSCYARFLEQIR
                     THPAVSDAANLASDERTSVRMIVGGLDAALAELPPRLRHRRLRSLTTVLFSLLADHER
                     AVEAGKVAADDRTAWVEIIDMLAGTLTAPVTHR"
     gene            455950..456327
                     /locus_tag="NONO_c04080"
     CDS             455950..456327
                     /locus_tag="NONO_c04080"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase-like domain-containing protein"
                     /protein_id="AHH15221.1"
                     /translation="MSSDEIGFAAPIPVLRIYDVDKAYEFYRDFLGFEIEWEHRFGPD
                     FPLYVQISRSHARLHLSAHHGDGTPGSVVWTAVDGIDGWQAELAARDYPFAKPGTPED
                     GPGGRGFQVIDPFGNVLRFAQPD"
     gene            456420..456806
                     /locus_tag="NONO_c04090"
     CDS             456420..456806
                     /locus_tag="NONO_c04090"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH15222.1"
                     /translation="MPLLVAGAAAGAAIVLHFRDPHTHGAYGLCPFYALTGWWCPGCG
                     GLRAMHNLTEGRVLDAVHSNVFLLPLLLTVMFWWGRWAVGRWRGRPDTSFPFRIGGRG
                     QWVLIGALVVFTVLRNTPFGTWLAPA"
     gene            456824..457027
                     /locus_tag="NONO_c04100"
     CDS             456824..457027
                     /locus_tag="NONO_c04100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15223.1"
                     /translation="MTEVETTGSLKARVRAKMLRQLNEDGAPDPEQDDPRQIAIENDL
                     EALDSVTDGDPLVEELAARYLVP"
     gene            complement(457012..458490)
                     /locus_tag="NONO_c04110"
     CDS             complement(457012..458490)
                     /locus_tag="NONO_c04110"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cysteine desulfurase"
                     /protein_id="AHH15224.1"
                     /translation="MSTVVSKTVVATAEIAVAEQICDESTCTSPTCTCTSCSASACDS
                     NATRACRTGEPIARVSGCDLRVPLVQGGFRTYANFDYAASAPALAQVTDRVNELLPFY
                     ASVHRGAGYASRVSTDCYEAARNSVARAVNAADDQVVVFTRNTTDSLNLLACCVPGDT
                     VVLDIEHHANFLPWTRGGRRVVRAASTIAETLRRIEAELCAEPAALLAVTGASNVTGE
                     VLPLAELTAIAHRRGARILVDAAQLAPHRRIDLQGCAVESGGIDYLAFSGHKLYAPFG
                     AGVLVGRRDWLDAAPPYLAGGGAVTAVTTEDARWACAPQRHEAGSPNVLGAAAVAAAC
                     EALAELDAHAVVDHEHHLIERLRDGLESIAGLHSLRIFDDSADSVGIVAFTIDGFEPG
                     RVAAYLSAEYGIGVRDGKFCAHPLLRRLNVDGAVRASVGLGTSVADVDRLIDALRRLV
                     RDGARWNYTRADGQWSPLPETRPGLTESSSGAAPCATPQGTR"
     gene            complement(458749..459300)
                     /locus_tag="NONO_c04120"
     CDS             complement(458749..459300)
                     /locus_tag="NONO_c04120"
                     /codon_start=1
                     /transl_table=11
                     /product="putative flavin-dependent oxidoreductase"
                     /protein_id="AHH15225.1"
                     /translation="MSSSQRPDAEVADLGPGHDGITAAQYRSAMRHYPAGVTIVTLSR
                     PDRPVGFTATSFASLSLDPPLISFNIAHTSSSIDAMSEAESVVVHFLGEHQQHLAQRF
                     SRAAEHRFTDPEQWSTLDTGEPVLHGTPIWVRATVDRLIPIGDHTLVVGLVTRVHDDT
                     SDEPMRNPLLYYNGTYHRPAGLD"
     gene            459384..460205
                     /locus_tag="NONO_c04130"
     CDS             459384..460205
                     /locus_tag="NONO_c04130"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase/isomerase family protein"
                     /protein_id="AHH15226.1"
                     /translation="MTDWKAFDVERTGAVARVTLTGPGKGNAMGPDFWSELPRIFAEL
                     DADAEIRAIVLTGSGKHFSYGLDLPAMSPTFGPLLGEKALAAPRTDFLYEIRRMQDSV
                     TAVADCRKPVIAAVSGWCVGGGLDLIAAADIRLASAEASFSLREAKVAIVADIGSLHR
                     LPGIIGEGHLRELAYTGKDIDAARAEKIGLINDVYPDQEAVLAAAHALAEEIAANPPL
                     VVQGIKDVLDQPKAGKIADGLRYVSAWNAAFLPSEDLTEAIQAVFEKRSPVFRGK"
     gene            complement(460260..460751)
                     /gene="ppa"
                     /locus_tag="NONO_c04140"
     CDS             complement(460260..460751)
                     /gene="ppa"
                     /locus_tag="NONO_c04140"
                     /EC_number="3.6.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic pyrophosphatase"
                     /protein_id="AHH15227.1"
                     /translation="MEFDVTIEIPKGQRNKYEVDHETGRVRLDRYLYTPMVYPADYGY
                     IENTLGSDGDPLDCLVLLPESVFPGVIVEARPVGVLLMSDEAGGDEKLVAVPAGDKRW
                     DHIQDVNDIPEFERKAIEHFFEHYKDLEPGKWVKVDGWDGRAKAETLADEAYKRLQEQ
                     GGH"
     gene            460899..462383
                     /locus_tag="NONO_c04150"
     CDS             460899..462383
                     /locus_tag="NONO_c04150"
                     /codon_start=1
                     /transl_table=11
                     /product="putative D-alanyl-D-alanine carboxypeptidase"
                     /protein_id="AHH15228.1"
                     /translation="MVGRGKQNIGGLASRRRRNMWIAVLVATVVAVVVVAAVLVTVRP
                     WTEEFRHGGLTVAAPPAPVKPFPQLTPAAPDAPEASPQGLAKALAQVATSPDLGSFAG
                     SVSDPDTRTTLWSADPDKPMIPASTLKVMTTAAALLVLPADHRLTTRVVAGSAPGEVV
                     LVGAGDPTLTAQADGKGYYPDGPKLSDLVSQIRASGHPVDSVVVDTSLYSGPAWPSGW
                     DPVDIAGGSWAPIEPVMIDGGRLDPLVEYSPRSATPALDAGRRLALELGADPAKVRLG
                     KAPAGAAELAHVDSAKLRDRLRDMMIHSDDVLAEAIGREIAGVTGGEQSFAGAAAATL
                     TALRAAGFDTTGVTQIDNSGLSTDDRVPARLLDRILAEAAASDAAPDTKTSGTTGAPV
                     VETGDSSAAPSPLAPLLDYLPVAGGSGSLAERFTDGGPQRAGAGWVRAKTGTLSVSSA
                     LAGYVLDRDGRVVTFALMSNDRPPEASRPALDAVATALRNCGCS"
     gene            462397..463485
                     /locus_tag="NONO_c04160"
     CDS             462397..463485
                     /locus_tag="NONO_c04160"
                     /codon_start=1
                     /transl_table=11
                     /product="putative hydrolase"
                     /protein_id="AHH15229.1"
                     /translation="MTGIDDTSAATEDTPAKRSILAGSVDWALAARTGSAVVPSGPRT
                     TRYSAEQVVRELAEASIRAEGPVREVSLLADDRPVPAATIVDRPGWIRAAAASMSELT
                     GVTDAERGRFTGKPAGVQAGAMLAFLSTAILGQYDPFTGPDGTLLLVAPNIMAVERAL
                     GVSPSDFRLWVCLHEVTHRVQFSSAPWLADYMKSNVDTLGAVGDEPFNEVLTRLLEEV
                     RRRRDNAGSDDPADRGVLGLLRATQPPPQREALDRLLMLGTLLEGHADHVMDAVGPAV
                     IPTVSQIREAFDQRRRRPANPIQRLLRALLGVDAKVAQYVRGKAFVDEVVGKVGMARF
                     NTVWTDAETLPRTDEISTPQRWIDRVLE"
     gene            463482..464495
                     /gene="tilS"
                     /locus_tag="NONO_c04170"
     CDS             463482..464495
                     /gene="tilS"
                     /locus_tag="NONO_c04170"
                     /EC_number="6.3.4.19"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(Ile)-lysidine synthase"
                     /protein_id="AHH15230.1"
                     /translation="MNPPGDARARPSDPGAVRLPETAAVLAVRHAVRDWLARHRPSEP
                     VAVALSGGADSLALTAATVVEAPAVDALIIDHGLQPDSAEVAAEASAAALRLGCRSAR
                     VRRVTVTGPGGPEAAARQARYRALDELRDGLPVLIAHTLDDQAETVLLGLARGSGQRS
                     LQGMAAFDDPWGRPLLGIRRETTRQLCRDLGLRAHEDPHNSAPEFTRVRLRTEVLPLL
                     EDVLGGGVASALARTAAQLRADGEVLDSIADELLSRARDGSAVSVEILATAPGAIRRR
                     ALRSWLLEGGAKALTDKHLRAVETLITDWRGQGGVAVGGGMPGTRLVARREHGRLTLA
                     FAR"
     gene            464520..465074
                     /gene="hpt"
                     /locus_tag="NONO_c04180"
     CDS             464520..465074
                     /gene="hpt"
                     /locus_tag="NONO_c04180"
                     /EC_number="2.4.2.8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine-guanine phosphoribosyltransferase"
                     /protein_id="AHH15231.1"
                     /translation="MYGDDIASVLITEEQIQAKVDELAELIAKRYPPDAPEGDLLLVG
                     VLKGAIFFMTDLARALPIPTQMEFMAVSSYGSSTSSSGVVRILKDLDKDIAGRNVLIV
                     EDIIDSGLTLSWLMRNLSSRNPASLEVVTLLRKPDALRTQLEVANVGFDIPNEFVVGY
                     GLDYAERYRDLPYIGTLNPRVYSA"
     gene            465452..466348
                     /locus_tag="NONO_c04190"
     CDS             465452..466348
                     /locus_tag="NONO_c04190"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, LysR family"
                     /protein_id="AHH15232.1"
                     /translation="MDPHLRDLRYFVAVAEELHFTNAAQRLHIAQPTLSRQIRQLERQ
                     LDVVLFDRNQRSVALTVAGKELLEGARRILELWEVTNVALQEAGEVLRIGIPSSIGRG
                     LIAELESASGHRLALHSASWTDPSSGLAGRQADLALMWLPVPDSGRYRWQVLRTEPRW
                     ILLPENHRLADQDSIEFADLIDEPFIAMPSEAGAARDFWLGGDARNGRQAKIGGEAAT
                     AEERLEAVSLGLGVCLLAENNVPMYRWPGLTARPVSGLAPCELAMVWRADDDRPTILD
                     FANRVVAGGFSVLEDDRQPTGS"
     gene            complement(466352..467962)
                     /locus_tag="NONO_c04200"
     CDS             complement(466352..467962)
                     /locus_tag="NONO_c04200"
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="AHH15233.1"
                     /translation="MQNEGTALADATSNAVTRATQEVPVDAAETNRSRSAETSGPDTA
                     ADAAQHDSSGKPGHPEPAGDSTPPATPPTSSDTTPPNSSGPDTTATDPFALTTAVAIA
                     AAVRDGAVTAGQIVDAALERIDDGDARVGAFTTIRTEQARAESRALADRADLDILPLA
                     GVPVAVKNNIDVAGEITAAGSVAGLATPARSDHPVVRRLRDAGAIVVGLTEMPEGGLW
                     GVSDTPDRISRSPWNVRHSAGGSSGGSGAAVGAGLTPVAHGNDGLGSVRIPAACCGVV
                     GIKPGRGVVPAQVGVDSWGGMTENGALATTVADAALVLSVLADRPALADLEPPTPLRI
                     ALAAGSPSPLIRVDRHWTAAAQAAARLAGEAGHTVVPAALPYQGATTALALRWLANAA
                     REAGAVANPELLQRRTRVHVGLGRAVLRAGLIRPGQVDRIEARLQDFFDRHDVVITPT
                     LAAPAPAARSWHARGWLANVVASVRYSPFTPLWNLVGWPAMSVPMGLHPRTGTPVAAQ
                     LAGPPGSESTLLCLAAQLEAAQPWQRTA"
     gene            complement(468086..468937)
                     /locus_tag="NONO_c04210"
     CDS             complement(468086..468937)
                     /locus_tag="NONO_c04210"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase, SDR family"
                     /protein_id="AHH15234.1"
                     /translation="MSDFGTIRGKVVVITGGARGIGLATATRLQALGAKIAIGDVDET
                     AVKQSGTDHDFDHYGRVDVTDQQSFGTFLDDVERELGPIDVLINNAGIMPTGRVVDEP
                     DALTRRIIDINVYGVILGSKLALARMLPRRSGHVVNIASLAGESHIPGLATYNATKHA
                     VLGFTDTLREEYRGTGVSFSSVLPTLTNTELGSGVSVPKVMAPAEPEDIAEAIAGLLV
                     KPKAKVRVTRMAGIMAQVVGLLPQSLGDAIGRSLGSQDAFLGDVDSAARRAYEERVRR
                     GTDSAAG"
     gene            complement(468934..470565)
                     /locus_tag="NONO_c04220"
     CDS             complement(468934..470565)
                     /locus_tag="NONO_c04220"
                     /codon_start=1
                     /transl_table=11
                     /product="putative succinate-semialdehyde dehydrogenase
                     [NADP+]"
                     /protein_id="AHH15235.1"
                     /translation="MTNTESVPGESASGGTAARKSARKAAARTAKPAATEIEVRNPAT
                     GELSGTVPAESAEAVAAKVRELRLYQPEWEAIGAEGRKEWLLRLQDWIIDHSDHLADV
                     LQSETGKARIDALIDPNFSVDLIGYYARRAEKFLADDHPAPHSPLARVKKLITAYRPY
                     PVVGVITPWNFPLAMPVIDVIPALAAGAAVVLKPSEVTPLSALELARGWSEIGAPPVF
                     AVVTGAGATGAAVVDNVDYVQFTGSTKTGKRIAAACVERLIPYSLELGGKDPAIVLAD
                     ADIDRAAYGVAFGGLFNAGQVCISVERVYVEAPVYDTFVRKLADHVRELRQGADGRQP
                     KYDVGALANDAQKAIVSGHVDDAVAKGARALTGGKATGVGTFYEPTVLADVDHSMTCM
                     TEETFGPTIPVMKVADEAEAIRLANDSIYGLSASVWTGDKARGERVARQLNAGAVNIN
                     DVFANLFNFALPMGGQQQSGVGARWGGADGVRKYCRKQAITVPILPTQEKELMWFPYN
                     TAKIGFALAAMRAAGARGIRRLGIKDVLDTVGGKK"
     gene            470709..471992
                     /locus_tag="NONO_c04230"
     CDS             470709..471992
                     /locus_tag="NONO_c04230"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="AHH15236.1"
                     /translation="MATAPSSVEVRQWMADFVAETLRGDTLEQLVARLDAQVVERVPE
                     LTDRDLRRDLEASTRAHAFAVLGGLTQDTMDYAVPQQAHAFARTLARRGYDLRVLLRV
                     YHVGQEAALDYMTDVIEERRLPDRFERTALLRMFERSTRWVNTSVEVLTDTYTRERER
                     GLRAALNQRTEIVRALLSGEDPDADHASARLGFRLAQRQIAAVLWTDTESRAAGELAG
                     TCPAPDADGGNDELGLLERMAVRVATAVGGGGILTVPAGSSALWAWLPVDSDYPDSVV
                     AAAKTVVAAPVRIALGVPATGTAGFRQSHHEAIAARQVAERAAADLGRAVSYAQVETA
                     YLAGADVPAMRSLIRRELGQLAGSGPNSARLRETLLAYLRCHRSPEGAAAVLGVHKNT
                     VRYRIQRIEELLGRRIDECGLRLELALECAAIYGV"
     gene            complement(472001..472252)
                     /locus_tag="NONO_c04240"
     CDS             complement(472001..472252)
                     /locus_tag="NONO_c04240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15237.1"
                     /translation="MGSNITLLRGLEPRATDQEIFAAAQEYVRKVGGLTGLSYVTKPA
                     FDKAVAAVAEATTTLLAELPDHPIAATAEPPLRRSGDLV"
     gene            472410..473258
                     /locus_tag="NONO_c04250"
     CDS             472410..473258
                     /locus_tag="NONO_c04250"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15238.1"
                     /translation="MADATQSTTMAARDMPTLTTFPYPELDEREDDHWSGAQVSEDEL
                     RALSLGAFYSARWDAFHDALLLGPERDHPLGDRRELAIDTLTGAWGITDGTEAMASME
                     QLLEGMHGPLYALVHPLVTHALNSPERDRFGERADRHRAFLRQVGSFRGMDNPEALVR
                     DYDIWTQAIKLDLTGHLVQPLPADIQAWDLARVVAVARMAFTAGYLEADAAWDYVMRA
                     LPPAQRRYRNWRQFGDAYLTGWTYWQACEDMAVLKSGGVDRRLELVRLWMRPTSPWRR
                     IALQGE"
     gene            complement(473262..474185)
                     /locus_tag="NONO_c04260"
     CDS             complement(473262..474185)
                     /locus_tag="NONO_c04260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15239.1"
                     /translation="MDIVELRTPTAILRHGGGRVQVLRPGTDGERVLDVPVSDLLKVR
                     LNRRADDAVVIEIYLRYPSPVLTGVPADRTPLPVLIAEHDVPAATVIVQRINSQIVGT
                     QRIDMSAPDLVPPAPVWGRTGPTRADVDRAVRRMAPRRETRAATGVLHGMVTPAEFML
                     ETAAVTAVPPAGRGRGLLAVTTGRVLFLSIGSTPRYAHEMPVAALISAEVGKGTGDEP
                     GGEYGIDLTDGNTTWRFVGTDRADTDRIVGAVNFAIQRESADGAVAPPDPGVSQLYSE
                     WELLVERHSLAMVDDAQFQRYGRGILRSLPD"
     gene            474497..476872
                     /gene="ftsH"
                     /locus_tag="NONO_c04270"
     CDS             474497..476872
                     /gene="ftsH"
                     /locus_tag="NONO_c04270"
                     /EC_number="3.4.24.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent zinc metalloprotease FtsH"
                     /protein_id="AHH15240.1"
                     /translation="MNRKTVFRNLTIVAGILLVIYLVSYFSNDTRGWKNVDTSVALSQ
                     LADKPNVKQVQIDDKEQQLRITLKQGNEATGNQTQIMAKYPGGSEVSAQILRDVQDSG
                     APFNTAVKQDSWFTQILLFVLPMVLLLGIFVFVMARMQGGGRGGMMGFGKSKAKQLSK
                     DMPKTTFSDVAGADEAVEELYEIKDFLQNPARYQALGAKIPKGVLLYGPPGTGKTLLA
                     RAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFDQAKQNSPCIIFVDEIDAVGRQR
                     GAGLGGGHDEREQTLNQLLVEMDGFGDRTGVIIIAATNRPDILDPALLRPGRFDRQIP
                     VGNPDLAGRRAILRVHSQGKPIAPDADLDGLAKRTVGMSGADLANVINEAALLTAREH
                     GNVITGPALEESVDRVIGGPRRKSRIISEHEKKITAYHEGGHTLAAWAMPDIEPVYKV
                     TILARGRTGGHAMTVPEDDKGLMTRSEMIARLVMAMGGRAAEELVFHEPTTGASSDID
                     QATKIARAMVTEYGMSARLGAVRYGQEQGDPFLGRSMGTNSDYSHEVAREIDEEVRNL
                     IEAAHTEAWAILNDYRDELDALATALLERETLHRKDLEQVLSTVDKRPRITAFNDFGE
                     RVPSDRPPVKTPRELAAERGEPWPEEDETPQVDQPAPAPQPVPANGYPQQGYRNPTPA
                     YGYPAQPQPGGHPRPAGGPGYPPRQPTHGSRPDYGAPAGWSAPGWPPQDEGGQGPQTG
                     QQPEYGGGAPGYPDPQRYGGSHRRPDWSGDQEPTQNGAQDHGDWDGPNGRR"
     gene            476957..477619
                     /gene="folE1"
                     /locus_tag="NONO_c04280"
     CDS             476957..477619
                     /gene="folE1"
                     /locus_tag="NONO_c04280"
                     /EC_number="3.5.4.16"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase 1"
                     /protein_id="AHH15241.1"
                     /translation="MSANNGASAGSDTASLDAAVVEAPPIALSTGRPFDQERAEAAVR
                     ELLIAVGEDPDRPGLLDTPARVARAYRETFAGLYTEPDSVLNTTFDEGHQELVLVRDI
                     PMYSTCEHHLVSFHGVAHVGYIPGPQGRVTGLSKLARLVDLYAKRPQVQERLTSQIAD
                     AVMRKLDPRGAIVVIEAEHLCMAMRGIRKPGASTTTSAVRGLLQTNASSRAEALDLIL
                     RK"
     gene            477630..478565
                     /gene="folP1"
                     /locus_tag="NONO_c04290"
     CDS             477630..478565
                     /gene="folP1"
                     /locus_tag="NONO_c04290"
                     /EC_number="2.5.1.15"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="AHH15242.1"
                     /translation="MSELITPRDGRSCVVMGVVNVTSDSFSDGGRYLDPALAIAHGVR
                     LYEDGADIIDVGGESTRPGAVRVDPETEAARVVPVIRGLVEAGVPTSVDTMRAAVAAA
                     AISAGASVVNDVSGGRADAEMVKVVAAAEIPWILMHWRANAEHRHTGPAEHYDDVVGE
                     VLAELSAQVDLAMAAGVHPSRLVLDPGLGFAKNAEHNWALLGALPELTAQGLPMLIGA
                     SRKRFLGSLLADESGPRPPDGREVATATISALSAAHGAWGVRVHDVRSSVDAIVVAEA
