LOCUS       CP003563             6476459 bp    DNA     circular BCT 14-FEB-2014
DEFINITION  Sinorhizobium fredii USDA 257, complete genome.
ACCESSION   CP003563
VERSION     CP003563.1
DBLINK      BioProject: PRJNA163675
            BioSample: SAMN02641503
KEYWORDS    .
SOURCE      Sinorhizobium fredii USDA 257
  ORGANISM  Sinorhizobium fredii USDA 257
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
REFERENCE   1  (bases 1 to 6476459)
  AUTHORS   Schuldes,J., Rodriguez Orbegoso,M., Schmeisser,C., Krishnan,H.B.,
            Daniel,R. and Streit,W.R.
  TITLE     Complete Genome Sequence of the Broad-Host-Range Strain
            Sinorhizobium fredii USDA257
  JOURNAL   J. Bacteriol. 194 (16), 4483 (2012)
   PUBMED   22843606
REFERENCE   2  (bases 1 to 6476459)
  AUTHORS   Schuldes,J., Rodriguez,M., Vollstedt,C., Krishnan,H.B., Streit,W.R.
            and Daniel,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-MAY-2012) Genomic and Applied Microbiology,
            Goettingen Genomics Laboratory, Georg-August-University Goettingen,
            Grisebachstr. 8, Goettingen, Lower Saxony 37077, Germany
COMMENT     DNA and Bacteria are available from the Biozentrum Klein Flottbek,
            University Hamburg, Germany. Contact: Prof. Dr. Wolfgang Streit
            wolfgang.streit@uni-hamburg.de.
FEATURES             Location/Qualifiers
     source          1..6476459
                     /organism="Sinorhizobium fredii USDA 257"
                     /mol_type="genomic DNA"
                     /strain="USDA 257"
                     /isolation_source="wild soybean roots"
                     /db_xref="taxon:1185652"
                     /country="China"
     gene            101..1543
                     /gene="dnaA"
                     /locus_tag="USDA257_c00010"
     CDS             101..1543
                     /gene="dnaA"
                     /locus_tag="USDA257_c00010"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="AFL48605.1"
                     /translation="MRHDALFERVSARLKAQVGPDVFASWFGRLKLHSVSKSVVRLSV
                     PTTFLKSWINNRYLDLITNLFQQEDGEILKVEVLVRTATRGQRPAVHEEAVLAAAEPA
                     PAAPARRAASPQPVAAAAATVAAAARPTQAPLFGSPLDQRYNFESFVEGSSNRVALAA
                     ARTIAEAGAGAVRFNPLFIHSSVGLGKTHLLQAVALAALQSARAPRVVYLTAEYFMWR
                     FATAIRDNDALSLKESLRNIDLLVIDDMQFLQGKSIQHEFCHLLNMLLDSAKQVVVAA
                     DRAPWELESLDSRVRSRLQGGVAIEMEGPDYDMRLEMLKRRLEAARQDDASLDIPQDI
                     LSHVARNVTASGRELEGAFNQLLFRRSFEPQLSIERVDELLGHLVNAGEPRRVRIEDI
                     QRVVAKHYNVSRQELVSNRRTRVIVKPRQIAMYLSKTLTPRSFPEIGRRFGGRDHTTV
                     LHAVRKIEELIAGDTKLSHEVELLKRLINE"
     gene            1621..1740
                     /locus_tag="USDA257_c00020"
     CDS             1621..1740
                     /locus_tag="USDA257_c00020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48606.1"
                     /translation="MYSTAWPATETPLGSKSDALPDGIFFVPFVGYLFRHSSF"
     gene            1761..2135
                     /locus_tag="USDA257_c00030"
     CDS             1761..2135
                     /locus_tag="USDA257_c00030"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein R00369"
                     /protein_id="AFL48607.1"
                     /translation="MLYAVLCYNNEDVTSAWSQEEEDKVMRDLTAVQRKYVEAGKLGP
                     VARLLPTTAATTLRHSRGETVVMDGPFAETKEQLLGFYLIDCVSLDEALDFARELSAA
                     NPAAGSYEIRPLSLFKPGELAP"
     gene            2132..3409
                     /locus_tag="USDA257_c00040"
     CDS             2132..3409
                     /locus_tag="USDA257_c00040"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein R00370"
                     /protein_id="AFL48608.1"
                     /translation="MTDTAWIDLALVSARPQAMGALLRYFRSLDLAEEAFQEACIRAL
                     KTWPKNGPPRDPAAWLIFVGRNSGIDKVRRQARETALPPEELLSDLEDRESELADRLD
                     GAHYRDDILRLLFVCSNPALPATQQIALALRIVSGLSVKQIARAFLVGEAAMEQRITR
                     AKARVAAAGIPFETPDAADRAERLAAVATMIYLVFNEGYSAMNGPDGVSADLCDEAIR
                     LSRLLLRLFPSEPEIMGLTALLLLQHSRARARFDAHGAIILLEDQDRRLWNRPMITEA
                     LAMIDKAIRHRRPGPYQIQAAIAALHARAERPELTDWNEIELLYQALERLQPSPVVTL
                     NRAVAVSKRDGPEAALALVEPLADRLSSYFYYHGLRGGLLKQLDRSREARVAFDRAIA
                     LATNAAEAAYIRKQLDHLEADAIASITPAEEKQ"
     gene            3484..3966
                     /locus_tag="USDA257_c00050"
     CDS             3484..3966
                     /locus_tag="USDA257_c00050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48609.1"
                     /translation="MTAATEIDPINDRELVLIRLIDAPREKVYRAFTDAELLKQWFAP
                     LPWTITEAELDVRPGGTNRFVMRSPEGELYPNQGVYLEVVPNEKLVMTDAYTEAWKPS
                     EKPFMTAILTFEDEGGKTRYTARARHWSVADRETHEKMGFHEGWGQCADQLAALVARL
                     "
     gene            3981..4841
                     /locus_tag="USDA257_c00060"
     CDS             3981..4841
                     /locus_tag="USDA257_c00060"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glyoxalase family protein"
                     /protein_id="AFL48610.1"
                     /translation="MSITESSNAAEIRAVIEDWAEAMRQKDAGRVLSHGTEDCLVFSL
                     APPLKASDAGAGELEQWFSTWKGPLGYRLQDLEISSSDDVAFATALAHLSGEKQNGDK
                     PALWYRQTLGLKRTDKGWKIAHQHESVPFYMDGSVKAAIDLDPTSQVDWDAPSHPPMA
                     GVVAYLNVENADATAKFYSRAFGAKEEDRKYAEDGKRLIHCHLTINGGALMLNDPFPE
                     FGIPWKPPEGFVLHLIVDDANFWWKRAVAAGAEVTMPLEIAFWGDYYGQLRDPFGVTW
                     GIVAPVKKSD"
     gene            4974..5588
                     /locus_tag="USDA257_c00070"
     CDS             4974..5588
                     /locus_tag="USDA257_c00070"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase domain protein"
                     /protein_id="AFL48611.1"
                     /translation="MILHYQTHSPFARKTLVFANEAGIADRLEILHHETSPTLRNDRV
                     YAENPLGKVPVLLRTEGAPIFDSDVICAYLDTIHDGRKFIPESGDCRWQALTLQSVAQ
                     GLAQTGIALRWETVRRPEPLRYGALRDGYTEKIEATYDWLETVPDFNAPLHVGHIARA
                     TALSWMAFRALPSFHNRPRLNRWFDQFERRPSMRATPLSGDTHD"
     gene            complement(5648..6832)
                     /locus_tag="USDA257_c00080"
     CDS             complement(5648..6832)
                     /locus_tag="USDA257_c00080"
                     /EC_number="1.3.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="oxygen-independent coproporphyrinogen-III
                     oxidase-like protein"
                     /protein_id="AFL48612.1"
                     /translation="MIQTVPLSAIGDGMDPGFGVYVHWPFCAAKCPYCDFNSHVRHQP
                     VDQPRFIAAFLQEMASVRALSGPRTVTSIFMGGGTPSLMEPATVGAILEGIARHWHVP
                     DGIEITMEANPSSVEATRFHGYRAAGVNRVSLGVQALNDRDLKFLGRLHNVEDALKAV
                     RLAREIFPRMSFDLIYARPNQTVEEWERELKEAVSYAVDHLSLYQLTIEEGTPFFGLH
                     KAGKLTVPDGEQSAVLYEATQEITAAIGMPAYEVSNHALRGAESRHNLTYWRYGDYAG
                     IGPGAHGRLTDGPSKIATATERNPEAWLRLVEERGEGITEQEPLDLEAQADELLLMGL
                     RLREGVDLARWQTLSGRDPDPDREQFLIEHGFIERIGNSRLRCTPAGMLILDAVVADL
                     AC"
     gene            complement(6840..7484)
                     /locus_tag="USDA257_c00090"
     CDS             complement(6840..7484)
                     /locus_tag="USDA257_c00090"
                     /EC_number="3.6.1.19"
                     /codon_start=1
                     /transl_table=11
                     /product="Non-canonical purine NTP pyrophosphatase"
                     /protein_id="AFL48613.1"
                     /translation="MRKLGDKTLVVASHNAGKIREIRDLIGPLGFEAKSAADLNFIEP
                     EETGTTFEENAAIKALASARASGLPALSDDSGLAVDALGGAPGVYTANWAEREDGSRD
                     FAMAMERVEKALQENGATEPEDRTARFVSVLCLAWPDGHVELFRGEVEGKVVWPPRGT
                     SGFGYDPVFQPQGYDTTFGEMSAEEKHGWKPGDSEALSHRARAFKLFAETCLGA"
     gene            complement(7518..7934)
                     /locus_tag="USDA257_c00100"
     CDS             complement(7518..7934)
                     /locus_tag="USDA257_c00100"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="AFL48614.1"
                     /translation="MAPALEGILETALYADDLDAAEAFYGNVLGLERITRVGDRHVFF
                     RCGDGVLLIFNAAETMKPPATGALPVPPHGTKGKGHMCFRIAAEALDTWKAKLETAGV
                     AIEADIRWPNGARSFYFRDPAGNSLECAEPGLWAID"
     gene            complement(7986..8705)
                     /gene="rph"
                     /locus_tag="USDA257_c00110"
     CDS             complement(7986..8705)
                     /gene="rph"
                     /locus_tag="USDA257_c00110"
                     /EC_number="2.7.7.56"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH"
                     /protein_id="AFL48615.1"
                     /translation="MRPSGRKTDQMRKVSFERNFSKHAEGSCLVRFGDTHVLCTASLE
                     EKVPAWLRNGGKGWITAEYGMLPRATGERMRREASAGKQSGRTQEIQRLIGRSLRAVV
                     DLPALGERQISIDCDVIQADGGTRTASITGAWIALHDCLKWMEARNMIKLERVLKDHV
                     AAISCGIFANQAVVDLDYLEDSAAETDANFVMTGSGGLVEIQGTAEGKPFTEEEFASL
                     MQLAKDGISELVALQKQAIAG"
     gene            8863..9942
                     /gene="hrcA"
                     /locus_tag="USDA257_c00120"
     CDS             8863..9942
                     /gene="hrcA"
                     /locus_tag="USDA257_c00120"
                     /codon_start=1
                     /transl_table=11
                     /product="heat-inducible transcription repressor HrcA"
                     /protein_id="AFL48616.1"
                     /translation="MVLRNPETKGVASTLDERSGEIFRRIVETYLESGEPLGSRNLSR
                     LLPMSLSPASVRNVMSDLEGLGLIYSPHVSAGRLPTQTGLRFFVDAFMQVGSLSPEER
                     TSIERQVRRAERDQPIDSLLAEASQMLSGMSRGAGLVITTKSDPVLKHVEFIRLAPTK
                     ALAVLVGEHDQVENRIIELPAGVTSAQLTEAANFVNAHLAGQTIPELRSQLEKVKQTV
                     RGELDALSQDLVERGLAIWSGSEGDEKPARLIVRGRANLLEGLEGTEDIERLRMLFDD
                     LEKKDSLIELLNLAESGPGVRIFIGSENKLFSLSGSSLIVAPYRDSDDRIIGAVGVIG
                     PTRLNYSRIVPMVDYTAQLMSRLSR"
     gene            10101..10724
                     /gene="grpE"
                     /locus_tag="USDA257_c00130"
     CDS             10101..10724
                     /gene="grpE"
                     /locus_tag="USDA257_c00130"
                     /codon_start=1
                     /transl_table=11
                     /product="protein GrpE"
                     /protein_id="AFL48617.1"
                     /translation="MTDETNKNGPEAAAPEETVTTAAPEAEAPEADASAAAPDALELA
                     KAESAELRDKYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARDMLAVSDNLRRALEAI
                     PAEARESGDAGLMALIEGVEMTERSMLAALERHGVKQLDPTGQRFDPNFHQAMFEVPN
                     AEVPNNTVVQVVQAGYTIGERVLRPAMVGVAKGGPKVAAAESETPAA"
     gene            complement(10987..12222)
                     /locus_tag="USDA257_c00140"
     CDS             complement(10987..12222)
                     /locus_tag="USDA257_c00140"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-linked oxidoreductase"
                     /protein_id="AFL48618.1"
                     /translation="MLQAGGHWRNWVGNQSCIVRHRGVPGSEAELAEMVRQATSAGLN
                     VRCAGSGHSFTPVALTSGLHLTLSGMQGVANIDQTRKRVSVSAGTTINQLGKALKSNG
                     LSLINQGDIDSQALAGALTTGTHGTGAALGNMASQIVGMRLVQPDGSILVVDETTPDL
                     LEASRVSVGMLGVISEITLQVMDSYNLHEKLWRCDFDECMEQHDELAAKHRHFGFFWC
                     PVPESRHCYCLPDTSSVSTTEKTADVCEMKVIDITDRPPMDDAFERIAYSSEIYPIEY
                     VPNFHELEYAVPVAHGKEAVKAVRKLMLEKHPTCIYPIEYRFTAGDSGWISPFYEQDS
                     ITLSVSGEPGTDYWDYLKDVDTILRQYGSRPHWGKLHFLGAEDVTALYPRSGDFRALR
                     AKVDPECRFLNDHLRQLFA"
     gene            complement(12233..13000)
                     /gene="cpnA"
                     /locus_tag="USDA257_c00150"
     CDS             complement(12233..13000)
                     /gene="cpnA"
                     /locus_tag="USDA257_c00150"
                     /EC_number="1.1.1.163"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclopentanol dehydrogenase CpnA"
                     /protein_id="AFL48619.1"
                     /translation="MTGRLAGKVALISGGAGGCGLAASQLFAREGAKVGIVDLPKSKG
                     EEVAEAIRAEGGQAVFAAADVSVSAEVSAAVRTVEDAFGPITVLFNHAGILAVGPFLE
                     TEEEEWDRLMAVNVRSMFLMTKAVLPGMIGAGGGSIVCTSSISAVAATPMEVLYDTTK
                     GACHMFARAIAVEFRDRGIRCNAVCPGFIATDHGKREVAGLSKYGVDVSEAAIAAQQG
                     RMCDPMEVANAALFLACDESSFVNGTHLFVDNCFTAV"
     gene            complement(13264..13728)
                     /gene="ptsN"
                     /locus_tag="USDA257_c00160"
     CDS             complement(13264..13728)
                     /gene="ptsN"
                     /locus_tag="USDA257_c00160"
                     /EC_number="2.7.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulatory protein PtsN"
                     /protein_id="AFL48620.1"
                     /translation="MALAGLLHQNAIIPAMRANSKKQLLLELAARASKLTGLPEREIF
                     DVILQRERLGSTGVGNGIAIPHGKLGNLSSLIGIFARLDTPVDFEALDDQPVDLVFLL
                     LAPEGAGADHLKALSRIARVLRDHDMVTRIRGTDSASAIYMLLNEDTTSHAA"
     gene            complement(13903..14475)
                     /locus_tag="USDA257_c00170"
     CDS             complement(13903..14475)
                     /locus_tag="USDA257_c00170"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sigma(54) modulation protein"
                     /protein_id="AFL48621.1"
                     /translation="MSVRVSGKHMEIGESFRSRIGEQVREAVTKYFDGGYSSQVTVEK
                     SGSRFSADCKLHLDTGVVLQANGQANEPQAAFDAASDRIEKRLRRYKRKLKDHHNGNG
                     QNAAEVAYMVMDSVPFEDEEVPDDYAPTIVAETTKQLRTMSVANAVMALDMTDEPVLM
                     FRTPGKEDLNIVYRRNDGNIGWIDAANIKR"
     gene            complement(14666..16228)
                     /gene="rpoN"
                     /locus_tag="USDA257_c00180"
     CDS             complement(14666..16228)
                     /gene="rpoN"
                     /locus_tag="USDA257_c00180"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-54 factor RpoN"
                     /protein_id="AFL48622.1"
                     /translation="MALSASLHLRQSQSLVMTPQLMQSIQLLQMTHLELAQFIAQEVE
                     KNPLLEFQSGEETGFGSDRAERDEAGLAPEAGGGAEEPIGQGDLYDSATSSSSERLSE
                     ELDADFANVFQDDTAPQRADAPELLGQWKSMPGAGGSDDGEGYDLDDFVAGRKTLRET
                     LLEQIPFALGAPSDRLIAQHLIDQLDEAGYLHAEIGETAARLGASAADVTRVLLVLQQ
                     FDPPGVFARTLSECLAIQLRLRNRLDPAMEALVANLELLARRDFATLKKICGVDEEDL
                     VDMLAEIRKLDPKPGTSFETSVTEAIIPDVIVRSAPDGGWLVELNPDALPRVLVNHAY
                     FAEISRHSRKNSTDQTFLSECMQNANWLTRSLDQRARTIMKVASEIVRQQDAFLVHGV
                     DQLRPLNLRIVADAIKMHESTVSRVTSNKYMLTPRGLFELKYFFTVSIGSAENGDAHS
                     AESVRHRIRTMINQESADAVLSDDDIVDILKQAGVDIARRTVAKYREAMNIPSSVQRR
                     REKRALAKAAGF"
     gene            complement(16369..17196)
                     /locus_tag="USDA257_c00190"
     CDS             complement(16369..17196)
                     /locus_tag="USDA257_c00190"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter ATP-binding protein
                     R00382"
                     /protein_id="AFL48623.1"
                     /translation="MQDSDVQIPFFPKRKRVKKPSAAAVAARPVDKARYDGTLIARGL
                     TKSYRSRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPVDEGSIEINGNDV
                     TTMPMYRRARLGVGYLPQEASIFRGLTVEENIRAVLEIHDKNVDRRESKLNDLLGEFS
                     ITHLRKAPAIALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVADIQALVRHLT
                     SRGIGVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVTNPDVRRLYLGDNFSL"
     gene            complement(17196..17756)
                     /locus_tag="USDA257_c00200"
     CDS             complement(17196..17756)
                     /locus_tag="USDA257_c00200"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein R00383"
                     /protein_id="AFL48624.1"
                     /translation="MSVTSTVSFKVSATLAAAGIGALMIASGALAQATSSRMKGMQLS
                     NDKPIQIESDKLEIKDPESKAIFTGNVKVVQGTTTLQAGSMTVFYKTGGGTISGGNAD
                     IDRIEVSKQVFLNSGVQQATADTGSFDLTRQTLVLKGDKVVLSEGKNVFVGCQLNVQM
                     DTGEAQLEACGGRVQIQLDPQSRKQN"
     gene            complement(17771..18490)
                     /locus_tag="USDA257_c00210"
     CDS             complement(17771..18490)
                     /locus_tag="USDA257_c00210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48625.1"
                     /translation="MRILRISQDPNGTDGPLMLNQAHFPDIFSDSGTSSADAYASAAR
                     HSARVKRLKVVLPLAAGVIALIFAVVSFVRAFLPEDLQLETATIENGKIVMQNPAISG
                     RNRQDISYSMKAQRALQDIANPDIITLEQIHAEMPVNDTMVATVDATSGIYDRGGNTL
                     DMNAPFTISMNNGVNADFQSAYLDIDAGEMETKRPIAISMKGGSIIAQSLRMTDKGRV
                     VTFEGMVRVNVEPSAIRKNAK"
     gene            18699..19658
                     /gene="sppA"
                     /locus_tag="USDA257_c00220"
     CDS             18699..19658
                     /gene="sppA"
                     /locus_tag="USDA257_c00220"
                     /EC_number="3.4.21.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative signal peptide peptidase SppA"
                     /protein_id="AFL48626.1"
                     /translation="MDELAIADRRSLRRKLSFWRWTAAAILVLGGFALIAFSGWTEVS
                     ERAREHVARVTVSGLIQDDRELVERLERIADNNSAKALIVTISSPGGTTYGGEVLYKA
                     IRKVAAKKPVVADVRTLAASAGYLIALAGDRIVAGETSITGSIGVIFQYPQVKQLMDK
                     VGVSLESIKSRPLKAEPSPFHPPSPEARAMIQTMIDDSYNWFVDLVAERRKLPRPEAL
                     ALADGRIFTGRQALKGKLVDTIGGDDEIRAFLAERKVSKDLPVVDWEEPGGSFPFGLS
                     TVVSHWLKLLGYDAFPAMNGLEKIGGDKLFLDGLVSVWQVDAQ"
     gene            19780..20082
                     /gene="ihfB"
                     /locus_tag="USDA257_c00230"
     CDS             19780..20082
                     /gene="ihfB"
                     /locus_tag="USDA257_c00230"
                     /codon_start=1
                     /transl_table=11
                     /product="integration host factor subunit beta"
                     /protein_id="AFL48627.1"
                     /translation="MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAGGNRVE
                     LRGFGAFSVKNRPSRSGRNPRTGDSVFVEEKWVPFFKTGKELRERLNPGMNDKDED"
     gene            20204..20545
                     /locus_tag="USDA257_c00240"
     CDS             20204..20545
                     /locus_tag="USDA257_c00240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48628.1"
                     /translation="MFKKIVNIVVLVPLAVILIALSVANRQTVTLALNPFDTADSVLS
                     VSAPFFLFLFLAVTVGLILGAAAVWLSQGKYRRRARNEAHEALKWHREAEKHRSEAER
                     LAQTNLPAPQN"
     gene            complement(20570..21022)
                     /locus_tag="USDA257_c00250"
     CDS             complement(20570..21022)
                     /locus_tag="USDA257_c00250"
                     /codon_start=1
                     /transl_table=11
                     /product="putative carbon monoxide dehydrogenase subunit
                     G"
                     /protein_id="AFL48629.1"
                     /translation="MDITGEERIAARREAVWQCLNDPDILKRCIPGCQAIEAVSPTEL
                     TAVVKVKIGPVSATFNGTVMLSNLNPPESYRISGEGKGGIAGFAKGGADVTLTEASDE
                     TVLRYDVKAEVGGKLAQLGSRLIDSTAKKLAQQFFANLNLAVSGEAAD"
     gene            21216..22340
                     /locus_tag="USDA257_c00260"
     CDS             21216..22340
                     /locus_tag="USDA257_c00260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48630.1"
                     /translation="MKEKDRRSKNASVTAARGRGAEARGGRHEHGHLPAKSGPPKGKG
                     GPPPQKLQRPAAQESAPARAIEPRTGEKPAETVPLILETVPTAGYHLIDSGDGEKLEQ
                     YGPYRIVRPEAQALWPKALPTAVWERADAIFTGDTDEDGLGRWRFSNEALGETWPMQL
                     LDTDFLGRFTSFRHVGVFPEQLAHWSWMKDQVASAGRPLKVLNLFGYTGVASLIAAKA
                     GAEVTHVDASKKAIGWARENQTMARAEKLPIRWICDDAMKFIQREERRGSRYDIILTD
                     PPKFGRGPNGEVWQLFDHLAAMLDICREILSPDARGLVLTAYSIRASFYSIHELMRET
                     MRGCGGRVESGELIIREGGLDGKAPGRALSTSLFSRWVPK"
     gene            22337..23194
                     /gene="ysgA"
                     /locus_tag="USDA257_c00270"
     CDS             22337..23194
                     /gene="ysgA"
                     /locus_tag="USDA257_c00270"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative tRNA/rRNA methyltransferase YsgA"
                     /protein_id="AFL48631.1"
                     /translation="MNSDRSDHGTPRVGQVKEVTSLTNPIIKDIRALAQKKHRDETRS