                     WRRAADQVERRASDQVERRAADRTGQAVDQSQGRE"
     gene            478562..478936
                     /gene="folB"
                     /locus_tag="NONO_c04300"
     CDS             478562..478936
                     /gene="folB"
                     /locus_tag="NONO_c04300"
                     /EC_number="4.1.2.25"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin aldolase"
                     /protein_id="AHH15243.1"
                     /translation="MSSDRIELRGLRAYGYHGCFDFERRDGQEFVVDLTLWTDFARAA
                     ATDDLSATVDYGELAQRAVAIITGPPRNLIETVAAEIADEIIRDDRVSAAEVVVHKPS
                     APIPHTFADVRVVATRRREVSG"
     gene            478933..479469
                     /gene="folK"
                     /locus_tag="NONO_c04310"
     CDS             478933..479469
                     /gene="folK"
                     /locus_tag="NONO_c04310"
                     /EC_number="2.7.6.3"
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="AHH15244.1"
                     /translation="MSRAVLSIGSNLGDRFGYLRSVVDALAPRLIAVSSVYSTPPWGG
                     VPQENYLNAVVVVEDPAYGPRDWLSSGQELEQRAERVREVRWGARTLDVDVVWCAELR
                     RDGAHPVVSADPTLTLPHPQAHNRAFVLVPWSEIEPDAVLEVEGRSRPIRELLAELDP
                     GEVEGVRMTELSLRAADR"
     gene            479483..479962
                     /locus_tag="NONO_c04320"
     CDS             479483..479962
                     /locus_tag="NONO_c04320"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH15245.1"
                     /translation="MNVMRPTKVLDLLANVAIAAAVAWVATRWAYSSFPPITALAAAS
                     LYPVAAVEAVLAFMIRSRVGDHRIGDGPKQLHPITAARAVALAKASAQVGSLAAGVWL
                     GFLIWVFPQRGTIRAAASDTPGAIVGLVAGLVLVAAALWLEYCCRAPHEPPDEPATS"
     gene            480033..481097
                     /locus_tag="NONO_c04330"
     CDS             480033..481097
                     /locus_tag="NONO_c04330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15246.1"
                     /translation="MVSPSRSSTSSRQRDNAGKIVVGVLILLGLIASVFLIFSNNVQL
                     VRVGLVAALWAAAVAALAATRYRRDAAVDQAKTRDLQKVYELQLEREITARREYELGV
                     ESRVRREVGADAAELAALRGELTVLRESLQRLFDGDLLVDRPALRAEAVRVQELTRAT
                     VANGSSQETDTWDAWSSPSAPLHVVSPVFDPDHPEPPMFASPYDDPVTAETAVVTAEP
                     SEAEDDSDAAESARDSSEEKSAEKSKEKEAASAAVDPKSADAEKVDAEKDSADTDRAR
                     PSAESGEKSAESEVVAEPAAAVPASSVPRLAPVQPAATMGTAGSRRRRHADADANQPG
                     RKLTVAEIMANLQSEQNGAK"
     gene            481173..482153
                     /locus_tag="NONO_c04340"
     CDS             481173..482153
                     /locus_tag="NONO_c04340"
                     /codon_start=1
                     /transl_table=11
                     /product="P-aminobenzoate N-oxygenase AurF-like protein"
                     /protein_id="AHH15247.1"
                     /translation="MLSTAADKTPVDSEYHEILRGLSEGSVTKNFDPYLDIDWDSPDF
                     AIDPTDTRWVMPEEDPLGRHPWYKAQPLERQIAMGMWRQAGIAKVGLDFEQLLIRGLM
                     QYLVSVPNGDPEFRYVTHEAAEECNHTMMFQEMINRIGEDVVGMGTIDRKLTMIIWPA
                     VKYFPELFFTMILGGEEPIDHLQKSLLRAGTDLHPMVQRVMQIHVAEEARHISFAHEY
                     LRRNVPGMNPALKFALSLLFPTAMRIMLDMIMTPPREFVEKFDIPAEVMREAYWSSPK
                     SRATARGVFGDVRALATTSGLMNPVAKVAWRLLGIDGPATRYRSEPVRSA"
     gene            482274..483278
                     /locus_tag="NONO_c04350"
     CDS             482274..483278
                     /locus_tag="NONO_c04350"
                     /codon_start=1
                     /transl_table=11
                     /product="Rossmann-like domain-containing protein"
                     /protein_id="AHH15248.1"
                     /translation="MVTSEFSRPDEAGSSRPAGANARAGHPSDGSGITDGDPAPARLT
                     VGIVSAGRVGSALGVALERAGHVVFGVAAISDASRHRAQTRLPESRILPVEEIAARSE
                     LLILAVPDSELPGLVAGLATAGVVRPGTIVAHTSGANGVAVLAPLRGVRPLAIHPAMT
                     FTGHDEDTARLANACFGITAADEIGYAIAQSLVIEMGGEPVRVAEEQRTLYHAALAHG
                     SNHLVTLIVDAVAALRAALDGPGLLGQPTVDDQPGGLAERMLAPLASAALDNALRRGL
                     PALTGPVARGDTAAVAAHLTALEAADPDLADGYRAMSLRTAQLTGADQELIDVLEVRR
                     "
     gene            483275..484210
                     /gene="panC"
                     /locus_tag="NONO_c04360"
     CDS             483275..484210
                     /gene="panC"
                     /locus_tag="NONO_c04360"
                     /EC_number="6.3.2.1"
                     /codon_start=1
                     /transl_table=11
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="AHH15249.1"
                     /translation="MKKLTPEQLRQLYRPGELTVVHEPAAVSAVTSALRAVGRTVALV
                     PTMGALHQGHLELVRRAKRTNQVVVVSIFVNPLQFGENEDFDTYPRTLDADVALLRDE
                     GVAMVFAPSVAQMYPEGPRTSVHPGPLGAELEGASRPTHFAGMLTVVAKLLQIVQPHE
                     AFFGEKDYQQLTLIRQMVRDLNFDSEIIPVATVRETDGLALSSRNRYLDDAQRELAIT
                     LSAALVAGRHAGGLGPEAVLAAARSVFDSAPDVDVDYLELRGADLGPIPGSGNARLLV
                     AARIGKTRLIDNMAVTVAAADGTSALPAQPAQADA"
     gene            484225..484644
                     /gene="panD"
                     /locus_tag="NONO_c04370"
     CDS             484225..484644
                     /gene="panD"
                     /locus_tag="NONO_c04370"
                     /EC_number="4.1.1.11"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate 1-decarboxylase"
                     /protein_id="AHH15250.1"
                     /translation="MLRTMMKSKIHRATVTHADLHYVGSVTVDPDLMDAADLLEGEQV
                     CIVDIDNGARLETYVIAGERGSGVIGINGAAAHLVNPGDLVILIAYAMMDEAELREYQ
                     PRVVFVDDRNRPVELGADPAHAPEGSGLTSPRSLTFA"
     gene            484662..485456
                     /gene="coaX"
                     /locus_tag="NONO_c04380"
     CDS             484662..485456
                     /gene="coaX"
                     /locus_tag="NONO_c04380"
                     /EC_number="2.7.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="type III pantothenate kinase"
                     /protein_id="AHH15251.1"
                     /translation="MLLTIDVRNTSIEIGLFSGNGSHAELAHTWRVHTNPLLTADEFA
                     MQVRGLVGDRLDQVIGVSALSTVPPVLRELRAMLERYWSHVPHVLVEPGVRTGIPLLV
                     DNPKEVGADRIVNCLAAYHRFDSPAIVVDFGTAICVDLVSAKGEFLGGTIAPGVEIST
                     EALVARSALRRAELTRPRSVVGKNSMECMQSGAVFGFAGLVDGLIDRIRDELDAFAGD
                     DVSVVATGPTAPLIVPESETIDHHEPHLTLDGLRLVYERNQQRRRP"
     gene            485633..486286
                     /locus_tag="NONO_c04390"
     CDS             485633..486286
                     /locus_tag="NONO_c04390"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cysteine dioxygenase type I"
                     /protein_id="AHH15252.1"
                     /translation="MRSSVINAAATSTGESARHRSGQLPPVRTGSALAAELAERSVSP
                     ALPTRLRPADLLRLTDEGAEDVLAGRFDHLLPSSGVWPTENRWAVRLLADDEVDVWLI
                     SWVPDKYTELHDHAGSLGALTVLSGALSEFRWNGKELRQRTLSAGDQASFPLGWVHDV
                     VRAPDQFAGVPEPSNPTLSVHAYSPPLSAMSYYEVTGHGTLRRTRSVLTDQPEGDVK"
     gene            486283..486714
                     /locus_tag="NONO_c04400"
     CDS             486283..486714
                     /locus_tag="NONO_c04400"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese-like domain-containing protein"
                     /protein_id="AHH15253.1"
                     /translation="MTHMTITGMLDAARAQLKRMYAFELPEAVARGALLVDIRPQAQR
                     VREGTLPGALVVERNVLEWRLDPTSSARLALATDHDREWVVVCSEGYTSSLAAASLQQ
                     LGLHRATDLVGGYQAVKAAGLLSVAAGAPHLAGEISALVSL"
     gene            486781..488346
                     /gene="lysS"
                     /locus_tag="NONO_c04410"
     CDS             486781..488346
                     /gene="lysS"
                     /locus_tag="NONO_c04410"
                     /EC_number="6.1.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="lysine--tRNA ligase"
                     /protein_id="AHH15254.1"
                     /translation="MSTPNTPSSGDSAGRAPAGQSRPAAVEVDIPEQMRIRREKRERL
                     LDAGVDAYPVVVPRTHSLAEIRAAYPDLEPDTSTGQQVGVAGRVIFTRNTGKLCFAQL
                     QEGDGTRLQAMISLNGVGAEALAAWKADVDLGDFVFVHGEVISSRTGELSVMADSWSM
                     AAKSLRPLPVAHKELSEESRVRQRYVDLIVRPEAREMARTRVKAVLALRTALERRGFL
                     EVETPMLQTLHGGAAARPFVTHSNALDMDLYLRIAPELFLKRCVVGGIEKVFEINRNF
                     RNEGADSTHSPEFAMLETYEAYGTYDDSARMMRELIQEVAQEVFGTQVVTLADGTEYD
                     LSGEWNTVEMYPSLSDSLGVEVTPETTVPELLALADRVGLEIPSDKGYGHGKLVEELW
                     EHTYGDKLYAPTFVRDFPVETSPLTRQHRSKPGVTEKWDLYVRGFELATGYSELVDPV
                     IQRERFVDQARLAAAGDDEAMRLDEDFLAAMEYGMPPTTGTGMGIDRLLMALTGLGIR
                     ETILFPIVRPAGR"
     gene            488462..488827
                     /gene="lsr1"
                     /locus_tag="NONO_c04420"
     CDS             488462..488827
                     /gene="lsr1"
                     /locus_tag="NONO_c04420"
                     /codon_start=1
                     /transl_table=11
                     /product="Lsr2 protein"
                     /protein_id="AHH15255.1"
                     /translation="MAKKVTVSLIDDVDGESIADETIEFAIDGVSYEIDLSAANAAKL
                     RDGLDAWVSNARRVSGRRRSKPIGAGTAAPKGRVSMDREQSAAIREWARRKGHKVSAR
                     GRISADVVESYHKEVGRNN"
     gene            489008..489634
                     /locus_tag="NONO_c04430"
     CDS             489008..489634
                     /locus_tag="NONO_c04430"
                     /codon_start=1
                     /transl_table=11
                     /product="FHA domain-containing protein"
                     /protein_id="AHH15256.1"
                     /translation="MTGIHESFLRFTDRAGGRHELTLTPDRVRITIGRSPQADLALSW
                     DAEVSRLHAAVEYLGAHWTIVDDGLSRNGTFVNGERLAGRRRLETGDRIRVGTSILSF
                     HDYTGGVDDATRTSVGPTLPSLRSLTDTQRAVLIALCRPYRGNTEFATPASNQQIADE
                     LYLSVDAIKTHLRALFSKFGVEDLPQNQKRVRLAALAIQTGIISHRDL"
     gene            489732..490709
                     /locus_tag="NONO_c04440"
     CDS             489732..490709
                     /locus_tag="NONO_c04440"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipase, alpha/beta hydrolase family"
                     /protein_id="AHH15257.1"
                     /translation="MTRSPMVRALRGLRRLPGTALILVVLSTLWTTAAGAARADYPVD
                     YNFFAGIPYELRNPGGSLPGANDWSCRPSAAHPEPVVLVHGTGGGAQTNWGVYAPLLA
                     NEGYCVYSLTYGAYDLPWPLSAIGGMRPVQDSSAQLAAFVDRVRAATGATKVDLIAHS
                     QGNLVGNYFVKRLGGSDKVDKFVAIAAPWLGTFGPVIDPARNFARGLGAGPAFEAMLG
                     VTPCAACAQMTGTSDFMKSLNADGVYDPNVTYTNIETRYDELVVPYTVALVPGPKTTN
                     ILVQDGCDADYSEHAGIAGSDRAAAFALNALDPDHPRTPPCHFIPPLTG"
     gene            491217..493766
                     /locus_tag="NONO_c04450"
     CDS             491217..493766
                     /locus_tag="NONO_c04450"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATP-dependent Clp protease ATP-binding
                     subunit ClpC"
                     /protein_id="AHH15258.1"
                     /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGV
                     AAKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNY
                     IGTEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGSKESVEPGSRGES
                     GTPSTSLVLDQFGRNLTQAALEGKLDPVIGRSKEIERVMQVLSRRTKNNPVLIGEPGV
                     GKTAVVEGLAQAIVNGEVPETLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINT
                     RGDIILFIDELHTLVGAGAAEGAIDAASILKPKLARGELQTIGATTLDEYRKYIEKDA
                     ALERRFQPVQVGEPTVEHTINILKGLRDRYEAHHRVSITDGALVAAATLADRYINDRF
                     LPDKAIDLIDEAGARMRIRRMTAPPDLREFDDKIADARREKESAIDAQDFEKAARLRD
                     KEKQLVAKRAEREKQWRSGDLDVVAEVDDEQIAEVLANWTGIPVFKLTEEETTRLLRM
                     EDELHKRIIGQEDAVKAVSKAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELSKALAN
                     FLFGEDDALIQIDMGEFHDRFTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDE
                     IEKAHQEIYNTLLQVLEDGRLTDGQGRTVDFKNTVLIFTSNLGTSDISKAVGLGFAQS
                     NNEGSNYERMKLKVNDELKKHFRPEFLNRIDDVIVFHQLTNEQIVEMVDLMINRVATQ
                     LRNKDMEIELTDQAKSLLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFGELGPGQI
                     VSVDVEGWDGEGTGEDAKFTFAGRAKPAKAEVEPVAALAGAGETTAEAAGE"
     gene            493930..494709
                     /locus_tag="NONO_c04460"
     CDS             493930..494709
                     /locus_tag="NONO_c04460"
                     /codon_start=1
                     /transl_table=11
                     /product="phytanoyl-CoA dioxygenase (PhyH)-like protein"
                     /protein_id="AHH15259.1"
                     /translation="MLSDAQVDAFVAEGFVRVDGAFSAETATAAREILWRATGCDPED
                     PATWNQPVIRLPGFGDEPFRVAARSPLLARACDQLVGPGRWVPRNGLGTFPIRFPSDQ
                     PPGDDGWHIDASFAGDDDDPSDYGRWRVNVVSKGRGLLMLFLFSDVGPQDAPTRIRAG
                     SHLRMARVLEPYGEAGVPMFDLVDDFATTADLPEVAATGRAGDVYLCHPFLVHAAQPH
                     RGAHPKFMAQPPLELNEEFRLERPDGDYVPVEAAVRRGLGR"
     gene            complement(494717..495505)
                     /locus_tag="NONO_c04470"
     CDS             complement(494717..495505)
                     /locus_tag="NONO_c04470"
                     /codon_start=1
                     /transl_table=11
                     /product="luciferase-like domain-containing protein"
                     /protein_id="AHH15260.1"
                     /translation="MTIRFGTMLVPQSATGWTAAARDAEQQGYHTLLMPDTLMTQSPF
                     PALAAAAAVTTTLRLRPNVLAAPLRTAATVVRETAALQALSDGRFELGIGVGRPGAEA
                     EAQRLGLPWGSPGQRRTHLRDIVEAVRAEVDPAPAVMVAAAGPRMLTAAAGFADRILT
                     AVGPKATEQDVAQLFSLVRDSTDRPIPFTSQLIGVGERTAWSPSGHFDAAQLRDAGSF
                     ALLPADPEAAADILRERQDKYGIDEVIVPGDLAEGFAPVLELLS"
     gene            complement(495543..495806)
                     /locus_tag="NONO_c04480"
     CDS             complement(495543..495806)
                     /locus_tag="NONO_c04480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15261.1"
                     /translation="MTSHLTAATTNLSADHYGWHPWPFFWVFPLLFWLVVITGLILLV
                     RRSSLRDSGIGALRSSFARGEIGEEDYLSRLEVLRRTRRGARP"
     gene            496029..496673
                     /locus_tag="NONO_c04490"
     CDS             496029..496673
                     /locus_tag="NONO_c04490"
                     /codon_start=1
                     /transl_table=11
                     /product="von Willebrand factor type A domain-containing
                     protein"
                     /protein_id="AHH15262.1"
                     /translation="MTNPDATLIAVLLDRSGSMQSIKADTEGGLAAYFEEQRKLPRQI
                     QVTFAQFDTEYECLYSNVQIDRIPAPELHPRGGTALYDALGKLVTDVGAELAARPESE
                     RPGTVIVVVLTDGHENSSREWTHAAVRSLITQQQEVYNWDFLFLGANMDAVEIGASMG
                     FAPSQSITYAAAPAGVAGVFGAAAAYSARLQSDPGSARSSGFTDSERQQSNPGE"
     gene            complement(496822..497487)
                     /locus_tag="NONO_c04500"
     CDS             complement(496822..497487)
                     /locus_tag="NONO_c04500"
                     /codon_start=1
                     /transl_table=11
                     /product="putative two-component system response
                     regulator"
                     /protein_id="AHH15263.1"
                     /translation="MNDIRVLVADDQALVRAGFAALLDAQDGIEVVGEADNGEQAVRL
                     ARELRPDVVLMDIRMPVLDGLAATREIAADPALTEVKVVVLTTFELDEYVFEAMRSGA
                     TGFLVKHTEPADLVKAVRVVAGGDALLSPSVTRRLVAEFATRAKPAPETTLTDLTDRE
                     REVMTLVAEGLTNAEIGKRLFMSPATARTHVSRILLKLNARDRTQLVVMAYESGLVRP
                     GWQ"
     gene            complement(497697..498998)
                     /locus_tag="NONO_c04510"
     CDS             complement(497697..498998)
                     /locus_tag="NONO_c04510"
                     /codon_start=1
                     /transl_table=11
                     /product="putative two-component system sensor kinase"
                     /protein_id="AHH15264.1"
                     /translation="MVLTLVVTVIQVGAGHAANAHQADVRSLDGIGYALLVAGPVLLL
                     LRRRYPRSVFVAVLAVTAGYLLAGYGYGPIFVSLIIAFLTAASRGSRWYTYPLVPLGY
                     LLMVWPVPALRGQDTGGWPVIGILAWLFVLIGIAEGIRQRQAVLLARSQRAEAARRNA
                     AAERARELAEREQRADRERLAIARELHDVLAHSLSLINVQSSVALELFDRKPEQAATA
                     LSAIKEVSRDALEEVHSLLRSIRAGAGTVAAPTSPAVGIGDLESLLAPTRAAGTVVHT
                     RITGTPHRLPVVVDVAAARIVQESLTNVLRHAPGTEATVAVDYSPTGLCITVDNDGPP
                     NSPQSSTTGGGNGIPGMIERAHALGGELSAAARTDGGFRVEARLPIPATAAAREHGST
                     LPSTPSGRANDAHLRTRPPRSADRANDAGTPESAAEPRERE"
     gene            499157..500089
                     /locus_tag="NONO_c04520"
     CDS             499157..500089
                     /locus_tag="NONO_c04520"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter, ATP-binding protein"
                     /protein_id="AHH15265.1"
                     /translation="MNRSNADDVVLTAGLTKRYGDQVAVDAVSMTVRRGEIYGFLGPN
                     GAGKTTTLRMLVGLIASTSGSATVLGCRPGEPEALRRIGVLIEGPGFYPYLSGRDNLR
                     VLARYRRNAAGRRDRFAEVDEVLARVGLADRADDRFRAYSLGMKQRLGVGAALLGGPD
                     LLILDEPTNGLDPAGMAEMRELITGLAAEGHTVVLSSHLLSEVQEICDRVGVISGGRL
                     LTESTVSELRGAATLLVCAEPVETAYPAVRRVVGDHAAMLTATGIRVDAGRATAPEVA
                     RAVIESGADLLELRIDERSLEEVFFEMTKQESPI"
     gene            500086..500952
                     /locus_tag="NONO_c04530"
     CDS             500086..500952
                     /locus_tag="NONO_c04530"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH15266.1"
                     /translation="MTATDMTGDVIACVRAEFARLRKWPAFWIVLGTWIVLNLVFAYL
                     FNYLAYSSGSGSRMSNGQPREVLLQLMLPAAVPEVFTQGMAMFGGALMLVLGALVVGS
                     GYGWGSWKTVFTQGPSRAAVAGGTVLALVAVVVGLVVTAFVVDTGVAAVIGAAEHQSL
                     SLPTLGHTALGLGTGIAILGMWTLAGALIAAIARGPALAVGLGLVWVLVVENLLRGVA
                     AIFAPIRAVTDHLPGTAAGSLAGAMRTVGGSATPGVLDILSRPASAVVLAVYIVLFAA
                     GAITLAVRRDMA"
     gene            501019..501462
                     /locus_tag="NONO_c04540"
     CDS             501019..501462
                     /locus_tag="NONO_c04540"
                     /codon_start=1
                     /transl_table=11
                     /product="putative osmotically inducible peroxiredoxin"
                     /protein_id="AHH15267.1"
                     /translation="MPTRSARTAWTGGLQDGSGQVELASSGVGKFDVSFPKRTADTAE
                     GATSPEELIAAAHSSCYAMALSGQIGAAGGTVQSLDVNADVTLGPDPAGGFRISRIVL
                     KVRGRVADIDAAAFDQAAQNAKAGCPISKALAGVDTIELDAALES"
     gene            complement(501530..501844)
                     /locus_tag="NONO_c04550"
     CDS             complement(501530..501844)
                     /locus_tag="NONO_c04550"
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase
                     domain-containing protein"
                     /protein_id="AHH15268.1"
                     /translation="MAVVKINAIEVPEGAGPELEKRFANRAHAVENSPGFLGFQLLRP
                     VAGDNRYFVVTQWDSEESFAAWRDGPAKEAHAGQARQPVATGASLLEFEVVLDVAGKT
                     GD"
     gene            501857..502657
                     /locus_tag="NONO_c04560"
     CDS             501857..502657
                     /locus_tag="NONO_c04560"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase family protein"
                     /protein_id="AHH15269.1"
                     /translation="MRPSRHVSSEPMLYDEGGAGVPILLLHGLMGSARTWADHVPWLR
                     EYGHVYTFDAAGHGRPAPPRLTTEHFVADLAEATAEIADPMVVIGHSMGGLHGWMFAA
                     AHPERVRALVVEDMAPDFRGRTAQHWAEMIAAWPQPFPDADAVLDYFGPVAGRYFLNS
                     FTSGPDGYRLHGSVDTFRDISEEWGTRDFWPQWRSVRVPTLLIEGEFTITPPGQVKEM
                     ATVRPGVRYLMVEGAGHLVHDDQPERYRAEVEKFLHEIMGVSAEEDLE"
     gene            502759..503931
                     /locus_tag="NONO_c04570"
     CDS             502759..503931
                     /locus_tag="NONO_c04570"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="AHH15270.1"
                     /translation="MINFSIPADLAAERDRIRRFVTDTIVPFERDPRLTSHGPNDELR
                     QELVELARAEKLLTIQAPEELGGRGLTHVEQAVLYEAAGWSTLGPVAMNCAAPDEGNM
                     FLLSKVANPEQTDRFLMPVINGRQRSVFAMTEPGGAGSDPGQLATTATFDGENFTING
                     RKWLITGADGAKTWIIMAKLEANPHLPEGPTLFLTEGGQPGIVIERTMNTMDRNYVGG
                     HGVVRFENLVLPKESLLGESGQALRYAQLRLAPARLTHCMRWLGAAERAHAIAVEHAK
                     TRTAFGKPIGEHEGVSFMLADNEIALHQCRLTIWHACWLMDQGHKARHESSMAKSYVS
                     EELFKVADRCVQVLGGIGISDETVVEMIFRDMRAFRLYDGPTEVHKWAIGRQVLRG"
     gene            504006..504833
                     /locus_tag="NONO_c04580"
     CDS             504006..504833
                     /locus_tag="NONO_c04580"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase/isomerase family protein"
                     /protein_id="AHH15271.1"
                     /translation="MSSELQVDVSAGVAVLTLNRPAQQNAMTPGMAEALGVALRRCDT
                     EDSIRAVVITGTPPAFCAGADLSSRVGDVSATIDPPPWQIRKPVIAAVNGHAVGIGLA
                     LALQCDLRYVADDAVYGLNQVRRGVMADGYAHWTLPRLAGMANAADIMLTGRTFDGDE
                     ARQMGVANNSLPAGEVLPTALAVAHDLAAGSAPLPTALSKRLLWEGLGMTPEAVGRLE
                     TDLHDIVGNSADAAEGMAAFRDRRAPKWSGSISSEWPAGELSPEQRAGLDVSGSEPN"
     gene            complement(504839..505135)
                     /locus_tag="NONO_c04590"
     CDS             complement(504839..505135)
                     /locus_tag="NONO_c04590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15272.1"
                     /translation="MYQPDYWGSLPEPPTGSPVEHPHATTVLLVGVLSLFCCGALGPV
                     AWVMGKRALDEIEMSGGTIGGRSQIMVGYIVGIVGTFMMVLVAGIFLLMLLAGT"
     gene            complement(505234..506202)
                     /locus_tag="NONO_c04600"
     CDS             complement(505234..506202)
                     /locus_tag="NONO_c04600"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase, TrmH family, group 3"
                     /protein_id="AHH15273.1"
                     /translation="MAGNSQRRGAIRKGGTKKGQTVGSGGQRRRGLEGRGATPPASAR
                     KYHPAAKRAAAAAKAAKSGQGSGRPRPGTRKGDDGPELVLGRNPVVECLRAEVPATAL
                     YVALGTENDDRLTESVQRAADAGISILEVSRVDLDRMSTNGLHQGMALQVPPYRYAHP
                     DDLLDTARASGTAPLLVALDNISDPRNLGAVIRSVAAFGGHGVVIPQRRSASVTAVAW
                     RTSAGAAARLPVARATNLTRTLKDWAKAGLQVVGLDAGGDTVLDEFDGTTPTVVVVGS
                     EGKGLSRLVRETCDSILSIPMAGPVESLNASVAAGVVLADIARQRR"
     gene            complement(506282..507667)
                     /gene="cysS"
                     /locus_tag="NONO_c04610"
     CDS             complement(506282..507667)
                     /gene="cysS"
                     /locus_tag="NONO_c04610"
                     /EC_number="6.1.1.16"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine--tRNA ligase"
                     /protein_id="AHH15274.1"
                     /translation="MTLRLFDTETRTLRDFIPLVPGHASVYLCGATVQGEPHIGHVRS
                     GVAFDVLRRWLAANGYDVAFVRNVTDIDDKILTKAAAAGRPWWEWAATHERAFDRAYE
                     ALGVLPPSVEPRATGHITQMVDLMRRLIDRGHAYAADGNVYFDVRSYPAYGELSGHRI
                     EDVQQGESAGSGKRDPRDFTLWKAAKPGEPTWPSPWGPGRPGWHLECSAMAEFYLGAE
                     FDIHCGGMDLVFPHHENEIAQSRAAGDGFARTWLHNGWVTLGGEKMSKSLGNTLSVPN
                     VLTRVRAVELRFYLGSAHYASMLEYSDQALSDAAQTYQRLEAFVQRTVERVGEVAVGK
                     WTDTFAEALDDNLAIPKALAEIHRVVHEGNRALEAGASEAAREAAGQVRAMLAILGVD
                     PLDPHWAAPSDSSAAESALDVLVRAELERRQQARSEKDWAAADAVRDRLGAAGIEVVD
                     TAGGSDWSLAK"
     gene            complement(507895..508395)
                     /gene="ispF"
                     /locus_tag="NONO_c04620"
     CDS             complement(507895..508395)
                     /gene="ispF"
                     /locus_tag="NONO_c04620"
                     /EC_number="4.6.1.12"
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase"
                     /protein_id="AHH15275.1"
                     /translation="MTDLTALRTGIGSDVHPIEPGRPCWMAGLLFDGDDGCAGHSDGD
                     VAAHALCDALLSAACLGDVGAVFGTGRPEWEGVSGAAMLTEVRRLLDEQGYRIVNAAV
                     QVIGNRPKIGPRRIEAQQVLGDLLGAPVAVSGTTSDGLGLTGRGEGIAAVATALLLHD
                     GRCSTS"
     gene            complement(508392..509033)
                     /gene="ispD"
                     /locus_tag="NONO_c04630"
     CDS             complement(508392..509033)
                     /gene="ispD"
                     /locus_tag="NONO_c04630"
                     /EC_number="2.7.7.60"
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase"
                     /protein_id="AHH15276.1"
                     /translation="MPKAFVPVGGSPMLVRAVDGLITSGVVDRIVIMAPIEMIDAARQ
                     VLTAHAPAVGSVPVDVVAGGAERTDSVRAGLAAAPEATHILVHDAARALTPPSLVARI
                     VAELTTGLRAVVPGVPVADTIKSVSATGDVTGTPDRSGLRAIQTPQGFDAELLRAAYA
                     VDLPATDDAGLVEALGVPVRVIPGDPLAFKITGQLDLRLADALCAENDTVVRR"
     gene            complement(509117..509605)
                     /locus_tag="NONO_c04640"
     CDS             complement(509117..509605)
                     /locus_tag="NONO_c04640"
                     /codon_start=1
                     /transl_table=11
                     /product="putative RNA polymerase-binding transcription
                     factor CarD"
                     /protein_id="AHH15277.1"
                     /translation="MIFKVGDTVVYPHHGAALIEAIETRTIKGVQKEYLVLKVAQGDL
                     TVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVN
                     KVAEVVRDLWRREQDRGLSAGEKRMLAKARQILVGELALAEGTDDVKAETLLDEVLAA
                     AS"
     gene            509887..510582
                     /locus_tag="NONO_c04650"
     CDS             509887..510582
                     /locus_tag="NONO_c04650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15278.1"
                     /translation="MTALKATTASNVTKVSRRALAVAALATGAALALSGCGAGQISQT
                     AHQVPAVNGNAATVGNMALRDVRILLPQSEQYTNAKGGKAVLAFSAINQGSARTDELV
                     SVTTDLGQVKITPDKPQLVPGQTVVADGAAKAGEAASAPTSAAAPTTEPGHAATEAGE
                     GAGTADNPADPNAHPILVEITGLTRDIVPGLTYGVTFNFKDAGTVAVQVPVDAGPDTP
                     RHEASVVSEHQGH"
     gene            510669..512072
                     /gene="radA"
                     /locus_tag="NONO_c04660"
     CDS             510669..512072
                     /gene="radA"
                     /locus_tag="NONO_c04660"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="AHH15279.1"
                     /translation="MAKVKSLYRCSSCGNEVAKWVGRCPGCSEWGTVDEVAVTAGSSG
                     AGNSAGRRALLPSTAAAPISTIDSKVTRARPTGVGELDRVLGGGVVPGSVVLLSGEPG
                     VGKSTLLLEVAHRWARQREERALYVTAEESAGQVRLRADRTDAVHERVYLAAESDLAT
                     ILGHVDQVRPTLLVVDSVQTMLAADADGVIGGVTQVRAVTAALTALAKASGIAVLLVG
                     HVTKDGNVAGPRTLEHLVDVVLQFEGDKHSTLRMVRGIKNRFGSADEVGCFELHDDGI
                     KGVSDPSGLFLHHRADQVPGTAITVAMDGKRPLLGEVQGLTVSTQVPAPRRAVSGLDY
                     NRVSMVLAVLQSRCGVYLGKHDVYAATVGGMRLAEPAADLAVAVAIAGAERDIPLRAG
                     MVVLGEVGLAGEVRRVTGVGRRLREAERLGFTEALVPPGTDLSGITMKVHEVANVRAA
                     LASSGLSKRRRERTEAS"
     gene            512211..513353
                     /gene="disA"
                     /locus_tag="NONO_c04670"
     CDS             512211..513353
                     /gene="disA"
                     /locus_tag="NONO_c04670"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA integrity scanning protein DisA"
                     /protein_id="AHH15280.1"
                     /translation="MTPGRWVTHLLGRPAPRGRPAVPADIVRPRGADPAATIARLVPG
                     TELRDGIDRILRAHTGGLIVLGYDERLERICDGGFELDVEFSPTRLRELSKMDGAVVL
                     STDGTRIRRANVHLVPDHSLPTAESGTRHKAAERTAAQAGFPVVSVSRSTGIVTVYFD
                     GGRHPIQTSETILARANQAMATLERYRSRLDESARQLSLAELNDCATLRDVLAVVHCL
                     ELVRRVAREIGSDVDELGVDGRQLALQLAELVGNTDTLRRLLVRDYLRAEPAGDAELE
                     HALDGLDGLLEVDLLELTNLAPPLGFPATIEALDAAVGPRGYRVLAEIPRVPLGRAEP
                     VIAAFGSLSGLVSASAAEIEGVGGIDAELARQIREGLARLAEPGTV"
     gene            complement(513354..514022)
                     /locus_tag="NONO_c04680"
     CDS             complement(513354..514022)
                     /locus_tag="NONO_c04680"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15281.1"
                     /translation="MLEPNGPLPPEIYWRRRLLAIGALVVALALVIWLAMMLLRGGGD
                     NKDTKHAGAAATSTSAAATGTGNPSSAKPAAPGTSASGTVNSTANGTPAQCPDQSLAV
                     KSNVGQPTYKAGEQPVFTVVITNISTAACTRDMGSGLQQVWVQSLDGQRRLWSSTDCD
                     QGGPADVRTLNGGQQAAFTLTWSATTSQPGCEGDRVPVPAGGYAVVAQFGSVRSTPET
                     FNIA"
     gene            complement(514149..514799)
                     /gene="cynT1"
                     /locus_tag="NONO_c04690"
     CDS             complement(514149..514799)
                     /gene="cynT1"
                     /locus_tag="NONO_c04690"
                     /EC_number="4.2.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="AHH15282.1"
                     /translation="MGNLWKMGRMPHTNPISAWKSLREGNDRFVNGTLSHPSQGAADR
                     AKLVGGQHPRAILFGCGDSRVAAEIIFDQGLGDMFVVRTAGHVIDESVLGSIEYGVEI
                     LDVPLIVILGHDSCGAVRATIDALDDGNVPGGFIRSLVERVTPSILGGRRDGLTEVDE
                     LEARHVQETARLLTDRSKIVADRVESGRCAIACVNYKLSDGRAQLHKVIGDIGETV"
     gene            514872..515741
                     /locus_tag="NONO_c04700"
     CDS             514872..515741
                     /locus_tag="NONO_c04700"
                     /codon_start=1
                     /transl_table=11
                     /product="putative A/G-specific adenine glycosylase MutY"
                     /protein_id="AHH15283.1"
                     /translation="MSVDADALIDWYGSAARDLPWRRPGVSAWQILMSEIMLQQTPVV
                     RVEPIWREWVARWPVPSAMAAASPGEVLRAWGKLGYPRRALRLHECARVLAAEHGDVV
                     PADVEVLLGLPGIGAYTARAVACFAYGQRVPVVDTNVRRVVARAVHGRAEAGNPRARD
                     LAETEELLPVRIDRAAVFSAALMELGATVCTARTPDCDRCPLPHCGWIAAGRPVSDVV
                     RRTQKYDGTDRQARGRLLDVLRGATGPVERMALDLAWTHDPGQRDRALDSLLVDGLIE
                     QTDNGLFALAGEG"
     gene            515825..516190
                     /locus_tag="NONO_c04710"
     CDS             515825..516190
                     /locus_tag="NONO_c04710"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15284.1"
                     /translation="MRLLLDRPYVLAWIYVLASVLLGPVIFLGGYVFFTQGVGDYCDA
                     IHGSVADRDAAFRSAQIFQVTGAGVMVAVGLVLLIRLWTHRARLPWYFSVVSGAAVEV
                     MMAGFVLVILLSGPAGQSC"
     gene            complement(516153..517085)
                     /locus_tag="NONO_c04720"
     CDS             complement(516153..517085)
                     /locus_tag="NONO_c04720"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC metal ion transporter, permease"
                     /protein_id="AHH15285.1"
                     /translation="MNEKLSDVFTKMLDFTTTADLLSYDFVQQAFIAAALLGLLAGVI
                     GPLVVNRQMSFAVHGTSELSLTGAAAALLIGIGVGAGAIVGSVVAAVMFGLLGSKARE
                     RDSVIAVVMSFGLGLSVLFLWLGPSRAGSKFSLLTGQVVSVGGNGLTSLALCTAAVLV
                     VLAFIYRPLLFASTDPEVAVARGVPVRALSVVFAVLLGVTAAFGVQIVGALLVLSLLI
                     TPAAAAAQLTASPLRATVLSVVFAEIAAVGGILLSLAPGVPVSTFITTISFAIYLLCR
                     FVGRPLTEARRRRIPPAVAAVAPSSSDLPVRTAV"
     gene            complement(517082..518320)
                     /locus_tag="NONO_c04730"
     CDS             complement(517082..518320)
                     /locus_tag="NONO_c04730"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter, ATP-binding protein"
                     /protein_id="AHH15286.1"
                     /translation="MPGQIRTETATGARTDSGAGLSRIAEADCTFCDTASTSPPPAET
                     PASTTSAAGSASVPPAPAANPGTPTSAADGDTPVTAPSTSAVSAETSAITPPTSATPA
                     ENSVPARSSATVADAPVKNAQVSTKATGPAAIVAPPGVAHPTPAVSLRGAALAFGSRT
                     LWQGLDLDIAPGEFVAVLGPNGSGKTSLLRMLLGQLAPSAGTAEVAGMPARPGNSRIG
                     YVPQQKTIDAGVQLRGVDLVGLGVDGHRWGLGWRGRGERRRRVAAAIAQVGAEHFATA
                     PLESLSGGEQQRLRVAQALAGDPAVLLCDEPLLSLDLANQRLVSELIDRRRRTHDTAV
                     LFVTHEINPILPLVDRVLYLVDGKFRIGTPDEVMTSEVLSELYGTEVDVLRVRGRLVV
                     VGTGDEIDALGTHHSESAGE"
     gene            complement(518332..519222)
                     /locus_tag="NONO_c04740"
     CDS             complement(518332..519222)
                     /locus_tag="NONO_c04740"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC metal ion transporter,
                     substrate-binding protein"
                     /protein_id="AHH15287.1"
                     /translation="MIRSLVARIAVVTLGATTAFTLAACSGSSSGSGKPSIVASTDVW
                     GSVAAAVGGPDVEVKSIIDNPTVDPHSYQTTPSDAAAIREAALVVYNGGHYDEFAEKA
                     AEGRDKPTLAAFDLRAGAAAGDENEHIWYDMNTVGAVADKIAAELGDIDPEHKQAFAD
                     RAAALRGRLAGVTAITAKIAAAHPKSPVLQTEPLAHYLLLAADTDDRTPHEFEEAIEQ
                     GTDPAPADLAAVRDLLNAKKVRALVYNIQTEDKTTKDVASTAKSAGVPVIEVTETLPE
                     HTDFVKWQTDNANALAAALG"
     gene            complement(519395..521968)
                     /locus_tag="NONO_c04750"
     CDS             complement(519395..521968)
                     /locus_tag="NONO_c04750"
                     /codon_start=1
                     /transl_table=11
                     /product="putative trehalose-phosphatase"
                     /protein_id="AHH15288.1"
                     /translation="MSAQDLPHELRRALSAVARVPRLLVASDYDGTIAPIVSDPAKAY
                     PHRESVSALRALAGLSTTTAAVISGRALRDLAALSRLPVEVQLIGSHGSEFDVGFVHA
                     IDNDAKQLLTEVRHALADIAEQNPGVTVEAKPASIALHVRNATPEVGRRALQQARQGP
                     ASWVGVQVTEGKAVIELAVIQTDKGAALDIIRHQEGASAAVFFGDDVTDEKAFARLSG
                     PDIGIKVGEGESRAEFRVASTEEVAKALAFLLEERRTWLAGASAPRIERLTMLASPRS
                     NALLTPDGTVTWFCHPEPDSAAVFAHLLGGPAAGHFTIAPERQGLPLSQRYVDGTMTV
                     ETRWSSLKVVDYLPHDAALERTDLTRVITGDAKAVVTFAPRPEFGQVPVTLVRDPAGL
                     RVHGTNDPIVLRSPGVRWEISEEGIHHVARAVVDPSEGPIVLEMRCGTADLAPAMVSE
                     PERRNEAERYWRDWAASLELPPLKPDLMKRSALTLRGLVHAPSGSIMAAATTSLPEDI
                     GGVRNWDYRYCWLRDAALTAHALVALGSLTEAEDFLAWTHRVLDTLAGPERLHPLYTL
                     YGETLPPEAVLDQLPGYAGSRPVRVGNAANMQVQLDVFGPIVDLISGLAEAREAKGIL
                     NPAKALPDRDWDLVHAMVSAVQRRWNEPDHGIWEIRGNPRHHVYSKVMGWLTVDRALK