                     FMAEGLKLVIDALDLGWKIKTLVYAKGAKGKPQVEQVAAKTVAKGGLVLEVNEKVIST
                     ITRRDNPQMVVGIFEQRYQPLKDIRPGEDQTYVALDRVRDPGNLGTIIRTADAAGASG
                     IILIGETTDPFSLETVRATMGSVFAMPIVRTSVEDFIRWQSSAGVQVVATHLAGSVDY
                     RTIDYRSKPVVLLMGNEQAGLPVELAREAAALARIPQAGRADSLNLAIATGIMLFEAR
                     RHLLSTDAR"
     gene            23194..23694
                     /gene="lspA"
                     /locus_tag="USDA257_c00280"
     CDS             23194..23694
                     /gene="lspA"
                     /locus_tag="USDA257_c00280"
                     /EC_number="3.4.23.36"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein signal peptidase LspA"
                     /protein_id="AFL48632.1"
                     /translation="MSERNTLFSRPLPIALFILVAIVADQAVKYLVEAFLPFQEAVPV
                     VPMLALYRTYNFGVAFSMLSGMEGWFIVGIRLAVVAFVLWLWRRTPKDRFFAHLGYAM
                     IIAGALGNLVDRLLFGYVIDYILFHTTSWSFAVFNLADSFITVGAGAIVLDELLQAKR
                     TRSLKL"
     gene            23742..25997
                     /gene="rpfC"
                     /locus_tag="USDA257_c00290"
     CDS             23742..25997
                     /gene="rpfC"
                     /locus_tag="USDA257_c00290"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="sensory/regulatory protein RpfC"
                     /protein_id="AFL48633.1"
                     /translation="MSEPSSVMPRKQASSGARSAAVDLVPSAVGAATVRRSAIDRETS
                     LGRILFALAGLVAAALLLVVGARAGLHLLPALAAVGALAGAFLLLADDSAASVRASAT
                     GEITGKAERQCSATAKLLSTIHDALGDIALIRGMDGRIVQANAVFSRLCGHADVRGLT
                     CASLGLSFEPRPGPDRFIVRFATPAGLRLYDWHEVVIREPATGRLMRHSIARDVTEEA
                     QSARRGEEARLRAEEASQAKSRLLATVTHEIRTPLSGILGMSHLLAQTKLSAEQRNYL
                     ADMQQSGHALVQLVEDLIDFSSLSAGRFQLHPSEQDLRLVIENVVEMLSHRAHEKGIE
                     IGAAIDTNVPSRVAFDAARLRQVLFNVIGNAVKFTEAGGVLVTADFGEGRVRIRVDDS
                     GPGMAADELARVFEEFEQAGDDAQRSKGTGLGLAISRRIVEAFGGCLTASSVTGEGSR
                     FEVRFPVEAVDAAAQLRRGVLAEAHVLLLAPDGPASAALAATVETLGGRCRRAPTLAA
                     ARGVVAQVLAGHLPLTDIIVDHRHAAQFRELLSREPGLERLRLRKTCLISPEERTSHP
                     VNRMGGYEAWLIRPLREKSLVEVLLGRLTGIEKRDGINDNRPILRAEPRKAAAVSQDG
                     RRVLLAEDDPVNALVLRKMLERAGHTVDHIGDFAALETALQGKEAPGLIVTDFNMPGG
                     DGLALLRRLRGREAPGSWSRVPVVVLTSDMRSDLHHLLLAAGADAVHTKPAEPARFLA
                     EVARLLETGQP"
     gene            26114..27004
                     /locus_tag="USDA257_c00300"
     CDS             26114..27004
                     /locus_tag="USDA257_c00300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48634.1"
                     /translation="MTIDLLDSTSVVDTSRACVRKTIAAPATDVLGRIANLETRLARS
                     AAEIDAAQAVRYRVFVEEMKAQVAPEAERRKRDVDGWDAICDHLLVLDTSIEGDPEEQ
                     IVGTYRLLRQEVAARAGGFYSASEFAIGNLLARHPGKRFMELGRSCVLPEYRTKRTVE
                     LLWQGNWAYALKHGIDAMFGCGSFPGVVPEEHALALSFLHHNVLARDEWTVAARPELF
                     RTMDLMPSEAINPKKALAALPPLIKGYMRLGAMVGEGAVVDHAFRTTDVLIVLPISNI
                     SGRYLNYYGADAGRFSSSVS"
     gene            complement(27503..29788)
                     /gene="tme"
                     /locus_tag="USDA257_c00310"
     CDS             complement(27503..29788)
                     /gene="tme"
                     /locus_tag="USDA257_c00310"
                     /EC_number="1.1.1.40"
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent malic enzyme Tme"
                     /protein_id="AFL48635.1"
                     /translation="MPATDKSDRTMTSVTAQEALDFHSQGRPGKLEISPTKPMATQRD
                     LSLAYSPGVAVPVKAIAEDPATAYDYTARGNMVAVISNGTAILGLGNLGALASKPVME
                     GKSVLFKRFADVDSIDLEVDTENVDEFINCVRFLGPTFGGINLEDIRAPDCFIIEQRL
                     REVMDIPVFHDDQHGTAIIAAAGLINALALTGRDFKTTKLVCNGAGAAAIACIELIKA
                     MGFNPENIILCDTKGVIYQGRTEGMNQWKSAHAVKTDRRTLAEAVEGADVFFGLSAKG
                     ALSPDMVRSLAPRPIIFAMANPDPEITPEEVAQIRDDAIVATGRSDYPNQVNNVLGFP
                     YIFRGALDVRASTINDAMKIAAAEALASLAKEDVPDDVAAAYQGNRPRFGPQYIIPVP
                     FDPRLISAIPMAVAKAAMETDVARKPITDLNAYGQQLSARRDPIASTLQRIYERVRRQ
                     PKRIVFAEGEEVQMMRSAIAYANQQLGTAILLGREEQMRETAEREGIDLDRPGIQIVN
                     ARLSKRVGAYTDFLYARLQRKGYLFRDVQRLINNDRNHFAASMVALGDADGMVTGLTR
                     NYSTALEDVRRCIDAKPGHRVIGVSIALCRGRTVLVADTAVHDMPSAEELADIAEEAA
                     GLAKRLGYVPRVAMLAYSTFGHPSGERSERVREAVKILDRRRVDFEYDGEMAADVALN
                     HRVMEQYPFCRLSGTANVLVMPAFHSASISTKMLQELGGSTVIGPLLVGLDKSVQIAS
                     MSAKDSDIVNLAAIAAYNAGT"
     gene            29891..32638
                     /gene="mutS"
                     /locus_tag="USDA257_c00320"
     CDS             29891..32638
                     /gene="mutS"
                     /locus_tag="USDA257_c00320"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="AFL48636.1"
                     /translation="MNFMSDASSRTGDVLSVSELASEESRSTATPMMEQFIEIKANNP
                     DSLLFYRMGDFYELFFKDAVEASRALGITLTKRGQHLGQDIPMCGVPVHAADDYLQKL
                     IALGFRVAVCEQVEDPAEAKKRGSKSVVRRDVVRLVTPGTITEDKLLSPSESNYLMAL
                     ARIRSGSEPAYALAWIDISTGIFRLAETGESRLLADILRVEPRELILPDTVFHDPELR
                     PVFDVLGRVAVPQPAVLFDSATAEGRIARYYGVKTLDGFGTFSRAELAAASAAISYVE
                     KTQLAERPPLGIPERESAASTLFIDPATRANLELVKTLSGARDGSLLRALDRTVTSGG
                     ARLVAERLMSPLTDPERINRRLDSIEVLLDQPSFAMDVRDTLRRAPDMPRALSRLALG
                     RGGPRDLGAIQAGLRAAAATSTLLSGARLSAELAEAQAAIAALPASLLARLDSTLAED
                     LPLLKRDGGFLREAASGELDEVRALRDQSRRVIAGLQLQYCEETGIKSLKIKHNNVLG
                     YFIEVTAGNAGAMTDTDAGRARFIHRQTMASAMRFTTTELAELETKIANAADRALAIE
                     LEAFEAMTREVVAHAEAIKAAALALATLDVSAGLAVLAEEQNYARPVVDHSRKFLIDG
                     GRHPVVEQALRRQAGNPFVANGCDLSPTDGPEAGAIWLLTGPNMGGKSTFLRQNALIA
                     IMAQMGSFVPANAAHIGIVDRLFSRVGASDDLARGRSTFMVEMVETAAILNQASDRSL
                     VILDEIGRGTATFDGLSIAWAAVEHLHEVNRCRGLFATHFHELTVLSEKLGRLSNATM
                     RVKEWDGDVIFLHEVGPGAADRSYGIQVARLAGLPASVVARARDVLAKLEDADRKNPA
                     SQLIDDLPLFQVAVRREEAARVSGPSKVEEALRAINPDDMTPREALDALYTLKKDLAG
                     R"
     gene            32896..35811
                     /gene="glnD"
                     /locus_tag="USDA257_c00330"
     CDS             32896..35811
                     /gene="glnD"
                     /locus_tag="USDA257_c00330"
                     /EC_number="2.7.7.59"
                     /codon_start=1
                     /transl_table=11
                     /product="[protein-PII] uridylyltransferase GlnD"
                     /protein_id="AFL48637.1"
                     /translation="MQDRLHLQRTIRSVGQDASRHYMARHETSFLEILDVAALRAKCG
                     FIASAHAEQREPMRRALLAAFKEANNAGRAKARELLAADGAGIKCAERISWLQDQLIT
                     VLHDFVLNEVFDAAHAPPATRLAVTAVGGYGRGTLAPGSDIDLLFLLPSKKAVWAEPA
                     IEFMLYVLWDLGFKVGHATRTIDECIRLSRADMTIRTAILECRYICGSEALAGELEQR
                     FDHEIVRNTGPEFIAAKLAERDGRHRKAGDTRYLVEPNVKEGKGGLRDLHTLFWIAKY
                     FYRVKDPADLVKLGVLSRQEYKLFQKSDDFLWAVRCHMHFLTGKAEERLSFDIQREIA
                     EALGYHDHPGLSAVERFMKHYFLVAKDVGDLTRIFCAALEDQQAKDTPGISGVFSRFR
                     HRTRKIAGTLDFVDDGGRIALASPEVFKRDPVNLLRLFHIADIHGLEFHPAALKQVTR
                     SLSLITPHLRENDEANRLFLSILTSRRNPELILRRMNESGVLGRFIPDFGKIVSMMQF
                     NMYHHYTVDEHLLRTVDVLSRIDRGLEEEAHPLTAMLMPSIEDREALYVAVLLHDIAK
                     GRPEDHSVAGAKVARKLCPRLGLSPKQTETVVWLVEEHLTMSMVAQTRDLNDRKTILD
                     FAERVQSLDRLKMLLIMTVCDIRAVGPGVWNGWKGQLLRTLYYETELLLSGGFSELSR
                     KERAKHAALILGDALKDWPKKERDAYVRLHYQPYLLTVAVEDQVRHAEFIREADRAGK
                     TLATMVRTHHFHAITEITVLSPDHPRLLTVIAGACAAAGANIVDAQIHTTADGRALDT
                     ILVNREFSVDEDETRRAASIGKLIEDVLSGRKRLPEVIASRTRARKRSKAFTVTPEVT
                     ISNTLSNKFTVIEVEGLDRTGLLSEVTAVLSDLSLDIASAHITTFGEKVIDTFYVTDL
                     VGAKITNENRQANIAARLKAVLAGEVDEARERMPSGIIAPAHPPRISNASKTTKAET"
     gene            35808..37415
                     /gene="murJ"
                     /locus_tag="USDA257_c00340"
     CDS             35808..37415
                     /gene="murJ"
                     /locus_tag="USDA257_c00340"
                     /codon_start=1
                     /transl_table=11
                     /product="protein MurJ"
                     /protein_id="AFL48638.1"
                     /translation="MSLVKKFATVGGATLGSRVFGFVRETFMAAALGTGPVADAFNTA
                     FRLPNTFRRLFAEGAFNAAFVPLFAKEIEARGMEGARRFSEEVFGVLFTVLLLLTIAM
                     ELAMPFIVRELIAPGFADDPAKFASTVTFATIMFPYLACMSLAAMMAGMLNSLHRYFA
                     AAIAPVFLNFILIGVLVYAWYIGQDTVAVGYGLSWGVMAAGLVQLAIVWIAVRNAGIR
                     IGFRRPRLTANVTRLLVLALPAAITGGITQINLLINTNIASAKEGAVSSLVYADRIYQ
                     LPLGVVGIAVATVLLPELARALRAGNLSEASNLQNRSVEFTLFLTLPAAAALLVMSEP
                     IVRLLFERGKFSPEATVVVGHILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAI
                     SVAVNVSLALTLFPSLAASGIATAEVVAGWVNALLLFATLAWRGHWGRDIPLLTRIPR
                     LVVAAGIMAAALHYAIQWLAFPLSSAAPVLTQAATVCGLMAAAMMIYFAAAFGLGGAS
                     LGMIRRSLKRKAVSAPESPAGEGADTP"
     gene            37662..38957
                     /gene="trpS"
                     /locus_tag="USDA257_c00350"
     CDS             37662..38957
                     /gene="trpS"
                     /locus_tag="USDA257_c00350"
                     /EC_number="6.1.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan--tRNA ligase TrpS"
                     /protein_id="AFL48639.1"
                     /translation="MISPATTPPCSRSASKSSRRRAMKPTEPWPSSPIRSAIAGTSCN
                     PPDRCVPLDCIWPAVHKRGDINWWALHKPDGDDMNEFKPLVFSGVQPTGNLHLGNYLG
                     AIRKFVALQENNDCIYCVVDLHSITAQLVHEDLPGQIRSIAAAFVASGIDPEKHIVFN
                     QSAVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKDRENASLGLLAYPSLMAADILVY
                     RATHVPVGDDQKQHLELTRDIAQKFNIDFMEHIRRGGYGVDIVVGEEPIHAYFPPVEP
                     LIGGPAPRVMSLRDGTKKMSKSDPSDLSRINLMDDQEMIARKIRKAKTDPDALPSEVE
                     GLKGRPEAENLVGIYAALSDRSKDEILAEFGGQQFSVFKPALIDLAVDVLSPITGEMR
                     RLMDDTAHIDAILRDGGERARARAEKTMREVREIIGFLQ"
     gene            39010..39501
                     /gene="uspA"
                     /locus_tag="USDA257_c00360"
     CDS             39010..39501
                     /gene="uspA"
                     /locus_tag="USDA257_c00360"
                     /codon_start=1
                     /transl_table=11
                     /product="putative universal stress protein UspA"
                     /protein_id="AFL48640.1"
                     /translation="MVSTRLSRLEGHRRKFMAVIDDTPECGRAVHYAGLRAKNSNGGL
                     VLLYVIADGDFQQWLGVEEIMRAEAREEAEATLAKIAQTVRERIGIEPEIVIREGIAT
                     EQIYALIEEDRDIAILVLAAGSAKEGPGPLVSSIAGKAAAFPIPVTVIPDLLTDEEID
                     ALT"
     gene            39609..40175
                     /locus_tag="USDA257_c00370"
     CDS             39609..40175
                     /locus_tag="USDA257_c00370"
                     /codon_start=1
                     /transl_table=11
                     /product="putative scaffold protein Nfu/NifU"
                     /protein_id="AFL48641.1"
                     /translation="MFIQTEATPNPATLKFLPGKVVMESGTAEFRSEDEARAGSPLAV
                     RLFSIPGVSGVYFGYDFITVSKEGQEWQHLKPAILGSIMEHFMSGQPIMSGASRAEET
                     DQEGEFFDEGDEAIVATIKELLDTRVRPAVAQDGGDITFRGFKDGTVFLNMKGACSGC
                     PSSTATLRHGVQNLLRHFVPEVQSVESV"
     gene            40390..41058
                     /locus_tag="USDA257_c00380"
     CDS             40390..41058
                     /locus_tag="USDA257_c00380"
                     /codon_start=1
                     /transl_table=11
                     /product="putative peptidase M22, glycoprotease"
                     /protein_id="AFL48642.1"
                     /translation="MLVLAIDTSGSGCAAAVYDGAAGEVLARAGADIGRGHAERLMEF
                     VDEALLASDRQLAEIDRIAVTIGPGSFTGIRVGVAAARGLALALGKPAVGVTTLQVVA
                     ENAREKQPGRPVLAAIDAKRGEVYVQSFTALGEAEGEAEILPLAEARDRVSGFTGVIC
                     GSGAPLVASAERAGGPDEIDVAFVGRLGAAADPASAKPKPLYLRGPDAKPQAGFAVTR
                     ATAG"
     gene            41141..41638
                     /locus_tag="USDA257_c00390"
     CDS             41141..41638
                     /locus_tag="USDA257_c00390"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ribosomal-protein-alanine
                     N-acetyltransferase"
                     /protein_id="AFL48643.1"
                     /translation="MSFTDYFTRRTEFDIFPLEEADLMAAATLHGQRFAAPWSDGEIH
                     ALLLQDTVFGFAARQTNGTFRPAFGGFVLSRATAGEAEILTIGVDSRFARSGLGWRLM
                     QAVMREAFVKGAETLFLEVDETNLAAIGLYGKLGFAKVGERKAYYQGTAGARTAALVM
                     RLDLR"
     gene            41675..42490
                     /locus_tag="USDA257_c00400"
     CDS             41675..42490
                     /locus_tag="USDA257_c00400"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 1-acyl-sn-glycerol-3-phosphate
                     acyltransferase"
                     /protein_id="AFL48644.1"
                     /translation="MINWIRVALYAILLAIVSLLLMPVQLACLWLDLKPRRFLPRFWH
                     RTACRLLGMRVRVHGELDRRRPLLISANHVSWKDILVLSSIADVVFVAKSDVKDWPVF
                     GLLARLQASVFIERQQKRTTGDQVSEIGRRLADREVVVLFPEGTTSDGNRLLEIKTSL
                     FGAAASAVPQSPTGVVHVQPVAISYTGIHGMPMGRYYRPIAAWPGDIGLLPHLVGVLR
                     EGALDVEVDFGEAVDYDHRSNRKEVSRTIEQRIRSMLSDRLRGRAPAREKTAA"
     gene            42573..43973
                     /gene="miaB"
                     /locus_tag="USDA257_c00410"
     CDS             42573..43973
                     /gene="miaB"
                     /locus_tag="USDA257_c00410"
                     /EC_number="2.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="(dimethylallyl)adenosine tRNA
                     methylthiotransferase MiaB"
                     /protein_id="AFL48645.1"
                     /translation="MTQETALLPKSPVAGDEHVPARKVFVKTYGCQMNVYDSDRMSDA
                     LSRDGYVATDVLEDADFVLLNTCHIREKAAEKVYSELGRLRELKKTKASEGREMVIGV
                     AGCVAQAEGNEILRRAPAVDLVIGPQTYHRLPEALKRARSGERVVETDYAIEDKFEHL
                     PAPDKAKTRARGVTAFLTVQEGCDKFCTFCVVPYTRGAEVSRPVAQIIAEAEKLVDGG
                     VREITLLGQNVNAWHGTGPDGRDWGLGDLLWRLGEIDGLARLRYTTSHPRDMDASLVE
                     AHRSMAKLMPYLHLPVQSGSDRILKAMNRRHTAAEYLALVERIRAIQPDLALSGDFIV
                     GFPGETEEDFEDTMRLVEAVGYAQAFSFKYSSRPGTPGADLTDQVAEEVKAKRLERLQ
                     SLLVNQQRDFAAACVGREIDLLLEKHGRMPGQLVGRSPWLQPVNVDAKRSQIGDIIKV
                     RITKAGPNSLFAEVIE"
     gene            44088..45143
                     /gene="phoH"
                     /locus_tag="USDA257_c00420"
     CDS             44088..45143
                     /gene="phoH"
                     /locus_tag="USDA257_c00420"
                     /codon_start=1
                     /transl_table=11
                     /product="PhoH-like protein PhoH"
                     /protein_id="AFL48646.1"
                     /translation="MNGHEMISSSSRHSNTTATDANHFVLTFENNRFASELFGQFDQN
                     LKLLEERLRVDARPRGNSVAISGDLVATNQARRALDYLYGRLQSGASIDTSDVEGAIR
                     MAVAADDQLQLPTMERKAKLTMAQISTRKKTIAARTPMQDSYIRALERAELVFGVGPA
                     GTGKTYLAVAHAAQLLERGAVDRIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDA
                     LYDMMPGDKVERAITAGVIEIAPLAFMRGRTLANAAVILDEAQNTTSMQMKMFLTRLG
                     ENGRMIVTGDPSQVDLPRGVKSGLVEALQILKGVEGVSVIRFKDADVVRHPMVARIVR
                     AYESHTAVHDESEQSDR"
     gene            45161..45667
                     /locus_tag="USDA257_c00430"
     CDS             45161..45667
                     /locus_tag="USDA257_c00430"
                     /codon_start=1
                     /transl_table=11
                     /product="putative rRNA maturation factor"
                     /protein_id="AFL48647.1"
                     /translation="MMALDIQISVEQGNWPSEDELHVLSTRILGAAADFLAAEEKQPF
                     PDEPPELSLVFTDDTSMRTINAEWRNQDKPTNVLSFPAFPVTPGKMPGPMLGDIIVAY
                     ETLKREADELEKPFEEHLMHLLVHGFLHLFGYDHIEDDEAERMEGLETRILARLGLSD
                     PYGDRAPD"
     gene            45680..46828
                     /gene="tlyC"
                     /locus_tag="USDA257_c00440"
     CDS             45680..46828
                     /gene="tlyC"
                     /locus_tag="USDA257_c00440"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin C"
                     /protein_id="AFL48648.1"
                     /translation="MSDFKTQPATVASEEADASGDADAGSSSTTARAEGNKPISSFWS
                     RAARLWRGAGASSLREDLADALMTDADSNTAFSPEERAMLNNILRFREVRVEDVMVPR
                     ADIEAVDQSITLGELMVLFEESGRSRMPVYSEGLDDPRGMVHIRDLLAYVTRQARNRR
                     RNGKAPNPAAVAEKTPRQPKPGFDLSRVDLNKTVEEAGIIRQVLFVPPSMLASDLMQR
                     MQAARIQMALVIDEYGGTDGLVSFEDIVEMVVGDIEDEHDDDEVMFARSSDDVFVADA
                     RVELEEIAEAIGPDFDVREQLEDVDTLGGLVFASLGRIPVRGEVVQAIPGFEFQILDA
                     DPRRVKRVRIMRKRPPARRRMVKPETLPDALPANGGAQANVPPPTSAE"
     gene            complement(46869..47444)
                     /locus_tag="USDA257_c00450"
     CDS             complement(46869..47444)
                     /locus_tag="USDA257_c00450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48649.1"
                     /translation="MFDSREKIALFIDGANLYATSKSLGFDIDYRKLLSAFQKRGYLL
                     RAYYYTALIEDLEFSSIRPLIDWLDYNGYTVVTKPAKEFTDALGRRKIKGSMDVELAI
                     DALEQRHVVDHYVLFSGDGNFTTLVAALQRNGRKVTVVSTLSTQPPMIADELRRKADY
                     FIDLTSLRSEIDRHPQEAPETVRPTNESVNP"
     gene            complement(47591..47707)
                     /locus_tag="USDA257_c00460"
     CDS             complement(47591..47707)
                     /locus_tag="USDA257_c00460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48650.1"
                     /translation="MLFPDSEVSIDCLRSWRHEGGAISQMTSPTGCDMIELD"
     gene            47767..49419
                     /gene="lnt"
                     /locus_tag="USDA257_c00470"
     CDS             47767..49419
                     /gene="lnt"
                     /locus_tag="USDA257_c00470"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase Lnt"
                     /protein_id="AFL48651.1"
                     /translation="MIRPILRVRPAQPARLGGCMERLAGKIILLSGASRAFVGFLAGL
                     LAMFAQPPFGIFAAAFISFPMLVWLIDGVATHPDDGVVRRLLPAASIGWSFGFGYFLG
                     GLWWLGNAFLVEAELFAWAIPLAVVGLPAVLALFYALAVLIARCLWSDGVGRIAALAV
                     GFGVAEWLRSFLFTGFPWNAVGYAAMPMPLMMQSASVVNVATINMLAVFVFAAPALVG
                     TGKGARIGLAVAAALFAAHIGYGYYRLSLPAPEPLTPERTVRLVQPVIDQAKKMDDRE
                     RAAIFKTHLALTAAPPQEGGKRPDIIVWPETSIPFILTDNPDALTEIAEVLQEGQVLL
                     AGAVRAEDAGAGLPRRYYNSIYVIDDRGQIVGAADKVHLVPFGEYVPFEDVLNSWGLN
                     SLAVAMPGGFSAASNRSVLTLPGGRTLYPLICYEAIFADEIDGNAPVSDALLNVTNDA
                     WFGDTPGPRQHIHQARLRAVETGTPMIRAANTGISAIVDARGVLVVGLGYNYKGVTDA
                     ILPGKMPTPTDSMTRGRIFWFTAAFLLLVAAISRRSLNFRTN"
     gene            49565..49981
                     /locus_tag="USDA257_c00480"
     CDS             49565..49981
                     /locus_tag="USDA257_c00480"
                     /codon_start=1
                     /transl_table=11
                     /product="putative HTH-type transcriptional regulator
                     R00410"
                     /protein_id="AFL48652.1"
                     /translation="MIENKKKPNPIDIHVGSRIRLRRTMLGMSQEKLGESLGITFQQI
                     QKYEKGTNRVGASRLQNISSILNVPVSFFFEDAPGADGAGSGMAEPSSSNYVVDFLSS
                     SEGLQLNRAFVKISDPKVRRKLVDLVKALAAEAESE"
     gene            50207..51475
                     /gene="metK"
                     /locus_tag="USDA257_c00490"
     CDS             50207..51475
                     /gene="metK"
                     /locus_tag="USDA257_c00490"
                     /EC_number="2.5.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthase MetK"
                     /protein_id="AFL48653.1"
                     /translation="MRANYLFTSESVAEGHPDKVCDRISDEIVDLVYREAAKSGVDPW
                     TVRIACETLATTNRVVIAGEVRLPPSLLKKDKNGNDVINPSKFKAAARKAIRDIGYEQ
                     DGFHWKTAKIDVLLHFQSAHIAQGVDNAADKQGEEGAGDQGIMFGYACRETAELMPAP
                     LYYSHRILHLLAAARKKGEGDVARLGPDAKSQVTVRYVDGKPSEVVSLVLSTQHLDES
                     WDSAKVRKVVEPYILEALGDLKIADDCTWYINPTGKFVIGGPDGDAGLTGRKIIVDTY