                     LAEKFDRPVDPAWIELRDTISEEVKAKGWNEQVQSYTAAYDGTDLDAATLHIGLSGLI
                     EPSDPRFAATVVATEAELRSGSTVYRYHHDDGLPGGEGGFHLCAAWLVEAYLLIGKRE
                     DAEALFAQLVDVAGPTGLLSEEYDPVAERSLGNHPQAYSHLGLLRCAQLLSQPVAVLA
                     Q"
     gene            complement(522126..522782)
                     /locus_tag="NONO_c04760"
     CDS             complement(522126..522782)
                     /locus_tag="NONO_c04760"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH15289.1"
                     /translation="MASPSREQAADSGAQNGARNRATVSTLSEDELSSAAQRERRKRI
                     LDATLALASKGGYDAVQMRAVAERADVAVGTLYRYFPSKVHLLVSALAREFEQLDSKR
                     KPLPAQTPRDRMHLVLTQVTRAMQRDPLLTEAMTRAFMFADASAAAEVDRVGKVMDNF
                     FARAVIEGEPNDRDLAIARVISDVWLSNLVAWLTRRASATDVAERLELTVDLLLGEKS
                     "
     gene            522925..525072
                     /locus_tag="NONO_c04770"
     CDS             522925..525072
                     /locus_tag="NONO_c04770"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="AHH15290.1"
                     /translation="MTIATTDEHKAVQESMRGWAAAAQPIATMRSGTPGFWREFWPGL
                     VGLGVFSIAVPEESGGAGGGVSDLAVLIEQAAHDLVGGPVTATALAGLVAGDTLDEDT
                     PCGIALGEPVVVPHNGTGPLEVTGTWDVVYGADENTALLLPVRSGERELWCLFDAGTA
                     GVRIEALSALDLGVPLARVECDKVAVPAERVFEPSVAVADLAAALVAAEAAGIAGWCL
                     ETAVEYAKVREQFGRRIGEFQAIKHICAWMLCRTEQTRAVAADAAAAVDSGSGELALS
                     AAIAMTVALDAAVENAKDCIQVLGGIGFTWEHDAHLYLRRASALRSLLGGSARWRAEV
                     ARLTHAGIRRTVGVDLGGESAWEAAGLDASEEAALAADLVRIAALPVAEQRTALAEAG
                     LLAAHWPAPYGRGAGPLLRSHIDDQIRKAGIELPDLVIANWAIPTLLQWGTPEQIERY
                     AGPTLAGDVIWCQLFSEPGAGSDLAALRTVAEKVEGGWKLRGQKVWTSLADRATWGIC
                     LARTDASAPKHKGISYFLVDMKSAGLEIRPLVEITGEARFNEVFLDDVFVPDDCLVGD
                     VNNGWRIARSTLSAERIAMGGKGIGEELEAMIAAAPTSGPGAEVVADRLGALIAESVA
                     GTLLEARAAQKLLSGGDPAAESSVRKLVGVRHRQAVAEFAAELSGTAGALDTEAVKEF
                     LLTRCLSIAGGTEQILLTVAGERILGLPREAQG"
     gene            525099..526166
                     /locus_tag="NONO_c04780"
     CDS             525099..526166
                     /locus_tag="NONO_c04780"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="AHH15291.1"
                     /translation="MDFTRDESQDAVAEVVVSLLERESARDIALWPIIAESGLLAVPL
                     PERFGGDEMGLLEVSAMLTELATDAAQTPALVTLGFGVLPLRAVGLPDAVADKVFPAV
                     AEGAVLTAALHEPGAPFVTKPETSAVSDGVTVRITGSKVAVPYADTARWMLVPTGNGI
                     AVVDGDAAGITRTPSPSSDGVPEFSVRFENVAIPAEQLLPEGLTELHRYALASIGAVA
                     DGLLKGVVALTAEHVRTRQQFGRALAQFQAVAQEIADVYVVSRTLSVAAASAVWALAQ
                     DDRGAAHTERVDDDLDVLAFAVADELPRAMQMCHHLHGGLGVDMTHPLHRYYSQAKDI
                     ARWLGGASFRLDRLGVRCSSN"
     gene            526151..527320
                     /locus_tag="NONO_c04790"
     CDS             526151..527320
                     /locus_tag="NONO_c04790"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="AHH15292.1"
                     /translation="MFIELTAEQRQLRDELRSYFTGLVTPEEEAEMQENRHGDAYRAV
                     VKRMGRDGKLGLGWPKEYGGAGFGPLEQQIFYNEAVRADVPVPLVTLLTVGPALQSFG
                     TEEQKRKFLPGILTGDVHFAIGYSEPDAGTDLAALRTSAVRDDSGDWIVNGQKIFTTG
                     AHEADYVWLAVRTGSVESRHKGITILIVDTKDPGYSWTPIITADGAHHTNATYFDNVR
                     VPANMTVGEENGGWKLITTQLNHERVSLGPSGKIEQLYERVREWARKQGVLGETEVRR
                     GLGRLHAMVRLNELLNWQVASNMERPDADQRDVIADASATKVFSTEALQEAGRISEEI
                     VGRFGDPADQATADLLTWLDKRVKQNLVVTFGGGVNEVMRELIAQMGLRLPRVPR"
     gene            527331..528296
                     /locus_tag="NONO_c04800"
     CDS             527331..528296
                     /locus_tag="NONO_c04800"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15293.1"
                     /translation="MPETMTTQDIVAAGERIREAGECAPRRGRDPVNQPMINNWVEAL
                     GDSNPIYVDEEAARAAGHPGIVAPPAMAQVWTMPGLHGARPADDPMNAVNDLLDAAGY
                     TSVVATNCEQTYHRYLRPGERPVARTRLGDLVGPKRTGLGEGWFATYLLTWYVDDEPV
                     TEMVFRMLKFAPGTGKTAAPAESGEVSAEDLAKRVRPTVSKDTEFFWDGVKLGELRIQ
                     QRPDGSLQHPPVPALWKDHTEQSDYVVASGRGTVFSFVVHHAPKVPGRQLPYVVALVE
                     LEEGVRMLGELRGVDPAEVEVGLPVEVGFQQLDDDDTVPYWKAVR"
     gene            528293..528712
                     /locus_tag="NONO_c04810"
     CDS             528293..528712
                     /locus_tag="NONO_c04810"
                     /codon_start=1
                     /transl_table=11
                     /product="putative MaoC-like dehydratase"
                     /protein_id="AHH15294.1"
                     /translation="MTSTIEPTTVRVGTTLPELVIHADPTFVVSTALATRDFQDVHHD
                     RDKAVERGSKDIFVNILTDTGLVQRFVTDWAGPGAIVKSLALRLGVPLYAGDTLTLTG
                     TVSAVDGVDITIDVVGKDSLGDHISAKAVISLQEARQ"
     gene            528709..529884
                     /locus_tag="NONO_c04820"
     CDS             528709..529884
                     /locus_tag="NONO_c04820"
                     /codon_start=1
                     /transl_table=11
                     /product="putative thiolase"
                     /protein_id="AHH15295.1"
                     /translation="MTGLSRRAAIAGIGATDFSKDSGRSELRLAAEAVTAALADAGLT
                     AADVDGLTTFTMDTNTQAAVARATGIPSLKFFSNIPFGGGAAAATVQHAAMAVATGIA
                     DVVVAYRAFNERSGNRFGQFATHLATGNPSSSGVDNAFSYTHGLGTPAAQVAMVARRY
                     MHVYGARSTDFGAVAVADRKHAAVNPAAHFYGKPITLDDHQSSRWIAEPLHLLDCCQE
                     TDGGVALVITSAERAKDLPNKPALIAGAAQGSGADQYVMTSYYRDGLTGLPEMGLVGD
                     QLWAQSELRPEDMQAAILYDHFTPFVLMQLEELGFCGRGEAKDFIADGAIEIGGRLPL
                     NTHGGQLGEAYIHGMNGIAEGVRQIRGSSVNQVEGLNNIVVTAGTGVPTSGLVLTTA"
     gene            530196..531317
                     /locus_tag="NONO_c04830"
     CDS             530196..531317
                     /locus_tag="NONO_c04830"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATPase, AFG1 family"
                     /protein_id="AHH15296.1"
                     /translation="MNAVDPAHVVPDDACVAREVMGGNGSPAGLGAVRAGAPVDSGIG
                     DIVLDDDQRFAAERLRQVALRLGSRWRRPRGLYLHGRPGRGKTMLMDDFFARVSSDRK
                     RRFHFHEFFADLHRAVGTGGGLPAAVDTVLGDAELICFDEFHVHDIGDGMLLHRLLRT
                     LFERRIVLVATSNYPPENLLPNPLMHAKFEPVIALLRARLDVVSVDGAQDYRLLATGH
                     SGFAAGRYVVDPGASREYEDAGRTSGAGRTARVPIAHRTLTAHRADEELVIDFAELCG
                     SPLSPADYLALTRAHRRWTVRAVPPLRSVPVDWATRFVNLIDVLYDADLELTLYAEAP
                     LADLLGEVSGVPDLDRIASRLRRLLGPGAQPTRHGGGGS"
     gene            531534..532469
                     /locus_tag="NONO_c04840"
     CDS             531534..532469
                     /locus_tag="NONO_c04840"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15297.1"
                     /translation="MAGVRTAVSRAIGLIALMACVVFALRGYIPGTGGPHAVSPPSVV
                     TIALMPVLSLVSVVILLAGVFTSQHRLPLAMPDDDREREQQFRLSRFGMVVLIAVAVA
                     AVLTAIVWAVYLLVGGPGEAPSSNPPATATTQAQPTETEAPQRFSGTPELSGDTLIFV
                     AAGAALLVAVAVIGLGVVAVGSRDRRGKPQLLPAPAPAEAPVSLAQVAEMGLAAMMAS
                     GSKDARTAIIACYVAMESGLAQAREVAPLASDTPSEVLARAFDRGVLHDASARELVTL
                     FEEARFSPHSILEWQRMRAEQLLRIVLADLQGARL"
     gene            532466..532969
                     /locus_tag="NONO_c04850"
     CDS             532466..532969
                     /locus_tag="NONO_c04850"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15298.1"
                     /translation="MKRMTIVIGAALLIGAVELLALGNQRELLPILTGIVVFGALALL
                     LRSVIERARRQMRADIEDHEIENGPAEMLSRWHARAQMLASRADGTRADWDRYLRPLL
                     AKEFELSSGHRMTKNRKATEVAGRLQFGPELWRWVDPANSSTRDHTTRAPGRAALDEI
                     LRRLQDM"
     gene            532999..533961
                     /locus_tag="NONO_c04860"
     CDS             532999..533961
                     /locus_tag="NONO_c04860"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase associated with various cellular
                     activities"
                     /protein_id="AHH15299.1"
                     /translation="MTTPLDVTIKRTDAVLREIARVVVGKRDELQLIMVAVLSGGHVL
                     IEDLPGLGKTLIARSFATALGLDFTRVQFTPDLLPADLIGSTIYDMASGRFNFRRGPV
                     FANMLLADEINRTPPKTQAALLEAMAEGQVSIDGETFPLPQPFIVLATDNPIEYEGTY
                     PLPEAQLDRFAMQLRLGYLSEKDETQMIRRRLERGAVEPQVGQVVDARGLIEMRQAVE
                     FVTVHPDVVTYVVSLAAATRGHPQVEVGASPRAELDLVQMARARALLLGRDYVIPEDV
                     KALAVPAMAHRITLRPEMWVRRIRGEDVISELLRRLPVPRATST"
     gene            533958..535232
                     /locus_tag="NONO_c04870"
     CDS             533958..535232
                     /locus_tag="NONO_c04870"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15300.1"
                     /translation="MRHRDTRSAAEVALRWRPAPLVYMLAVAAAVALALAVTMGRWQL
                     AVFAAPMLGVLATAPIQLSRTRVQVDGGGILRCFESEEVELEVAAFVEDGHALLRCRP
                     EEVSGLDVRVEEASDSGPAPAGLRLSLSTERWGRYPVTVRLTALSPAGLSQASASVPA
                     GEVYVYPVADPQRMRLPRTEFPERIGTHLTRRHGPGVEYADIRAYAPGDELRIVNWPV
                     SARRGRLYVTERFTNRAADVVVLVDTSLQAPGPATDAMELMVRGAAQVAQTALQAGDR
                     TAVVCLGRAPRWLRPDIGRRQFYRIIDTVLGVGDEHIPNVGTLAPHTAVPLGAIVVAF
                     STLLDTEFALALIDLRKRGHAVVVVDVLRGTPFADGLDPTLARMWQLERTAMYRDMGT
                     VGVDIISWPEGARLDQAMQLVPDHRRLVRVRR"
     gene            535229..535687
                     /locus_tag="NONO_c04880"
     CDS             535229..535687
                     /locus_tag="NONO_c04880"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15301.1"
                     /translation="MTRFLGVLSGLLLTAAVALVLPWAGIPVFVAVVAGWRLRTVAVG
                     AVLIALGALAWADTGALAAAGVGVVATTYLLNTATLHAPEGVVPTTLPSAIGALGFTG
                     TAVLATLIPGRLAWLPLLAPVLVILLYALIAQGLVVQRRVREPEETPQPT"
     gene            536418..536705
                     /locus_tag="NONO_c04890"
     CDS             536418..536705
                     /locus_tag="NONO_c04890"
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase
                     domain-containing protein"
                     /protein_id="AHH15302.1"
                     /translation="MVIVAGHLVVDPQQRESYLADCADVVEQARNAPGCEEFSISADL
                     IDTDRIVIFERWESRAAVEAFRGSGPSDAQNAAIRAASVAEYDVADTRPLT"
     gene            complement(536826..537689)
                     /locus_tag="NONO_c04900"
     CDS             complement(536826..537689)
                     /locus_tag="NONO_c04900"
                     /codon_start=1
                     /transl_table=11
                     /product="putative MaoC-like dehydratase"
                     /protein_id="AHH15303.1"
                     /translation="MPIDLKTALGAELPSQDFSWTPSDVQLYHLGLGAGERWTDAGEL
                     RYLDDTQPQVLPTFATVAPTMRITEPPKVSYPGVEIELAKVVHGSQEIIVHRPIPAEG
                     KATATGRVTELWDKGSAAVLTRELTITDSDGQALWTDRSSIFAKGEGGFGGERGPSNK
                     VELPARTPDFEVLTPTLPQQALLYRMCGDRNPLHSDPAFAHAAGFPNPILHGLCTYGL
                     VCKTATDTVLNSDASRVAGFRARFAGVLYPGETIRSRIWREGNELIIGATVVEREDAA
                     VLSDVRLTIAD"
     gene            complement(537838..539526)
                     /locus_tag="NONO_c04910"
     CDS             complement(537838..539526)
                     /locus_tag="NONO_c04910"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 3-oxosteroid 1-dehydrogenase KstD"
                     /protein_id="AHH15304.1"
                     /translation="MTDREYDVVVVGSGAAGMTAALAAAHHGLRAVLIEKAAHYGGST
                     ARSGGGVWIPGNKALKASGRPDDREEARRYLHSIIGDVVPKEKIDTYIDRGAEAFDFV
                     LDHSPLKMTWVPGYSDYHPEAPGGLGSGRSCEPKPFNLKVLGAEAAKLEPPYAKAPLN
                     VVVMQTDFVRLNLIKRHPKGMMRAMRVGARTYLAKFTGKQIVGMGQAIIAAMRKGLMD
                     ANVPVLLDTPLTKLITEDGRVVGVEATVDGEPTVFKARYGVVLGTGGFEHNAEMRTKY
                     QREPITTDWTTGAAANTGDGILAGMEVGADIGFMEDSWWGPTIFKGEGKPWFALAERN
                     LPGAIMVNADGKRFGNESAPYVEAVHTMYGGKWGQGDGPGENIPAWLVFDQRYRNRYI
                     YAGLQPGQRFPSRWMENDNIVKAGSIAELAEKLGVPAENLSNTITRFNAFAEKGVDED
                     FGRGKSHYDRYYGDPTVKPNPCLAALEQGPFYAAKIVPGDLGTKGGLVTDTAARVLRE
                     DGSVIDGLYASGNSSIPVMGHTYAGPGATIGPALTFGYLAVMDIVAKAKQSASE"
     gene            539679..540464
                     /locus_tag="NONO_c04920"
     CDS             539679..540464
                     /locus_tag="NONO_c04920"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 2-keto-4-pentenoate hydratase"
                     /protein_id="AHH15305.1"
                     /translation="MLSDAVRNELAAELAVAERDRSPIDPLVTRHPAIDVVDAYEIQL
                     LNIRQRLADGAKVVGHKVGLSSKAMQEMMGVDEPDYGHLLADMQVFEDVPVDTSKYLF
                     PRVEVEVGFVLGADLPGEECTEADVLAATVAYAPAIELIDTRIKNWNIALCDTIADNA
                     SSAGWVLGPERVAPDRLDIKAIDATLTRNGEVVAEGRSDAVLDDPTIAVAWLARKVAS
                     FGVRLKAGDIVLPGSCTRAIDARPGDDFHAEFAGLGSVRLKFS"
     gene            540475..541386
                     /locus_tag="NONO_c04930"
     CDS             540475..541386
                     /locus_tag="NONO_c04930"
                     /EC_number="1.2.1.10"
                     /codon_start=1
                     /transl_table=11
                     /product="acetaldehyde dehydrogenase"
                     /protein_id="AHH15306.1"
                     /translation="MTGNGKVTAAIVGSGNISTDLLYKLLRSERIEPRWMIGIDPDSE
                     GLKRARGLGLETSAEGADWLLALPEKPDMLFEATSAYVHREYAPKYEAAGIRAVDLTP
                     AAVGPAVVPPVNLGANIDTPNVNMITCGGQATIPIVAAVSRVVEVPYAEIVASVSSVS
                     AGPGTRANIDEFTKTTSKGVETIGGAKRGKAIIILNPAEPPMIMRDTIFAAIPEDADT
                     DAISESIHKMVADIQEYVPGYRLLNEPQFDEPSVVSGGMAKVSVFVEVEGAGDFLPPY
                     AGNLDIMTAAATRVGEVMAEQILTARV"
     gene            541400..542452
                     /locus_tag="NONO_c04940"
     CDS             541400..542452
                     /locus_tag="NONO_c04940"
                     /EC_number="4.1.3.39"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-2-oxovalerate aldolase"
                     /protein_id="AHH15307.1"
                     /translation="MNYVLQPFSQELDVRVTDTSLRDGSHHKRHQFTATEVRDIVAAV
                     DAAGVPVIEVTHGDGLGGSSFNYGFSKTPEQELITIAAQTAKQAEIAVLMLPGVGVKE
                     DIKISQDNGASIVRIATHCTEADVSIQHFGYARDLGLETVGFLMMSHSQPPEVLAKQA
                     RIMADAGCQCVYVVDSAGALVLDQVTDRIAAVVAELGDDAQVGFHGHENLDLAVANSI
                     YAVKAGAKQIDGSARRFGAGAGNTPVEAFIGVADKIGIKTGIDFFAIADAAEDVVRPV
                     MPQECLLDRQALMMGYAGVYSSFLKHAERQAERYGVSAAEMLVRAGKRKLVGGQEDQL
                     IDIALELQREQAGASA"
     gene            542696..543181
                     /locus_tag="NONO_c04950"
     CDS             542696..543181
                     /locus_tag="NONO_c04950"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15308.1"
                     /translation="MKIRTFIGVAAAAVAVACAGTGVASADPFVAANGPTAQNPADYL
                     VGDTVYFSAGYANCSMHPNGDVGCDISPGIANLWGIPITNLAIDLPFLPAHPTFGLTG
                     ALGRAGSRSIDSGPSSDGYDYGGTISYGGATCSGGGRGAISCTSKGHSFNFGWSGTNL
                     S"
     gene            543266..543901
                     /locus_tag="NONO_c04960"
     CDS             543266..543901
                     /locus_tag="NONO_c04960"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH15309.1"
                     /translation="MAALDAGGPRMTKRRAETRQRLLDAAFEAFAEEGFGRCTVEQIC
                     ERAGFTRGAFYSNFTSLEELFLDMWEARSAEMLRELTGVLESDGDVAVGDLRTGVERV
                     LRAVPLDDKWFRITAEFTAHALRNPPLRRVMVARENAIVAALLPVLEALLSRVGRRVT
                     DREGLGRAVVAVHDGTATQCLLEPGSTTAWDQRVTLFTQVAIAYSVGEDAA"
     gene            544037..544906
                     /locus_tag="NONO_c04970"
     CDS             544037..544906
                     /locus_tag="NONO_c04970"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase family protein"
                     /protein_id="AHH15310.1"
                     /translation="MSVAVEGVAGELIAVGRDRIHLCRGGDPGARAVVLIHGFGGSLH
                     WFERVASPLVAAGYQPIRIDLRGHGYTRPVDGRTTVADLGGPAQGRMVADLLDVLDLE
                     DVVVVGHSFGADVALATAHSARVGAVGIIDQAPDYSYAKFPSGNAALANPVLGPVLHR
                     LATPPFVRIGLRYAVAPGFDLCTAFADPDQAVIDYRMMNPAVAQAVVTERRRRLAADP
                     LDAQLARLALPAHVVHGTADRFYDWKPTAQRYRAAGARVDIIEGAGHSPNVERPEQVA
                     ELLGEFLRSTAAS"
     gene            545065..545472
                     /locus_tag="NONO_c04980"
     CDS             545065..545472
                     /locus_tag="NONO_c04980"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15311.1"
                     /translation="MTDRPALAKALDLQPHPEGGWFRETWRSGIEFEPAGYDGPRSCA
                     TAINFLLLPHERSAPHTVASDEIWLWQRGGPLLLNIGGEEVTLGPDVEGGQLLQAVVP
                     AGVSQAARPAGDEYVLVSCVVAPGFDFADFRLD"
     gene            complement(545654..545971)
                     /locus_tag="NONO_c04990"
     CDS             complement(545654..545971)
                     /locus_tag="NONO_c04990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15312.1"
                     /translation="MVAWAKAPDFADRPERRDQVRAQTVVDKQRYLEDGLTPVACHSC
                     GVEVLVRKSSSHQRSMQWTESPAQRCPVFAKLAGPGKPDPCPALEKSIQYAIDEGILT