                     GGAAPHGGGAFSGKDTTKVDRSAAYAARYLAKNVVAAGLAERCTIQLSYAIGVAQPLS
                     IYVDLHGTGKVSEDQVEKAIRKTMDLSPTGIRRHLDLNKPIYAKTSAYGHFGRKAGRD
                     GSFSWEKLDLVKPLKEAISLDSTAINSRAA"
     gene            51706..52419
                     /gene="trmB"
                     /locus_tag="USDA257_c00500"
     CDS             51706..52419
                     /gene="trmB"
                     /locus_tag="USDA257_c00500"
                     /EC_number="2.1.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N(7)-)-methyltransferase TrmB"
                     /protein_id="AFL48654.1"
                     /translation="MTEPRRARATEAFFGRRKGKPLRERQAAQIENLLPALRLDLKEP
                     APDELPALFPAAVTRIRLEIGFGGGEHLIHRAAEDPSTGFIGVEPFVNSMAKLLGQIE
                     AREIDNVRLYDDDATQVLDWLPLASVDQIDLLYPDPWPKRKHWKRRFVSKVNLDRFAR
                     VLKPGGRFCFASDIDSYVNWTLFHCRDHAAFEWTAETSADWLTPFAGWPSTRYEAKAR
                     REGRSSAYLTFRRAYCMYP"
     gene            complement(52643..52900)
                     /locus_tag="USDA257_c00510"
     CDS             complement(52643..52900)
                     /locus_tag="USDA257_c00510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48655.1"
                     /translation="MGLKAITSSLSKHDLAHLGAGEVGYIRKMRSEEVSRCFPEAPEM
                     GPGIDLWALFAADGTPILLTDNRSSTFFKAAEDDLRTVSLH"
     gene            complement(52950..53381)
                     /gene="hspH"
                     /locus_tag="USDA257_c00520"
     CDS             complement(52950..53381)
                     /gene="hspH"
                     /locus_tag="USDA257_c00520"
                     /codon_start=1
                     /transl_table=11
                     /product="small heat shock protein HspH"
                     /protein_id="AFL48656.1"
                     /translation="MSRITPFTSPLLVGFDSMEKTLERIAKANDGYPPYNIERIRGDS
                     AAGTPERLRITLAVAGFSDEDLEVTTEENQLVIRGRQVETGEKDYLHRGIAARQFQRT
                     FVLADGMRVLGAELRNGLLSVDLVRPEPVRMVKKINISVPE"
     gene            53634..54578
                     /gene="rihA"
                     /locus_tag="USDA257_c00530"
     CDS             53634..54578
                     /gene="rihA"
                     /locus_tag="USDA257_c00530"
                     /EC_number="3.2.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrimidine-specific ribonucleoside hydrolase
                     RihA"
                     /protein_id="AFL48657.1"
                     /translation="MTNARKIIIDTDPGQDDAAAIMLAFGSPEEIDVLGITAVAGNVP
                     LTLTTRNARIVCELCNRTDVKIFAGAERPVARPLVTAEHVHGKTGLDGPELSEPAMPL
                     QEQHAVDFIIETLLAEAPGAVTLCTLGPLTNIALALTKAPEIAPRVRELVMMGGGFFE
                     GGNITPAAEFNVYVDPEAAEIVFRSGIPIVMMPLDVTHRVLTHKVRVEKIRAIGSPAA
                     VALAEMLEFFERFDIEKYGTDGGPLHDPTVIAYLLRPELFTGRDCNVEIETASALTTG
                     MTVVDWWQVTGRKHNAKVMRHIDDEGFFDLLTDRLARL"
     gene            complement(54631..56991)
                     /gene="mcpA1"
                     /locus_tag="USDA257_c00540"
     CDS             complement(54631..56991)
                     /gene="mcpA1"
                     /locus_tag="USDA257_c00540"
                     /codon_start=1
                     /transl_table=11
                     /product="chemoreceptor McpA"
                     /protein_id="AFL48658.1"
                     /translation="MFNFHAKSLATKLIAVTGGTIGLVLLASNFVLISQTQDRVETLV
                     FDGAKTEARAIAADIAGSVGELAAAARTMSGVLGRGHAGKSTDRAGAINLLKANLDQH
                     DFAFGSWFAEAPKAFDGKDVVNSIELGGNAEGAFTPYWSKDRNGKAQLSTFRADYAAE
                     WYSLAAKSGKGAITQPYMAEGTDVPTTMTSLAYPVMSDGKMIGVSGVDISLASLADRL
                     ATLKPFGSGRVYLLSQDGKWLAAPIPDLLMKDYEGEGEDVIKNALSSKASGMIRNLTY
                     DGNAPFDRVVYPFKLPDVNANWVILVDVPRTAINAPVNDQTYMMIIGGIVVLAAVLAG
                     LYLAVRRYVQKPLAGLVRDVETLSNGDYAKPISGQDRSDETGSVAKALEGFRHQLADA
                     KRLEGEARREREQAELERSRSETERAETGALQRDIVARLGKGLSHLASGDLAYRIADD
                     FPGEYAQLKRDFNATIESLEETIRTVNHSVVNIGSGTGEISSAANDLSHRTEQQAASL
                     EETAAALDQLTSQVDASAENAKIAAKSVELASSDAEQSGAVVQKAIAAMQGIEQSSHE
                     VSRIIGVIDEIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSANAAKEIK
                     TLINTSAGQVREGVDLVGKTGGALRKIADQVVQINGLIRQISSSASEQAVGLKEINSA
                     VNQMDQVTQQNAAMVEETTAAGMTLNEEARSLTELVSRFRVAQREQTQSSADMLRGTA
                     AKMRTAEAPRPAAETPAARGYSSSTQRVLVQTSGANALAQGSWEEF"
     gene            complement(57272..58171)
                     /gene="rbsK1"
                     /locus_tag="USDA257_c00550"
     CDS             complement(57272..58171)
                     /gene="rbsK1"
                     /locus_tag="USDA257_c00550"
                     /EC_number="2.7.1.15"
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase RbsK"
                     /protein_id="AFL48659.1"
                     /translation="MITVFGSINVDLIATTARLPKPGETVAGTGFSTAAGGKGANQAL
                     AARRAGASVRMAGAVGSDSFAEGALALLKAAGTDLGLTKTVGAPTGTAHILVGGDGEN
                     VIVVVASANATVSEGDAVSAVEQMSAGDTLMLQLEIPAASVEKALVEAKRRGIRSIIN
                     IAPLTPEAARLGRMADIVIANETEFELLAGRSGIAGAEREAAIKGLHDETGQTVIVTL
                     GAEGVAAAHQGEIHRARGLAIEPVDTVGAGDTFCGYLAASLDAGLAFPDALRRAAVAG
                     SLACLKAGAQPSIPLDSEVAARL"
     gene            complement(58223..59476)
                     /gene="rmuC"
                     /locus_tag="USDA257_c00560"
     CDS             complement(58223..59476)
                     /gene="rmuC"
                     /locus_tag="USDA257_c00560"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA recombination protein RmuC"
                     /protein_id="AFL48660.1"
                     /translation="MEPNAFAFDQPLFLIGTFPVTAGHLVTVAALLFVLLAIASARRA
                     RALDADDRDRQLSALLAAQTEMQGRIAAMAEVFGTRQTELNQTLSQRIDGMTHRIGAS
                     ISEQTKATHENLRRLQERLAVIDSAQNNIQSLAKDMAGLQSILANKQTRGAVGQSRME
                     AIVADGLPMGAFTFQATLSNGARPDCIIRMPNDQPPLVIDAKFPLEAWNAMRDAPSAE
                     RRQQAAQSFRRDMEVHIRDVASKYLLAGETQDTAFLFVPSESIFAEIHEHFEAIVQKA
                     HRQRVVIVSPSLLLLSIQVIQAILKDARMREQAHLIQGEVVRLMEDLSRLDERVRKLQ
                     GHFAMTQKDVEDILISSDKLTRRGAKIEALELQAVTPVAQDAKAAGDKATGDKAAGDK
                     AAGDRGDRTVDNRIGQLKLRVVDED"
     gene            59594..60118
                     /gene="def"
                     /locus_tag="USDA257_c00570"
     CDS             59594..60118
                     /gene="def"
                     /locus_tag="USDA257_c00570"
                     /EC_number="3.5.1.88"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase Def"
                     /protein_id="AFL48661.1"
                     /translation="MTIKPLIILPDPVLRQVSTPVETIDDDIRRLADDMLETMYDAPG
                     IGLAAIQIGVPRRLLVLDVSKEGEEKKPLVFINPKIVRSSEERSVYEEGCLSIPDYYA
                     EVERPAAITVEFRDRDGKEQSVEADGLLATCLQHEIDHLNGVLFIDYISKLKRDMVIR
                     KFTKAAKTRGAKAI"
     gene            60303..61238
                     /gene="fmt1"
                     /locus_tag="USDA257_c00580"
     CDS             60303..61238
                     /gene="fmt1"
                     /locus_tag="USDA257_c00580"
                     /EC_number="2.1.2.9"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase Fmt"
                     /protein_id="AFL48662.1"
                     /translation="MPLRIIFMGTPEFSVPTLSALVEARHEIAAVYTQPPRPGGRRGL
                     DLKKSPVHQAAELLGVPVLTPVNFRDAADRQTFRDFDADVAVVVAYGLLLPEEILSGT
                     RHGCYNGHASLLPRWRGAAPIQRAIMAGDRETGMMVMKMDKGLDTGPVALTKTVPIGE
                     TMTAGELHDKLMHVGAALMKEAMAKLEADELTLTPQPEEGVVYAAKIAKDETRVDFTR
                     SAADVHNHIRGLSPFPGTWFELEIAGRIERIKVLGSEPAAAAGSPGTVLDDALTIACG
                     EGAVRPTRLQRAGGKSLATPEFLRGTPIGVGTRIA"
     gene            61238..61981
                     /gene="truA"
                     /locus_tag="USDA257_c00590"
     CDS             61238..61981
                     /gene="truA"
                     /locus_tag="USDA257_c00590"
                     /EC_number="5.4.99.12"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="AFL48663.1"
                     /translation="MPRYRLTVEYDGSDYVGWQRQENGPSVQGAIEKAVLSLTGETVS
                     IRGAGRTDSGVHAMGQVAHLDLTREWASHTLRNALNAHLALAAERVSILDAAEAPPEF
                     DARFSARRRHYLYRIISRRSPLALEARRAWWVPKTLDHEAMHTAAQHLVGHHDFTTFR
                     SAHCQATSPLRTIDRLDVTRSGELIEIRATAQSFLHNQIRSFAGSLKLVGEGKWTPDD
                     LKAALEARDRKACGPVAPPEGLYFMQVDY"
     gene            complement(62002..62598)
                     /locus_tag="USDA257_c00600"
     CDS             complement(62002..62598)
                     /locus_tag="USDA257_c00600"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="AFL48664.1"
                     /translation="MPLIDEVLAYIKGLWLLVQGNREGYQWLDISEGGLWRSFSAILW
                     SLPAMAVSWASWRLYYLSAMPSGTTVGIAFFLKLLVVDLVSWLLPIVLVAALSRPLGF
                     SALVVPVVVTTNWLSVPLSYAMAIPAAILLLARGGHQLTALFSLIVLIAGVVLLFRLL
                     RTITGNQNLLASALTALYLLPSMMLAQYLQHFFGLMPG"
     gene            complement(62582..63778)
                     /gene="dapE"
                     /locus_tag="USDA257_c00610"
     CDS             complement(62582..63778)
                     /gene="dapE"
                     /locus_tag="USDA257_c00610"
                     /EC_number="3.5.1.18"
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-diaminopimelate desuccinylase DapE"
                     /protein_id="AFL48665.1"
                     /translation="MFPTDPISNLAALIRCPSVTPAEGGALTALETMLAPLGFTVDRV
                     VARAAGTPDIENLYARLGAEGPHLMFAGHTDVVPVGDEAAWTQPPFSAAIAGGKMYGR
                     GAVDMKGGIACFVAAVARHIEKHGRPNGSISFLITGDEEGPAINGTVKLLEWAAGKGE
                     RWDACLVGEPTNPESLGDMIKIGRRGSLSGRITVRGVQGHAAYPHLADNPVRGVLQLT
                     QALMDPPFDNGTENFQPSNLEVTTIDVGNAAVNVIPAKASAAFNIRFNDRWTAESLMA
                     EIVARLDRAARDGALRPGRDPVKYEIVWNERPSHVFLTRSNALIDSLSGAVEAVTGRR
                     PKLSTTGGTSDARFIKDYCPVVEFGLVGQTMHMVDERVATADLETLTEIYETFVARWF
                     GHAADR"
     gene            complement(63938..67123)
                     /gene="bepE"
                     /locus_tag="USDA257_c00620"
     CDS             complement(63938..67123)
                     /gene="bepE"
                     /locus_tag="USDA257_c00620"
                     /codon_start=1
                     /transl_table=11
                     /product="efflux pump membrane transporter BepE"
                     /protein_id="AFL48666.1"
                     /translation="MNFSRFFVDRPVFAGVLSVLIFVAGLIGMTGLPISEYPEVVPPQ
                     IVVRAQYPGANPAVIAETVATPLEEQINGVEGMLYMQSQATADGLMTLTVTFELGTDP
                     DQAQQLVQNRVSQAEPRMPEEVRRLGVTTVKSSPDLTLVVHLISPNGQYDINYLRNYG
                     VLNVKDRLARVEGVGQVQIFGGGDYSMRVWVDPEKAAERGLAASDIANAVRGQNVQAA
                     AGVIGASPSVAGLDLQLSVNAQGRLKTPEDFANIVVKSGANGEITRLGDVARVEMGAA
                     DYSLRSLLDNKAAVGMGVFQAPGSNAIQISENIHKAMAELKQTMPEGVDYEIVYDTTQ
                     FVRASIESVVHTLLEAIALVVLVVIVFLQTWRASIIPLVAVPVSIVGTFAVMYVFGFS
                     INALSLFGLVLAIGIVVDDAIVVVENVERNIAQGLSPVQATYRAMQEVSGPIIAIALV
                     LVAVFVPLAFITGLTGQFYRQFALTIAISTVISALNSLTLSPALAALLLKDHHAPKDR
                     LTRIMDALFGWFFRGFNRFFGASSEAYGRGVGGILTRKSLIMGVYVILLGVTFALFRA
                     VPGGFVPAQDKQYLIGFAQLPDAATLDRSEDVIRRMSDIALKHPGVEHAIAFPGLSIN
                     GFTNSSNSGIVFVSLKPFEERTTPELSGGAIAMQLNQEFGAIQDAFIAMFPPPPVQGL
                     GTTGGFKLQIEDKNGLGYRALDDAAKAFLAQAAQTPELAGLYSSYQINVPQLYADLDR
                     TKARQLGVAVTDVFETLQIYLGSLYVNDFNAFGRTYSVRIQADANYRSHADDIGKLKV
                     RSQSGEMIPLSALLKVEQTVGAERAIRYNGFLAADINGGPAPGFSSGQAQAAIERIAA
                     ETLPPGISFEWTDLTYQQILAGNSGILIFPLALLLVYLVLAAQYESLLLPISIILIVP
                     MGIMAALTGVWLTGGDNNVFTQIGLIVLVGLSAKNAILIVEFARELELSGKSAVSAAI
                     EASRLRLRPILMTSMAFIMGVVPLVTSTGAGAEMRSAMGVAVFAGMIGVTAFGIFMTP
                     VFYVLIRKLSGERPLKHAGAHIEAPHLAPGE"
     gene            complement(67251..68453)
                     /gene="bepF1"
                     /locus_tag="USDA257_c00630"
     CDS             complement(67251..68453)
                     /gene="bepF1"
                     /locus_tag="USDA257_c00630"
                     /codon_start=1
                     /transl_table=11
                     /product="efflux pump periplasmic linker BepF"
                     /protein_id="AFL48667.1"
                     /translation="MTSSVARRALWGAGFSILMSIAGGGAVLLGLPARFEADAATEAT
                     AAPAAVPVSVAKAESRRITTWESFSGRLAAIERVEVRPRVGGAILSAHFREGALVEKG
                     DLLVTIDPDPFAAAVERAEAEVAAAEARVALARTELERARKLVTTSAIPQSGVDQRLS
                     AYDEAQANVRSAKAALRSARLDLQYTEVRAPIAGRVGRLEVTAGNLVSAGTASPILTT
                     LVSIDPIYASFNVNEEVVAAALAKLSASAGTDSIERIPVQIGTAADEGTPISGHIQLI
                     NNEVDAATGTIRVRAALENPDGRLIPGQFVRIRIGDPAPAEKLVISDRAIGSDQDKKF
                     VLVVGSDNKVEYRQVTLGPTADGMRIVESGLKPGESIVVNGLQRVRPGVVVAPQPAEQ
                     ATASIAKP"
     gene            complement(68496..69311)
                     /locus_tag="USDA257_c00640"
     CDS             complement(68496..69311)
                     /locus_tag="USDA257_c00640"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipase / esterase"
                     /protein_id="AFL48668.1"
                     /translation="METHFTEETMQTGQGSCCARVYKGASLLTPPPVVLHLHGGGFTG
                     DSVAAGEKVAGALAAAGAVVVSPEYPSACLNPFPAALDAAYAILASMRSRCPQFAHKK
                     SLLFVAGEEAGGNLAAGLALMARDQFLTDLKGQILLSPLLDPCLATPSFRKFCPQSSV
                     QSIADGWQQYLGEGSGLTHPYAAPSHCTRLGGLVPALVITSEECPMRDEAKAYAERLR
                     GAGVPVEMHVLPGRAAWIPANVSAQESWPAQEETISGIFSRFFEKAGAKATQT"
     gene            69448..70356
                     /gene="yhjC1"
                     /locus_tag="USDA257_c00650"
     CDS             69448..70356
                     /gene="yhjC1"
                     /locus_tag="USDA257_c00650"
                     /codon_start=1
                     /transl_table=11
                     /product="putative HTH-type transcriptional regulator
                     YhjC"
                     /protein_id="AFL48669.1"
                     /translation="MDQLTAMRVFLRVVETGNFTRASVSLNMPKATVTNLIQGLEAHL
                     RTKLLNRTTRRVLVTPDGALYYERAARLLSDIDELDGSLSSAQSLPKGRLRVETASAF
                     ANLIIIPALPEFHRKYPDIQIDLGVSDRTVDYLAENVDCAIRGGTLTDQSLIARRITE
                     MKFVSCASPDFLERHSMPQHPSDLEKNCQVVGYFLPTGRQMPFYFRRGSEEIEINGRY
                     VVAANESTTYLAAARAGLGVIQAPFFMVRDDLRAGTMVPVLPDWDVDPTPIYLVYPPN
                     RHLSSRLRVFADWVVKVVAQSQLDGA"
     gene            complement(70467..72368)
                     /gene="deaD"
                     /locus_tag="USDA257_c00660"
     CDS             complement(70467..72368)
                     /gene="deaD"
                     /locus_tag="USDA257_c00660"
                     /EC_number="3.6.4.13"
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock DEAD box protein A"
                     /protein_id="AFL48670.1"
                     /translation="MTEFEGIAPSIAEALAKRGYTTLTPVQEAMLDPALDGADALVSA
                     QTGSGKTVAFGLALGPTLLGPARQFDAPGVPLALVIAPTRELALQVKRELEWLYEITG
                     ATIASCVGGMDIRSERRALERGAHIVVGTPGRLCDHIRRDSLDTSALRAVVLDEADEM
                     LDLGFREDLEFILEASPAERRTLMFSATVPRSIATLAKSYQRDAVRIGVASEQKQHGD
                     IDYRSLLVAPSDRENAIINVLRYYEARNAIVFCSTRAAVNHLTARFNNRGFSVVALSG
                     ELSQNERTHALQAMRDGRARVCIATDVAARGIDLPGLELVIHADLPNNSETLLHRSGR
                     TGRAGQKGVSALIVPVNQRRKAERLLDGARITATWAKPPSADEVTRRDEERLIADPTF
                     DEPPRDDEQAIVHALIERHGAEKLAAAFLRQFRAGRSAPEDLADIPLGGDRGKTRRDG
                     PVAPRDEIDAPRADFTDGQWVSLSVGRKQNAEPRWLIPMLCRHGKLTKRDIGAIRMQP
                     EETYVELTAEGAERFLSAIGPNRTLEKGIRVKTLPGAPDSSQPRQDKPDFAKKRPRPA
                     EAASEHGQRDFKPKRKFEKKPPLTQDAHPEKRDEKPWSKKQGKPEAKKSGSDFKPKAK
                     RNNAKNRQA"
     gene            complement(72521..72904)
                     /locus_tag="USDA257_c00670"
     CDS             complement(72521..72904)
                     /locus_tag="USDA257_c00670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48671.1"
                     /translation="MAEEGRPPSMTWLFFSPSGRIGRLPFFLSWLFWFVVGGVILMQM
                     LKYENQDVALVFWTLALIGSGVASTVSIAMLAIKRLHDIGYPGPLALCLFIPVLSPIV
                     FIALCLWPGAQGANEFGGRRNGPRR"
     gene            complement(72907..73764)
                     /locus_tag="USDA257_c00680"
     CDS             complement(72907..73764)
                     /locus_tag="USDA257_c00680"
                     /EC_number="2.3.1.117"
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
                     N-succinyltransferase"
                     /protein_id="AFL48672.1"
                     /translation="MTNHDLASLSQTIETAFDDREAVSTGTRGAIRDAVEAALNLLDS
                     GKVRVAERGADGTWTVNQWLKKAVLLSFRLNPMELVRGGPGESVWWDKVASKFDGWSV
                     NEFEKAGFRAVPNCVVRRSAYIAPNAVLMPSFVNLGAYVGEGTMVDTWATVGSCAQIG
                     KNVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKS
                     TKIVDRATGEVMYGEVPPYSVVVAGSMPSGSTMATGQPAPNLYCAVIVKRVDEKTRSK
                     TGINELLRD"
     gene            74070..74969
                     /locus_tag="USDA257_c00690"
     CDS             74070..74969
                     /locus_tag="USDA257_c00690"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48673.1"
                     /translation="MGRMKKRGLRSKGGVWDPLADSSQSRQRASTVPVTPQSASPTYR
                     LAYIDDDFLCREELRPVRLQLELLKTEMMLEERGINSTVVMFGGARIPEPGGEAWAAK
                     NETQRKNLEAASVYYDEARKFARLCSEQSAKLGHKEYVIVTGGGPGVMEAGNRGAADV
                     GAPSIGLNIVLPHEQAPNSYVTPELSFNFHYFAIRKMHFLLRAKAVAVFPGGFGTLDE
                     LFETMTLMQTGRLALVPLVLFGEKFWRSIINFEALAEFGTIAPDDIDLVHFVETAEEA
                     WEIIARFYETVDPRAVPMATGRR"
     gene            complement(74988..75701)
                     /locus_tag="USDA257_c00700"
     CDS             complement(74988..75701)
                     /locus_tag="USDA257_c00700"
                     /codon_start=1
                     /transl_table=11
                     /product="putative pyrimidine 5-nucleotidase"
                     /protein_id="AFL48674.1"
                     /translation="MKKLDRLPTHADFAHVTDWVFDLDNTLYPHHVNLFAQIDRNMTA
                     YVAEILSLEPTEAKKLQKEYYRDHGTTLQGLMIHHGIDPNDFLERAHAIDYSVVPANP
                     ELGEAIKALPGRKFIFTNGSVVHAEMTARALGILDHFDDIFDIVAAGYVPKPAGDTYD
                     KFMSLHRVDTQHAAMFEDLPRNLLVPKALGMKTILLVPRNLEYEFAEAWETSSDADEQ
                     IDYVTEDLAGFLRRIVAPV"
     gene            75804..76718
                     /locus_tag="USDA257_c00710"
     CDS             75804..76718
                     /locus_tag="USDA257_c00710"
                     /codon_start=1
                     /transl_table=11
                     /product="putative integral membrane protein"
                     /protein_id="AFL48675.1"
                     /translation="METWVLITVAAAFLQNIRSSMQKHLKGAMGTTGATFVRFGFGLP
                     FALLYLLVLWRVAGQPLPVPNGTFFLWAVVGGLAQIAATFLLVHLFSFRNFAVGTAYS
                     RTEPAQAALFGLIFLGEKASHGTLVAIAISVIGVMLISVARTTLSARSLVTSVFSRTA
                     AIGLLSGTFFGLSAVSYRSASLVLAPSLPAPDYMMQASFTLGFVILLQTIVMLLWIVA
                     REPNELKRIAAAWKPAFIVGLVGSSASFGWFMAMTLQQAAIVKVVAQVEMLFTFATSF
                     FVFREWINRLELVGCLLIVLGVVMLLVL"
     gene            76790..77869
                     /gene="ada1"
                     /locus_tag="USDA257_c00720"
     CDS             76790..77869
                     /gene="ada1"
                     /locus_tag="USDA257_c00720"
                     /EC_number="2.1.1.63"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional transcriptional activator/DNA
                     repair enzyme Ada"
                     /protein_id="AFL48676.1"
                     /translation="MLFDLPNDDTLYDALLARSSDYEGQAFACVKSTGIFCRLSCPAR
                     KPKRENTLFFDSIAACINSGFRPCERCRPLDQAAGKEPLVDQLLKLLDRSPDRRWTED
                     DLVRRGFDPSTVRRAFKRSLGVTFLDLARQRRMGEAARQLSAGVSVIEAQVDAGYESP
                     SGFRAAFARLIGEAPVKAQGRELLFADWIDTPLGSMVAVADQTLLHLLEFHDRKALPA
                     EMERLKRTARSAVVPGRTAPIEQIATELNAYFAGQSGEFRTPLALDGTAFERRVWARL
                     MRIPIGETRSYSDIAREIATIEAVRAVARANGANRIAIVVPCHRCIGADGSLTGYGGG
                     LERKQWLLRHEGKMRPVGLFTEEIR"
     gene            77866..78642
                     /locus_tag="USDA257_c00730"
     CDS             77866..78642
                     /locus_tag="USDA257_c00730"
                     /codon_start=1
                     /transl_table=11
                     /product="putative carboxyvinyl-carboxyphosphonate
                     phosphorylmutase"
                     /protein_id="AFL48677.1"
                     /translation="MNQEERARAFTALHRKGDPVVLYNIWDAGSARCVAEAGGKALAT
                     GSWSVAAAHGFADGQKIPLQLLVEIAREIVAATDLPLSVDFEGAYSEDPAQGAANVAQ
                     LIDAGAIGINFEDQVVGKSGIHPIDKQVARIRAIREMAERQNVPLFINARTDLFLQES
                     DAARHAGLMNEAIARAKAYAGAGASGFFAPGLADAELVARLCAASPLPVNVMMKPGAP
                     DLPTLAAAGVGRVSYGPFPYRAMIAWLQGEAEKVYGSAVK"
     gene            complement(78814..79701)
                     /gene="argB"
                     /locus_tag="USDA257_c00740"
     CDS             complement(78814..79701)
                     /gene="argB"
                     /locus_tag="USDA257_c00740"
                     /EC_number="2.7.2.8"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglutamate kinase ArgB"
                     /protein_id="AFL48678.1"
                     /translation="MSASESEIQARLLAQALPYMQRYENKTIVVKYGGHAMGNPELGR
                     AFASDIALLKQSGVNPIVVHGGGPQIGAMLNKMGIESKFEGGLRVTDEKTVEIVEMVL
                     AGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKARKTIKDPDSNIERILDLGFVGEV
                     VEVDRTLLDLLARSEMIPVIAPVAPGRDGHTYNINADTFAGAIAGALNATRLLFLTDV
                     PGVLDKEGNLIKELSVAQARALIADGTISGGMIPKVETCMEAIKAGVQGVVILNGKTA
                     HSVLLEIFTERGAGTLIVP"
     gene            79901..80614
                     /locus_tag="USDA257_c00750"
     CDS             79901..80614
                     /locus_tag="USDA257_c00750"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48679.1"
                     /translation="MTTQKPESGDARRDEVIAGEYVLGVLSAADRRQVEARMATDRDF
                     AAMVLRWRNNLAAFDSADETIAPLRALPSVEHRAFELQAGVGDSVGLWNSLSFWRSLA
                     IASVAAVTVLVIALAGLFGGGSGGRPLVADLAGQGNAIGFVALFDVGSGRLRLTPVAA
                     RQDGEKSLEFWLLRGNDPAISLGVLPQSGEGEFRVPPAMRTKITEGSTLAVSVEPRGG
                     SPTGSPSGPYLARGSAGYR"
     gene            complement(80681..81220)
                     /locus_tag="USDA257_c00760"
     CDS             complement(80681..81220)
                     /locus_tag="USDA257_c00760"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane associated protein"
                     /protein_id="AFL48680.1"
                     /translation="MSDLIVIGFDAPEEADRVLLKLHSLKKEYLIDLEDAVVVVRDTE
                     GKAHLKQSINLTSVGAASGLLSGSLWGGLVGLLFLNPLAGFAIGGALGAGAGALSGSL
                     ADYGIDDDFIKSLGNTIPNNSSALFILVRKVQPEKVLAELTGLRGRVLKTSLSPEQEQ
                     KLQAALSEAQTPSPQAGTF"
     gene            complement(81365..82018)
                     /gene="engB"
                     /locus_tag="USDA257_c00770"
     CDS             complement(81365..82018)
                     /gene="engB"
                     /locus_tag="USDA257_c00770"
                     /codon_start=1
                     /transl_table=11
                     /product="putative GTP-binding protein EngB"
                     /protein_id="AFL48681.1"
                     /translation="MSGNNNQNASSVFGRPWIFIRGVPAMKFLPPEGPTEIAFAGRSN
                     VGKSSLINALVGHRGLARTSNTPGRTQELNYFVPDGYSGEADDLPPMALVDMPGYGYA
                     QAPKEQVDAWTKLVFDYLRGRSTLKRVYVLIDARHGIKKNDEEVLSLLDKAAVSYQIV
                     LTKTDKIKAAGVPRLIAETLDKIKKRPAAYPEVLSTSSEKGDGIEELRAAIEHAVVR"
     gene            complement(82186..83967)
                     /gene="yidC"
                     /locus_tag="USDA257_c00780"
     CDS             complement(82186..83967)
                     /gene="yidC"
                     /locus_tag="USDA257_c00780"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein insertase YidC"
                     /protein_id="AFL48682.1"
                     /translation="MMENNRNYFVAIALSVLILVAWQFFYVNPRMEKDRIAAEKAQQT
                     QQAQPQQGGQQATPGQGLPGGVVPGENRDQAVAKSARVAIDTPALSGSINLTGARFDD
                     LKLKDYRETVDPKSPVITLFSPAETADGYFTEIGYIGGDATGSVPGPQTVWTLSGGDK
                     LTPATPVTLTYTNDKGITFARTISVDEHYMFQIVDSIKNGTSAPVSLSSYGRVTRFNK
                     PTTPSIYVLHEGFIGVAGDNGLQEVGYSKVEDDQPVEPGKSTGGWLGITDKYWAATIV
                     PPQETPFDIRFSHFADGRPRYQSDYKSDAITVAPGQSAEVKNLVFAGAKEVPVVDNYE
                     VAYAIPNFDKLIDWGWFYFITKPMFKMMDFFFRLFGNFGIAILITTIVVKLIFFPLAN
                     KQYASMANMKKVQPKMEELKKKFGDDRMGLQQAMMQLYKDEKINPLAGCWPIVIQIPV
                     FFALYKVIYVTIEMRHAPFFGWIRDLSAPDPTTIVNLFGLLPFDGPAFLHLGVWPIVM
                     GITMFLQMRMNPTPPDPTQAMLFTWMPLVFTFMLASFPAGLVIYWAWNNTLSIAQQSI
                     IMKRQGVRIELFDNLKSLFAKRPKPAE"
     gene            complement(83964..84350)
                     /gene="rnpA"
                     /locus_tag="USDA257_c00790"
     CDS             complement(83964..84350)
                     /gene="rnpA"
                     /locus_tag="USDA257_c00790"
                     /EC_number="3.1.26.5"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease P protein componentRnpA"
                     /protein_id="AFL48683.1"
                     /translation="MTSEKDKITVGRLKSRPQFLAVRAGEARKGPHFLLEVLDRNDPE
                     GEARVGFTVTKKHGNAVERNRMRRRLKEAVRLSAGFAMKPGHDYVIVARRDLLNVPFD
                     ALTRALQDRIENKPKPKRPPAGSRKP"
     gene            complement(84383..84517)
                     /locus_tag="USDA257_c00800"
     CDS             complement(84383..84517)
                     /locus_tag="USDA257_c00800"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48684.1"
                     /translation="MKRTYQPSKLVRKRRHGFRARMSTKGGQKVLAARRARGRKRLSA
                     "
     gene            84843..86840
                     /gene="mcpA2"
                     /locus_tag="USDA257_c00810"
     CDS             84843..86840
                     /gene="mcpA2"
                     /locus_tag="USDA257_c00810"
                     /codon_start=1
                     /transl_table=11
                     /product="chemoreceptor McpA"
                     /protein_id="AFL48685.1"
                     /translation="MRIRGKIYLIVGIMSLLAIAITGMSLLIVSKYNDELGQFQNASE
                     RSFKGERLNRLVTAVVMESRGVYAASTIEKATPFAEGIIKNLDKIDALLKEWRPLVPA
                     DRLAAFDAVAKRADEFKAFRTETARLGREVSPQAANEQGNNEANRANRKAFQAEIDVV
                     VDADRESLQAITNGIAAFESAVVLIVLGIAGLGMAAGIGAAFYIGTNHLSQPIVDLTG
                     RMKLLAGGELSVDVPFAGRKDEIGDMAAAVEVFKRNGLAVRELNAQETALREKSADLQ
                     SSIGIVVAAAAAGDFTQRIGKDYDNDDLNRFAASVNELVGSVDSGIAETRRVVASLAA
                     GDLTQSMEGHFQGAFAELQENVNETFSTLQKTMREVRSTTDSINGNASELRSAADDLS
                     KRTEQQAAALEQTSAALDEITAAVRSSTERAHEATLMVTEAKENAAESASVVRNAIDA
                     MGRIEQASSEIGQITNVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQ
                     RAASAAKDIKALISKSGSEVATGVKLVQATGAALDEIETRVLKINDHIHSIATAAREQ
                     STGLGEVSTAINQMDQVTQRNAAMVEEANAATHKLSAEANGLATLITYFKVDREPARA
                     ITPAREMSRPVASPARRMMGTVARAFGGGSAAAARSDWEEF"
     gene            87176..87832
                     /locus_tag="USDA257_c00820"
     CDS             87176..87832
                     /locus_tag="USDA257_c00820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48686.1"
                     /translation="MLRPRAAEPCFAVGARPSSGGAEHSCRCLSRPLRPGFLFVYVAA
                     VVLSIPAASVLTIAAGFLFGPFLGGTITVLAATLGSSLLFVAARGVLGDLLRRRAGRF
                     VERLAEGFRRNAFLYLLVLRLAPIFPFFIVNIAPAFFDVKLRTFVAATLLGIVPATFA
                     YAWLGCELDDVIARAGESGHALSLSDFATKEISLALLALAVIATLPLAYRVIKSRRQG
                     "
     gene            87852..89276
                     /gene="merA"
                     /locus_tag="USDA257_c00830"
     CDS             87852..89276
                     /gene="merA"
                     /locus_tag="USDA257_c00830"
                     /EC_number="1.16.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric reductase MerA"
                     /protein_id="AFL48687.1"
                     /translation="MGNILKPDICVIGGGAAGLSAAAGAAAFGVSVVLVEQGKMGGDC
                     LNYGCVPSKALIAAARQAQAMRQAGEFGLVAAEPFIDGERLQARIRSVIEGIAPHDSI
                     ERFLGLGVEVIQGSARFVDDRTVAAGDHLIRARRFVIATGSSPAIPPIAGLAETPYLT
                     NESLFEVMPVPRHLVVVGGGPFGLEMAQAHCRLGARVTVVERASALSKEDPELKAVVL
                     DAVRSEGTVLHEGTVIRSVERDDDGVRLHCEHQSGRFDIEGSELLLATGRVANYGALD
                     LGAAGIRHDAERIHVGADLRTSNRRVYVIGDAAGGLQFTHAASYHARLVLQQILFRLP
                     SREVRAIVPRVTFTDPEIAQVGPTEDEARASFDAIELVRWDLSGNDRARTDGLGRGMV
                     KIVVGRGGRILGAGIAGAGAGEMINLWSFAIANRLTLKNFRDYVAPYPTLSEIGKQAA
                     ISYYSPMARNRFVRSAIRLLRCFG"
     gene            89296..90780
                     /locus_tag="USDA257_c00840"
     CDS             89296..90780
                     /locus_tag="USDA257_c00840"
                     /codon_start=1
                     /transl_table=11
                     /product="Two component sensor histidine kinase protein"
                     /protein_id="AFL48688.1"
                     /translation="MMVEDARPANEGAPPRAAVGFLRGLSGKLLLLTIAFVMLAEVLI
                     FVPSVANMRLRWLEDRLNTVAAAAVVVDGLQNIELPRPVQRETLMATGTKAIVIRRKD
                     ASRMIATVDMPPAIDGEYDIANFSALGAIRDAFDTLLFGGNRIMRVYGPLGESDATIE
                     LVMKDASLRKAMLVYSRNVFLLSIVISLITAALIFLAINRMLIVPIKRLTASMQEFSD
                     EPSSPERVLVPPDGGDELAVAGQHLASMQRELQKTLKQQKSLAELGLAVSKINHDMRN
                     ILSSAQLISDRLADVDDPVVKRFAPTLLRTIDRAVGYTQEVLSYGRTAEAEPHRRFVA
                     LRPLVQDVGELLAVDRQSGIEFDVQIRDEIMVDADSEQLFRVVHNICRNAVQALANHQ
                     PEDGRSRMISVSAVRTGSVVTISIEDTGPGMPAKARENLFAAFRGSARSGGTGLGLAI
                     ARELVLAHGGTIALVEKPTPGTLFRIELPDRPVRLDAFRAKGRS"
     gene            90933..91009
                     /gene="trnR1"
                     /locus_tag="USDA257_c00850"
                     /note="tRNA-Arg-ACG"
     tRNA            90933..91009
                     /gene="trnR1"
                     /locus_tag="USDA257_c00850"
                     /product="tRNA-Arg"
                     /note="codon recognized: CGU"
     gene            91378..93694
                     /locus_tag="USDA257_c00860"
                     /note="hypothetical protein"
                     /pseudo
     gene            93733..94662
                     /locus_tag="USDA257_c00870"
     CDS             93733..94662
                     /locus_tag="USDA257_c00870"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48689.1"
                     /translation="MRNLVMRKYLAATFLIAVAIGPASALDIRGGAKVGPVGVSTSVG
                     LGKKGASAGIGADVDKVGGAKAGASAGKKGTSAGIGADVNGVGGAKAGAAIGSKGISA
                     GFGANVNGVGGAKAGASLGTNGGSSAGVAGNVGRANGGVSAGAGSTGGLSSVGGASAA
                     RGNASGGWAAGTSGRGSATTIIRFAPATSARPIVLPRILWPLKAKRAQHERGEWGYPL
                     RFPLSLAAIPGTPPAVVRVCRRAIASAASPLGALQVRAASAGSLLRHRSGALTAPLAV
                     SIDYRGQHGVEVRQARIRCRLDPSGRVTAVIAP"
     gene            complement(94775..95245)
                     /locus_tag="USDA257_c00880"
     CDS             complement(94775..95245)
                     /locus_tag="USDA257_c00880"
                     /codon_start=1
                     /transl_table=11
                     /product="YbaK/aminoacyl-tRNA synthetase associated
                     region"
                     /protein_id="AFL48690.1"
                     /translation="MTIARKLQNYIETEGIDYDTVPHNRTATTSQTAEAAHVPGNRLA
                     KSVVVHHEMGYVLAVVPATHRVELSTLQDVMNRRLGLASEEEVSTLFNDCEIGAVPPI
                     GSAYGVPVILDESLDKANDVYFEGGDHRTLVHMSGTSFRNLTRDAQVARFSHPG"
     gene            complement(95374..96051)
                     /locus_tag="USDA257_c00890"
     CDS             complement(95374..96051)
                     /locus_tag="USDA257_c00890"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48691.1"
                     /translation="MVARLIVQTLIWFGIMGAVLFASAGTFAWPAAWIYLAIMLALSL
                     VTGLLLAWHDPALLKERLSAPIQKDQPKADKVLLTVLLLFLFGAFAFMALDAARFEWS
                     AVPPWAQAAGALLLVLSIGFNYRVLRENSFAAPVVKVQSERGQRVITTGPYRYVRHPL
                     YSGSLLFVAGTSLLLGSWWGLLAALGLAALLAIRVGIEEKALRAGLAGYDEYAERVRY
                     RLIPFVW"
     gene            complement(96370..96855)
                     /locus_tag="USDA257_c00900"
     CDS             complement(96370..96855)
                     /locus_tag="USDA257_c00900"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48692.1"
                     /translation="MVRWRRRRLPGIPAQGKAMMSEASDLERFVKAQQCVYETALAEL
                     RAGAKRTHWMWFIFPQIQGLGHSPMAQRYAISNVDEARVYLRHPLLGRRLLECTEAVN
                     AVTGRSALDIFGRPDDLKFRSSMTLFEAADPTVGAFARALDHYYNGARDPRTREILGR
                     I"
     gene            complement(96849..97835)
                     /gene="iolS"
                     /locus_tag="USDA257_c00910"
     CDS             complement(96849..97835)
                     /gene="iolS"
                     /locus_tag="USDA257_c00910"
                     /EC_number="1.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="protein IolS"
                     /protein_id="AFL48693.1"
                     /translation="MKTRILGRTGARISEIGFGAWQIGGSWGDVSEEDGRRALHAALD
                     NGVTFIDTADVYGDGRSEKIIAAVLKERGGEKPLVATKAGRRLNPHVADGYTGGNIEA
                     FIDRSLKNLGVEALDLVQLHCPPTDVYYRPELFGALDQLVTKGKIRHYGVSVERVEEA
                     LKAIEYPGIATVQIIYNIFRQRPHDLFFAEAKKKNVGIIVRVPLASGLLSGKIGRDTV
                     FAADDHRNFNRHGEVFDVGETFAGVPFEAALEAVEQLRALVPANVPMAQFALRWILAQ
                     EAVSVVIPGARNAVQAQSNAAASALAPIDGAAMDAIAALYERLIKVHVHQRW"
     gene            complement(97929..98513)
                     /locus_tag="USDA257_c00920"
     CDS             complement(97929..98513)
                     /locus_tag="USDA257_c00920"
                     /codon_start=1
                     /transl_table=11
                     /product="IMPACT family member in pol 5'region"
                     /protein_id="AFL48694.1"
                     /translation="MFTLQRIETSTQEIKKSRFLAIAGPIDDEQSAKAFLAAHSAPGA
                     NHNCWAWRIGQTYRFNDDGEPSGTAGKPILAAIDGQSLDRVVVAVTRWFGGVLLGSGG
                     LIRAYGGTAALCLRTAEKVELVETLRVTIACDFADLALIKARLTARGVAIASESFTDT
                     GAVLAIDLRKDVAEATLALVSDLSRGRAIVTLQS"
     gene            complement(98758..102693)
                     /gene="putA"
                     /locus_tag="USDA257_c00930"
     CDS             complement(98758..102693)
                     /gene="putA"
                     /locus_tag="USDA257_c00930"
                     /EC_number="1.5.99.8"
                     /EC_number="1.2.1.88"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional protein PutA"
                     /protein_id="AFL48695.1"
                     /translation="MPDGPPTPFRRGGLNMGTSGSFLRHPHVSPARPIYIEKHPAAGR
                     ICRMDVRRMKAYFRPRILGRKAPATPRGGPRSMSQTQLQKPTVTTDAAPVPFTDFAPP
                     IRPPSTLRQAITAAYRRPETECLPPLVEAAALPRETQDAAARTARKLVEALRAKHSGS
                     GVEGLVQEYSLSSQEGVALMCLAEALLRIPDTATRDALIRDKIADGNWKSHLGGGRSL
                     FVNAATWGLVVTGKLTSTVNDRSLAAALTRLISRCGEPVIRRGVDMAMRMMGEQFVTG
                     ETIDEALRRSRALEQKGFRYSYDMLGEAATTAADAKRYYKDYENAIHAIGKASDGRGI
                     YEGPGISIKLSALHPRYSRSQAGRVMSELLPKVKALAFIAKTYDIGLNIDAEEADRLE
                     LSLDLLEDLCLDKDLADWNGLGFVVQAYGKRCPFVLDFLIDLARRAGRRIMVRLVKGA
                     YWDAEIKRAQLDGLEDFPVFTRKIHTDVSYVACARKLLSATDVVFPQFATHNAQTLAT
                     IYHMAGKDFHVGKYEFQCLHGMGEPLYEEVVGRENLGRPCRIYAPVGTHETLLAYLVR
                     RLLENGANSSFVHRIADPNVSIDELVTDPVEIVRAMPVVGAKHEKIALPAELFGAART
                     NSAGLDLSNEAALASLTETLKASATIAWTAAPQLAAGSADGETRPVANPGDHRDVVGS
                     VAETSEEDARRAARLAAEAVPSWAAVPPAERAACLDRAADLMQARMPTLLGLIVREAG
                     KSLLNAIAEVREAIDFLRYYAEQTRRTLGPGHKALGPVVCISPWNFPLAIFTGQVAAA
                     LVAGNPVLAKPAEETPLIAAEGVRLLHEAGVPASALQFLPGEGRVGAALVAAPETAGV
                     MFTGSTEVARHIQAQLAERLSPAGRPIPLIAETGGQNAMIVDSSALAEQVVGDVIASA
                     FDSAGQRCSALRVLCLQEDIADRTLTMLKGALHELDIGRTDRLSVDVGPVISAEAKDI
                     IEKHIERMRGLGRKVEQIGLAAETEKGTFVPPTIIELEKLSDLQREVFGPVLHVIRYR
                     RDALDRLVDDINATGYGLTFGLHTRLDETIAHVTSRIKAGNLYVNRNIIGAVVGVQPF
                     GGRGLSGTGPKAGGPLYLGRLVTTAPVPPQHSSVHTDPTLLDFAKWLDGKGATAEAEA
                     ARNAGSTSALGMDLELPGPVGERNLYALHPRGRILAVPATESGLYHQLAAALATGNSV
                     VVDAASGLQATLKNLPHSVALRVSWSKDWTADGPFAGALVEGDAERIREVNKAIAALP
                     GPLLLVQAASGEEIARNPDAYCLNWLVEEVSTSINTAAAGGNASLMAIG"
     gene            complement(102651..102959)
                     /locus_tag="USDA257_c00940"
     CDS             complement(102651..102959)
                     /locus_tag="USDA257_c00940"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48696.1"
                     /translation="MTISPIQDFDCQSCGACCAYSAEWPRFSMETEEELERIPADYVA
                     ADLGGMRCENERCTALEGTLGKFVACKVYAMRPIVCRTCMPGDDECLMARQRHFGAAA
                     "
     gene            complement(103010..103816)
                     /gene="cpdA"
                     /locus_tag="USDA257_c00950"
     CDS             complement(103010..103816)
                     /gene="cpdA"
                     /locus_tag="USDA257_c00950"
                     /EC_number="3.1.4.17"
                     /codon_start=1
                     /transl_table=11
                     /product="cpdA: 3',5'-cyclic adenosine monophosphate
                     phosphodiesterase CpdA"
                     /protein_id="AFL48697.1"
                     /translation="MTKFIVFTDLHMVPDGTTIIGIDPYRRLANGITHVNRYHADADR
                     VVFAGDLTHQADRASYERLKDLFSELIPPAAIMLGNHDRREVFLEVFPEAATDENGFV
                     QQVIDFADCRAVLLDTLFAPPYDYPMSHAGHLCERRLVWLDRQLGSAGDRPVLIFMHH
                     PPHASGFAGIDMIRLINEEQFYGLVKRHGNVRHIFAGHVHRTISGSSRGIPFSIFKSP
                     VHQQPMPFDIPDASLSVDEPAAYGIAVITADGVLVHTEDYEIARRDAVEA"
     gene            103897..104022
                     /locus_tag="USDA257_c00960"
     CDS             103897..104022
                     /locus_tag="USDA257_c00960"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48698.1"
                     /translation="MMLLRPEPTGDLLRLEHERAMGQLTALIYQFALLTRYPEIR"
     gene            104022..105056
                     /locus_tag="USDA257_c00970"
     CDS             104022..105056
                     /locus_tag="USDA257_c00970"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="AFL48699.1"
                     /translation="MRWKRTIQLLDVHCEGEIGKVAIGGVPKIPGNTIAEQLNHINTV
                     DDSLRRFLCLEPRSGSIGSVNLLVPPKRPEADAGFIILQADQAHAMSGSNSICVTTAL
                     LESGMIEMKEPETVVMLDTAAGLVKATATCRDGRCERVKLTMVPSFVQELDVEVDTPE
                     WGRIKLDLCFGGVFYALVDVRQIGTTIDKANARRIVEAGMALKDIVNRALPVVHPEIP
                     EIKGVAYVMFRDTEADGTVRTCTTMWPGRVDRSPCGTGSSANLATLHARGKVKPGDVL
                     KSRSIIGSEFEVGLEAVTTVAGREAIIPTISGRGWTFGLHQVALDPFDPLADGFALTD
                     TWGPQAGEIR"
     gene            complement(105074..105637)
                     /locus_tag="USDA257_c00980"
     CDS             complement(105074..105637)
                     /locus_tag="USDA257_c00980"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48700.1"
                     /translation="MDSHIKPPIRIASASLLAAAMLLSFATIAARSASAAELSAAEQC
                     DREAGSDLDLERNRAFPAVATHDIRIGVALSACREAYNQNGGARTQFQLARVLDRAGE
                     KLKSLRVLGEAAQNGHALAMAMYGTRLVERGEAEAAFDLYQRAAAAGNVVAAHNLAAA
                     YRDGVGTRADGALAAQWFERAQTNELQ"
     gene            105831..106451
                     /locus_tag="USDA257_c00990"
     CDS             105831..106451
                     /locus_tag="USDA257_c00990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48701.1"
                     /translation="MPQLQMKRRMVLGGLIMAVIGGRAAAAASGSVVGKAAKIRGNVR
                     RRQGEAEERLTAGGSVLDRDYVMTSTNSFADLALSETRILLGPQTELLIDSFIAGEGG
                     TLELGVGRMVFDRPRGLPKVDVAIRTAFGMIGVRGTKFFCGPSRTAAFAVFVEHGAVS
                     VEGGGVTRMLAAGQGVDIDRPGAAPSEQTNWGQARIREAYASVGLG"
     gene            complement(106427..108217)
                     /gene="cya11"
                     /locus_tag="USDA257_c01000"
     CDS             complement(106427..108217)
                     /gene="cya11"
                     /locus_tag="USDA257_c01000"
                     /EC_number="4.6.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate cyclase 1"
                     /protein_id="AFL48702.1"