                     VDE"
     gene            complement(545971..547191)
                     /locus_tag="NONO_c05000"
     CDS             complement(545971..547191)
                     /locus_tag="NONO_c05000"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 3-ketosteroid-9-alpha-monooxygenase
                     oxygenase subunit KshA"
                     /protein_id="AHH15313.1"
                     /translation="MAETAQRGSKVREIDVGSTPTRYARGWHCLGLTETFRDGKPHAV
                     QAFGTKLVVWANSDNELKVLDAYCRHLGGDLSMGEVKGDSIACPFHDWRWGGNGRCTS
                     IPYARRVPPLARTRAWTTLERNGQLFVWHDHEGNPPPDEVTIPYIEGPYTDAEGGPSE
                     ELNSGWTPWTWNTMLIEGANCREIVDNVVDMAHFFYIHFAFPTYFKNVFEGHVATQFL
                     ETKGRPDIGMAAKYGGETLLKSEASYFGPSYMINPLTNLYGGYEIKVQLINCHYPVTQ
                     DSFVLQYGLSVEIPKGIDNDTAMKLANSMADFFGDGFLQDVEIWKHKSKIDNPLLCEE
                     DGPVYQLRRWYDQFYVDVDDIDPKMVQRFEFEVDTTKANEHWEAEVAENLRRKAEEEE
                     AAKNDAAVKQEAGA"
     gene            547416..548585
                     /gene="hsaA"
                     /locus_tag="NONO_c05010"
     CDS             547416..548585
                     /gene="hsaA"
                     /locus_tag="NONO_c05010"
                     /EC_number="1.14.14.12"
                     /codon_start=1
                     /transl_table=11
                     /product="flavin-dependent monooxygenase, oxygenase
                     subunit"
                     /protein_id="AHH15314.1"
                     /translation="MTQEVTERVEALLPKLREQAQEAEDLRRIPDETMKALQETGFFK
                     LLQPRQWGGYAADPVVFYDTVRKIASACGSTGWVSGIIGVHNWHLALFSQQTQEEVWG
                     EDSQVRISSSYAPMGAGVVTESGDGYIVNGSWAWSSGSDHATWTFVGGPVIKDGKPVD
                     FGSFLVPRTDYRIDDVWNVVGLKGTGSNTLVLENVFVPRHRFLSYKAMNDLTAPGLRE
                     NTDPVYKMPWGTIHPTTISTPIVGMAYGALEAHVEHQGKRLRAAYAGEKAKDDPFAKV
                     RIAEAASDIDAAWRQLSGNVADEYKLLVAGEEIPFDLRVAARRDQVRATGRAIASIDK
                     MFESSGATALANGTPLQRFWRDAHAGRVHAANDPERAYTMYGTHAFGMPVTDGMV"
     gene            548586..549476
                     /gene="hsaD"
                     /locus_tag="NONO_c05020"
     CDS             548586..549476
                     /gene="hsaD"
                     /locus_tag="NONO_c05020"
                     /EC_number="3.7.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="4,5:9,10-diseco-3-hydroxy-5,9,
                     17-trioxoandrosta-1(10),2-diene-4-oate hydrolase"
                     /protein_id="AHH15315.1"
                     /translation="MTTVSTDSALTYESTSKFAQVRPDLKLHYHEAGVGNGPTIVLLH
                     GGGPGASSWSNFSKNIPVLARDFHVLAVDQPGFGQSDKPVDHPQYFVHSSSALKDLLD
                     TLEITDRVHLLGNSLGGGAAVRFALDYPDRAGKLVLMGPGGLSTNLFAPDPTEGVKAL
                     GKFNVEPTRDNLEKFLRIMVFDQSLITPELLDERFASANTPESLAATRAMGKSFAGAD
                     FEKGMLWRDAYKLRQPVLLIWGREDRVNPLDGALVALKSIPRAQLHVFGGCGHWAQLE
                     KFDEFNRLATDFISGVKERE"
     gene            549473..550372
                     /gene="hsaC1"
                     /locus_tag="NONO_c05030"
     CDS             549473..550372
                     /gene="hsaC1"
                     /locus_tag="NONO_c05030"
                     /EC_number="1.13.11.-"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-dependent extradiol dioxygenase"
                     /protein_id="AHH15316.1"
                     /translation="MSIRALGYMRIEATDMAAWREYGLKVLGMMEGEGPNPDALYLRM
                     DDFPARLVIVPGEQDRLQVSGWEVTDAPALQQLRETLTKADVAFEEGAKDELAERRVE
                     GMIRFHDPAGNTLEAFYGAQYLARRFVSPYGHKFVTAEQGLGHVVLTCNDDAAAQEFY
                     QGVLGFRLRDSMRLPPQIVGRPADGDPAWLRFYGCNPRHHALAFLPLPNPTGIVHLMV
                     EVENSDDVGLCLDRAIRKKVKMSATLGRHINDKMLSFYMKTPGGFDIEFGCEGLEVDD
                     HDWIARESTAVSLWGHDFSVGFK"
     gene            550391..550984
                     /gene="hsaB"
                     /locus_tag="NONO_c05040"
     CDS             550391..550984
                     /gene="hsaB"
                     /locus_tag="NONO_c05040"
                     /EC_number="1.5.1.36"
                     /codon_start=1
                     /transl_table=11
                     /product="flavin-dependent monooxygenase, reductase
                     subunit"
                     /protein_id="AHH15317.1"
                     /translation="MTTTGEHPEIDGRQFRNVLGQFCTGITVITTFGPPEDGTAAAPI
                     GFACQSFAALSLDPPLVLFCPTKGSRSWAAIEQSGRFAVNVLAEEQQPVCARFGSREP
                     DKFAGIDWRTSELGLPVLDDALATIQCTVDSVVDGGDHYIVIGRVLALSESTDSGRPL
                     LFYRGQYTAIEPEKTTPAPWRADLEHFLTTTTLDTWL"
     gene            551150..552466
                     /locus_tag="NONO_c05050"
     CDS             551150..552466
                     /locus_tag="NONO_c05050"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipase"
                     /protein_id="AHH15318.1"
                     /translation="MKRGRIVLQVATAAAAISLVFGAGAGYAPDAHAASDSFYTYSGS
                     APLDSIAPGTVLQTRTIPYHMVGIPLPITAVQLQYRTNDAQERPTANITTVLLPPGGV
                     DPAKAVAYQSYYDSLNPEDGPSRSAAGVVSLGDSVLSAESPQIVPLLAQGYTVIIADT
                     EGQTADFAAGPEYGMATLDSIRAATHSPEVGLNEQTRIALMGYSGGAIATNWAAALAP
                     AYAPEVNSQLVGAAEGGLLVNPARNLKYLDGSFGWAGVAAMAIIGVGRSYGIDFSPYL
                     NDYGQQIVNRMDQVSIANVLFQYPGLTWPQLVKPQYADPRDVPPFVEAVRKVNLGRAA
                     TPTIPMFIGQGANGVLEGTDGSKPSIGAGDGVMIAGDVRGLANQYCADGATVQYTQYD
                     ALSHIPSLLLTWTPQALQWINERFAGVPAADTCGAIAPGNSLIPEM"
     gene            complement(552627..553880)
                     /locus_tag="NONO_c05060"
     CDS             complement(552627..553880)
                     /locus_tag="NONO_c05060"
                     /codon_start=1
                     /transl_table=11
                     /product="putative multidrug transporter, MFS family"
                     /protein_id="AHH15319.1"
                     /translation="MSSTLASPVVSEATTTTKTKQPKSVWAVAFASVIAFMGIGLVDP
                     ILKPIGEQLHASPSQVTLLFTSYMLVTGVAMLITGVVSSRFGAKKTLLAGLAIIVVFA
                     ALAGCSGTVGQIVGFRAGWGLGNALFIATALATIVGAATGGVARAIILYEAALGIGIA
                     AGPLVGGFLGGFSWRAPFFGVAVLMAIAFIAIIVMLPEMPKPAQHTSITAPFKALRHR
                     GLLLVSITALLYNYGFFTLLAYTPFPLNMGTYSIGFIFFGWGLLLALASVFFAPRLQR
                     MFGTVPMIAVALGLFAADLAVMAIWADQKPVLVVGTVLAGLFLGVNNTLITEAVMISA
                     PVERSTASAAYSFVRFVGGAAAPYLAGKLGEHQMALPFWVGAACTALGVVILLAGRSV
                     LAHVDDHDPAAHSEAEAEAITVGDD"
     gene            complement(553873..554310)
                     /locus_tag="NONO_c05070"
     CDS             complement(553873..554310)
                     /locus_tag="NONO_c05070"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, MarR family"
                     /protein_id="AHH15320.1"
                     /translation="MVDIAVTAARLTRLAGTLGTNALPRALVRALSTLEEHGPLRISE
                     FAHLDGCSQPSATALIGRLTSAGYVARTKDPDDSRAVVVELTPTGRAELHASRRAFGT
                     TLAARLPDFDIDRLSHLESELTDLLEALKSAAPHKVSIRSVDE"
     gene            complement(554552..555640)
                     /locus_tag="NONO_c05080"
     CDS             complement(554552..555640)
                     /locus_tag="NONO_c05080"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="AHH15321.1"
                     /translation="MTDIAELRELASSVRAALTKHGDSAALRRAIYSESGYDERLWTL
                     LCEQIGVAALAIPEEFGGVGADLDTALVVVEELGRTLHNPPMLGSAVLGVQAVLASGD
                     DAAAGRLLPEVAEGSRTLAVCWADEKGWAATGAGSQRAAGFGVRADGDTLSGTAHYVL
                     DGASADTLLVVTDSGLYEIDATATGVTRTLTRTMDPTRRLSTVTFDGAKAARLSDDPT
                     AITSRLRAVAWAALAAEQVGAAEQCLESTVEYSKSRVQFGRPIGSFQALKHRMADMYV
                     LVESARSAAYAAIADLDRPVTGETTLDLESARIHCSQTFRSVVSEMVQMHGGIAITWE
                     HDAHLYFKRAHGDAELFGMPARPLARPA"
     gene            complement(555681..556682)
                     /locus_tag="NONO_c05090"
     CDS             complement(555681..556682)
                     /locus_tag="NONO_c05090"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="AHH15322.1"
                     /translation="MRFALSSEQRDFAGSLRKMCDAASTPAAIRAWGDGDSGAGRALI
                     RQLAGAGALGLAIAEEFDGMGAETIDLVVAAQEFGRAAVPGPLVETAAVIPALLQALD
                     DSGPAQRWLPGFAEGGALGTIALSPQTPAVDADSADVVLLVDGDRLYTATPGDRIESV
                     DAARRLYSVSADELVAQGDSVRAAAATAFDAGALAVAAQLLGAGKAMLDTSVAYVIQR
                     QQFGQPIGRYQAIKHHLADAKIGLDMAEPLLNRAALTFGTADRARDVSAAKIACADAA
                     YRTARIALQVHGAIGYTAECDLSLWITKATALRSAWGTADFHRARVAAALRSPGGEA"
     gene            complement(556729..557859)
                     /locus_tag="NONO_c05100"
     CDS             complement(556729..557859)
                     /locus_tag="NONO_c05100"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="AHH15323.1"
                     /translation="MDLELDSAAAQFQLEVREFLRAAVPAEPLPSMDTREGFEAHRAW
                     EHTLAEARLSVVSWQQEYGGRDASLLEWVLFEEEYYAAGAPGRVSQNGIFLLAPTLFE
                     HGTPEQLERILPRMARADDIWAQAWSEPEAGSDLAGIRSSAKRTEGGWILNGQKTWSS
                     RASFADWAFGLFRSDPEAERHKGLTYVMFPLTAEGVTVRPIPQLDGEPGFAEIFLDNV
                     FVPDRDVIGEPGAGWRVAMSTSSNERGLSLRSPGRFNATAARLIDLWRETADPADTAA
                     RNRVVDAWIGAEAYRLNTLGTVTRLSEGGKLGAESSINKVFWSELDIAMHETALDLLG
                     AAAEQTSAWTDGYLFSLAGPIYAGTNEIQRNIVAERLLGLPR"
     gene            complement(557860..558747)
                     /locus_tag="NONO_c05110"
     CDS             complement(557860..558747)
                     /locus_tag="NONO_c05110"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase/isomerase family protein"
                     /protein_id="AHH15324.1"
                     /translation="MTTPAAGPIPDEGEVVTYERRGPVAVVTMNRPDYRNAQNSVMTY
                     ALDAAFTRAVEDAEVKVIVLAGNGEHFSAGHDIGTPGRDHHVSYDNKAALWWDHVDRP
                     GGDQRFARELEVYLGMCRRWRELPKPTIAMVQGACIAGAMMLAWVCDMIVAADDAFFS
                     DPVVRMGIPGVEYFAHPWVLGPRRAKEVLFTGDRFSAELAYEWGMVNRVVPRAELESH
                     TLELAGKIATMPQFGLALTKKAVNQCEDLMGMRAGIDSVFGLHHFAHAHNAEVGADSL
                     GGMNAKSMKATATTAEQAR"
     gene            complement(558744..560294)
                     /locus_tag="NONO_c05120"
     CDS             complement(558744..560294)
                     /locus_tag="NONO_c05120"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fatty-acid--CoA ligase"
                     /protein_id="AHH15325.1"
                     /translation="MTTLVQTTPLALHEAARIHGDAPALSDGETHLSWVQLLDEVRQT
                     AGALLARGIERGDRIALWAPNTWHWVVAALASHYVGAAIVPLNTRYVADEAADVIGRV
                     DAKALFIADPFLGRQRLAELRAAATGLVIDTVIVIPAEGEATHYDDAIAWSALPELAA
                     TVPADQVVNRAESVQPEDISDILFTSGTTGRSKGTMVAHRQALDVVRGWTERSTLDSS
                     DRYLVIPPFFHNFGYKAAILACLVTGATIVPQATFDVPQTMRMVQEQAITVLTGPPTI
                     YQTILEHPARADFDLSSLRVAVTGAATVPVVLVERMRGELRFEVVVTAYGLSESSGFG
                     TMCLPDDDPETIANTSGKAMAGFEVRIGDHGEVLLRGPNVMVGYLDDPESTAKTIDPE
                     GWLHTGDVGILDERGYLKITDRLKDMYISGGFNVYPAEIEQTLARLDGVAESAVIGVP
                     DERMGEVGKVYIVRRSGAAIEADDVIAYAKQTLANFKVPRFVEFRDQLPYSAAGKVLK
                     RQLREEKS"
     gene            560434..561687
                     /locus_tag="NONO_c05130"
     CDS             560434..561687
                     /locus_tag="NONO_c05130"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="AHH15326.1"
                     /translation="MSAIQTPDSATGADTSADREFRAEVREWLAENLNGQFRELRGLG
                     GPGSEHEAFDERLEWDRHLAAAGLTCLGWPVEYGGRAATLRQQVIFHEEYAGADAPAR
                     VSHLGEELLGPTLLAFGTEEQKQRFLPGIRSVTELWCQGYSEPGAGSDLANVSTTARL
                     DGDEWSINGQKIWTSLAHLSDWCFVIARTEPGSTRHHGLSYLLVPMKQPGIEVRPIIQ
                     LTGTAEFNEVFFDDARTAADLVVGKPGEGWGVAMGTLTFERGISTVGQQIRFARELSN
                     LEAVAKANGALDDPALVERIDQAWVGLRVLRAHALRTLESAHQHVDARTAAGQASVSK
                     LLWANWHRGLGELAMDVLGAEGLIARNPVGGTDSALDPHPADDLGLWQRLYLFTRADT
                     IYGGSNEVQRNIISERVLGLPREAR"
     gene            561743..562537
                     /locus_tag="NONO_c05140"
     CDS             561743..562537
                     /locus_tag="NONO_c05140"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, SDR family"
                     /protein_id="AHH15327.1"
                     /translation="MPDLSVPPQPVTGHGLLTGRTAVITAAAGTGIGSATARRLLSEG
                     SDVVVSDWHERRLKQTEEELAAEFPDRKVASVVCDVTSTEQVDELIRVAAERLGRIDI
                     MVNNAGLGGETPVVDMTDEQWDRVLDITLNGTFRCTRAVLNYFRGAGHGGVIVNNASV
                     LGWRAQHGQAHYAAAKAGVMALTRCSAVEAAELGVRINAVAPSIARHPFLDKVSSTEL
                     LDRLAAGEAFGRAAEPWEVAATIAMLASDYTTYLTGEVVSISSQRA"
     gene            complement(562777..563169)
                     /locus_tag="NONO_c05150"
     CDS             complement(562777..563169)
                     /locus_tag="NONO_c05150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15328.1"
                     /translation="MGFSEDGVTGERSHPAGPDVWVAVLWGAVVTICWAPVAAAVVAS
                     VYRFPIPFDGYARGASDALSAALASVFYLVVGGAFPLALAGALAGFLLARGRGRARRL
                     TLIAATGFATACAAALLLALLEYAIGPW"
     gene            563357..564085
                     /locus_tag="NONO_c05160"
     CDS             563357..564085
                     /locus_tag="NONO_c05160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15329.1"
                     /translation="MGLDGPQEDNELLELELIRQVVLARRRQDGVVLAALTLGAELLD
                     HAGEIASRAAQILRAHQVDESEIARDPRAALRADIARDVRRARRIGVGCEPGASDPAR
                     EHRRQQTALLCEVRADLLEVLRHCRRFRFDRIAFAEGIDRGLSAATGKLEGAADRDTY
                     LAWQRGIVLKLSEIPEPGGPPRVLATVDAGPGRGPLQVEWDSCERRLALVTRMKRAGI
                     PPLEICDRLLTDLSMSSPLRYSIR"
     gene            564112..564768
                     /locus_tag="NONO_c05170"
     CDS             564112..564768
                     /locus_tag="NONO_c05170"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH15330.1"
                     /translation="MDQANAWLYYGRVTASEASKSARRNELLGLAAGLFAERGLRATT
                     VRDIADAAGILSGSLYHHFDSKEAMVDEILRGFLDDLFGRYREIVAATLSPRATLEAL
                     VIASCESFDRWHSAVAIYQAEAKRLSQTPRFEYIAEYNREFRELWRNVLTEGVRDGSF
                     RPELDVELAFRFLRDTVWVAVRWYSPGGRITADILAKQYLTIVLDGLTNPETRSETKQ
                     "
     gene            564778..565965
                     /locus_tag="NONO_c05180"
     CDS             564778..565965
                     /locus_tag="NONO_c05180"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 3-ketoacyl-CoA thiolase"
                     /protein_id="AHH15331.1"
                     /translation="MSTSSDRRQYAPVREAYVIDAVRTPIGKRGGALAGVHPADLGAA
                     ALRGLLSRNDIDPGKVDDVIFGCVDAIGPQAGNIARTAWLAAGYPEEVPGTTVDRQCG
                     SSQQAINFGAQAIMSGTAEVIVAGGVQNMSAIPISAAMLAGKEYGFDSPFVGSTGWDH
                     RYGTGEVSQFNGAQMIAEKWDISREDMERWALRSHERARKAIAEGSFDREIVPVGDFW
                     IDEGPRETSLEKMAGLKPLTEGSRLTAAVASQISDGASATLLASDWAVAEYGLKPRAR
                     IHHVSARGADPIYMLTAPIPATKWALEKTGLTIDDMDVIEINEAFAPVVLAWLKETGA
                     NPDKVNVHGGAIALGHPLGATGAKLFATLLNELERVNGRYGLLTICEGGGTANATIIE
                     RIA"
     gene            complement(566245..567561)
                     /locus_tag="NONO_c05190"
     CDS             complement(566245..567561)
                     /locus_tag="NONO_c05190"
                     /codon_start=1
                     /transl_table=11
                     /product="lipase"
                     /protein_id="AHH15332.1"
                     /translation="MRRRLAVLQIATAATVVSLLFGSATGLAPSAHAASDSFYEYTGS
                     APLDSVAPGTVLRTRTMPYHFAGIPTPITAVQLQYRTTDAQQRPTVNITSVLLPPMGV
                     DPTKAIAYQSFYDSLNPEDGPSRAVAGNVSFGGSVNITEGQLVTPLLAQGYTVIVADT
                     EGRTADFAAGPEYGMNTLDSIRAATHAAETGLNEQTRIGLIGYSGGAIATNWAAALAP
                     VYAPEVDRQLVGAAEGGVLVNPARNLRYIDGSLGWAGVAAMAIIGVGRSYDIDFSPYL
                     SPLGTEITNRMRYASIANVLLQYPGLTWAQMVKPEYADPNSVTPFVDAVRKVDLGLAP
                     TPTVPMFIGQGANGILEGTAGDKPIAGPGDGVMVAGDVRTLARQYCDTGNPSVLYRQY
                     DLLSHTPSMVAWLPEALPWINDRFANRPAPSNCGAIAPGNPLDPVL"
     gene            567848..568393
                     /locus_tag="NONO_c05200"
     CDS             567848..568393
                     /locus_tag="NONO_c05200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15333.1"
                     /translation="MDPRRIELNRRHSIELGRLFDQFCRDHPGNEFGFGADTPDSERD
                     GKLWDAYSAEMLARQQAERSQLADRLEAEQRGESQLTVSGAEEAVARVVAMIETRGID
                     YPTDSLTAERFETGWSVFAPVEVDDSDPMAFLDIPVGRSIFLVGDSGRIVEVSSSIPP
                     QQARALFNEEERANEARRDPE"
     gene            complement(568416..569801)
                     /locus_tag="NONO_c05210"
     CDS             complement(568416..569801)
                     /locus_tag="NONO_c05210"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aminoglycoside phosphotransferase"
                     /protein_id="AHH15334.1"
                     /translation="MDVMPESAAGQPLSLEAGVGRILGGAIGKTVADISLRQFTGGAS
                     RQVYAVEARDEAGEPVRAVLRRDPPGQGDAQRMRAEAVCLRAAAAAGVPVPEVFAAAD
                     TAPGIDAPYLLMERVEGESIPRKLQRDPEFEQMRPGLADELGHVLGLIHRTPLDTLDI
                     LDDHDPLTTIEQIYRDLDDPRPVVEAGLRWLRENSPEDHPKALVHGDFRLGNFLIAPD