                     /translation="MFRTPRELFFDNLTQWAPSPRSTDILVVDIDRLAVEARSESWDR
                     GATAELISRLAAAGAKAIAVDFVFSSDCGPAAPVNAALASAIGEAPVVLGFLAAERVL
                     EHPRPVPPLALRRQLAVPEQWFIHGAETACPMFMDRAKAATAAFLVGDKDARVRRAQA
                     FAVIDNDAFPALGIEAGRLGAASSTPVLGGEPAWLRLDHAIIPLDADGNLRFVASSQA
                     EIAARTVSAADVMADRIDESRIAGKLVFVGSSMPSLGGLRPTASMPLEPSVQIHADIA
                     NAIMTGFVPYRDGDLPVMEALFSVAAGVVAAYGATKLRPMMTLTLGGAAVLAVSAFAG
                     VIYAATGWLFDAVSISVAMVTILVVTSALQLARVRRAEAIARQKFSQYLPQSVVARYI
                     DDPDRGRVAGEERPVTAVFTDIEGFSTLSHKLSPRELVALLDIYFAEVNALVSRHGGM
                     VDKVVGDAVHALFNAPEDLADHVDKAIDCAIAIHALAEEMRARPQFAEQGFGRTRIGI
                     ETGPAVLGEVGAGGKLDYTAHGDAVNLAARLQEANKFLGTAICIGPAAAAQSSARLRP
                     LGRHEIRGFGSMELFTVADGESPHPRPTLA"
     gene            complement(108321..109025)
                     /locus_tag="USDA257_c01010"
     CDS             complement(108321..109025)
                     /locus_tag="USDA257_c01010"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, Crp/Fnr
                     family"
                     /protein_id="AFL48703.1"
                     /translation="MTEINRSPAFWRSFPIFEDFDKETLCELADIASYRKWPAGTVIF
                     QRGDEGNYMIVVVSGRIKLSLFTPQGRELMLRQHEAGALFGEMAVLDDQPRSADATAV
                     TAAEGYVIGKKAFLDLITQKPRIAEAVIRFLCAQLRDTTDRLETIALYDLHARVARFF
                     LATLRQIHGNELPASANLRLTLSQTDIAAILGASRPKVNRAILSLEESGALKRTDGIV
                     SCNVGRLLMIADPPED"
     gene            109245..109682
                     /locus_tag="USDA257_c01020"
     CDS             109245..109682
                     /locus_tag="USDA257_c01020"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein contains DoxX family
                     domain"
                     /protein_id="AFL48704.1"
                     /translation="MPQNVIVLIGRVLLSIIFIVSGFGKLTDPAGTAGMITNAGWPAA
                     TALAYLAGLFELVSGLAILVGFQTRIASYLLAAFCLVTAFVFHSGPINIPDFPEAANG
                     LLSMFNQIMMMKNITLAGAFLVLAGFGPGALSLDARLGRTVAA"
     gene            complement(109754..110182)
                     /locus_tag="USDA257_c01030"
     CDS             complement(109754..110182)
                     /locus_tag="USDA257_c01030"
                     /codon_start=1
                     /transl_table=11
                     /product="putative RbsD/FucU transport protein"
                     /protein_id="AFL48705.1"
                     /translation="MLKGIDPILSPELLAALRAMGHGDEIALVDGNYPGQEHARRLVR
                     LDGHHLVPVLDAILSVLPIDDFVPEAIFRATVKQDKDALDPVHRDIVECCRKHEPGQS
                     VVPLLGAEFYPRVKAAHTVVQTSEPRLYGNVILRKGVIYP"
     gene            complement(110182..111414)
                     /locus_tag="USDA257_c01040"
     CDS             complement(110182..111414)
                     /locus_tag="USDA257_c01040"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ROK family protein"
                     /protein_id="AFL48706.1"
                     /translation="MSLIQDPHGGSAQPDVIDPSGGANQTRVRAYNERLVMSLVRRHG
                     SLSKAEIARRSGLSAQTVSVIMRALEADGLLVRGDPVRGRVGQPSIPMRLNPDAVYSF
                     GVKIGRRSADLVLMDFLGNIRLHLHQIHTYPLPDDLVTFIVEGIEKLERQLSSEDRKR
                     IAGVGIATPFELWNWAEEVGAPREEMDRWRKFDLQAAVTARTPHPVFLQNDGTSACGA
                     ELAFGVGANYPDFVYFYIGSFIGGGVVLNSALFSGRTGTAGAIGPLPVSGKDGRTTQL
                     LKIASVFVLEKLLRDRGVDPKPLWYSADDWIDFGEPLEIWIQDSAAALAQAVVSAVSI
                     VDFSAAVIDGGFPPWVRSRLLAATRKALQTLDLQGVTVPDLVEGAVGSHARAIGGASL
                     PLFSRYLLDTNVLFKELT"
     gene            111682..112707
                     /locus_tag="USDA257_c01050"
     CDS             111682..112707
                     /locus_tag="USDA257_c01050"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic binding protein/LacI
                     transcriptionalregulator"
                     /protein_id="AFL48707.1"
                     /translation="MKKTVLSTAFGALALGVAFASPSQAADVSACLITKTDTNPFFVK
                     MKEGATAKAQELGVTLKAYAGKVDGDHDSQVAAIESCIADGAKGILIAASDTKAIVDQ
                     VKKAQAAGVLVIALDTPLDPATAADATFATDNLLAGKLIGQWAAATMGENAKTAKVGF
                     LDLTPSQPTVDVLRDQGFMIGFGIDPKDPNKIGDEDDPRIVGHDVTNGNEEGGRTAME
                     NLLQKDPEINVIHTINEPAAVGAYQALKAVGKEKDVLIVSVDGGCPGVKSVAEGVIGA
                     TSQQYPLMMAALGIEAIKKFAETGEKPKPTEGKDFFDTGVALVTDKPAAGVESIDTKV
                     GTEKCWG"
     gene            113007..114092
                     /gene="rbsC1"
                     /locus_tag="USDA257_c01060"
     CDS             113007..114092
                     /gene="rbsC1"
                     /locus_tag="USDA257_c01060"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose transport system permease protein RbsC"
                     /protein_id="AFL48708.1"
                     /translation="MGEPNTAAQPSQEFEKVLVNSSTDVASFDTHDKTPLQKIQHFLH
                     STPAAVPFVVLIASILVFGLAIGGRFFSSYTLTLILQQIAVVGMLGAAQTLVILTAGI
                     DLSIGVIMVISAVVMGNCAVSYGLPAPIAVAAGFLVGGACGLLNGLLVSRLKLPPFIV
                     TLGTWYVIMSTNFIYSENATIREADVTAVTQWLHVFGVNFKVGTAVLTLGVVAMVVLV
                     FGLWYALNHTAWGRHLYAVGDDPEAAKLSGIRVGRVLLSAYTIAGLIAALAAWVSIGR
                     NGSISPSAAVTDYNLQAITAAVIGGISLFGGRGSILGTLIGAMIVGVVSMGLNMLGAD
                     PQWKVFLTGVLIISAVAVDQWIRKVAA"
     gene            114092..114874
                     /gene="rbsA1"
                     /locus_tag="USDA257_c01070"
     CDS             114092..114874
                     /gene="rbsA1"
                     /locus_tag="USDA257_c01070"
                     /EC_number="3.6.3.17"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose import ATP-binding protein RbsA"
                     /protein_id="AFL48709.1"
                     /translation="MAQEPILTARGLVKRYGRVTALDHADFDLYPGEILAVIGDNGAG
                     KSSMIKAISGAVTPDEGEIHLEGQPVHFRSPMEARAAGIETVYQNLALSPALSIADNM
                     FLGREIRKPGLFGKLFRTLDRSAMEKMARSKLSELGLMTIQNINQAVETLSGGQRQGV
                     AVARAAAFGSKVVIMDEPTAALGVKESRRVLELILDVRRRGLPIVLISHNMPHVFEVA
                     DRIHIHRLGRRLCVINPKEYTMSDAVAFMTGAKAPPGEAIAA"
     gene            114871..115491
                     /gene="yggC"
                     /locus_tag="USDA257_c01080"
     CDS             114871..115491
                     /gene="yggC"
                     /locus_tag="USDA257_c01080"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein YggC"
                     /protein_id="AFL48710.1"
                     /translation="MNVQSLRDEILKRAAGAGRFVVAIAGPPGAGKSTLAEALAEAIA
                     EAGESVAVLPMDGFHMDNAVLVEKGLLPRKGAPETFDVRAFLSTLAAVHANDGEVLVP
                     VFDRTRELAIASARAIAPQTRIVLVEGNYLLLDEAPWSRLDGAFDYSIFIDPGIEVLE
                     RRLLQRWYDHGYDEESARKKALGNDIPNARRVVGNCRASDLVIRDF"
     gene            115677..116714
                     /gene="pyrC1"
                     /locus_tag="USDA257_c01090"
     CDS             115677..116714
                     /gene="pyrC1"
                     /locus_tag="USDA257_c01090"
                     /EC_number="3.5.2.3"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase PyrC"
                     /protein_id="AFL48711.1"
                     /translation="MQELVIRRPDDWHLHLRDGGMLRGVIADTSRHFARAIVMPNLVP
                     PVVTSADAAAYRERILAAIPAGDRFEPLMTLYLTEGTDPDDVEAGFRSGLVKAVKLYP
                     AGATTNSHSGVRDIAKAMPVLERMAEIGLPLCVHGEVTTPEVDIFDREAVFIETVLDP
                     LRRHLPDLRITMEHVTTKDGVDYIKEHAANLAGSITTHHLIINRNAILVGGIKPHYYC
                     LPVAKRETHRLALRAAAISGDVRFFLGTDSAPHADPLKECACGCAGIYTSINTMSCLA
                     QVFEEEGALDRLEAFTSLNGPAWYGLPANDETITLRKGSEPVRYPAKIETEAGPVTVF
                     DAMFPLYWAVA"
     gene            116739..117437
                     /gene="pyrE"
                     /locus_tag="USDA257_c01100"
     CDS             116739..117437
                     /gene="pyrE"
                     /locus_tag="USDA257_c01100"
                     /EC_number="2.4.2.10"
                     /codon_start=1
                     /transl_table=11
                     /product="orotate phosphoribosyltransferase PyrE"
                     /protein_id="AFL48712.1"
                     /translation="MFSNAFTDKAVMAELVAKMLWEIKAVHFRADQPYKLSSGMASPV
                     YIDCRKLISYPRVRSAVMDFAAATILREAGFEQFDVVAGGETAGIPFAAMLAERLALP
                     MIYVRKAPKGHGRNAQIEGHMPEGARVLVIEDLTTAGGSMFKFIDAIRAAGGIVEHGI
                     ALFYYDIFPEARGNMKSKGVDLHYIATWRNVLAVAREQALFDEKTLNEVEAFLNAPLA
                     WSARKGGVDTLAAQ"
     gene            117488..118414
                     /gene="frk"
                     /locus_tag="USDA257_c01110"
     CDS             117488..118414
                     /gene="frk"
                     /locus_tag="USDA257_c01110"
                     /EC_number="2.7.1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="fructokinase Frk"
                     /protein_id="AFL48713.1"
                     /translation="MIVCCGEALIDMLPRESAAGESAFAPYAGGAIFNTAIALGRLGI
                     PTGFFTGLSDDMFGDILRETLKAANVDFGPCATLPLHTTLAFVKLVNGHASYAFFDEN
                     TAGRMITTDHLPAFGDFCEALHFGAISLIPEPCGSTYEALMTREHDRRVISFDPNIRP
                     GFIKDREAHLARMNRMAAMSDIIKFSDEDLAWFGMEGSHDTLAVEWLKRGPKLVVITR
                     GADGAVGYTRNHKVEVASQRVMVVDTVGAGDTFDAGVLASLKLNNLLTKEQVANLSDE
                     AIRQALALGAKAAAVTVSRAGANPPWKYEIGL"
     gene            complement(118475..120100)
                     /gene="pgi"
                     /locus_tag="USDA257_c01120"
     CDS             complement(118475..120100)
                     /gene="pgi"
                     /locus_tag="USDA257_c01120"
                     /EC_number="5.3.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase Pgi"
                     /protein_id="AFL48714.1"
                     /translation="MKALVENLKATARETKATDIRAAFAADPSRFSRFSTRLGDLLLD
                     YSKCAVNDTVLDGLEALAKAAKVEEKRDAMLRGDIINITEERAVLHTALRNRSNRPIL
                     VGGKDVMPDVNTVLDAMGAFADDVRSGTLKGATGKKITDVVNIGIGGSDLGPVMATLA
                     LAPFHDGPRLHFVSNVDGAHIADTLKLLDPETSLFIVASKTFTTIETMTNAATARAFI
                     AGKLGEAAVGHHFAAVSTALDKVAAFGIDAARVFGFWDWVGGRYSIWSAIGLPLMIAI
                     GKENFGRFLDGAHAIDEHFRTAPVRENLPMLLGLIGFYHRNVLGYPSRAILPYDQRLT
                     RFPAYLQQLDMESNGKAVTLDSKPVEFATGPVVWGEPGTNGQHAFYQLIHQGTDVIPA
                     EFMIAANGHEKDLRHQHQLLIANCLAQSEALMKGRTLAEAKAQLTSKGMDEAKADKIA
                     PHRVFSGNRPSLTFVYDQLDPFALGRLIALYEHRVFVEGALFNINPFDQWGVELGKEL
                     ATGLLPVVEGKESAEGHDSSTAGLVAALLKAAR"
     gene            complement(120357..122057)
                     /gene="fadD"
                     /locus_tag="USDA257_c01130"
     CDS             complement(120357..122057)
                     /gene="fadD"
                     /locus_tag="USDA257_c01130"
                     /EC_number="6.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain-fatty-acid--CoA ligase FadD"
                     /protein_id="AFL48715.1"
                     /translation="MAEASMQQAGSGAGKNWIKSYPPGVPAEIGPLPYRSLGEFFDHA
                     VAQHSWRPAFTCMGKSLTFADLNVHSGRIGAWLQSLGLAKGDRVAVMMPNILQNPVIV
                     YGILRAGYTVVNVNPLYTPRELEHQLVDAGAKAIFVLENFAHTVEQVVARTKIKHVVV
                     ATMGDMLGVKGLVVNVVVRRVKKLVPAWSLPGHLSFRTVLAKGEKLSLAKPNVAPGDV
                     AFLQYTGGTTGVSKGATLTHANLLSNMAQMGIWLNTAFLRKPRPENLTFMCALPLYHI
                     FALTVNSLMGLATGGNNILIPNPRDIPAFVQELAKYKTNIFPGLNTLFNALMNNPEFQ
                     KLDFSSLILTFGGGMAVQRPVAERWLATTHCPIHEGYGLSETSPVATANRLDTDEFTG
                     TIGMPLPSTEVEIRDDDGNTLPTGEIGEICIRGPQVMAGYWQRPDETAKAISPDGFFR
                     TGDIGFMNAAGLTKIVDRKKDMILVSGFNVFPNEIEEVVATHPGILECAAIGIADPHS
                     GEAVKLFVVRKDPNLTEGDVKRHCAEHLTNYKRPRHVEFRDELPKSNVGKILRKDLRG
                     "
     gene            122451..123626
                     /locus_tag="USDA257_c01140"
     CDS             122451..123626
                     /locus_tag="USDA257_c01140"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="AFL48716.1"
                     /translation="MQLGNRERENPPVEPRLFGQPAHSRSALVLPISAARWMLVLVLI
                     AGVYFFHGFVVPVLAAVVIGFASWPIYRRLLQALNGNRTLAATIAITSVVAFIVVPIS
                     IAAAYAVDEVRDWLVWAVQTNVSGAPVPAWLTTIPVAGAWLGQQWVKYVGHPGALGEL
                     VQLVSGSNIGNIYRGVLVIGASAFQSFLTLLFMLITLFFVYRDGHSFSKQLDRLGEQI
                     FPMRWERLSRVVPLTISSTVTGMGIIAIGEGIVLGVAYWLAGVPSPVTLGIITGLMAL
                     IPGGAPLCFTLVSIYLVASGSLLQGVALFVWGTTELFIVDKTLRPRLVGGPIKLPFLP
                     TFFGLVGGVKTMGFLGLFVGPVLMALLVAIWREWMHEVANQPEPTAKPISRVDIAAK"
     gene            123730..126414
                     /gene="kdpD1"
                     /locus_tag="USDA257_c01150"
     CDS             123730..126414
                     /gene="kdpD1"
                     /locus_tag="USDA257_c01150"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor protein KdpD"
                     /protein_id="AFL48717.1"
                     /translation="MPEIDRDQARRPDPDALLGLADKGGRGKLTVFLGAAPGVGKTYA
                     MLMRAQRLKEQGADIVIGLVETHGRSETAALLDGLEVLQRRDVAHNGRTLHEFDLDAA
                     LARRPRIIVVDELAHTNLGESRHPKRYQDIEELVDAGVDVWTALNIQHLESLSDIVAQ
                     IAGVPVRERIPDTVLSRADEVLLVDLPPAELIDRLKEGKVYLPDNAKRAVDHFFRLGN
                     LTALRELALRRTADRVDDQMVDYLKQNAIEGPWPAGERLLVCIGPDPLSEKVVRTASR
                     LASGLNADWIVVSIERADREAGDGEAMRQLDETFRLAEQLGAETRRIIGSDFVEEILK
                     LARRENATQIVIGARRHWFPLSLFRASLPDALSRRVSGIGIHLVTGKIEPAAKTRQRS
                     QRLLPEGLARALGIAGGTVGLATGLGVLIEQFIILQNISLLYLLAVLASAVYAGYFAA
                     LAAALFSVVAYNFFFIEPVGTFTVAEPHEVFALLVFLAAAALAGSLASRIRDQAKTAR
                     GRATATQALYDFSRKLSGTANAEDVLWAAVTQMQSTLRRNAVLLLPEDGDIALSVAWP
                     PDTELSVSDMMAARWTFEKREPAGNDTGTLPNSPFQFRPLMSPQGVVGVCGFLQEDRP
                     LDINEERALAAILDQTAIAVDRARLSRESLDQAAQLEGEKFRAALLSSLSHELTTPLT
                     TITGAVTTLRQLGEGMPKEGRRELLNSIEEESGRLKNFVSNLLDMNRIEAGTINARRD
                     RVDVADVVHAAVERARKYFPGRVFETSIAADLPLMRGDSVLLGQVLFNLLDNADRFGG
                     DEPVSIYARREGDEVVLSVTDLGKGIAPADLEHVFDKFFRKGKSDGRSLGTGLGLTIS
                     KAFVEAMGGRIKAESPALRRRGTRISMRFPAAEAEPSN"
     gene            126500..127165
                     /locus_tag="USDA257_c01160"
     CDS             126500..127165
                     /locus_tag="USDA257_c01160"
                     /codon_start=1
                     /transl_table=11
                     /product="putative CDP-alcohol phosphatidyltransferase"
                     /protein_id="AFL48718.1"
                     /translation="MNVAPDGGEPGRPGADRRPIAARDTGFARRLTALLLKTPITPNA
                     ISVLSVGFAAIGAAALFFATRWPPLYLAAVAGIQLRLLCNLLDGMVAVEGGRGSPVGA
                     LYNEFPDRVADTLLIVALGYAAGAGWLGWAGALAAALTAYVRVFGGSLGQAQDFRGPM
                     AKQHRMALMSLASVLALGEAWLTTERFVLYATGWTILAGALFTCWTRTRAIVSRIPGA
                     AKP"
     gene            127078..127773
                     /locus_tag="USDA257_c01170"
     CDS             127078..127773
                     /locus_tag="USDA257_c01170"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 1-acyl-sn-glycerol-3-phosphate
                     acyltransferase"
                     /protein_id="AFL48719.1"
                     /translation="MDHPRRGALHLLDPHEGNRFPHPGSRKAVIDLVLIGLTRFLVGG
                     QAHWIGASPDTRQRIYFANHASHLDTLLIWSALPRLLRGSTHPIAASDYWGKGRVRRH
                     IALKVLNAVLVDRATQGPPGAALAPLRGVLAEGESLVLFPEGTRGTERLPGPFKSGLY
                     WLSQEFPEVELIPTYLDNPSRAFPKGTFLPVPISCTVRFGAPLSRRQGEEKDAFLERA
                     RAAVGALASDPVA"
     gene            127781..128722
                     /gene="ynbB"
                     /locus_tag="USDA257_c01180"
     CDS             127781..128722
                     /gene="ynbB"
                     /locus_tag="USDA257_c01180"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein YnbB"
                     /protein_id="AFL48720.1"
                     /translation="MSLSDKLFILFGGISALLGVASVIGFALSRKVTSENGRATVDNL
                     NARIKAWWVMVAIFAVSFGLGRGVTVVLFALTSFYALREFTSLTPTRGADHLPLVAAF
                     YVLLPLQYWLIWIDWYALFTILIPVYGFLLLPSLAALKGDPEQFLLRVSRIQWGLMLT
                     VYCISHAPALLTLDIPGRPREGFLLLFFLITVAQFSDVMQYVSGKLFGRTKVAPVVSP
                     SKTVEGLVGGGLSAVAAGAGLWWITPFTPLEAAAMALAIVAMGFLGGLALSAVKRSMG
                     VKDWGTMISGHGGVLDRMDSLSFAAPVFFHLTRYFYT"
     gene            complement(128960..129124)
                     /locus_tag="USDA257_c01190"
     CDS             complement(128960..129124)
                     /locus_tag="USDA257_c01190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48721.1"
                     /translation="MSDGDIESALGVACELLEMTHEAIIRLIIREWLEEYGLLPIHDL
                     DEGSETEESA"
     gene            complement(129763..129838)
                     /gene="trnT1"
                     /locus_tag="USDA257_c01200"
                     /note="tRNA-Thr-CGT"
     tRNA            complement(129763..129838)
                     /gene="trnT1"
                     /locus_tag="USDA257_c01200"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACG"
     gene            131205..132377
                     /locus_tag="USDA257_c01210"
     CDS             131205..132377
                     /locus_tag="USDA257_c01210"
                     /codon_start=1
                     /transl_table=11
                     /product="putative BirS-like protein incolved in biotin
                     regulatory network"
                     /protein_id="AFL48722.1"
                     /translation="MSGLETAIRNALERSERSNAEVRARIYQSARQALENGLKKQEIE
                     DPEIIAKQRHRLEAVIHAIETEERAALKARVASPIVSLADVKGKGDAAARDSAAATAP
                     VQQEPGFRAEARPVSTGDGGLGVLGALRPERDGPRLSSPPVAGDEKSTDAGTPGSSAP
                     DLGVTEKRPRKRRRGRLLSLVMVVATLAAAVGAGAWWVQTNDLLKSPAERDTNIANPP
                     AVVETEDFPAAAGLPTLGAQEGFSGDWIEVFTSADAAAIKPGARASAEPFDDDGGERI
                     RLTSAAAAKEGEVAIDIPADVLAELSGKSSTLALSVQALPGKTTEFSVECDFAALGAC
                     GRHRFTAHDERVDMLFKISFDGDVAPDGSGKLLINSDVSGAGNSLDLFAIRVLPGQ"
     gene            complement(132437..133339)
                     /locus_tag="USDA257_c01220"
     CDS             complement(132437..133339)
                     /locus_tag="USDA257_c01220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48723.1"
                     /translation="MALEQAPTAGAPGSRAVELAIGGKTRVFDIDNPELQKWIDDEAF
                     SSDDYPYEKKLGEEEYEETLTKLQIELVKVQFWMQATGKRVMAVFEGRDAAGKGGAIH
                     ATTAYMNPRSARVVALTKPTETERGQWYFQRYVSTLPTAGEFVLFDRSWYNRAGVEPV
                     MGFCTPEQYEHFLKETPRFEKMIVNEGIQLFKFWLNIGREMQLKRFHDRRHDPLKIWK
                     LSPMDIAALGKWDDYTEKRDRMLKETHTDHAPWTVIRGNDKRRARINLIRHMLTKLDY
                     DGKDKAAIGKVDDKIIGSGPGFLR"
     gene            133598..134857
                     /gene="phoR1"
                     /locus_tag="USDA257_c01230"
     CDS             133598..134857
                     /gene="phoR1"
                     /locus_tag="USDA257_c01230"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase synthesis sensor protein
                     PhoR"
                     /protein_id="AFL48724.1"
                     /translation="MDNEGIVLDSAKVFWQGLKPKLKAERGILGLSIVLAVLAALAGI
                     HVLAVLPFWIVLVAALLKRRAPSVEPVPEAVPRVTEKRPDPLIPVLNALDMPVLVIAA
                     DETVLFQNAAAEKAFGTIPPESYLSARVRSPGILDMVRETIATGKINQIEHSERLPSD
                     AVYVVRVAPADVGGEVPSGRVFLLTYRDISQTRRIDRMRSDFVANASHELRTPLASLR
                     GFIETLEGPAKNDTKAQQKFFGIMHEQVTRMSRLVDDLLSLSRLELKSHIAPEDTVDL
                     VPLLGHVRDSLAPLASDLDVTISLDVPEEPVFVQGDRDELIEVFENLIENACKYGQEG
                     KKVDVRLTGYGGQAEIAVIDYGPGIPAEHVPRITERFYRVNVEASRSKKGTGLGLAIV
                     KHILTRHRARLVIQSEVGKGTVFTVRF"
     gene            135050..136084
                     /gene="sphX"
                     /locus_tag="USDA257_c01240"
     CDS             135050..136084
                     /gene="sphX"
                     /locus_tag="USDA257_c01240"
                     /codon_start=1
                     /transl_table=11
                     /product="protein SphX"
                     /protein_id="AFL48725.1"
                     /translation="MKVLKLTVAALVASAAFAGAAAARDQIQVAGSSTVLPYAKIVAE
                     TFGETFPDFKTPVVESGGSSAGLKEFCKGVGEDTIDIANSSRKIKDSEVEACKAAGVT
                     EIQEVKIGYDGIVFATDAGNADLALKPEHLYKALAAEVVVDGKLVANPYKKWSEVDAS
                     LPDAEIAAFIPGQKHGTREVFEEKILAEGCKEAGAKDVIKAAVSDAKEQLSKCVAVRK
                     DGMAVDIDGDYTETLARIASNKSGIGVFGLSFYENNADKLKVATVNGVVPSTETIASG