                     GLRAVLDWELAHVGNPIEDLGWLCVRAWRFGADAPVGGLGTREQLVDGYERATGYRPS
                     TTELHWWEVFGTLKWLVLSRFQAERHFSGTERSLELAAIGRRVCESEYDLLDVLGLLE
                     TSAAIPASAEPVATVHDRPSPTEILELVAATLGADIGAASTPEQGRSRYLLRVCANLL
                     GIAARELSAGPAAGDAVRSSLGALGCDSERELAERLRAGTLSCLEDSVRQAMSTAVRA
                     RLLVANPRYVR"
     gene            complement(570187..571275)
                     /locus_tag="NONO_c05220"
     CDS             complement(570187..571275)
                     /locus_tag="NONO_c05220"
                     /codon_start=1
                     /transl_table=11
                     /product="putative nitronate monooxygenase"
                     /protein_id="AHH15335.1"
                     /translation="MTVRLRTPLTELAGIEHPIVQTGMGWVAGPGLVAATANAGGLGI
                     LASATMTLEELEVAIAKTKAKTDKPFGVNIRADLSDAPDRIELMIREGVKVASFALAP
                     KKELIARLKDNGVVVMPSIGAAKHAVKVASWGADAVIVQGGEGGGHTGSVATTLLLPS
                     VLDAVDIPVVAGGGFFDGRGLAAALSYGAAGVAMGTRFLLTQDSSVPDSVKQQYLSRG
                     LQDTVVSLKVDGMPHRVLNTELVDKLEHSGSYRGLAAAVSNAVKFKGMTGMKWSTMIK
                     DGIAMRKQKDLTWSQVIMAANTPMLLKAGLVEGNTHAGVLASGQVAGIIEDLPTVAEL
                     IDRIIDDAVARIDALAALRDGADSGTSA"
     gene            complement(571272..572030)
                     /locus_tag="NONO_c05230"
     CDS             complement(571272..572030)
                     /locus_tag="NONO_c05230"
                     /codon_start=1
                     /transl_table=11
                     /product="putative CoA-transferase beta subunit"
                     /protein_id="AHH15336.1"
                     /translation="MSDTTTITRAEVCAVACAEIFRGAGEIMASPMSPTPTIGARLAR
                     LTFEPDLLLSDGEALFLAETPALGAKAPTEGWIPFGKVFDVVASGRRHVVMGANQIDR
                     FGNQNLSAFGALQQPSRQMFGVRGAPGNTINHATSYFVPKHSKRVFCDQVDIVCGIGY
                     DKIDPENPAYRFHHLHRVVSNLGVFDFGGPDHTMRALSLHPGVSAADVAENTSFEIAG
                     LDSAEVTRTPTEEELRIIRTVLDPKGIRDKEVAA"
     gene            complement(572051..572932)
                     /locus_tag="NONO_c05240"
     CDS             complement(572051..572932)
                     /locus_tag="NONO_c05240"
                     /codon_start=1
                     /transl_table=11
                     /product="putative CoA-transferase alpha subunit"
                     /protein_id="AHH15337.1"
                     /translation="MRDKRISLEEAVSQLRSGMTIGLGGWGSRRKPMAFVRALLRTDV
                     TDLTVVTYGGPDLGLLCSAGKVRKAYYGFVSLDSAPFYDPWFAKARTGGELVAREMDE
                     GMVKSGLQAAAARLPFLPTRAGLGSDVLTFWDGELRTVQSPYPDADGRTETLVAMPAL
                     NLDAAFVHLDLGDKHGNAAYTGVDPYMDDLFCLSAERRFLSVDRVVETDELVKAVPQQ
                     AIVLNRMMVDGVVEAPGGAHFTLSGSHGRDEKFQRHYVEAAKDHETWAAFKARYLDVS
                     EAEYQSAVGEFAAEQAK"
     gene            complement(572932..573696)
                     /locus_tag="NONO_c05250"
     CDS             complement(572932..573696)
                     /locus_tag="NONO_c05250"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase/isomerase family protein"
                     /protein_id="AHH15338.1"
                     /translation="MGINRHTETSGIEVVTIDYPPVNALPTAGWFGVADALREAGRDP
                     ETKVVVLRAEGRGFNAGVDIKEIQRNPGHQTLIDANHGCFDAFAAVYDCPVPVIAAVN
                     GFCLGGGIGLVGNADVIVASDDATFGLPEVERGALGAATHLARLVPQHMMRTLFYTAS
                     TVTAQQLHHFGSVHKVVPRAELDSAALEVAKNIAAKDGRVIRAAKRALNGIDVQDVHR
                     SYRYEQGFTFELNLAGVADEIRARFDEDLAAKKGTK"
     gene            573747..574517
                     /locus_tag="NONO_c05260"
     CDS             573747..574517
                     /locus_tag="NONO_c05260"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase, SDR family"
                     /protein_id="AHH15339.1"
                     /translation="MAIEVDLSGSVVLVTGGVRGVGAGISRVYLDAGATVVVCARRPG
                     EAPIESSGRTAEFLPCDVRDGDAVNGLVDEIVRRHGRLDHVVNNAGGAPFAPTATASR
                     NFNAKIVELNLLAPLLVSQAANAVMQKQERGGSIVMISSVSGHRPSPGTAAYGAAKAG
                     VDSLVSSLAVEWAPKVRINSIIVGMVGTESSHLHYGDDEGIAAVEATVPLGRLATPED
                     IGRVAVFLSSPLAGYVNGGSLIVHGGGERPAFLDAANA"
     gene            574552..575469
                     /locus_tag="NONO_c05270"
     CDS             574552..575469
                     /locus_tag="NONO_c05270"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase, SDR family"
                     /protein_id="AHH15340.1"
                     /translation="MTDNPEKICAGRTVIVTGAGRGIGRAHALAFAAAGANVVVNDLG
                     AELDGAPSADSPAAQVAEEIVAGGGKAVVNGDDIADWAGAERLIDQAVATFGGLDVVV
                     NNAGIVRDRMLVNLAEDEWDAVIRVHLKGHFATMRHAAAYWRAESKAGRTRDARIINT
                     SSGAGLQGSVGQGNYGAAKAGIAALTITAAAEFGRYGVTVNAIAPSARTRMTETVFAD
                     MMARPDDGFDAMAPENISPIVVWLGSPDSAGVTGRMFEVEGGKIALADGWRHGVPEDR
                     GARWEPSELGPVVRELIAKSVAPEPVYGA"
     gene            575796..577241
                     /locus_tag="NONO_c05280"
     CDS             575796..577241
                     /locus_tag="NONO_c05280"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AHH15341.1"
                     /translation="MTMGRIARVIAVAGIVGSCGVLGPFVANAQSPAPANPTTPQIHP
                     DPAPSLPDPLGTGSAQQLPETAQPGADRAPELTRPGPGGIQAPGATQPDTGAGVTQDG
                     TGAAQHGPGVTRQGPGASQQEPATPQPGDTTQQGPVARTPGTGSTGPIPSDDSDYDGT
                     LMIPGRSATSAAPDPTEVSGPAGPPVAPTPVAGEGFAGLLTILGTGSAAAGSAAAASG
                     SALTGSALAGVGTALAGTGSAAAGSVGATTGSALAGTGSAAAATGSAAAATGSAAAAA
                     TGSALAGTGSALAGLTGLGAAATGSALAGLAGTGSAATAATLAALLGTGSAITGSAAV
                     GSAAAMSPLLLLLLLQPPPAAPAAPPPAVAPPAPPAPAAPAAPGAPAVVAAPPAPAAA
                     PPAAPAPAPPTAPAPPAASAPPAVAAPNPAVRPTAASSGLPEVKTLAVLGGVIAMALA
                     AAGSGAVSFQSASAAQARVDAARAEFFGPRA"
     gene            577253..577765
                     /locus_tag="NONO_c05290"
     CDS             577253..577765
                     /locus_tag="NONO_c05290"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15342.1"
                     /translation="MTESRIQTGRSYRRVAAAVDAVCAVAADFDATTLDEVVLAVAAE
                     RGRMIEIADAQLGPGVCGQRRSYPDKDVIVLATALPSRDHTLAHELGHVVFDHPGEPA
                     AEVTLEASDDLIAYMLSQRAHQQIVDDGQDEQYEWEAETFASMLMTRLRVFNNRGAGV
                     SVLRFDEALG"
     gene            577787..578815
                     /locus_tag="NONO_c05300"
     CDS             577787..578815
                     /locus_tag="NONO_c05300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15343.1"
                     /translation="MTFWLTALLVWMAAGARIGRVLVKPATTARVAVVIAVAAVAAAA
                     TLGIPEIGVAVDHLLPHGINGEALADRLVVATWLLFTVATSVVAAAAWPVVSRRNLRQ
                     IAWLVYALGAAVIAVTIAWSLLFGWVMTLIGCVFIAVTGLRNLDWTALGRGIALYTTG
                     TIVAGILAALSIRRLAIGDHPVRAGDPGWYWPTWQIASLLIAVGAVWIVIELWLRARL
                     LLRQIRSLHRTMIKRFPEVLAHEQTVSATQLKASDQVAQIMDALYLQTGGGMELAAAG
                     DPAPSVSERAGKVARWARNPLGDDIVDARWIAPPEGLSPRGWVQAIARAFDSTTTSDR
                     KPAAAQAD"
     gene            complement(578958..579374)
                     /locus_tag="NONO_c05310"
     CDS             complement(578958..579374)
                     /locus_tag="NONO_c05310"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional repressor"
                     /protein_id="AHH15344.1"
                     /translation="MADFAARLNKLFETVHPPGRKPHTNAEVAAALTASGHPISKPYL
                     SQLRSGQRTNPSDETVAALAKFFKVKPDYFFNDIYAAKIDHDLELLSQLQGYGLRRLS
                     SRAFDLSEESQNLLTSMAEKLRASEGLPEVPPDGTE"
     gene            complement(579733..580899)
                     /locus_tag="NONO_c05320"
     CDS             complement(579733..580899)
                     /locus_tag="NONO_c05320"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="AHH15345.1"
                     /translation="MGTPVIVEAARTPIGKRNGWLAGLHAAEVLGAAQRGVLERAQLD
                     PALVEQVIGGCVMQVGEQGNNVTRTAWLHAGLPWQVGATTVDCQCGSAQQANHLIAGQ
                     IAQGAIDIGVACGVESMSHVPLGANVGENAGPRRPASWDIDMPNQFEAAERIAKRRGI
                     TRDDIDEFGVRSQRLAAQAWAEGRFDREVLTVTGAPQVDKEGNLTGEKLDVNRDQGLR
                     ETSRESLAKLKPVLEGGIHTAGTSSQISDGAAAVLLMDEQAAARADLRPRARIITQCL
                     VGAEPEFHLDGPVQATTRLLERSGMSISDIDLFEINEAFAAVPLSWASVHKPDMDKVN
                     VNGGAIAIGHPVGSTGSRLITTALHELERSDKSVAMILMCAGGALATGTIIERL"
     gene            581053..582297
                     /locus_tag="NONO_c05330"
     CDS             581053..582297
                     /locus_tag="NONO_c05330"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytochrome P450"
                     /protein_id="AHH15346.1"
                     /translation="MVDARVAPNLPEGFDATDPDMWARGIPAEEFAELRRAAPIWWNP
                     QSPEVGGFHDDGFWVVSKHADVKEVSRRDDFSTYENTAIPRFNDDIPREAIELQRHIL
                     INKDAPEHTKLRKLISKGFTPRAINGLRAELSARAKSIVDAAAASGTGDFVTQVACEL
                     PLQAIAELIGVPQEDRMKVFQWSNEMTGYDDPESDADPAMSSMEILGYAWQMAEARKA
                     APADDIVTTLVNADIDGEALTSEEFGFFVILLAVAGNETTRNAITHGMHAFLENPEQW
                     ELYKRERPATAADEIIRWATPVSSFQRTALADTELGGVQIKKGQRVLLMYRSANFDEE
                     VFENPYTFDITRDPNPHLSFGGTGAHFCIGANLARLEIDLIFNAIADHLPDITKIGDP
                     KRLTSGWLNGIKEFQVDYKTGA"
     gene            complement(582405..582824)
                     /locus_tag="NONO_c05340"
     CDS             complement(582405..582824)
                     /locus_tag="NONO_c05340"
                     /codon_start=1
                     /transl_table=11
                     /product="SnoaL-like domain-containing protein"
                     /protein_id="AHH15347.1"
                     /translation="MTTTTTEHPARIAGHASQSAVRARDKDAWLALFAADGIVEDPIG
                     PSVFDPDGVGHRGHEAISAFWDKAIAPTESIEFVFGDSFACGNEVAFTGLIRTRLGGH
                     VIDAEGVFTYKVDDAGKILALRAFWETDRAMGTMRKE"
     gene            complement(582929..584095)
                     /locus_tag="NONO_c05350"
     CDS             complement(582929..584095)
                     /locus_tag="NONO_c05350"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acetyl-CoA acetyltransferase"
                     /protein_id="AHH15348.1"
                     /translation="MTNQAAVLGTGQTHHVTKRSDVSMSGLCREAIDRALEDAGLTMK
                     DIDAVVVGKAPDLFEGSMMPELFMADALGATGKPLLRVHTAGSVGGSTGIVATNHVQA
                     GVYRRVLAICWEKQSESNAMWALSNPVPFTAPVGAGAGGYFAPHVRAYIRRANAPLHI
                     GAMVAVKDRRNGAKNPFAHLHQPDITMESVLASQMLWDPIRFDETCPSSDGACAIVIG
                     DEESAKATEASGKKVAWIHATAMRTEPLAYSGRDQVNPQAGRDAAAALWKQAGITNPI
                     EEIDAAEIYVPFSWFEPMWLENLGFAAEGEGWKLTDARETEIGGKLPVNPSGGVLSSN
                     PIGASGMIRFAEAAKQVMERAGDYQVEGARKAFGHAYGGGSQYFSMWVVGSEPR"
     gene            complement(584092..585126)
                     /locus_tag="NONO_c05360"
     CDS             complement(584092..585126)
                     /locus_tag="NONO_c05360"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acetyl-CoA acetyltransferase"
                     /protein_id="AHH15349.1"
                     /translation="MSDNATDIAVVGFAHAPHVRETYGTTNGVEMLVPCFQQLYDKLG
                     IGVSDIGFWCSGSSDYLAGRAFSFISAIDSIGAVPPINESHVEMDAAWALYEAWVKLR
                     SGQVDTALVYGFGKPSAGTLRQVLTMQTDPYLVAPLWPDALSLAGLQARAGLDSGAWT
                     ERDMAAVSAADEAEIDKRLAAPYVANPLREHDIAPITDGAAAIVLARGDKARELCERP
                     AWLTGMAHRIDTPMFGARDLTTSASTAAAAAAITGGDAGGFDVAELHATFSHEQLILK
                     QAIGLGESTRINPSGGALAGNPMFAAGLERIGFAADEIINGTAGRALAHASSGPALQQ
                     NLVAILEAGR"
     gene            complement(585140..586135)
                     /locus_tag="NONO_c05370"
     CDS             complement(585140..586135)
                     /locus_tag="NONO_c05370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15350.1"
                     /translation="MTGAIAKGSGPEAEPAPEVLGAELRMKFDYTRSVGPTIGRFLTG
                     LREGRIVGVRGSDGRVIVPPAEYDPVTADPLTDFVDVSDVGTVQSWSWVADPLPGQPF
                     DRPFAWALVKFDGADTALLHALDVASPDEVRSGMRVRVRWATERTGSIHDIACVEPGE
                     TSAPAAESPAGEPVTGIVTPIDLVYKHTASPAETVYLKALAEGRLIGGRADADSKVYF
                     PARGADPIDGRSTDDMVELGNDGTITTFCIVNVPFQGQKIKPPFVAAYVLLDGADIPV
                     LHRVTGCDPADVRMGMRVKAVWKPREEWGYTLENVDHFEPNGEPDADYDSYRHHL"
     gene            586242..587279
                     /locus_tag="NONO_c05380"
     CDS             586242..587279
                     /locus_tag="NONO_c05380"
                     /codon_start=1
                     /transl_table=11
                     /product="putative F420-dependent oxidoreductase"
                     /protein_id="AHH15351.1"
                     /translation="MRFGLQLGYWGAAPPPNAAELVAAAEDAGFDAVFAAESWGSDAF
                     TPLAWWGSATNRVRLGTSVVQLSARTPTATAMAALTLDHLSGGRHILGLGVSGPQVVE
                     GWYGQPFAKPLARTREYVGIIRQVLAREAPVVNDGKHYPLPYNGPGATGLGKPLKPIT
                     HPLRADVPIWLGAEGPKNVALTAEIADGWLAIYYTPRLAAMYDEWLDEGFARPGARRS
                     REDFEIAASCQVIITDDPRTEIDRIKPVMALYIGGMGAEELNFHAQVYRRMGYGAEVD
                     EITRLFRAGRKEEAAAVIPDQLILDTAIIGDEDHVRSQLKVWEAAGVGMLTVSLRDVG
                     QLQRLAPLVQS"
     gene            587574..589223
                     /locus_tag="NONO_c05390"
     CDS             587574..589223
                     /locus_tag="NONO_c05390"
                     /codon_start=1
                     /transl_table=11
                     /product="putative long-chain-fatty-acid--CoA ligase"
                     /protein_id="AHH15352.1"
                     /translation="MSYNIADLVEHTIDLVPDRVALADDVRSVTYAELEDRANRLAHH
                     LQEQGVQPGDKVGIYSRNTIEAVETMVAIFKARAVMVNVNFRYVENELQYIFENSDMV
                     ALVHERRYSDKVSAVRPNTPKLKAVVAVNDGTEDQVPLAADSVEYEAALASTSGERDF
                     GDRSNDDIMMIYTGGTTGMPKGVMWRQEDWWRVLGGGINFVTGEAIEDEWQQAKAGAA
                     GPQMVRYPIPPMIHGGSQSATFHGLFDGGKTIMLPEFTAHGVWQAIDRHGVNLIFITG
                     DAMARPMLDALKAGHPETGAAYQHSNLWALASSAALFSPALKDEFIELLPNTVITDSI
                     GSSETGFGGLSVAAKGATHTGGPRVKIDASTAVLDDEGNPVAAGSGQVGLLARTGNIP
                     LGYYNDPVKTAATFKEFNGIRYSIPGDFARVEEDGSVTMLGRGSVSINSGGEKIYPEE
                     VEGALKCHPEIFDALVIGVPDERWGQRVAAVVQCRGGNRPTLEELRPVLSQEISAYKL
                     PRSLWFVDEIKRSPAGKPDYRWANDHAQSRPADEEAHASAK"
     gene            589378..590430
                     /locus_tag="NONO_c05400"
     CDS             589378..590430
                     /locus_tag="NONO_c05400"
                     /codon_start=1
                     /transl_table=11
                     /product="putative RNA polymerase sigma factor"
                     /protein_id="AHH15353.1"
                     /translation="MPRFPGCFLSVGCATVIGMSEKASTGTVDDVLQQFEGYRRELCA
                     YAYRMLGSSFEAEDAVQDTFTRAWKAYDSFEGRSSVRSWLYKICTNICLDMLDGPQRR
                     ARPMDLSGPSRPDSPMPPPQPDYVWVEPIPNALAFGADPAEHASTKDSLRLAFVAACQ
                     HLPATQRAILIMREVLRFSANETAEMLTMSPASVNSALQRARATMSKVQPSESGSYDE
                     SDDEQRGLVDNFVRAFEAYDMDALTSLLKQDVALSMPPLELWISGPENVAEFMLSEGP
                     SACRGSRMVPLAGANGLPAFGQYKPTDEPGVFSPWSITVLELDGGEISGLNFFLDTER
                     LFPLFGLPAELREPAE"
     gene            complement(590434..590586)
                     /locus_tag="NONO_c05410"
     CDS             complement(590434..590586)
                     /locus_tag="NONO_c05410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15354.1"
                     /translation="MYPVKRLLIFVIAAIVAISVYDYARSPGHIGMVIAGGVVVAIWL
                     TAKAID"
     gene            complement(591165..592034)
                     /locus_tag="NONO_c05420"
     CDS             complement(591165..592034)
                     /locus_tag="NONO_c05420"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, LysR family"
                     /protein_id="AHH15355.1"
                     /translation="MQYFLTVAEELHFGRAAGRLHIVQSAVSQQITRLERELDVALFD
                     RTTRTVRLTEAGRRLLPHAEQVIAAVSRARDAVDDLRAERSGTVRLGTSTGLGARLES
                     ILVEFARAAPEAHLELVDADTGERMKRVRSGELDAAIVRGARDEPGLELLPLWSDRLV
                     AAIPARHDLAVRREVELACLAELPLRLVDRARNPALHDLVVGSCRAAGFEPRFGPEFT
                     TEQDTLAAIGFGAPSWTVYYAAQATRLVFPGVVWRPLRDPEPVMPSYLAVRPDPPRAE
                     LRALITACHSITD"
     gene            592168..592953
                     /locus_tag="NONO_c05430"
     CDS             592168..592953
                     /locus_tag="NONO_c05430"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase family protein"
                     /protein_id="AHH15356.1"
                     /translation="MPYLTVNDTQLYYEDQGTGRPLLFLHGWGTSGRVWGAQQADLVR
                     EFRVVTLDWRGCGRSARPLSGNTLAGAVADVAEVIRQLNLVRPVVIGSSIGATFATEL
                     ALAHPELVAGVIAVDGPAYWPGQGMPLAEIIDEMRYRRAEFLSTWVPNWYAPGTAPLL
                     VDWTIRQILDSGVYIDELFHVFATYDPRPRLPLLRTPIHYVHGELDAEIPVEVARVCA
                     ALTPGAQVSVIEGAGHMPQQERAAEFDAALRAAVTGFLLPTPA"
     gene            592987..593799
                     /locus_tag="NONO_c05440"
     CDS             592987..593799
                     /locus_tag="NONO_c05440"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase family protein"
                     /protein_id="AHH15357.1"