                     EYPVSRPLFFYVKKAHMGVVPGLKEYVEFFIDDQMIGPDSPLAEYGLVAAPDAEREEI
                     RKAFEAGNML"
     gene            136181..137665
                     /gene="pstC"
                     /locus_tag="USDA257_c01250"
     CDS             136181..137665
                     /gene="pstC"
                     /locus_tag="USDA257_c01250"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transport system permease protein
                     PstC"
                     /protein_id="AFL48726.1"
                     /translation="MSTSLLLLIIALIGFLAYFAGRARSLAQSGGKFSDLHSLPGYHG
                     SYVAIWAMLPAALVLAAWLIASPLYIDSSVRSSLPETVKSQGAATVQLALGQVKSVAG
                     GLLRLDAPEVAALENGSANLRETLAAKGVALAGEGEPYMIEAAQQFNAMRSYSRWLMS
                     AVVLLVAVAGGVYAIRNITTRFRARNQVERVMLASLIVASSIAILTTIGIVASMLSEA
                     GRFFSMVSPFEFFFGTVWDPRFAAAGSGGASGQFGLLPLLGGTLYIAFVAMLFAVPIG
                     LFAAIYMAEYASPRLRSTAKPLLEVLAGIPTIVYGFFALVTVGPFLRDISTQLNGLLT
                     GNYQNFIQAQSVLTAGIVMGIMLIPFVSSLSDDIITQVPRALRDGSLGLGATRSETVK
                     KVILPAALPGIVGALLLTASRAVGETMIVVLAAGVAARMQLTPFEPMTTVTVKIVHQL
                     TGDLEFTSPQTLVAFALGITLFVITLCLNIYALYIVRKYREQYE"
     gene            137662..138984
                     /gene="yqgI"
                     /locus_tag="USDA257_c01260"
     CDS             137662..138984
                     /gene="yqgI"
                     /locus_tag="USDA257_c01260"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter permease protein YqgI"
                     /protein_id="AFL48727.1"
                     /translation="MTDLASPTVRVSTRPAETRRDIGIKRRYAAERRFRAYGISAIVL
                     GLFFLALLVSTVVSNGYTAFLQTTITLPIEFSEKVIDPKNERSTDAKQLMTANYPLLV
                     RDALVKQLGLDAKKRPLVKQATDMISASARTQLRNMVVADPSIIGKTVPVTLLAEANI
                     DSAFKGQIDLSVAETNRKVKDQQVAWMNELADAGVLKKSFNTGIFAFGASSRPEAAGV
                     GVALIGSLYMMLIVLVLSLPIGVAASIYLEEFAPKNRLTDLIEVNINNLAAVPSIVYG
                     LLGLAVFINFAGMPRSAALVGGFVLTLMTLPTIIIATRAALKAVPPSIRSAALGLGAS
                     KMQTIFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVVDFPGSPLEPSTAL
                     PVQIYMWANEAERAFVERTSGAIIILLIFLVFMNLGAILLRRRFERRW"
     gene            138998..139813
                     /gene="pstB"
                     /locus_tag="USDA257_c01270"
     CDS             138998..139813
                     /gene="pstB"
                     /locus_tag="USDA257_c01270"
                     /EC_number="3.6.3.27"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate import ATP-binding protein PstB"
                     /protein_id="AFL48728.1"
                     /translation="MNIMSEAAVEKALDQKMNTVPYKMIGKDVSVYYGEKRALFDVNL
                     NIRENTVTALIGPSGCGKSTFLRTLNRMNDTIENCRVTGRITLDEDDIYDPSIDVVEL
                     RARVGMVFQKPNPFPKSIYENVSYGPRIHGLARSKADFDEVVETSLQKAGLWNEVKDR
                     LQEPGTGLSGGQQQRLCIARAVAVSPEVILMDEPCSALDPIATAKVEELIHELRANFT
                     IVIVTHSMQQAARVSQRTAMFHLGNLVEENDTDKMFTNPDDQRTQDYIMGRFG"
     gene            139870..140580
                     /gene="phoU"
                     /locus_tag="USDA257_c01280"
     CDS             139870..140580
                     /gene="phoU"
                     /locus_tag="USDA257_c01280"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transport system protein PhoU"
                     /protein_id="AFL48729.1"
                     /translation="MSTHITSIYDEELKYLTRRISEMGGLAEQMVADSVRALVNSDLA
                     LAQKVISDDTILDDAERQIGEKAIVTIAKRQPMAADLREIMGSIRIAADLERVGDLGK
                     NTAKRVIAVAGSGIPRKLARGLEHLAELALVQLKEVLDVYASRSPEKANSIRERDEEI
                     DAIYTSLFRELLTYMMEDPRNITPCTHLLFCAKNIERIGDHATNIAETIYYMATGAQP
                     VGERPKDDTTSSLGSVTD"
     gene            140628..141311
                     /gene="phoB1"
                     /locus_tag="USDA257_c01290"
     CDS             140628..141311
                     /gene="phoB1"
                     /locus_tag="USDA257_c01290"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate regulon transcriptional regulatory
                     protein PhoB"
                     /protein_id="AFL48730.1"
                     /translation="MLPKIAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEIRLQE
                     RLPDLLILDWMLPGVSGIELCRRLRQRPETERLPIIMLTARGEESERVRGLATGADDY
                     VVKPFSTPELMARVKAMLRRAKPEVLSTVLRCGDIELDRETHRVHRRSREVRLGPTEF
                     RLLEFLMSSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSNMPDVIRTV
                     RGAGYSLES"
     gene            complement(141430..141990)
                     /locus_tag="USDA257_c01300"
     CDS             complement(141430..141990)
                     /locus_tag="USDA257_c01300"
                     /codon_start=1
                     /transl_table=11
                     /product="GcrA cell cycle regulator"
                     /protein_id="AFL48731.1"
                     /translation="MDSAIPTPRTGSAEMNWTDERVEKLKKLWSEGLSASQIAAQLGG
                     VSRNAVIGKVHRLSLPGRAKAGGTTATARPKRTTSAPRAPNYAARAVTRTVTRTAGAT
                     VLKEEVAVDLVAEQELSIDTNIIVPMSRRLELTQLTERTCKWPIGDPLKEEFHFCGND
                     SPEASPYCSYHARLAYQPSAERRRMR"
     gene            142360..143559
                     /gene="argD1"
                     /locus_tag="USDA257_c01310"
     CDS             142360..143559
                     /gene="argD1"
                     /locus_tag="USDA257_c01310"
                     /EC_number="2.6.1.11"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine aminotransferase ArgD"
                     /protein_id="AFL48732.1"
                     /translation="MAATTPLYDTYLRAPLRFERGEGVWLIAEDGTRYLDFAAGVAVN
                     SLGHAHPHLVEALKGQAEKLWHVSNLYDIPGQESLARRLTAVTFADRVFFTNSGAEAL
                     ECAIKTARRHHFAKGHPERFHVITFEGAFHGRTIATIAAGGQQKYIEGFGPKAPGFYQ
                     VPFGDLAAVKNAINDETAAILIEPIQGEGGVRLAPKEFMQELRALCDEFGLLLILDEV
                     QCGVGRTGKLFAHEWSGIKPDIMAVAKGIGGGFPLGACLATEAAAAGMVAGTHGSTYG
                     GNPLAMAVGNAVLDVVLAEGFLENVRDVALVFRQGLASLKDRFPDVIEEIRGDGLMLG
                     IKAKVPSADVLKAIRAEKLLAVPAGENVLRLLPPLITTAAEAREGLARLERAAEKVRA
                     KSGTAAA"
     gene            143630..144547
                     /gene="argF1"
                     /locus_tag="USDA257_c01320"
     CDS             143630..144547
                     /gene="argF1"
                     /locus_tag="USDA257_c01320"
                     /EC_number="2.1.3.3"
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase ArgF"
                     /protein_id="AFL48733.1"
                     /translation="MTASRHFLDLSAMTSADLRTIIDDALLRKTATKAGTAEKPLDGK
                     MLAMIFEKPSTRTRVSFDVGMRQLGGETLFLSGTEMQLGRAEAIGDTAKVLSRYVDAI
                     VIRTTDHRRLLELAEHATVPVINGLTDDTHPCQIMADIMTFEEHRGPVKGKTIAWTGD
                     GNNVLHSLIEGSARFGYKMNMAVPLGSEPQNKFLNWARNNGGEILLCHEAEQAVAGAH
                     CVVTDTWVSMNQEHRARGHNVFQPYQVNEALMKHASPEALFMHCLPAHRGEEVTDEVI
                     DGPQSVVFDEAENRLHAQKSILAWCLGVV"
     gene            144965..145960
                     /gene="hslO"
                     /locus_tag="USDA257_c01330"
     CDS             144965..145960
                     /gene="hslO"
                     /locus_tag="USDA257_c01330"
                     /codon_start=1
                     /transl_table=11
                     /product="33 kDa chaperonin"
                     /protein_id="AFL48734.1"
                     /translation="MTETAPGLGEFDFAGDDHVVPFQVEGLDVRGRAVQLGPMLDAIL
                     ERHSYPLPVARLVAETVVLTVLLGTSLKFEGKLIVQTQGDGPVDLVVADFSTPDRVRA
                     YARYDEEALAAAENGGRTQPHELLGNGILAFTIDQGAHTQRYQGIVALDGATLEEIAA
                     VYFRQSEQIPTKVRLAVAELLDRDENGKPRHRWRAGGMVAQFLPEAPDRMRQPDLPGG
                     DGDDSDAGLLFEDDDLWAEAKVMVETIDTDELTDPMVGTERLLYRLFHERGVRVYQPQ
                     AVYDRCSCSRDKIRQVLEGLSDEDIEHSIEDGQIKVTCEFCSTNYRFEASEVRSQ"
     gene            complement(145972..146364)
                     /gene="apaG"
                     /locus_tag="USDA257_c01340"
     CDS             complement(145972..146364)
                     /gene="apaG"
                     /locus_tag="USDA257_c01340"
                     /codon_start=1
                     /transl_table=11
                     /product="protein ApaG"
                     /protein_id="AFL48735.1"
                     /translation="MYRALTRDIEVTVEPYYLEEQSDPDDSRYVWGYRIVISNHSGTA
                     VRLMTRYWHITDENGQVDEVSGPGVIGEQPLLNPGDTYEYSSGCPLDTPSGVMFGHYS
                     MEAEDGETFNVAIPAFSLDSPGLVRTLN"
     gene            146476..147090
                     /gene="ynjF"
                     /locus_tag="USDA257_c01350"
     CDS             146476..147090
                     /gene="ynjF"
                     /locus_tag="USDA257_c01350"
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane protein YnjF"
                     /protein_id="AFL48736.1"
                     /translation="MLDGAVRRHLDPILNRLGAALAKRGLSADAITICGLCLGLAAAV
                     LIARHDYLAAAALILLSRLCDGLDGAVARASRKTDFGGFLDIVLDFAFYGAIPLAFIV
                     ADPTANGLAGGLLLFSFYVNGSSFLAFAAIAEKRALSTEIRGAKSIYFTTGLAEATET
                     IAFFLVACLFPAWFSALAVIFAALCLYTALSRIVLARLIFRDGR"
     gene            complement(147140..148324)
                     /gene="metZ"
                     /locus_tag="USDA257_c01360"
     CDS             complement(147140..148324)
                     /gene="metZ"
                     /locus_tag="USDA257_c01360"
                     /EC_number="2.5.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="O-succinylhomoserine sulfhydrylase MetZ"
                     /protein_id="AFL48737.1"
                     /translation="MSKNWRPATQLVHGGTTRSQHGETSEAIFLTQGFVYDSSEAAEA
                     RFKGETDGFIYARYGSPTNDMFEKRMCMLEGAEDARATASGMAAVSSAILCQVKAGDH
                     IVAARALFGSCRWVVETLAPKYGIECTLVDGRDLANWENAVRPNTKVFFLESPTNPTL
                     EVIDIAGVAKLANQVGAKVVVDNVFATPLFQKPLELGAHVVVYSATKHIDGQGRCLGG
                     VVLADKAWIDENLHDYFRHTGPAMSPFNAWTLLKGIETLPLRVKQQTDNARRIADFLA
                     EQPQVARVIYPGRKDHPQADIIAKQMSGGSTLVAFELKGGKEAAFALQNALEISRISN
                     NLGDSKSLITHPATTTHKNLTDEARAELGISAGTVRFSAGIEDSDDLVEDFAKALKSV
                     RA"
     gene            148521..149618
                     /gene="dcd"
                     /locus_tag="USDA257_c01370"
     CDS             148521..149618
                     /gene="dcd"
                     /locus_tag="USDA257_c01370"
                     /EC_number="3.5.4.13"
                     /codon_start=1
                     /transl_table=11
                     /product="2'-deoxycytidine 5'-triphosphate deaminase
                     protein Dcd"
                     /protein_id="AFL48738.1"
                     /translation="MGRETGILADRAIAALYASGRLKSEKVLDDDQIQPASLDLRLGS
                     KAFRVRASFMPGPAHLVADKLDRLKLHVIDLSEGAVLETGCVYIVPLMESLSLPEMMS
                     ASANPKSSTGRLDIFTRVITDRAQEFDKIPAGYSGPLYLEISPRTFPIVVRRGSRLSQ
                     IRFRIGHSVLSEQELLGLHESDVLVASERPNVSGGGIALSIDLKGTGPEGLIGYRGKH
                     HTSVVDVDKKAEHAVFDFWEPLYSRGRDDLILDPDEFYILVSREAVHVPPLYAAEMTP
                     FDPLVGEFRVHYAGFFDPGFGHASAGGSGSRAVLEVRSHEVPFILEHGQIVGRLIYEH
                     MLERPEGLYGLDLGSNYQAQGLKLSKHFRAE"
     gene            149758..149832
                     /gene="trnG1"
                     /locus_tag="USDA257_c01380"
                     /note="tRNA-Gly-CCC"
     tRNA            149758..149832
                     /gene="trnG1"
                     /locus_tag="USDA257_c01380"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGG"
     gene            complement(150840..151652)
                     /locus_tag="USDA257_c01390"
     CDS             complement(150840..151652)
                     /locus_tag="USDA257_c01390"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="AFL48739.1"
                     /translation="MLFLGIAEPVWRLGAFAVIFAALAALELLHPRLERPELLQALKA
                     RRWATNLSILLFSSLLLRIVFPAAATGVALWTDLRGYGLLPAFGVPAPLAGLLAFVAL
                     DFAVWLEHVVFHKLPVLWRIHRVHHADPGVDVTTALRFHPLEILLSMAWKSAVIITLG
                     APAVSVLIFEIVLNAAAMFNHANLRLPPKVDRLLRQMIVTPDMHRIHHSVEKGETDSN
                     YGFNLSVWDRLFSTYVAQPASGDEAIQTGLKAFGRGEPTKLVWSLMLPFRRG"
     gene            complement(151756..152166)
                     /locus_tag="USDA257_c01400"
     CDS             complement(151756..152166)
                     /locus_tag="USDA257_c01400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48740.1"
                     /translation="MSASLSQHEALVYVMVMMSAVDRSMSDDEFARIGGLVRFLPAFD
                     GFDEDRLIHIGRECAAQLAAPEGLDVTLEMVRESLPQRHYETAYALAVEIAAADQRIR
                     TEEIRLLQLLRDRLGLDKLTCAAIERGALARFRR"
     gene            complement(152191..153030)
                     /locus_tag="USDA257_c01410"
     CDS             complement(152191..153030)
                     /locus_tag="USDA257_c01410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48741.1"
                     /translation="MRPQFISIAGGLAALALYAGILLNGAATIRARESAATPDFVLET
                     PDAAAIEEPAEEPAPAAQIPAEPTPPPAEAEAAAKTSRVPVRPVEPDLFAIPEEGVAK
                     PLERIAPRPPLSAPEEKKTTPTVLKRPIALAAGLVQTGDTTLQIKDIEPEKADKLCEG
                     AGKSWPCGMVARTAFRNFLRGRALVCDQVDEKTEDSPAASCRVGNINVAEWLVTNGWA
                     IPLSGTALEAKAEAARDAKRGFYGSDPRDLSRKPLVLQEPAGGLNFGETAPDLQAPVE
                     IPN"
     gene            complement(153043..153696)
                     /locus_tag="USDA257_c01420"
     CDS             complement(153043..153696)
                     /locus_tag="USDA257_c01420"
                     /codon_start=1
                     /transl_table=11
                     /product="putative peptidase, S24 family"
                     /protein_id="AFL48742.1"
                     /translation="MLSHDSIWRAIDALAERHQLSASGLARRAGLDPTSFNKSKRQSP
                     DGRDRWPSTESISKILEATGATIDQFMALLQSVSGVSPRSGQPASGIPLIGFAQAGAG
                     GFFDDGGFPVGQGWDEVEFPVAPQSKASVYALEVQGDSMLPLYRDGDVLIVDPGAQVR
                     RGDRVVLRSREGEVMAKILARQTSRGVELLSLNPEHPNRSFEMKDVEWIARIIWASQ"
     gene            complement(153859..154383)
                     /locus_tag="USDA257_c01430"
     CDS             complement(153859..154383)
                     /locus_tag="USDA257_c01430"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator protein, HxlR
                     family"
                     /protein_id="AFL48743.1"
                     /translation="MTDDHRSACPINLSLEVFGDKWSLLIIRDMIFGGKRHFREMLRS
                     QEGISSNILADRLKTLLDMGMLTKRDDPSHKQKAIYSLTEMAIALVPIMAHLGAWGRR
                     YLPVSEELSIRAQLMEEGGPALWERFMDELRAEHLGPSGASEGPSVRQTLQAAYEEVM
                     ARKAMQRQLDSAGS"
     gene            154524..154997
                     /locus_tag="USDA257_c01440"
     CDS             154524..154997
                     /locus_tag="USDA257_c01440"
                     /codon_start=1
                     /transl_table=11
                     /product="activator of Hsp90 ATPase 1 family protein"
                     /protein_id="AFL48744.1"
                     /translation="MTQTSVEHASFTIERVFMASPERVFGAFADPAAHDRWFVKADNW
                     PVAEYRHDFRVGGREGGRFSQDGKTFYFNETVYLDIVENRRIISAYTMAKDDRPISAS
                     LATVELAPEGSGTRVVFTEQAAFLDGLDQVEYRRSGWEQLIGFLAAELGEKAEAA"
     gene            complement(155018..155620)
                     /locus_tag="USDA257_c01450"
     CDS             complement(155018..155620)
                     /locus_tag="USDA257_c01450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48745.1"
                     /translation="MQLPKAEKPIMQPLPFALAILLLLATPGPTNTLLWLSGAAVGMR
                     RSLPLLLGELGGYLTVIVPVAVIAAPLLSAHPAIGLVLKLAAACWRLFMAHALWTVKA
                     NAASERPIVPGQVFVTTLLNPKALIFTLVIMPQVGLQAMPPWLLGFAALTLSAGRCGS
                     PAGTLLARLPRRPVGPRRIAAACLVAFSFGIAGSALASMV"
     gene            complement(155735..156031)
                     /locus_tag="USDA257_c01460"
     CDS             complement(155735..156031)
                     /locus_tag="USDA257_c01460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48746.1"
                     /translation="MSKPHKVVVENIIRPGKINFVDAEKYAAMKATLLAVTPTEPPGL
                     TLAEIRERILARLPEEEFPGGKGVSWWSKTVQLDLEAKGEIVREKTRPIRLHRG"
     gene            complement(156194..158407)
                     /gene="fadJ"
                     /locus_tag="USDA257_c01470"
     CDS             complement(156194..158407)
                     /gene="fadJ"
                     /locus_tag="USDA257_c01470"
                     /EC_number="4.2.1.17"
                     /EC_number="5.1.2.3"
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid oxidation complex subunit alpha"
                     /protein_id="AFL48747.1"
                     /translation="MSYTNFKIETDADGIALVTWDMPDKSMNVLTEEVMDELDAIVDQ
                     TTADAAVKGIVFTSGKSSFSGGADLSMIKSMFTLQTEEKKKDPANAAQKLFNLVGRMT
                     GLFRKLETSGKPWVSAINGTCMGGAFELSLACHGRVASNSKSVKIGLPEVKVGIFPGA
                     GGTQRVPRLTNTQDALQMMTTGSSLTAARAKAMGLVHEVVDPDKLVDAAKAMIKNGLK
                     AVQPWDEKGFKLPGGGVWTPASAQLWPAASAILRRETYGNYPGAIAILKCVYEGLQVP
                     FDTGLKIEQRYFTEILQTTEAFSMMRSLFISMQELGKGARRPAGVAKTELKRVGVVGA
                     GFMGASIAYVTAAAGNPVTLIDRDMEAAEKGKAHSEGLVKDAIGKGRLTKEEGEALLA
                     RISPSADYNDLKEVGLVVEAVFEDRQVKKDVIEKVEAVIGEDAIFASNTSTLPITGLA
                     KNSKRPEQFIGVHFFSPVEKMMLTEVIVGKETGDKALATALDYVAAIKKTPIVVNDTR
                     GFYVNRCVFRYIHEAYDMLIEGVPPAMIENAAKMAGMPVGPLSLNDEVAIDLSQKILK
                     ATVADLGEKAVDPRHMALVNKLVDELDRRGRKNGKGFYEYPAKPAKKYLWPELKTLYP
                     QKAADKVDVEVLKQRFLATMALEAARTIEEGIVTDPREADVGSILGFGFAPYTGGTLS
                     YIDGMGARAFVAMCNKLAEDYGDHFKPTPLLKEMAEKGETFYGRFDPYGQAQKAA"
     gene            complement(158429..159637)
                     /gene="fadA"
                     /locus_tag="USDA257_c01480"
     CDS             complement(158429..159637)
                     /gene="fadA"
                     /locus_tag="USDA257_c01480"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acyltransferase"
                     /protein_id="AFL48748.1"
                     /translation="MTKVFVYDHVRTPRGRGKKDGALHEVPSVRLAAKVLEAVRDRNG
                     LDTSTVDDIVMGCVDPVMDAGAVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFCA
                     AKIAQGADDIVIAGGVESMSRVGLGMSGGSWFMDPSVNLPAYFMPQGVSADLIATKYG
                     FSRDDVDAYAVESQKRAAHAWEKGYFENSVVPVKDQNGLTILDRDEHMRPGTDMQALA
                     SLNPSFQMPGEMGGFEAVAIQAHPEIERINYVHHAGNSSGIVDGAAAVLLGSKAGGAA
                     MGLKPRARIRAFANIGSDPALMLTGPVDVTEKLLKRADMKLSDIDLFELNEAFAAVVL
                     RFCQAFDIPHDQINVNGGAIAMGHPLGATGAMILGTVLDELERRDLNTALVTLCIGAG
                     MGTATIIERV"
     gene            complement(159749..161545)
                     /gene="mmgC1"
                     /locus_tag="USDA257_c01490"
     CDS             complement(159749..161545)
                     /gene="mmgC1"
                     /locus_tag="USDA257_c01490"
                     /EC_number="1.3.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase MmgC"
                     /protein_id="AFL48749.1"
                     /translation="MPIYKAPVDDTLFILNDVLGLERYHNLPGFADATPDMVAAILGE
                     AARLAEDELFPINLSGDQEGCKRRDDGSVTTPTGFKRAFDLYCEGGWLGLAAPEEFGG
                     QGLPYTLHTAVGEFMSAANMSLMMYPGLTQGAIAAILVHGSEEQKRAYLPKMIDGTWT
                     GTMNLTEPHCGTDLGLLRTKAAPNGDGSYRISGQKIFISAGEHDMAENIIHLVLARIE
                     GAPEGVKGISLFIVPKFKLNDDGRPGAHNGVSCGAIEHKMGIHGNSTCVMNYDEATGY
                     LIGAENKGLSAMFVMMNEARLAVGMQGLAIAEIAYQNAANYARERLQGRSLSGAKAPE
                     QKADPIIVHPDVRRSLMTIKAFNEAGRAFTLWTALKSDIAHRSDNEAERQAADDILGL
                     MTPILKGVLTDKGFEHAVMAQQVFGGHGYIEEHGMSQYVRDARIAMIYEGANGIQALD
                     LVGRKLGLNGGRAVMALFKEIGDFCEENRGDESLSGYTKALKKGLNDLQAATMWFMQN
                     AMAKPDNAGAGSTDYMHLFGLVVLGYMWARIAKTAQEKLAAGETTQADYLKNKLTTAR
                     FFMERILPETALRKVRIETGADTLMALDAAAF"
     gene            161961..165647
                     /locus_tag="USDA257_c01500"
     CDS             161961..165647
                     /locus_tag="USDA257_c01500"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48750.1"
                     /translation="MNGSRSNPQRIGNPSYGDRPSLDALNRTIEGLEARIEGLMSSVS
                     REQRQPERPTPPNNAVSEILERQRVLTAARERTPLRERIAARETDRPTPARLAEEPRY
                     QPSQAAPAQPPRPAAAADIAEALVGLRQDLKRDISDGLAREMHALRSEIRGIKVEASE