                     /translation="MRIATARLDGGEARVAYELTGTGPAVILVHGTAAARDQWAPLTE
                     RIADRYTVVALDYSGSGDTTDHGGPLTVADLAAEVLAVVEHAGIRRFHLVGHSLGAVV
                     AAQVAATVPERVRSLFLHAAWVRTDVRMDSEFRYWIELLRHDAERGTDLFPRMLPLMA
                     FGPRYWDNTTAADNDALVKQLAGVIALGAIRQTEVDRAVDLTGLLDRITAPTLVLASA
                     HDRIIPAAQQQALLAAIPDARYAEIDAGHGAPGEDSDGFIAKVAGFLDDRTR"
     gene            complement(593850..594269)
                     /locus_tag="NONO_c05450"
     CDS             complement(593850..594269)
                     /locus_tag="NONO_c05450"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase-like domain-containing protein"
                     /protein_id="AHH15358.1"
                     /translation="MASKMIFINLPVEDLERSKSFYEALGWKINPDFTDDNAACVVVD
                     DNICLMLLTHHHFETFTNRPIADTRAATGSIYALSLGSADEVETLLTAAKAAGATEET
                     SEDKRAQEEAVGMFSRAFLDPDGHHWEAFWMDYPGGN"
     gene            594432..594995
                     /locus_tag="NONO_c05460"
     CDS             594432..594995
                     /locus_tag="NONO_c05460"
                     /codon_start=1
                     /transl_table=11
                     /product="AAA domain-containing protein"
                     /protein_id="AHH15359.1"
                     /translation="MGELADRTEPETGAVYLITGIQAAGKSTVAEALARRLPRSAHVR
                     GDVFRRFVIGGRAEMSGAPSAEALRQLELRHRLAASVADEYAAAGFTAIVQDVVLGEL
                     LPWMIERIGTDPLYVIVLAPRPAAVAEREAGRAKKAYGTFTVEQLDGILHAETPDIGL
                     WLDTTDLTVEQTVDAILDRAEPVRARA"
     gene            complement(595002..595526)
                     /locus_tag="NONO_c05470"
     CDS             complement(595002..595526)
                     /locus_tag="NONO_c05470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15360.1"
                     /translation="MTHHAIDDRLGIARGSASYYYRTRQDLLVAAITYLTTTSRNAFQ
                     AALEQPDRRADTVDGAADLIAGQLDLLIGERRRDALARYALAADTAGDEELRRALAGC
                     LFSLPAAEDLLSSLGAGDPGGAARDLISLLEGLLFDRLLGTRALLGLRPGTPESVDDV
                     RRPVHRWLTALRDS"
     gene            complement(595634..596029)
                     /locus_tag="NONO_c05480"
     CDS             complement(595634..596029)
                     /locus_tag="NONO_c05480"
                     /codon_start=1
                     /transl_table=11
                     /product="death-on-curing family protein"
                     /protein_id="AHH15361.1"
                     /translation="MTDPSIYYLTMADLRVIAADAVGSYAVRDPGLLASAAARSQATV
                     FGADAYPTIWEKAAALLHSIASNHPLIDGNKRLAISAAIVFLARNRIDVDRLDEDRTF
                     DLMIEVAKGQLVEIADIAAQLAVALGHSL"
     gene            complement(596026..596265)
                     /locus_tag="NONO_c05490"
     CDS             complement(596026..596265)
                     /locus_tag="NONO_c05490"
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death family protein"
                     /protein_id="AHH15362.1"
                     /translation="MTVAPRPESWELPVSEARERLAEVLAAAEAGTVVHLTRHGRRVA
                     AVVPEQMAETADDEVRALSKRFADKHRKLLDRLAE"
     gene            complement(596561..597664)
                     /locus_tag="NONO_c05500"
     CDS             complement(596561..597664)
                     /locus_tag="NONO_c05500"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="AHH15363.1"
                     /translation="MDFTLTEGQQDLARLTGEVCGKLVTADRLRELDTAEVRFDEALW
                     RSLAETGVLAATLPESVGGSDLGVLEQTAILRELGKSVAAVPYLWSVVLGAGALARWG
                     SDAQRELATKAAAGETILTVALSEERNWEPARPVTTAVEDGGWKLTGAKTVVPFAAQA
                     SRILVPASVSGQAAVFLVDPAAAGVLLTDQQVVDRSPEAELEFDGAPAELLGTVGDGA
                     EILNWLLAQGWLGLAAQQLGTLERAIDLVAEYGREREQFNRKIGSFQAVAQRLADGYI
                     DLQGLRLAVTQAAWRVSEGLPADAEIHTAKFWAAEAGHRIAHTAVHVHGGVGIDRDHI
                     VQCYFTAAKHNEFALGGATDHLRALGTLLAEVH"
     gene            complement(597696..598889)
                     /locus_tag="NONO_c05510"
     CDS             complement(597696..598889)
                     /locus_tag="NONO_c05510"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="AHH15364.1"
                     /translation="MRIAYTEQQEQLRAELREYFAKLITPERREALSSQTGEYGQGNV
                     YREVVQEMGRDGWLTLGWPKEYGGQDRSTMDQLIFTDEAAVAGAPVPFLTINSVAPTI
                     MHYGSEEQKKFFLPKISAGELHFSIGYSEPGAGTDLASLRTSAVRDGDDWVINGQKMW
                     TSLIQYADYIWLAVRTDPEAKKHKGVSMFIVPADAEGVSWTPVHTMAGPDTSATYYQD
                     VRVPHSSMVGPENGGWALITNQLNHERVALTSAAPLALAVAQTTEWARDTKDSSGARI
                     IDNEWVRLNLARVHAKVEYLKLLNWEIASGADAGGDAAPRPWDASTCKVLGTELATEA
                     YRLLMEILGPQAYLRQDSPGAQLRGRLERMHRACLILTFGGGTNEVQRDIIAMTALKQ
                     PAAAR"
     gene            599100..599288
                     /locus_tag="NONO_c05520"
     CDS             599100..599288
                     /locus_tag="NONO_c05520"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ferredoxin"
                     /protein_id="AHH15365.1"
                     /translation="MKVIVDFDQCEANGICVGIAPDVFELDDEDMLHVVTADVPDDRL
                     ADVEQAVAQCPKAALRLE"
     gene            599333..600250
                     /locus_tag="NONO_c05530"
     CDS             599333..600250
                     /locus_tag="NONO_c05530"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, SDR family"
                     /protein_id="AHH15366.1"
                     /translation="MSESSNQSGTDLSGKVAIVTGAGAGLGRAEALALAAAGASVVVN
                     DLAESEAVAATLADIRALGAKAEFVAGSVAERATADALISTAEETFGSVDIVVNNAGI
                     VRDRMLFSLSDEDWDSVLAVHLRGHFLLSRNAAAYWRAKSKESGTPIYGRLINTSSEA
                     GLLGPAGQPNYAAAKAGITALTLSASRGLSRYGVTANAICPRARTAMTESVFSAAPDD
                     EVDPLSPDHVARLVAYLASPGAEAVNGQVFVVYGPMVALMAAPEVEARFDAAGAEWSA
                     DALADTLGAYFAERPAGRTFSASSLHDLG"
     gene            600530..601294
                     /gene="yrbE1A"
                     /locus_tag="NONO_c05540"
     CDS             600530..601294
                     /gene="yrbE1A"
                     /locus_tag="NONO_c05540"
                     /codon_start=1
                     /transl_table=11
                     /product="YrbE family protein YrbEA"
                     /protein_id="AHH15367.1"
                     /translation="MNEVLAVPLRAVGGFFELVAAVARALIRPPFQRREFVDQSWFVA
                     RVSIVPTILVAIPFTVLVSFTLNILLREIGAADLSGAGAAFGTVTQVGPIVTVLIVAG
                     AGATAICADLGARTIREEIDAMKVLGIDPIHRLVVPRVLASMFVAALLNGLVSTIGIA
                     GGFLFSVLLQGVNPGAFVNGLTLLTHLPELVISEVKATLFGLIAGLMACYLGLNVRGG
                     PKSVGDAVNQTVVFSFMALFVVNVVVTAVGIKFTVR"
     gene            601365..602150
                     /gene="yrbE1B"
                     /locus_tag="NONO_c05550"
     CDS             601365..602150
                     /gene="yrbE1B"
                     /locus_tag="NONO_c05550"
                     /codon_start=1
                     /transl_table=11
                     /product="YrbE family protein YrbEB"
                     /protein_id="AHH15368.1"
                     /translation="MDGIGHHAQFYARSLASMPKAFTHYRTETIRLIAEISMGTGALA
                     VIGGTVVIVGFLTLFTGGTIAVQGYSSLGNIGVEALTGFFAAFLNVRIAAPVISGIGL
                     AATIGAGATAQLGAMRVAEEIDALESMAIRPMPFLVGTRVLAGMIAIVPLYALAVIAS
                     FVASRFATVVIYGQSAGVYDHYFSTFLIPSDILWSFVQAILMALAVMMIHTYYGYNAT
                     GGPVGVGIAVGNAVRASLVAVVSVTLLMSLAIYGTSGNFHLSG"
     gene            602156..603376
                     /gene="mce1A"
                     /locus_tag="NONO_c05560"
     CDS             602156..603376
                     /gene="mce1A"
                     /locus_tag="NONO_c05560"
                     /codon_start=1
                     /transl_table=11
                     /product="MCE family protein MceA"
                     /protein_id="AHH15369.1"
                     /translation="MAANKLVEKEGAGKFFGAGWGVKLSGIGLVLFLAAIVAVALTMF
                     VGGFTTTEPVYLDAPRAGLVMDKDAKVKIRGVEIGHVSDIAYTGDHARLTLAMNPDQL
                     KMVPANATVDIRSTTVFGAKYVNFMEPPEPSSTHLKAGATVAAQAVTVEFNTVFQHLT
                     DVLAKVAPEKLNATLTALGTALQGRGDKLGQLLADSDQYLADINPSLPDLQRDLQTSV
                     GVTNLYADVTPDLLRTTHNATTTSKTIVDENKNFDAMLVNLIGLADTTRPILSDNAEA
                     LATSLDLLRPTTALLNEYRSGLGCVVEGIGSNVDIMDKIFGGGPGGTVLLNAGFMPGG
                     EPYKYPQDLPKVNATGGPHCEGVATRQPDDHANYLVTDTSQGEVWTPELHTHLNGPRV
                     FQIMFAGLPGVPNP"
     gene            603373..604404
                     /gene="mce1B"
                     /locus_tag="NONO_c05570"
     CDS             603373..604404
                     /gene="mce1B"
                     /locus_tag="NONO_c05570"
                     /codon_start=1
                     /transl_table=11
                     /product="MCE family protein MceB"
                     /protein_id="AHH15370.1"
                     /translation="MKLKMHSSTLKLGIFTLVMVIVLAFLVVVFSQMRFSRETGYHAV
                     FTNSSGMLPGSKVRIAGVPVGSVKSVKVGKDHLAHVDFDVDTKYRLYVSTRATVRYEN
                     LVGDRYLELMEGPGTAQVLKKGGTIGTDKTKPALDLDMLLGGFKPLLRGLDPTQVNDL
                     TGALLQVFQGQGGTLVSLLNSGGSFTKTLADRDALIGSVIDNLETVLATIDDHNKEFD
                     TTLTELQRLISGLAADKDPIGAALPKLAGATGDLTGLLQEARPDLKETFGQLGQLSQN
                     IDAHSSDIEWIFQQLPTTYRKLVRIGSYGSFLNMYVCGVTMLADGPDGKPMEVHLSGN
                     QTTGRCEDK"
     gene            604401..605462
                     /gene="mce1C"
                     /locus_tag="NONO_c05580"
     CDS             604401..605462
                     /gene="mce1C"
                     /locus_tag="NONO_c05580"
                     /codon_start=1
                     /transl_table=11
                     /product="MCE family protein MceC"
                     /protein_id="AHH15371.1"
                     /translation="MKSERSPLISAGIVGIVVAVSIALSALQFDRLPFIRSGAEFTAY
                     FADAGGLMPGDQVHVAGVRSGQVENVGLDGPKVKVTFSLDESIVLGNKTTAAIKTNTL
                     LGRKSLDVDPQGTGAIRKDQPIPLERTTSPYSLNDALGDLTKTVQGLDLDQVNKTLDT
                     LSESFADTPAPLRSALDGVTALSRSLNKRDAALTELLSHAQNVTKVLSDRANQINALL
                     TDGNDLLGELDARRSALSQLIVYVNQLAQQLTGFVNDNEAQLKPALDKLNSVLQLLQR
                     NKDNLGKALDALGPYAAALGEQVGSGPYFQAYLSNVESIPLRSLVDALVWPERLPQDL
                     YDSFGHPITTNPAETEPPR"
     gene            605459..606709
                     /gene="mce1D"
                     /locus_tag="NONO_c05590"
     CDS             605459..606709
                     /gene="mce1D"
                     /locus_tag="NONO_c05590"
                     /codon_start=1
                     /transl_table=11
                     /product="MCE family protein MceD"
                     /protein_id="AHH15372.1"
                     /translation="MNAVRRLSKVPRWAQIVAAIVVIALIGWLIYGAVSGIGKKHITA
                     YFPSTNGLYAGDDIRVLGVKVGRIDKIKPGKDQVEVDMTVNRGVDVPADAKAVLISPN
                     LVSARFVQLAPVYTGGPKMGNNGRIPIEHTAVPVEWDDIKKELTELSKALGPVGEDKQ
                     GSFGRVIDTAANNLGNGNAQAFRDTLQELSHTLNTLSDGRTDLFGSIRNLQQFVDVLS
                     KSNEQIVQFGGRLASVSSVLADTSNDLGAGLDNLDSAIGDVKRFLDERGGALTESVQR
                     LSDVTQLLADKRGDIERVLHAGPTGLVNFYQIYKPAQGSLAGAVVGTNFANASAFLCG
                     SVEAIEADDSDKSAALCKQYVAPVINSLMMNYPPILANPASLQTAFPQQLTFSTPELA
                     DRVNTAPPSSVPNGIAGLALPGGR"
     gene            606709..607956
                     /gene="mce1E"
                     /locus_tag="NONO_c05600"
     CDS             606709..607956
                     /gene="mce1E"
                     /locus_tag="NONO_c05600"
                     /codon_start=1
                     /transl_table=11
                     /product="MCE family protein MceE"
                     /protein_id="AHH15373.1"
                     /translation="MRNRRRRIAAVALGVAVLMGATGCEWDGLNSVSMPGAAGTGEGS
                     WKVRIQMPNVTTLTRNSPVKVDDVTVGSVSGIELQDWHALVTVSLDKGVNLPENAVAR
                     IGQTSLLGSNHVELAAPTGIAPEGKLKDGDLIPLDRAGTFPTTEQTLSSLSVVLNGGG
                     ISQLETITHELNATFNGREDAIRDLLPQLNQLTTTLDQQTGDIISAMGGLDRFGGELA
                     QEKDRVTEAITKIHPALTVLADKRENITKTITALGDLSGVVQQVIATSGDNLKANLAN
                     LWPTLQTLANTGDRLAASLQLLLTFPFPIKGINKAIKGDYMNLFVTYDLTSARMDSNF
                     LTGTPLGGKFGGVQAKYGVEAALGTIAGTAGEKGDPVQGPLQPPPPGQAPALPGLPPI
                     PGLPAIPGLTVPVPVAPQGGPGQ"
     gene            607953..609365
                     /gene="mce1F"
                     /locus_tag="NONO_c05610"
     CDS             607953..609365
                     /gene="mce1F"
                     /locus_tag="NONO_c05610"
                     /codon_start=1
                     /transl_table=11
                     /product="MCE family protein MceF"
                     /protein_id="AHH15374.1"
                     /translation="MKLSKFVRTQLVIFAIVAVVSLVVMSASYLHLPAMFGIGRYQVT
                     VQLEATGGLYPTANVTYRGTNIGKVQDVKLTPDGVDARMSISSKYKVPADVDAYVKSV
                     SAIGEQYVDLVPVENPHGGNLRDGSVIPVQRTRLPQDVGDMLDQADRLLSSVADTKLR
                     EVIDDAFIAFNGAGPDLQRFIDSASLLVQEAKGSTEQTKDLLAKLGPLLDTQNRSDPD
                     IRAWTKNLATVTDQLREHDPSLRDLIQRTPSAAQKVSSTFQDLKPTLPILLSNLVSVG
                     QVGVTYHAGVEQILVVLPPMIAALMTAAKSSPTKYGAKADFMLGLNDPPGCTTGFLPP
                     DQRRSPTDFSIPDTPELYCKISQDSSTAVRGIRNFPCAEVPGKRAPTPELCRDPRGYV
                     PEGTNPAFGPPQPVPSAGEPPAQGTQTHPASFSNRSLDPSTGTFTGPDGRTYRQGDIG
                     ADGSGTVPSSWQSMLEQQQR"
     gene            609433..610539
                     /locus_tag="NONO_c05620"
     CDS             609433..610539
                     /locus_tag="NONO_c05620"
                     /codon_start=1
                     /transl_table=11
                     /product="putative MCE associated membrane protein"
                     /protein_id="AHH15375.1"
                     /translation="MSETESTQTGRVRRRAGRPAGPPVDEADAGASANAPAAAKGESA
                     VQQTTGDAAATTKSAAAGTADATVKLATAKPAADDATEKLATAKSASGATEKLAAAEP
                     ATDDTTEKLATAKSGGELADPASEDATAKLATEAPAEDATVKSSKDKKSSKYARYSKA
                     ARAGRYSKSARDAESAQSDDETVKLPVSSETDADASTEIPDESGKKKLGVLGWAAAVV
                     AVLSLLGLLGSGGFYFYHQHQTDSLASQRDDYVQTAKQAVLNLTNIKDDSAQQDIDRV
                     LSVASGQLKEEYSARKDDYAKVVQQAKVKASGEIIEAALESSDDSSAKVLVAAKQTLT
                     NAGSPDPQQRYYRFRITVTRDGGHTTASKVEFVA"
     gene            610536..611024
                     /locus_tag="NONO_c05630"
     CDS             610536..611024
                     /locus_tag="NONO_c05630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15376.1"
                     /translation="MRNNLRPILFVSAAVLLVAALAVGGFTGFKYWSDQQTEHARSES
                     VGAAQTTVTGMFTYDFNNVDTELPKSADNLTPDFRKDYLKLVNEVIAKGAKEKQLTVK
                     ASSQAAGVVSADRSHAVVLVYLNQITTSKDSPQGAITPSRVRVTMEKQDGRWLASQVT
                     PI"
     gene            complement(611356..612912)
                     /gene="otsA"
                     /locus_tag="NONO_c05640"
     CDS             complement(611356..612912)
                     /gene="otsA"
                     /locus_tag="NONO_c05640"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="trehalose-phosphate synthase"
                     /protein_id="AHH15377.1"
                     /translation="MDQTSDIRSDRSRDGRETAPEPESAPANPGDHGSGFVVVANRLP
                     VDLERLPDGTTRWKRSPGGLVTALEPVLRNNNGAWVGWAGVPDVDVDPIIEDGLELYP
                     VPLTATEVSDYYEGFSNGTLWPLYHDVIVRPEYHRDWWTAYVEVNRRFAEYTAKVAAE
                     GATVWVQDYQLQLVPKMLRMLRPDLTIGFFLHIPFPPVELFMQLPWRTEIVEGLLGAD
                     LIGFHLPGGAQNFLYLAKRLAGQPTSRGTVGVRSKLGVVQVGFRTVRVGAFPISIASA
                     ELDELSRRRSVRERAAQIREELGNPKHILLGVDRLDYTKGIDIRLGALQELLHDGRLD
                     PSETVMVQLATPSRERVESYIQMRGDIERQVGRINGEFSRVGYPFVHYLHRPIPRDEL
                     VAFFVAADVMLVTPLRDGMNLVAKEYVAAHSGLNGALVLSEFTGAAAELRQAYLCNPH
                     DLDSVENAIMSAIEDDGETKRRRMRALRRQVLAHDVDRWARSFLDALAQDRVAGSALL
                     TDADVDPGTR"
     gene            complement(613000..613167)
                     /locus_tag="NONO_c05650"
     CDS             complement(613000..613167)
                     /locus_tag="NONO_c05650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15378.1"
                     /translation="MAAKSANDIADDDLEPLADETARQAQRVVAAYATDADECRMLLS
                     MLGIGPSTRGE"
     gene            613422..614261
                     /locus_tag="NONO_c05660"
     CDS             613422..614261
                     /locus_tag="NONO_c05660"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase family protein"
                     /protein_id="AHH15379.1"
                     /translation="MPLATVNGISLNYQVKGDKGKGTDTKGAAPLVVLIMGTGSPGRV
                     WELHQVPALVAAGYRVCTFDNRGVAPSYEAADGMTIDELVADTAALIEHLDEGPALVA
                     GTSMGARVTQELALARPDLVRKAVFMAGHARLDQFQKTLSLGEHELDASGVQLPPRYE
                     AAVTAVMNLSPATMADPNSARDWLDLFEFTGGPVSPGIRAQRRMDHDFDRLQAYRGIK
                     VPCLAMGFADDRMIPAYLTRELAEVIPDARYQEIPDAGHYGYLERPEAVNKVLLDFFA
                     GSR"
     gene            614408..614650
                     /locus_tag="NONO_c05670"
     CDS             614408..614650
                     /locus_tag="NONO_c05670"
                     /codon_start=1
                     /transl_table=11