                     DRNNAADIRADLQRLADSINQLGRQAPSAQADALRVEFDDLRTMIDGLAREDSMRRME
                     SRWNGVEDRLNAFDQNRDDELVALAYRLDEIKSQIGTLNPASAVDGLEDKLVAVARAI
                     EILGRQIEPDDRRLVPQFAELDQRLDEIGRAIVAGRNATSLDNAVVNRLESRLGDLSR
                     QIDSLARPVDTGLGVRIEALTARVEDLAGERAAARLEERLDQLSALLEHSQRNAAPEL
                     TDYLADISRKIEALDQGSVNDALAERLDYLARRIDELDGHADSPAPDMRFDRLEDRLA
                     DIAQRLEETQAAPFDDREALRNLEAQIGNLSALVSQSHQEPAGAAPMEFESRMTALED
                     YLATSDEYIIEAARQAAEAVMEAYARNGMPQTAAGADMAAISALADDLRALEGLSRSS
                     EERTARTFEALHETLVHIAEKLERLEEREPSAGMRNAPRDMPMMPKVVQPEYGGAFGD
                     AAERQDERQQAGSATEVEVSATGPVAADLSSSVDVSTVERDEPRVEARAAKAGLLAGL
                     TRRFSAKRNETAPVQARQMVEPAPSIDASEMLAPEDANQLLEPGSGVPDVKKILERVR
                     AGQMARGGQPEAGGEKADFIAAARRAAQMAVEEADSLKSAKDNKGPSAVSGAFARHRR
                     PILMAVGAVLLAIMSYPLVSTMLKGRDAQSVQPAAAVERKADVETASKTSGGEAAKPV
                     STPVAATAAETPKAVAPVEKAGIAPVATNVPATKADTAAAIVSAADAGEAPLLQPPAK
                     PAHTGPVSTFQPATTGTLTAASFEPVKASDIVLPEGFGPSALVTAAKGGDPLAHYEIG
                     TRFTEGRGAKEDLAEAAKWYQRAADAGVVPAGYRLANLYEKGAGVTRDAAKAKALYQK
                     AAEAGNASASHNLAVMLASGRDGAPDLAAAVKWFEKAANLGVRDSQFNLAVLYARGNG
                     VAQSLEESYKWFAIAARGGDKDAGEKRDEIARAMKPEELSSAKAKVDAWKVQPLDAEA
                     NTVDVPDAWVGPSTKTASVDMTKAVRNIQAILNNNGFDAGAPDGHMGKKTIAAIKAFQ
                     KSIGHEPTGEITDELVKELLKRNS"
     gene            166077..167003
                     /locus_tag="USDA257_c01510"
     CDS             166077..167003
                     /locus_tag="USDA257_c01510"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="AFL48751.1"
                     /translation="MTVYLPIAELSVNIFIILGMGAAVGFLSGMFGVGGGFLITPLLI
                     FYNIPPVVAVATGANQVVASSISGAITHFRRGTIDIKLGTVLLCGGLVGATVGIWLFS
                     LLRSIGQLDLVISLLYVVLLGSVGSLMLWESIGAMRKAAKNQPTQLRRPGQHNWIHGL
                     PLKMRFKKSKIYLSVIPVATLGFGIGILTSVMGVGGGFIMVPAMIYLLRIPTSVVVGT
                     SLFQIVFVSAYTVIVQASTNYTVDIVLAFVLMIAGVIGAQYGVRVGQRLRGEQLRALL
                     ALLVLAVGIRLSIELIIPPKDIYSVVSAGFGF"
     gene            167003..167806
                     /locus_tag="USDA257_c01520"
     CDS             167003..167806
                     /locus_tag="USDA257_c01520"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="AFL48752.1"
                     /translation="MRALARLLLFALTLAAAGPASAQSLEREVGNFPEKLEIGISTDE
                     ISITSDFRGADLTIFGAIDGFDANLLAQGKYNIVVVLEGPKDNATVRKKQRVFGIWVN
                     TQSMTFELVPEAYSLSSTRDIATIAPPRDIANMGIGVDHMRLVPLGFIGDGSSLGEFR
                     NAFRRIREESGVYQRDPGGVQFISSSLFKASVRLPANVPNGVHVVRAYLFREGLFVAA
                     KALPLRVVKTGLEQAITRAAHEQPIIYGLLAVTLAVITGWGASLLFRKD"
     gene            167773..168210
                     /locus_tag="USDA257_c01530"
     CDS             167773..168210
                     /locus_tag="USDA257_c01530"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator protein, AsnC
                     family"
                     /protein_id="AFL48753.1"
                     /translation="MGREPALPQGLMRYGAGAELLDYRVGAFPFVPLRFKRGRKISNA
                     PSVLAPRGGYNGREATSRKQRKPMKPIFVQLQCAPGRTYEVADEIYRKEIVSEMYSTS
                     GDYDLLLKIYVEEGQDIGKFINDNIASVPGISRSLTTLTFNAF"
     gene            complement(168264..168989)
                     /locus_tag="USDA257_c01540"
     CDS             complement(168264..168989)
                     /locus_tag="USDA257_c01540"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphoesterase protein"
                     /protein_id="AFL48754.1"
                     /translation="MHRLVHATSAPAASAFFQARTTINGVDAICDPLGGLFLPEAGTL
                     VVSDLHLEKGSAFARRGMMLPPYDTLATLRILEAIVARHNPKTVISLGDNFHDRTGSA
                     AMPETFRQMIAAMARGRDWIWINGNHDPDGTSGLPGASMDEFRHAGLVFRHEPSLADG
                     LGEVAGHLHPSATVRRREKSVRRACFATDGKRLLMPAFGVTTGGLDLRHRAMSGLFDR
                     QQLVAHMMGRDRIYSVRFANLLG"
     gene            complement(168997..171516)
                     /locus_tag="USDA257_c01550"
     CDS             complement(168997..171516)
                     /locus_tag="USDA257_c01550"
                     /EC_number="3.6.4.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATP-dependent helicase"
                     /protein_id="AFL48755.1"
                     /translation="MPESDALTLPAPFLRWFAEKGWRPRAHQLELLSRAEAGQSTLLI
                     APTGAGKTLAGFLPSLVDVTRRGKIRPGAAFVGIHTLYISPLKALAVDIERNLTKPVS
                     EMGLPVRIENRTGDTPQGKRQRQKLNPPDLLLTTPEQLALLIADGEAERFFKNLRYVV
                     LDELHSLVTSKRGHLLALGLARLRRLAPGLQTVGLSATVAKPMELQRWLVGQTPDEES
                     YAGLITVSGGAKPEISILRAENHVPWAGHSARYAIPDIYAAIKEHGTTLLFVNTRSQA
                     EMLFQELWTINDDNLPIALHHGSLDVAQRRKVEAAMAENRLRAVVATSTLDLGIDWGD
                     VDLVVHVGAPKGASRLAQRIGRANHRMDEPSRAILVPANRFEVMECQAALDANYVGAQ
                     DTPPVGKGALDVLAQHVLGMACAKPFDVLELYDEITSAAPYAELSWETFERVVDLVAT
                     GGYALRTYERYARIRKTKEGLWRVSNRMVAQQYRLNVGTIVESPMLNVRMVKRNARGS
                     LGRGGMSLGKVEEYFLEMLSPGDTFLFSGKVLRFEGIRENECLVSQAFSFDPKVPSYA
                     GGKFPLSTYLAAQVRKMLGDPTRRATLPDQVRDWLALQDDVSMLPREDELLIETFPRG
                     SRHYMVTYAFEGRLAHQTLGMLLTRRLDRAGLKPLGFVATDYSLGVWALDDLGAAFRA
                     RAPSLAQLFDEDMLGDDLEAWLNESFLLKRTFRTCAVIAGLIDQRHPGKEKTGRQVTV
                     SADLIYDVLRMHEPDHILLEATRNDAAAGLLDIGRLGTMLKRIKGHITHRQLDRISPL
                     AIPVMLEIGREAVQGEAQDFLLTEAADELINEAMGGPHTDG"
     gene            complement(171620..172255)
                     /locus_tag="USDA257_c01560"
     CDS             complement(171620..172255)
                     /locus_tag="USDA257_c01560"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="AFL48756.1"
                     /translation="MAQMSSVFGLWNTSPTRHTPLEDVQGVFSGSLVAALGLYFLASA
                     GLLTGSTAGVAFLLHYATGVNFALAFFLLNLPFFYLSLKRLGPAFTIKTFIAIGLTSL
                     LTDAQSRLFEIEQIHPGWAALLGGLLLGYGVLALYRHRASLGGVGILGVYLQERFGIR
                     AGFVQLAIDMVVLAVAFAVTTPRVVLWSVLGAVVLNLFVAINHRADRYIAL"
     gene            complement(172359..173297)
                     /locus_tag="USDA257_c01570"
     CDS             complement(172359..173297)
                     /locus_tag="USDA257_c01570"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48757.1"
                     /translation="MTARQLSSGDLIADRRADYAKMLAESGDHQGAAELMAQALELVP
                     NWAAGWFRLADYEEKSGRKEAAIAALRHTLRLSPEDIFGASLKLALLGASDTPEQPPS
                     TYVEQLFDDYAERFDQALVEKLDYSVPEKLAALIERATDGHKFRHVTDLGCGTGLFGE
                     RIRSRAEFLEGFDLSVNMRAKAEGKAIYDRLGRADLSLSPVDSGVFGELAEARADLVS
                     AADVLMYLGNLESAFSITDRLLAPGGLFAFSVEDGAVGDGFVLRPSLRYAHPQSYVAS
                     LCAEFRLSMIEIERTVIRMDAGLPIAGILFLARKSA"
     gene            173442..173708
                     /locus_tag="USDA257_c01580"
     CDS             173442..173708
                     /locus_tag="USDA257_c01580"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48758.1"
                     /translation="MSDGVNKFLGDSPLRVLVKLVVVSILVGFVMTVFDWRPLDLLDG
                     IRDFVVDLWRTGFAALGRVGDYLLLGAAVVIPAFIILRLLSYRR"
     gene            173711..174214
                     /locus_tag="USDA257_c01590"
     CDS             173711..174214
                     /locus_tag="USDA257_c01590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48759.1"
                     /translation="MQDQFFLPRRRLILSAGAMISLGLIAGCSTSGLLTPDDGTGSDQ
                     TEATLGYVNTLRKGKGLSSLARDHAASVAAMHQAARMARVGKMKHNIGWRDDFSDRMK
                     GDGVTLPAAENIAMGQDNAERAYEAWFKSPKHLENMLGSYRGLGVAVAQNTASGNRPY
                     WAMVLSG"
     gene            174262..175629
                     /gene="dinF"
                     /locus_tag="USDA257_c01600"
     CDS             174262..175629
                     /gene="dinF"
                     /locus_tag="USDA257_c01600"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-damage-inducible protein F"
                     /protein_id="AFL48760.1"
                     /translation="MTAMESLERGRLAREAGPFDVTNRLIFSIAVPMTLGFLTTPLLG
                     LVDTGVVGRLGRAELLAGLAVGAVLFDLIFATFNFLRASTTGLVAQAYGRGDRREQQA
                     VFWRSLVIAIFCGIAILLLSPLLLALGLWLMAPDAEVAAVTRTYFLYRMLSGPAALAN
                     YAILGFVLGRGEGTLGLLLQTLINGINIVLAILFGLVIGWGVAGVAIATVTGEVIGAV
                     AGFAIVYARFDKRDAPDWATIFSRDRLKALFGLNRDIMIRSFVLLAAFTLMTRIGTSL
                     GPVTLAANAVLMTIFLVAGYYLDGLANAAEQLTGRSIGAAYRPAFDRALRITTLWSLG
                     LALMTTVFFLAFGNALVDLLTTAPEVRALAYEYMPWAAVTALTGAMAFLMDGVFIGAT
                     WSRDMRNMMLAAFLVYGASLTVLVPAFGNHGLWAGLNLFLLLRGLFLAMLLPRRAAQT
                     FRPAQ"
     gene            complement(175605..176693)
                     /gene="pyrD"
                     /locus_tag="USDA257_c01610"
     CDS             complement(175605..176693)
                     /gene="pyrD"
                     /locus_tag="USDA257_c01610"
                     /EC_number="1.3.5.2"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotate dehydrogenase (quinone)"
                     /protein_id="AFL48761.1"
                     /translation="MTGPVERLARRGLFLLDPETAHGVSIRALKSGVVPSCAAPTDPR
                     LEQIIAGLSFPNPLGMAAGYDKNAEVPEALLRLGFGFTEIGTVTPRPQQGNDKPRIFR
                     LVEDEAVINRLGFNNDGHGAALARLQACSRQALIGVNIGANKDSADRIADYVAGIRTF
                     HAVARYFTANISSPNTPGLRDLQARESLAALLSAVLAARDEEAAKGGRRIPVFLKIAP
                     DLTEEGMDDIAAEVLAHDLDGLIVSNTTLSREGLKDQRQAKEAGGLSGKPLFEKSTAV
                     LARMRKRLGPKVPIIGVGGVSSAETAAEKIRAGADLVQLYSCMVYEGPGLPGRIVRGL
                     SQLCDREKLASIREIRDSRLDYWAGRNV"
     gene            complement(176690..177157)
                     /locus_tag="USDA257_c01620"
     CDS             complement(176690..177157)
                     /locus_tag="USDA257_c01620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48762.1"
                     /translation="MTSSPLEAGGNPLLIDAPWWTCADICGKAMARIHDDERTKMNAT
                     IYKIVPALLWQEARRAGQFAGAPVDLADGFIHFSTRDQVTETAARHFEGQTDLLLVAV
                     DPNSLGDKLIYEPSRGGALFPHLYAPLTLDAVLWEKPLPLGADGSHVFPELAP"
     gene            177156..177587
                     /locus_tag="USDA257_c01630"
     CDS             177156..177587
                     /locus_tag="USDA257_c01630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48763.1"
                     /translation="MRQVIAALAFGLALGWSHLAVAQEPAPGRYSMQKAETGFARLDT
                     ETGEVTLCQEKEGELVCRMAADQRAAFERELDLLTKRVEALEKAVQGGATAVKPDLPT
                     DEEIDRTMSIMERMMRKFMDIVKELEGRDTTEEGGPVPDKT"
     gene            177695..178342
                     /gene="agmR1"
                     /locus_tag="USDA257_c01640"
     CDS             177695..178342
                     /gene="agmR1"
                     /locus_tag="USDA257_c01640"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol metabolism activator"
                     /protein_id="AFL48764.1"
                     /translation="MSDMTIIIADDHPLFRGAMRQALSGMASAPAVVEAGDFTAARKA
                     AADNPDADLMLLDLTMPGVSGLSGLIALRAEFPSLPVMIVSAHDDPATIHRAIDLGAA
                     GFLSKSAGIEEIRDGIGKVMAGEIFVPAGYDQNQEYEPEVADLLHRLQTLTPQQSRVL
                     SMLAEGLLNKQIAYELGVSEATIKAHVSAILLKLNVDSRTQAVIQLSKLGNVAAA"
     gene            complement(178472..181978)
                     /gene="pleC1"
                     /locus_tag="USDA257_c01650"
     CDS             complement(178472..181978)
                     /gene="pleC1"
                     /locus_tag="USDA257_c01650"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Non-motile and phage-resistance protein PleC"
                     /protein_id="AFL48765.1"
                     /translation="MLSGSVIFASAFAYLLLLFAVASYGDRRASRSKIASKGRPLVYA
                     LSLAIYCTSWTYFGGVGLAAEQGLEFTGIYIGPILMFTLGMPLIRRIVRLAKTEKLTS
                     VADFVAARYGKNPAVAAIVALISLVGAIPYIALQLKAVSSSVAAMIDTSDYGIGAGEN
                     FIDLPLLVTLFLACFAIVFGTRHTDATEHQDGLILAIAMESVVKLVAMLTAGIYIVFV
                     LFDGPANLLAAAQQSPAVLSALEYQTPIARWILLIVLSAFGIIMLPRQFHVTVVENRT
                     ENELRTAGILFPLYLIAINLFVLPIAIAGILTFSGSGDADLYLLALPLAGDVPFITLL
                     TFIGGFSAATAMVIVASVALSIMISNDIVMPVFLRQRLGTRGTLQESVAGTLLNIRRT
                     AIFVVLLLGYGYYRSADMSAGLASLGLLSFVAISQMAPALLGGLVWRQANARGAIAGM
                     VSGFLVWAYLLFLPSLGGPDNSHVATTILSFLLPFTDLFSGPQSDPLVNASALSLLVN
                     VSAYVLGSLTRTPKPLERFQAGVFITRRSRTDRTFRGRKTKVTVRDLKTTIARYMGEE
                     RMQRSFHTYEQQSGRWLDENASADMALVHFSEQLLGSAIGSSSARLVFSLVLQRMDDT
                     SSDTAWLLDQASEALQYNQDMLQTALSQMDQGIAVFDNANNLIIWNRRFRELLDLPEV
                     AGQVGFPLADMVAILARRGDIRKDEERTLVTNFLTLDKPFLLELGTGARIIEVRTNAM
                     PDKGIVTTYTDITPRVAADMALKQANETLELRVTERTSELTRVNRELGEARAAAEDAN
                     IGKTRFFAAAGHDILQPLNAARLYSSSLVERLGDSDNKALVQNIDSSLESVEAILGAV
                     LDISRLDTGAMKPRLQAVPLDDLLRRIETDFAPMARAKEIEFVVMPTSLVVRSDPNLL
                     RRLVQNLVSNAIKYTLKGKVLVGVRRRGQQVTIEVLDSGIGIPASKFRTVFKEFARLD
                     EGARTASGLGLGLSIVDRISRVLNHPVGLRSKPGKGTGFKVTVPRDASAGERARPQPV
                     VAAKASDALTGLNIVCIDNEPKILEGMALLLGGWGCAVTTVESVAACARMGPNDLPVR
                     PEAIVADYHLDDGTGIEAIASIRALWKESIPALMVTADRTPEVRGAAERDGVSLQHKP
                     VRPAALRAWLTQLAAAGRAAAE"
     gene            182220..182648
                     /gene="mscL"
                     /locus_tag="USDA257_c01660"
     CDS             182220..182648
                     /gene="mscL"
                     /locus_tag="USDA257_c01660"
                     /codon_start=1
                     /transl_table=11
                     /product="large-conductance mechanosensitive channel"
                     /protein_id="AFL48766.1"
                     /translation="MLNEFKEFIARGNVMDLAVGVIIGAAFTKIVTSVVDDLVMPIVG
                     AITGGGFDFSNYFLPLSANVTAPTLAAARQQGAVFAYGSFITVLINFLILAWIIFLLI
                     KIVNRLRRSIEREKPPAPDAPPPQDILLLAEIRDLLKQRA"
     gene            complement(182628..182774)
                     /locus_tag="USDA257_c01670"
     CDS             complement(182628..182774)
                     /locus_tag="USDA257_c01670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48767.1"
                     /translation="MIVIGGLLNCPPLLDAFAAPITRFSLTDLSISVMFSRPAARISR
                     ALFQ"
     gene            182764..183930
                     /gene="aspC1"
                     /locus_tag="USDA257_c01680"
     CDS             182764..183930
                     /gene="aspC1"
                     /locus_tag="USDA257_c01680"
                     /EC_number="2.6.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase AspC"
                     /protein_id="AFL48768.1"
                     /translation="MTIMTSLSPRALSAPESGIVEVVNYARGRDGLIPLWVGEGDLPT
                     PEFISRAAAEALVAGETFYTWQRGIPPLREALVRYYQRRFQKTLAPENFYVTGSGMQA
                     IKLAIEAIASPGDEMVLLTPAWPNFAAAADLSGVRPAAVPLRFENGKWQLDLDRLEAA
                     IGEKTRALFINTPSNPTGWTATQDDLKAILSLARKHGLWIIADEIYALYYYLGGRAPS
                     FLDIMEEDDRILFVNSFSKNWAMTGWRVGWIVAPPAMGQVLENLIQYSTSGVAQFMQR
                     GAVVALDEGDGFVDDNVAKARRNRDLLCDALIATNRVETLKPDGALYAFLKIDGVTDS
                     RRAAIDIVDKTGVGLAPGTAFGEGGSLFMRACFLRDPVQIAEAADRLRTYIVNR"
     gene            184109..185143
                     /gene="exoB1"
                     /locus_tag="USDA257_c01690"
     CDS             184109..185143
                     /gene="exoB1"
                     /locus_tag="USDA257_c01690"
                     /EC_number="5.1.3.2"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase ExoB"
                     /protein_id="AFL48769.1"
                     /translation="MTILVTGGAGYIGSHMVWSLLDAGETVVVLDSLTTGFRWAVAPE
                     ARFYFGDVGDWAILARIFAENAIDAVVHFAGSAVVPESVAKPLAYYENNTAKTRALIA
                     ATIDAGVRRFVFSSTAAVYGTQDTPDPVKETAALRPESPYGRSKLMSEIMLEDAAAAH
                     DFSYVALRYFNVAGADPLGRAGQSTFGATHLIKVACEAALGRRRKVDVFGTDYPTADG
                     TGIRDYIHVSDLVAAHRNALDYLRRGGEPLVTNCGYGEGFSVLQVLDTVRQVSGRDFR
                     VDYAPRRPGDAAQVVADPSVARLKLDWVPTHASLEHIVQSAFDWEGYLSRKNSFDDGR
                     GEDGRLVANG"
     gene            complement(185167..185472)
                     /locus_tag="USDA257_c01700"
     CDS             complement(185167..185472)
                     /locus_tag="USDA257_c01700"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48770.1"
                     /translation="MPKTPAECKTMVDVRAEIDRLDRSLMALFAERWGYIDRAAEIKR
                     PLNLKADIPARVAEVRENARRHAIEFGLDPDFYEELWTQLIDRAIAHERELLGEGEQ"
     gene            complement(185717..185830)
                     /locus_tag="USDA257_c01710"
     CDS             complement(185717..185830)
                     /locus_tag="USDA257_c01710"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48771.1"
                     /translation="MGADRLGRRLLWFVGLWLAGVAAVSVVGLAIKLVLGS"
     gene            complement(185830..186834)
                     /gene="cydB"
                     /locus_tag="USDA257_c01720"
     CDS             complement(185830..186834)
                     /gene="cydB"
                     /locus_tag="USDA257_c01720"
                     /EC_number="1.10.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome d ubiquinol oxidase subunit 2"
                     /protein_id="AFL48772.1"
                     /translation="MAIDLPFIWAALIAFAVLAYVVLDGFDLGVGILFPYFPEKHDRD
                     VMMNSVAPVWDGNETWLVLGGGGLMAVFPLAYATVMPALYAPIIAMLLGLIFRGVAFE
                     YRWRTRRAEFLWNWAFAGGSTLAAFSQGLALGGLVQGIPVEDRAYAGGWWDWLTPFSI
                     VTGVAIVVGYALLGATWLIMKTRGDLAERARSIAVKCAFATVAAMGIVSLWTPFLEPV
                     YLQRWFGWPTAIFSVIVPLLVLGCLYLLLKGIQERHDVQPFIASLGLFVLGYIGIGIS
                     FYPYMVPPSLTIWDAAAPNESLAFLLVGALVLVPIILAYTAYSYWVFRGKVDPEEGYH
                     "
     gene            complement(186824..188239)
                     /gene="cydA"
                     /locus_tag="USDA257_c01730"
     CDS             complement(186824..188239)
                     /gene="cydA"
                     /locus_tag="USDA257_c01730"
                     /EC_number="1.10.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome d ubiquinol oxidase subunit 1"
                     /protein_id="AFL48773.1"
                     /translation="MFEAFDATVLARIQFAFTVSFHIIFPAFSIGLASYLAVLEALWL
                     WKKDEVYLELFNFWKTIFAVAFGMGVVSGIVMSYQFGTNWSVFSDKAGPVIGPLMGYE
                     VLTAFFLEAGFLGVMLFGLNRVGPRLHFLATAMVAFGTLISATWILAVNSWMQTPAGF
                     SVNEAGQFVPSDWWAVVFNPSFPFRLVHMVLAAYLTTAFVVGACGAWHLLRNTAPRRA
                     RTMFSMAMWMAAIVAPIQIFAGDLHGLNTLEHQPAKIMAMEGHYESHPDGAPLVLFGI
                     PNSGEKRIDYAIEVPKLGSLILKHDLDAPLAGLDSIPDELHPPVSIIFWSFRVMVGMG
                     LAMLGIGLWSLWCRYRGTLATNAWLHRMTVLMGPAGFVAVLAGWITTEVGRQPYTIYG
                     HLLTADSVSPIEAPAVGASLVAFIVVYFLVFGAGTFYILRLMARLPRDTMPELDEGPL
                     RTAGVTPGPAAAKSHGGHHGH"
     gene            complement(188437..189606)
                     /gene="hipO1"
                     /locus_tag="USDA257_c01740"
     CDS             complement(188437..189606)
                     /gene="hipO1"
                     /locus_tag="USDA257_c01740"
                     /EC_number="3.5.1.32"
                     /codon_start=1
                     /transl_table=11
                     /product="hippurate hydrolase HipO"
                     /protein_id="AFL48774.1"
                     /translation="MRISAAISNSLPELVAIRRDLHAHPELGLEERRTSAFIAQHLEA
                     LGYMVTTGLAKTGVVGTLRNGTGARSIGIRADIDALPIHEETGLDYASKTPGLMHACG
                     HDGHTAMLLGAARALAERKNFDGTVHLIFQPAEENFGGAKIMIDEGLFDKFPCDAVFA
                     LHNEPNLPFGQFAVREGPIGAAVDEARITVHGRGGHGAEPQETADPIVCGASIVMALQ
                     TIVARNIHPMDPAVVTVGAFHAGSASNIIPERAEIVVGIRSFDPAVRDELERRIRTIA
                     EAQAASFGMRATVDYQRSYDATINHKTETDFVRDLAIRFAGADKVVDLARPYMGSEDF
                     AYMLKEKPGTYFFLGSRVTGEEKPLHHPRYNFNDDLLPIGAAFWTELAEAYLART"
     gene            complement(189608..190432)
                     /gene="occM1"
                     /locus_tag="USDA257_c01750"
     CDS             complement(189608..190432)
                     /gene="occM1"
                     /locus_tag="USDA257_c01750"
                     /codon_start=1
                     /transl_table=11
                     /product="octopine transport system permease protein OccM"
                     /protein_id="AFL48775.1"
                     /translation="MTDETTHALALVPEDLPKAENFLKPHRIVLMLLFAGLVVAVAVF