                     /product="MbtH-like protein"
                     /protein_id="AHH15380.1"
                     /translation="MSTNPFDDEDGRFFVLVNDEEQHSLWPAFAEVPAGWRVVFGEDS
                     RAACVEYVEKNWTDMRPKSLRDAMAADDAARQASQS"
     gene            614802..614873
                     /gene="trnT2"
                     /locus_tag="NONO_c05680"
                     /note="tRNA-Thr-TGT"
     tRNA            614802..614873
                     /gene="trnT2"
                     /locus_tag="NONO_c05680"
                     /product="tRNA-Thr"
     gene            complement(615065..615778)
                     /locus_tag="NONO_c05690"
     CDS             complement(615065..615778)
                     /locus_tag="NONO_c05690"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="AHH15381.1"
                     /translation="MAFSWGLALVEANLDQRAAERSYDIAERELIPAVDWSAYSLRKA
                     WNAVKWWRENSKETYASGLANLSAALGLARHIERGTARIRSATVRFTRGRWFVAFSVE
                     VRRADRASVLPGAVVGVDLGITNLAVLSQPVAGVSDEHAMVADRFYPSSKMCSSCRAV
                     KTELRLSNRVFYCDSCGHRADRDRNAAANLAALTNNAPSMSSPSCGATKNEPAGKPCK
                     TNIVGSGYRHGNTPEVNVA"
     gene            616043..616837
                     /locus_tag="NONO_c05700"
     CDS             616043..616837
                     /locus_tag="NONO_c05700"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15382.1"
                     /translation="MPDIAEGVAGADVPDVRLGPGSMLWRHLGDRRFLATLPRAVGLQ
                     MLHPSIAAAQVEHVRVRLWDHKRRTVQRLIALAYIGRDPSWRIRVGHEHVKGIDEDGR
                     RYHALNPDLFFFQHATYVETLFTMINTFIAPMTTAEHEQLYAETCLWYRRYGISDRMM
                     PATWTEFTAYFDDACRTQLRPGTAFETVRGQVLRPDAWSQRFVPARVVRALHHDHALE
                     LMGERRRPGDRAALATYRAAVGASLLVRHRFPADLRSRLDVGSPVD"
     gene            616915..617661
                     /locus_tag="NONO_c05710"
     CDS             616915..617661
                     /locus_tag="NONO_c05710"
                     /codon_start=1
                     /transl_table=11
                     /product="putative two-component system response
                     regulator"
                     /protein_id="AHH15383.1"
                     /translation="MSRMNGVAGDRIPEARVLVVDDEPMIVELLSVSLRYQGFEVAAA
                     GNGAEGLDRAKQFRPDALIVDVMMPGMDGFGLLRRLRADGIDAPVLFLTARDEVDDKI
                     TGLTLGADDYVTKPFSLEEVVARLRVILRRSGHVVEETKSSRIRFEDIELDDDTHEVW
                     KAGEPVALSPTEFTLLRYFMVNAGTVLSKPRILDHVWRYDFGGEVGVVETYVSYLRKK
                     VDTGPDRLIHTLRGVGYVMRAPSRSRSSAK"
     gene            617658..619244
                     /locus_tag="NONO_c05720"
     CDS             617658..619244
                     /locus_tag="NONO_c05720"
                     /codon_start=1
                     /transl_table=11
                     /product="putative two-component system sensor kinase"
                     /protein_id="AHH15384.1"
                     /translation="MNDSRSVRERGDGGTDASGMTDETPDTTEPDGSYLPSSEPDTTG
                     RVSRPRGIRRRAARRFAAVPLRVTLVIALVALAGLGLLVSGVAVTSSMRNVLIDKVDR
                     QLFEARIWAAPHADRAPPERLPVPAGRERPPGLYYVRIDDPSGKNLLLLPSGPTAPDI
                     PGDLGRHPRTVGTVGDPGEHWRAVRFTTPDGTSTIAVRLTETENIVDRLIGLQVAVGV
                     IVLAALAVVAQFVIRRSLRPLGEVEKTAAAIAGGDLHRRVPVQGTNTEVDRLSQSLNG
                     MLAQIQTAFAATEASEESARRSEARMRRFVADASHELRTPLTTIKGFAELYRQGALTD
                     PAMFMDRIERESNRMSLLVEDLLMLARLDAQRPVERRPVDLLALASDAVHNARAVDAA
                     QRPDEPRRPIDLEIRPGTGTLEVRGDEARLRQVLGNLVNNALIHTPPEASVTVGLTPD
                     EDNVLIEVADTGPGLPQEEADRVFERFYRTDTSRSRDSGGTGLGLSIVQALVAAHGGT
                     VSVRSAVGQGTTFAVRLPRV"
     gene            complement(619245..619670)
                     /locus_tag="NONO_c05730"
     CDS             complement(619245..619670)
                     /locus_tag="NONO_c05730"
                     /codon_start=1
                     /transl_table=11
                     /product="HIT-like protein"
                     /protein_id="AHH15385.1"
                     /translation="MPSVFSAIIAGQLPGRFVWEDDEFVAFLTIAPVTPGHTLVVPRK
                     ELDQWQDLDPATFTRINEVAQKIGQAVRKAWDAPRAGLLIAGLEVPHLHLHVFPAFEL
                     TDFDITGADQNPSPESLDEAQAKIKQALRDLGYGANVPD"
     gene            620120..621325
                     /gene="purD"
                     /locus_tag="NONO_c05740"
     CDS             620120..621325
                     /gene="purD"
                     /locus_tag="NONO_c05740"
                     /EC_number="6.3.4.13"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="AHH15386.1"
                     /translation="MTAIAAAPGNPGIAQVAEVRAVDPAAAESVVGVATDFEADLVVI
                     GPEVPLVLGIADAVRAAGIACFGPSAAAARIEGSKAFAKDVMGAAGVRTAHSEIVDNP
                     GELDAALDRFGPTWVVKDDGLAAGKGVVVTADRSAARDHGAELLEQGHPVLLESFLDG
                     PEVSLFCLVDGETVVPLLPAQDHKRVGDGDTGPNTGGMGAYTPLPWLPAAAVTEIVDD
                     VVKPVAAEMVRRGVPFSGLLYAGLAMGQAGPAVVEFNCRFGDPETQAVLALLDSPLGE
                     LLHATATGTLAQAQPPRWKDGAAVTVVLAAENYPSRPRTGDVITGTDAAAANAEVLHA
                     GTSSRADGALVSAGGRVLNVVATGGDLTEARANAYERMAGIKLPGSHFRTDIGLAAVE
                     DRIALPTRV"
     gene            complement(621353..622348)
                     /locus_tag="NONO_c05750"
     CDS             complement(621353..622348)
                     /locus_tag="NONO_c05750"
                     /codon_start=1
                     /transl_table=11
                     /product="putative peptidase"
                     /protein_id="AHH15387.1"
                     /translation="MPDQARRAKMYQGGWTVIRPDWRTALRTERPSVRARLRSAARRS
                     RRAGRSAMGAGRSWFDRNLRGRDWRAEFGTLWPRLRGWVGGHRVLVLGVVVVGLFAAA
                     DAVAPATIDSTPNPGAMQRIAVAYPLQVQAEPETSKRYVKAMDNGERLREAQVVAAAS
                     RATLDRAKAEAAAAVAGTPQPWIPGPSASMPGGILPGGIAPGSLGFALPARGVFTSGY
                     GGRWGTFHYGIDIAAPIGSPIYAVADGTVIDAGPAQGFGLWVRIRHNDGTISVYGHMY
                     DFSVSVGEHVRAGQQIARIGNRGDSTGPHLHFEILINGQHVDPQPWLAVHGIQVG"
     gene            622564..623850
                     /locus_tag="NONO_c05760"
     CDS             622564..623850
                     /locus_tag="NONO_c05760"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aminotransferase"
                     /protein_id="AHH15388.1"
                     /translation="MDGARRRQRSVTTQGSPSGPCTRKPGRVGAFTAVFYRRRVRSES
                     RRSTVPTFYVMDVWKAAAERARTHGDVLVLAAGQPSTPAPAPVLRATRAALDGELLGY
                     TETFGIPELREAIAAHHRDGYGVDAVADDVVVTTGSSGAFTLLFLAAFDIGDTVVVAR
                     PGYPAYRNTLTALGCRVIELDCGPQTRFQPTVAMLEELPEPPAGLIVASPANPTGTMI
                     APDELAALARWCDDHGTLLISDEIYHGIAYSGSGGDTEPVSSAWETSRESVVIGSVSK
                     YFSMTGWRLGWMLAPERLRPALQRLASNMTVCPPAISQFAAVHAFGAEAKTELDGHVR
                     RYARNRALLLDGLPRLGITDLAPADGAFYAYADIGHLSQDSTRWCADLLARTGVALAP
                     GIDFDTSNGHRTVRFSFAGATADIEEALVRLGRYLS"
     gene            624153..624833
                     /locus_tag="NONO_c05770"
     CDS             624153..624833
                     /locus_tag="NONO_c05770"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="AHH15389.1"
                     /translation="MITATTPKGERRRQALVAAAAELLLEGGFDAVRHRSVATRADLP
                     LASTTYYFESLEDLIARAVEFSGTAELEAMRRRIGDVTHRRRGPEATVDLIVDLMVGT
                     DGPDDFARGRLIARYERSVASARHPELREVQLRLRAQLEDLVADVLRRSDRTVRTDQL
                     RRLVAVVDGAVVAALAESDPQPRRTARAALLELIDVIAPPTPQSLLASQPMPPAMPQQ
                     PSRHRTLD"
     gene            624840..626273
                     /gene="purB"
                     /locus_tag="NONO_c05780"
     CDS             624840..626273
                     /gene="purB"
                     /locus_tag="NONO_c05780"
                     /EC_number="4.3.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate lyase"
                     /protein_id="AHH15390.1"
                     /translation="MTLVPNVLATRYASPQLVQLWSPENKIVLERRLWLEVLRAQTEL
                     GAAGTESVTPEVIEDYERVLGEVDLASIAERERITRHDVKARIEEYNALAGHEQIHKG
                     MTSRDLTENVEQLQIRLSLEHVHEHGVAVAARLAERAAEYQALVMAGRSHNVAAQATT
                     LGKRFASAADEILIALRRVRELIDRYPLRGIKGPMGTAQDMLDLFDGDAGKLAQLEQK
                     VARHLGFSTVLTSVGQVYPRSLDHDVVSALVQLGAGPSSLAHTVRLMAGHELVTEGFQ
                     PGQVGSSAMPHKMNTRSCERVNGLQVVLRGYGSMAAELSGAQWNEGDVFCSVVRRVAL
                     PDAFFAIDGMMETFLTVLTEFGAYPAVIERELNRYLPFLATTRILMAAVRAGVGRESA
                     HEVIKEHAVAVALAMREQGREPDLLDRLAADDRMPLDRAGLEAALADRTAFIGAAEAQ
                     VGDVVAQVQKLIDAHPEAARYTPSPIL"
     gene            626390..626860
                     /locus_tag="NONO_c05790"
     CDS             626390..626860
                     /locus_tag="NONO_c05790"
                     /codon_start=1
                     /transl_table=11
                     /product="HIT-like protein"
                     /protein_id="AHH15391.1"
                     /translation="MDPYSIFADIVAGRAPSSKVYEDADVLAFMDIRPMTPGHLLVIP
                     KVPARSLAELDPAIGGKLFQVGQRLAAALRESEVRCDGVNLFLADGVTAGQEIFHVHL
                     HVIPRTPGDGFGLRNRATTPPRADLDYLAASIRGAAQRLGSAAEARPDGTWWLT"
     gene            626967..627926
                     /locus_tag="NONO_c05800"
     CDS             626967..627926
                     /locus_tag="NONO_c05800"
                     /codon_start=1
                     /transl_table=11
                     /product="putative esterase"
                     /protein_id="AHH15392.1"
                     /translation="MRRSTVAAFVLAVVAGVLGPWSGPQPRAAAAQVVGENDMSATRT
                     ALFIDSPAMGRTIQVQVLHPAGGGARPSYYLLDGLDPGVQQSTWTNATDAEPFFAGKN
                     VNVVLPMGGQASYYTDWQSDDPHFGRYRWETFLTQELPPIIDATFDGNGVNAIGGLSM
                     GGIAAFVLAARHPELYDAIAGYSACPDLGLAQGAITFSIANRGGNPFNMWGAPGSPEW
                     GAHDPALLVNRLRGKTIYLSTGTGIPGPHEAEIKPQLPENIFLGGPIEAGVDVCVTAF
                     EQRLRGMRIPARVDHNPVGTHSWSYWQDYLHASWPTIGAAIGA"
     gene            complement(627964..628188)
                     /locus_tag="NONO_c05810"
     CDS             complement(627964..628188)
                     /locus_tag="NONO_c05810"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15393.1"
                     /translation="MEAKNRDIEPGAVWQRSGDGAGGVEVAFLASGNIGLRDAKNPDG
                     PALIFTPGEWRAFVAGAKDGEFNRPGAESA"
     gene            628502..628711
                     /locus_tag="NONO_c05820"
     CDS             628502..628711
                     /locus_tag="NONO_c05820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15394.1"
                     /translation="MAPVFDSCAVVPRHLTVEQAHNILHSHSSCPTDQCPRRKAALFF
                     LMESRRSARGTGTDLRRSAPRTGLG"
     gene            628740..630950
                     /gene="ptrB"
                     /locus_tag="NONO_c05830"
     CDS             628740..630950
                     /gene="ptrB"
                     /locus_tag="NONO_c05830"
                     /EC_number="3.4.21.83"
                     /codon_start=1
                     /transl_table=11
                     /product="protease 2"
                     /protein_id="AHH15395.1"
                     /translation="MSFDTGVCGGMRRAETSAITVEPMALETAAAVIPPIAKKVPTER
                     THHGDTFADPYEWLRDKDDPEVIAYLEAENAYTDAQTAQLAPLRARIFDEIKSRTQET
                     DLSVPSRLGDYWYYSRSFEGKQYGVHCRCPIADRDDWTPPQLDVDTEITGEEILLDSN
                     VLAAGHDFFALGAYSISHDGTLLAYSTDTVGDERYVLRFKDLRTGELLGDEIAGTAPG
                     ATWSLDGTHVFYQTVDESWRPDTVWRHRLGADRSGDVRVFHEPDERYWVSIGATRSEK
                     YLMIWVGSKITSEGWILESDDPEGEFRVLLPRREGVEYSAEHAVIGGHDRLLILHNDV
                     IDGVKAENFVLAEAPVDDPAAMTTLIGHRDEVRLEDIDCFADHLVLSYRREALPRVAV
                     WPLTSDGYGELRELDFGLELFSAGVGSNPEWAQPTLRLGVTSFITPMQIFDYVPATGE
                     MTLRKQQQVLGGYDPDDYVQHRDWAVAADGTRIPVSVVRRRDSEGSGPKPLLLYGYGS
                     YEASIDPGFSVSRLSLLDRGMVFAVAHVRGGGEMGRLWYEHGKTLTKKNTFTDFVSCA
                     RHLVDTEVTRPELMVADGGSAGGLLMGAVANLAPELFTGILANVPFVDPLTSILDPSL
                     PLTVIEWDEWGNPLEDPEVYAYMKSYSPYENVTAQNYPAILAITSINDTRVLYVEPAK
                     WVAALRATKTGDSQLLLKTEMSAGHGGVSGRYEKWKEVAFEYAWVLDTVGLGES"
     gene            complement(631041..631349)
                     /locus_tag="NONO_c05840"
     CDS             complement(631041..631349)
                     /locus_tag="NONO_c05840"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15396.1"
                     /translation="MIGPVRAAILTALAVPLMIAAPGLAQADPGDPPPIYTQDEQCAT
                     TKDFVDKVHQANPGATPDQIADTYTRIMDEHNAYRGNEDARQRDRQYLLDNISRCGLA
                     "
     gene            631372..632142
                     /locus_tag="NONO_c05850"
     CDS             631372..632142
                     /locus_tag="NONO_c05850"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15397.1"
                     /translation="MSLRLHGGDTSAAHSGIMTGNDRGFGQLIVSVSGIRDTTLEQAS
                     AFAAEMDSRGVRLSLLVAPRLKGKYRLTEDAHTQEWLRERRASGDAIVLHGYDQAATK
                     RRRAEFATLPKHEARLRLTAADRVMEEIGLRTRLFAAPRWTISDGALAALPEVGFRLA
                     LGLTTVHDLERDVAQRCWVHGMGEGFRAEPWWCHALVMSAARIARRGGTLRLAVSAAQ
                     LSRPGPHQAMLDAVDLALFHEAAPQVYRWEPFILPHAA"
     gene            complement(632263..633702)
                     /locus_tag="NONO_c05860"
     CDS             complement(632263..633702)
                     /locus_tag="NONO_c05860"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate decarboxylase"
                     /protein_id="AHH15398.1"
                     /translation="MAASSKASKSDDLFAMPDLDRGAPKQKFPHREMMPQEAYQIVHD
                     ELMLDGVSRMNLATFCTTWIDEYAARLMAQSVAKNIVDKDEYPQTAEVERRCVRMVAD
                     LWHAPHPDTAHGTSTTGSSEAAMLGGLAAKTRWRKAGGQGLPNFVCGPVQVCWEKFAR
                     YFDVEIRQVPLRGDRYTLHPDDIAAHCDSNTIMVVATMGQTFTGLFEDIAGISAALDE
                     FQSRTGHDIPLHIDAASGGFLAPFCAPDLVWDFRLPRVKSINASGHKTGLAPLGAGWA
                     VWREVDDLPRELIFDVDYLGGSMATFNLNFSRPGGQAITQYYDFIRLGRTGYTRLQSA
                     IYRVGEHLAQGLRKTGLFDMIHDSTPEHGISAVCWRLREDPGFNLYDLSERLRSRGWL
                     IAAYPLPADRQDETIMRAVIRHGFTHDMADLLLADIDRCIDQLRKHPLTVPLTREDAG
                     GFTHSATAAVSNESILDALGMQENPAPGR"
     gene            633916..635346
                     /locus_tag="NONO_c05870"
     CDS             633916..635346
                     /locus_tag="NONO_c05870"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease family protein"
                     /protein_id="AHH15399.1"
                     /translation="MTDTVTAARKPLVTKYISWVTLALMTTSSVASLRSAPTMAVYGL
                     ACVFLYVVPALLFLLPTAFVSAELASGWDGGVYKWVGEGLSKQLGFLAVWCQFAMTIF
                     YYPSLLAYVASTFAYIINPSLASNGPYVAIVIIVIYWAGVFVSAQGTKTVAGLSSMGL
                     VIGTLIPGALLVVLGIVFLAQGNSSAAPMDAGHLLPQWTGLASLVLIVNNFLSYAGME
                     MNAVHVSSLRNPAREYPRAMALAVGLVLAIFIVPAVVISWVVPSQSLSLTAGVMQAFD
                     GFFNHFGIGFLTPVLGIMLVAAALGGMLTWLAGPSKGLLLIGRSEGYLPPVLTRVNKH
                     GVQQNMLVAQGIFTTVLALLYAFIPNVSSAYWMLSVITTQVYLIMYVLLFAAAVQLRR
                     RQPGHPRGYRAPWLIGLCGLGSASSVAAFLIGFVPPSQYGSGGAWRYVLVVGLGMGVV
                     GLLIPYLFLRLRRPEWKTEVPAEALS"
     gene            635343..635804
                     /locus_tag="NONO_c05880"
     CDS             635343..635804
                     /locus_tag="NONO_c05880"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AHH15400.1"
                     /translation="MTGPAASHPVETAEQTRNRRFVNVIVVVVLVALAIVGLLVFEQK
                     RDDARAAELAQVLHDRLVAAGLPAPEPDRIADTLGDDGGLICSDPSSPLVAARYRDAI
                     ATGAAGPGNRPVILDRDVLAATEIAVRTYCPDHLPAYLDRVARLRLGDTAK"
     gene            635817..637187
                     /locus_tag="NONO_c05890"
     CDS             635817..637187
                     /locus_tag="NONO_c05890"
                     /codon_start=1
                     /transl_table=11
                     /product="M20/M25/M40-family peptidase"
                     /protein_id="AHH15401.1"
                     /translation="MTDDARTAELRAQVRSLMPQAKSDLAQLVSYRSVADARQFPPEE
                     CHRAAQWVVDAFAGLGLSDAGLHETPDGSNAVVARYPAPAGAPTVLLYCHYDVQPPLD
                     DAAWHSPVWELTERDGRWYGRGAADCKGNIVTHLTALRALRNTLDGKGYPVGITLVAE
                     GSEEQGTGGLDAFVPEHADLLRADALVIADCGNFAVGVPTFTQTLRGNVNVLVTVETL
                     SGSLHSGMFGGAAPDAVAALVHLLATLRDEAGNTTVAGLTADQVWDGVQYPAEQFRAD
                     AGVLDGVELLGSGTVSDMLWARPALTVLGIDVPPVVGSAAAIQPSARARLNLRIPPGT
                     DPDSALKALTAHLESHVPWGARLHIETEGTGSPFRSGTGGPARRAMEDAFATAYGRTA
                     TTQGQGGSIPLCNVFADTYPDAEIMLIGVEEPKCLIHAPNESVDPDEIEQLALTEALF
                     LQSYTR"
     gene            complement(637192..637836)
                     /locus_tag="NONO_c05900"
     CDS             complement(637192..637836)
                     /locus_tag="NONO_c05900"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase superfamily domain-containing
                     protein"
                     /protein_id="AHH15402.1"
                     /translation="MRIAHFGHSCVLVEFDGVKILFDPGTFSHGFEGITGLDAIAITH
                     QHPDHIDPNRIEALIDANPSARLLSDPQTAQQRGESWEAVHAGNIVNIGDLQITGGGG
                     KHAVIHPELPVVDNTVFQLGTPDDPAQFVHPGDSLWVPPVSVGVLAVPAAAPWMKISE
                     AVDYLRAVSPRTAVPIHYGIIEPQAQGIYFGRLSEMRPADTEFTLIEPEDHAEF"