                     MRWDWLPRYLPRLGSGILVSLAMLFSTAILGFLLAVPLGLVQVTGPWFLKLPARLFCT
                     IIRGTPLLLQLWLLYYGLGSLFPQFPAIRHSFLWPYLREAWPYGVAALTLSFAAYEGE
                     VMRGAFAGVPQGELEAARAYGMGRWTMFRRIWLPRAVHRALPTLNGETVLQLKSTPLV
                     ATITVIDVYAVISKVRQETYLTYEPLLLLALIYMCLTGILVLAFRYFENRIPTRGA"
     gene            complement(190429..191457)
                     /gene="hisQ1"
                     /locus_tag="USDA257_c01760"
     CDS             complement(190429..191457)
                     /gene="hisQ1"
                     /locus_tag="USDA257_c01760"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine transport system permease protein
                     HisQ"
                     /protein_id="AFL48776.1"
                     /translation="MLRLQGRSRSGRRRSRTGRRGRTAQGRDGAQGQDQRGDQGDPCQ
                     RHLRRLLEEVLRLRHLRRLTAAGRRSYDRRPMLLSWSGCGCKTAHTFPHPALKNEVAM
                     AADSFINWSLLALSAPGWGGVLLQGFLHSIEIAVGGYALGLTLGVGGAFGKLYGGPVL
                     RDLLECYTTIVRAVPELVLILLLYYAGTDLLNQFLGTLGFATVDISGLMAGIFVIGIV
                     QGAYSTEVLRGAIKAVPSGQIEAARAYGMSPAKVLRRITLPAMLPYAIPGLANLWLIA
                     TKDTALLAVVGFSELTLVTRQAAGTTKAYFLFFCAAGALYLALTLLSNIFIGMIERHA
                     RRGFAEQR"
     gene            complement(192086..192859)
                     /gene="aotP"
                     /locus_tag="USDA257_c01770"
     CDS             complement(192086..192859)
                     /gene="aotP"
                     /locus_tag="USDA257_c01770"
                     /codon_start=1
                     /transl_table=11
                     /product="arginine/ornithine transport ATP-binding protein
                     AotP"
                     /protein_id="AFL48777.1"
                     /translation="MTDAAQAIAVTDLYKRFGPLEVLKGVSLHARQGDVIAIIGGSGS
                     GKSTFLRCINMLELPSAGRVCVHGEEIRMRPDGRGGLMPADRRQVQRIRTQLGMVFQS
                     FNLWQHMTILENVIEAPVHVLGKSKTEAVEMAEKLLRRVGLHEKRDAYPAFLSGGQQQ
                     RAAIARALAIQPLVMLFDEPTSALDPELVGEVLSVIGDLAREKRTMILVTHEMKFARD
                     VASHIVFLHNGIIEEQGPPEAIFGAPKSERLKKFISSIH"
     gene            193124..193738
                     /locus_tag="USDA257_c01780"
     CDS             193124..193738
                     /locus_tag="USDA257_c01780"
                     /codon_start=1
                     /transl_table=11
                     /product="putative HTH-type transcriptional regulator,
                     TetR family"
                     /protein_id="AFL48778.1"
                     /translation="MSRRSFHRAPEGERRQELIEATLDCISEFGLKGATVRQIAVRAG
                     VTAGLVRHYFDSKDQMVAEAYRAVIASLTEKAKNVAGDPTTRLKDFIAINLTEPVADS
                     RSVSLWAAFISQVRVDPVLAEIHRDGYLAFRNALQDLLSDFLAAKGRAASPEECRRYA
                     IAINGLVDGLWVEGCLAGDLFRDGELVGIAMASVEALLGLPIEE"
     gene            193757..194947
                     /gene="aspC2"
                     /locus_tag="USDA257_c01790"
     CDS             193757..194947
                     /gene="aspC2"
                     /locus_tag="USDA257_c01790"
                     /EC_number="2.6.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase AspC"
                     /protein_id="AFL48779.1"
                     /translation="MRYASITKRLADLGSGKWSLHIRARQLKASGADLIELTIGEPDL
                     PPHRALLDECQRAMDAGRYRYSNGRGEPALVAALAAKYRRRRAEVTAENILCFPGTQT
                     ALFAVMLGLAEAGDGVLVGDPLYATYEGVIHSTGAHPVLVPLKPEHGFHMRAEDLERA
                     ITPNCRVLLLNTPHNPTGAVLTKAEIAAIGEVARRHDLWIVCDEVYEELVFDAAFASP
                     FDNQDLAERTVVVSSISKSHAAPGFRSGWAIGPAEFTYRLLPVSETMLFGQQPFIADM
                     TAYALTHEIDTARQMREAYGRRADRIAIALARTPCVSVLPPEAGMFALIDVAGTGVSG
                     EAFAWALLEEESVAVMPGSSFGEQAQDFIRVSLTVPDAAIDEACRRIAVLAERCANRE
                     ERRA"
     gene            194944..196557
                     /gene="ilvB1"
                     /locus_tag="USDA257_c01800"
     CDS             194944..196557
                     /gene="ilvB1"
                     /locus_tag="USDA257_c01800"
                     /EC_number="2.2.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase isozyme 1 large subunit
                     IlvB"
                     /protein_id="AFL48780.1"
                     /translation="MSSGMKTVGEVLVDLLEANGVEVVFGIPGVHTVELYRGLGASKI
                     RHVTPRHEQGAGFMADGYARVSGKPGVALVITGPGLTNTITAMAQARQDSIPMLVISG
                     VNRRDSLGHGRGLLHELPDQQGMMKTLALYSHTLINPADLPLVVDRSFAVLLSGRPGP
                     VHIEIPTDVMAERIESRGTKPAAATRPRSDSETLQRAAILCAEASRPVILCGGGALTG
                     EVEVRALADQIGAPVVTTVNARGMLAGHSLRVPASPSLKAVRALLRDADVVLALGTEM
                     GQTDYDLYADGGFPVLRNLIRTDIDAAQLARGPQAALSILSGAKAATAGMLGFLPGHT
                     AAKDGASRADATRKAALKELPPKTRAEIGVIDLIYKALPDCTIVGDSTQAVYAGNLYC
                     DAPRQRAWFNSATGYGSLGYAPPAAVGAAVADRTKPVVCLVGDGGFQFSLAEIGSAAD
                     AAARVIFLVWNNDGYREIESYMVEAGITPEGVKPSAPDFLMTAGAYGVPAERLANIED
                     LPRALADAASRSGPSLIEIHQEKTAGVGS"
     gene            196852..197235
                     /locus_tag="USDA257_c01810"
     CDS             196852..197235
                     /locus_tag="USDA257_c01810"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48781.1"
                     /translation="MQAGRLVAVLWLFCASFAMQVIAVGQSVSGRAGAQSGNVSAPDS
                     GSPDRPAARQISRAVALPELRISGERPDGKSTLGGDPSAVLTVEAATLPIYEDVRPHS
                     FLRAEAPTGSRHESERIRGPPSFLA"
     gene            197333..199867
                     /gene="secDF1"
                     /locus_tag="USDA257_c01820"
     CDS             197333..199867
                     /gene="secDF1"
                     /locus_tag="USDA257_c01820"
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase subunit SecDF"
                     /protein_id="AFL48782.1"
                     /translation="MRTSRWAVLAYVAIIIFGCLAAVPSVLTPAMREQFASVLPFKPV
                     TLGLDLRGGSHLVLEVDGAGLQKARLNSLLDDTRRVLRGERVSASSARISGNSVTVSV
                     TDAADREKVLPKLQELAAPVGTVGFGGSAAELEVTTNGDVIALAMTEAGLSDRMTKAV
                     EQSLEIIRNRVDQVGVAEPLIQRIGSDRILVQLPGLQDPTRLRELLGSTAQMSFHMLD
                     QTADVTQPAPRGVDILPGANDGNKYPVESRIAISGERLEDAKVGFDQRTNQPVVDFAF
                     DSLGARQFADITRENVGRPFAIVLDGKVLTAPVINEPILGGRGQISGNFTVEEATVLS
                     ALLRSGALPAPLTIIEERSVGPNLGSDSIRMGLYTGLAGFGLVVTLMVVLYGAWGMIA
                     NVGLVLHTIMTIGVLGLIGSTLTLPGIAGIILGIGMAVDANILINARIREETEAGAGA
                     MKALDVGFNKAYATILDSNVTTLAGTVLLFWLGSGPVRGFAVTMMLGIVISMFTSVTV
                     VRLLMREVVVRRKMKKLEIPSLFGRVPHLPTFSFMKRRFQAIGFSAFLSISSVILFFT
                     PGLNYGIDFIGGIQVEAVSKEKIDLPTLRHSLEELNLGEVALQDFGGGQSVLIRVQRQ
                     PGGEQEQTAALSRIKDAVTTAIPGAALERTEVVGPTVSGELARSGFLAVGLAMVAILL
                     YIWFRFEWHFAVGAIAVLLLDITKTVGFFALTGIDFNLTAIAALLTMIGYSVNDKVVV
                     YDRMRENLRKYKSMPFSDLIDMSINQVIARCIFTSMATALSLVPMAIWGGEAVQSFAW
                     PMIFGVIVATTSSIYIGGPILLFLSRWWKDREASRSGAQQPGAPAA"
     gene            200371..200574
                     /locus_tag="USDA257_c01830"
     CDS             200371..200574
                     /locus_tag="USDA257_c01830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48783.1"
                     /translation="MSKQVIEYGGEAVGVVVPDQDRFKFLAVKYHVWDLDAKRFGSAD
                     EARAAIGHLLAGQGAPKHEAGAA"
     gene            200863..201873
                     /locus_tag="USDA257_c01840"
     CDS             200863..201873
                     /locus_tag="USDA257_c01840"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphosugar isomerase"
                     /protein_id="AFL48784.1"
                     /translation="MGLRNLKAEGHSPSAVLDSIRRTITTAKNGIEALAEQLATDTAF
                     AQSLIDAVELIGDGHGRVVVSGVGKSGHIGRKIAATLASTGTSAYFVHPTEASHGDLG
                     MVTSDDVLILLSWSGETAELANMLTYAKRFKVPIVSISSNRDSILARNSEIALVLPKV
                     PEACPHGLAPTTSAMLQLAVGDTLAIALLERRGFSAEDFKTFHPGGKLGAQLRLVHEL
                     AHLADQMPLLAVGRPMSEAVIEMSAKGFGVIGIIDEGGVLVGVITDGDLRRHMAGDLL
                     SQPVEDVMSHHPKVVQADLLASAAMEFMQEHKVTVLFLVDEAGVPEGILHIHDLLRAG
                     VA"
     gene            complement(201843..203174)
                     /gene="kpsS"
                     /locus_tag="USDA257_c01850"
     CDS             complement(201843..203174)
                     /gene="kpsS"
                     /locus_tag="USDA257_c01850"
                     /codon_start=1
                     /transl_table=11
                     /product="capsule polysaccharide export protein KpsS"
                     /protein_id="AFL48785.1"
                     /translation="MKAGTTIEQRPRRTFLFLQGPSSPIFAKIATRLEAHGHTCLRIN
                     LNAGDQIFWRRGGAHNYRGSITNWAGFVEEFIRRHSVSDLVLLGEERPYHQIAVASAR
                     RLGVEIFVVEMGYLRPDWLTLERGGMSSNSHFPADPQQILRAAAGLPEPDWRRRHTQT
                     FLAEAAYDLLYNLPNVFLWFLFPGYRRHAIFHPLAEYAGWVRRLTTSKRQCNAADRLI
                     ASLSSAGASYFVYPLQLETDFQLRAHSPFTSQKEAIGDILQSFSRHAPAATKLAIKVH
                     PLDNSLIPWRRIITHQAAALGIGARVVYLEGGNLDLLTEKSAGMVTVNSTAGLHALKQ
                     GKPVKVLGKAVFDIADMTDQQPLDAFWEAPQPPDPDLSAAMFRLMAASIQVRGNFYSV
                     AGTDAGADAIAERLHRNTVNEPGAFIDPPPRQKPAKRAAASGQATPARNRS"
     gene            complement(203201..204796)
                     /gene="rkpI"
                     /locus_tag="USDA257_c01860"
     CDS             complement(203201..204796)
                     /gene="rkpI"
                     /locus_tag="USDA257_c01860"
                     /codon_start=1
                     /transl_table=11
                     /product="capsular polysaccharide biosynthesis protein
                     RkpI"
                     /protein_id="AFL48786.1"
                     /translation="MALLPFELHDYPAALTLGCYLLSCGVIFFTDRFALPKRERRKNA
                     SPHGRNQDIVDVLARLPVIALVFAGFFAISWRPLYAAAGTMSFFIIFTGISRAKFKFI
                     REPLVFSDIALVADVFKYKSIFYATSLNVVFWVVAFLYVFGVSGLYMYFEPTALPARD
                     KLFWILVMIVIAAGPWLLLFYGPVNRPTAALVQRLVGKKVNLKMSTVRFGTFGSVVFH
                     FIVWLGVKREKIVAELSVRLRAAVHDLIGHEEAPLIVVWQSESFIDMRHFGVDTIKLP
                     AIDRLRQQAVQWGRLSNVFEGGYTLRTEFAVLSGLVPDDIHVDASYPYLRAAHYADAV
                     WPGKLKRAGWRTHFIHPYDRTFFLRHKAMPLLGFEKLTMLDAFDHDPSQDGLYVSDAA
                     LTARVLEETRKLPDDDSGLFFVASMANHGPWEPGRVGTLTNPVDIYLAILQQSDAALK
                     KLVDGLERLDRPVWLVFYGDHAPLLKSFADPFPDPRTDYYIVPLAKARPANHRPKLPQ
                     DEDPWNLLRALLRHANLHKDALQ"
     gene            complement(204897..205700)
                     /gene="rkpH"
                     /locus_tag="USDA257_c01870"
     CDS             complement(204897..205700)
                     /gene="rkpH"
                     /locus_tag="USDA257_c01870"
                     /EC_number="1.1.1.56"
                     /codon_start=1
                     /transl_table=11
                     /product="RkpH"
                     /protein_id="AFL48787.1"
                     /translation="MTHVIITGGSSGIGLALASLYAVRGARLSLIARSRDPLELAARK
                     LVAKYGARAEDIHIETADVAREEAIGSAIGRCVEALGPCDVLVTSAGVVEPAPFEDMS
                     SAAFRRQMETNFSGTVHAVRAVYPDMARRRTGHIVMISSGSGLIGIYGYTSYCASKFA
                     LRGFAEALRSEARCHGVGVSVSFPPDTETPQFEREIAERPREASVVMGAVRPWSAEAV
                     ARKIVKGVEGKRFEIYFGLTLFLLGRFGPAVRPLVDWWFDRAIARSRGR"
     gene            complement(205808..207223)
                     /locus_tag="USDA257_c01880"
     CDS             complement(205808..207223)
                     /locus_tag="USDA257_c01880"
                     /EC_number="2.3.1.29"
                     /EC_number="2.3.1.47"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 8-amino-7-oxononanoate
                     synthase/2-amino-3-ketobutyrate coenzyme A ligase"
                     /protein_id="AFL48788.1"
                     /translation="MSNDGNGQTFSKMNSSLKENLLDRMRNTHQSSERNRMARSERDL
                     PPAPRRQQARFEDLPEYKQVQTQKFASEQLGIANPFYRAHQTAAGATTVIDGRKLINF
                     ASYDYLGLNRHAHVLDRARETIETFGISASASRLVAGERPVHVELEERIARFYGVDAA
                     VCFVSGYLTNVAAIGCLLGPKDLVIHDEFIHNSALAGIKLSGAARRLFKHNDTADLEH
                     VLRTVSGDYRHIMVIVEGIYSMDGDVANLPALLKLKAEFGFWLMVDEAHSLGVLGRRG
                     KGLAEHFGVDPHEVDIWMGTLSKTTSSCGGYIAGSEALAAVLKASAGGFVYSVGLAPV
                     LGASAVASLDVLEREPERTAALRRNGALFLKLAREAGLDTGLSGGYSVVPVIVGDSLR
                     AVQLSNDLHAAGINVLPIIHPAVPEGMARLRYFITSEHTEEQIRRTVTLTAERLTDLT
                     ERNFGLGGVDIDQMLKALSAR"
     gene            complement(207220..214725)
                     /locus_tag="USDA257_c01890"
     CDS             complement(207220..214725)
                     /locus_tag="USDA257_c01890"
                     /EC_number="2.3.1.94"
                     /codon_start=1
                     /transl_table=11
                     /product="erythronolide synthase, modules 3 and 4"
                     /protein_id="AFL48789.1"
                     /translation="MTVEIIGRACLAPGAQSPQALFKILRQGMCTVTSVPGDRWDLAR
                     FWHPVMGTQGKTYSFAAGVLETIYDFDPAVFGMSQREAMYMDPQQRVLLQLAWRALED
                     ANISIASLHGENVGVYVGASSLDHANLTVEDPAAAGPYFMTGNTLSIVSNRISHVFGL
                     SGPSMTVDTACSSSLVALDQAMRALNAGEIDTAIVGGVNILAHPLPFVGFAQARMLSP
                     EGLCRAYDNDGAGYVRAEGGVVFVLRRSDRARRERDRSYARIVASGVNSAGRTNGISL
                     PSREAQANLLKAIYEGNGIDANQVAFVEGHGTGTKVGDPAEVWSIGTVIGAKRRAPVP
                     IGSIKSNIGHTEPASGLFGMMKAVLALEHNYLPASLHFDTPNEHIDFDSLNVRVTANP
                     IELLKGKRARLAGINSFGFGGANAHVVISDPDPVPQERATAGSAGQVFLASAHTQSSL
                     ENLLRDYKATFAGASKEETRAIIAASGANRTHMRHRFAARSDHPEDIVRAIASYLEKP
                     GSDIGEVGEAPLKNAQVAFVFSGNGSQWAGMGVEAFRENLHFRQSFTSVSALFKFHSD
                     IDLKDLLTDPELDKRLADTKVAQPLLFAIQAALSDSLVAMGIKPTAVFGHSVGEIAAA
                     YAAGALSLVDAVSIVAKRSLHQDLLAGEGTMAAVMLGEEAAAAFAQARGLDEVCVAAV
                     NAHNSVTISGPAHEVTAFRDAARKAKIPVQILDINYPFHHPIIDQAKEAFLADIPDIA
                     PRRTELTYLSTVTGSALDGTELEPDYWWRNVREPVRFQAATDAALVLGCRLFIEISPR
                     PILASYVKETIKQAAVPAAVVPTLLRDDGERGQDPISASMARAVAHGAAVDRPRVYGK
                     RDAFIELPSLPFEPIELRPQTTTDATDLFGRSGKAYRLIGWRGDPNSGSWKNHVDAHL
                     FPDLAEHVVDGKAILPGSGFIEIAVSAAQQYYGSDEVEITNLEIVRPLELSDSRIVEL
                     STILSPETGDIEIRSRERLSEDDWTVHAVARSRKPIAGANGRHPPISGLAKTGIVTPA
                     RAYDTAKHFGLDYGPHFQLLTRAVAYGERLIDVELKAPAGSGHPLVSYALHPISVDAT
                     FHGLVALFDRFTGDKGGAPYIPVRFGSVRVVNAGRPIARATVEIDSVSANSIKARFHF
                     FDAAGEPIAHFDDCRFRRTYLRKHKTLDSLSFHYEAVLSDVILPGTKRAGAVPAKLTE
                     PAAANSGVDNATLLFNAAIYRACHEIAHKLARGKSTIPDNRLPGDFAFQCFLTNCFYA
                     LEDAGLCEHQNGSWRVAPEFTLPSVEEILGELYGERPDRAVEAVLINNAYAEALSRLD
                     MLLARTADGETAAFNAGFISEATLDHQAVHSVASRSRMDQVLGMVEQALDAQVGGARL
                     RIVELGSVSAGFTRRLADLAARHGTTLSVVEPRDNAQRNLEIAFEEDAHVRILKKSEF
                     AAIGPFDLAVSASDNLYPLIEEEAGVRSALRSMLRESGALVAAVSAPSIFGDFAFGLS
                     DGWFQRSQTAEFPIGRLAAASHWQKCLADLELNEVDVSDCECPHGHTILIEARGTSIA
                     TGPMTSEAGVVPFLLIETGTLPSSVPAEAIPVVVSGDMAADVAALGAALDRLDGTPVR
                     AVFVSATGDQIGDEDSDLLQTQVLALSAFAEALKQRVGNGEPAGAERPRLVLVAPGGA
                     PVSESASSGVNSGLWTFVRVLQNEYEFLDVHALDVCDHAETDHVELLASALPLLAIEG
                     SNREWLLDRKTGLVSEIRAVSGPAAKTEGKTGAFPAATIRQRVSSQVSSIAWEETDVP
                     RAGLGEIVVSVAATGLNFRDVMWAMGLLPEEALEDGFAGATIGMELSGHVVEVGEGID
                     DLAVGDAVMAIASSAFSTHAVVSRAGVAKLPQTISPVAAATLPVAFLTAYYAMVELGR
                     IRAGETILIHGAAGGVGLAALQVAKLKGANVIATAGTREKRRFLTMLGADHVFDSRSL
                     GFVNEVRAVTGGEGVDLVLNSLFAEAMEQSLALVKPFGRFLELGKRDYYADSKIGLRP
                     FRRNVSYFGIDADQLLVNQPELTRRIFMEIGELFDEGRLTPLPYRAFDFDEIGNAFRL
                     MQNAGHIGKIVVLPPVAGQHEIAAKRRRGMKVDPDGMHLVVGGIGGFGLMAANWLVEK
                     GARNIALCSRRGQPDAATSAMIDRWKKAGVAASLHACDVTDAAAVETLLATLRSQAPL
                     RSIVHAAMVLDDALISNLTRGRNRPVIDVKAKGAAILDRLTRADTLDNFILFSSATTL
                     VGNPGQANYVAANGYLEGLARARRSEGLAGLAVGFGAIADAGYLTQNAEVNDLLAKRI
                     GKTALKAQVALDMVESHIAADPGSVDAAVVMISEIDWAAARNLPVARNALFEVILRGA
                     DQHASGAEGTKLDLVAMIEGKSPQEAEDILFDLVASEIAAILRVAKDTVTRGKILKEI
                     GLDSLMAVELGISFQQNTGFDMPLSGVADSTTVGDVARKLYEKVSKRDQSDEAETTDD
                     KLVTELTQRHIGAAKEKALSQ"
     gene            215127..216314
                     /gene="ctrA1"
                     /locus_tag="USDA257_c01900"
     CDS             215127..216314
                     /gene="ctrA1"
                     /locus_tag="USDA257_c01900"
                     /codon_start=1
                     /transl_table=11
                     /product="capsule polysaccharide export outer membrane
                     protein CtrA"
                     /protein_id="AFL48790.1"
                     /translation="MKRVTALLLCTALAGCQAVPGEGPLTSAIVAEAGQSGSEIGRRN
                     ATVFDIIDIDGQSARLVSEYVATTLSRRFGIGGGVGQVVIGVGDQLKVTIFEAGSDGL
                     FSTTESKQTSIDLVVQPDGKAAIPYVGSVRFAGLTLEQARQAILDALKQKAVEPDVIV
                     TSTSTASRIVTVSGAVGRPSVVPLNLVSETINEVIAKAGGPSAQPYETYVTLVRGKKT
                     GTVLLKSIIESPSENIHVKQGDQIFVTRDPRTFTILGQVRANQRVEFGANDLNLLEAV
                     ALAGGGADRTIDAKGYFVFRYEEPDIVMSLLGRERFNTMLSKGMQPDRVGRYPIVYRF
                     NMTNPDSLIVGQTFPIKNRDVIYASRHPSVDISKFMEFIARPIGIANSGVSIADNLND
                     LNN"
     gene            216314..216454
                     /locus_tag="USDA257_c01910"
     CDS             216314..216454
                     /locus_tag="USDA257_c01910"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48791.1"
                     /translation="MVTWGSHVPTGHASETEPRPPAPRVNILESIAFRGLPSFAPSGR
                     RR"
     gene            216548..217147
                     /gene="pncA"
                     /locus_tag="USDA257_c01920"
     CDS             216548..217147
                     /gene="pncA"
                     /locus_tag="USDA257_c01920"
                     /EC_number="3.5.1.-"
                     /EC_number="3.5.1.19"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrazinamidase/nicotinamidase PncA"
                     /protein_id="AFL48792.1"
                     /translation="MAEDALIVIDMQNDFCPGGALAVEDGDEVVPIVNRLIEGARHVI
                     LTQDWHPAGHSSFASSHPGKAPFQTVTMPYGEQTLWPDHCVQGSPGADFHPALRWTTA
                     ELIVRKGFRTEIDSYSAFFENDHRTPTGLAGYLHERGISKVTLCGLATDFCVAYSALD
                     AVAQGFSTSVVLGACRGIDLNGSLAAMTGRMREAGVELL"
     gene            217209..218513
                     /gene="pncB"
                     /locus_tag="USDA257_c01930"
     CDS             217209..218513
                     /gene="pncB"
                     /locus_tag="USDA257_c01930"
                     /EC_number="6.3.4.21"
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate phosphoribosyltransferase PncB"
                     /protein_id="AFL48793.1"
                     /translation="MPKTDIARRVYNHTWKLDPIIRSLLDTDFYKLLMLQMIWQLYPD
                     VDATFSLINRTKTVRLAEEIDEQELRDQLDHARTLRFTKKEMIWLAGNTFYGRKQIFS
                     PEFLSWLAKFRLPEYELSRRDGQFELAFRGRWVETTMWEIPALAIINELRSRAAMKGL
                     GPFTLDVLYARAKARMWSKVEQLRHYPSLRISDFGTRRRHSFLWQRWCVEALKEGIGA
                     SFSGSSNVLLAMDNDLEALGTNAHELPMVAAALARNDKELAAAPYKVLQDWNQLYGGN
                     LLIVLPDSFGTAAFLRNAPDWVADWTGFRPDSAPPIEGGEKIVAWWQKKGRDPRDKLL
                     IFSDGLDVDTIIKTYRHFEGRVRMSFGWGTNLTNDFAGCAPTEISGLNPISIVCKVSE
                     ANGRPAVKLSDNPRKATGDPAEVQRYLRFFGTEDFVEQSVRV"
     gene            218788..219000
                     /locus_tag="USDA257_c01940"
     CDS             218788..219000
                     /locus_tag="USDA257_c01940"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48794.1"
                     /translation="MRQAYSPDDVDVMRGALDVWCALHNVGKDGAEANRAARRILDLM
                     DRKKCSCDELLAQLGDFRPEPRQRAF"
     gene            complement(219505..219642)
                     /locus_tag="USDA257_c01950"
     CDS             complement(219505..219642)
                     /locus_tag="USDA257_c01950"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48795.1"
                     /translation="MRHPCSRSNVTRAFAGNASGGEWLPETCLKHGGAESYQYAGCGD
                     P"
     gene            219634..221889
                     /gene="pbpG1"
                     /locus_tag="USDA257_c01960"
     CDS             219634..221889
                     /gene="pbpG1"
                     /locus_tag="USDA257_c01960"
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 2D"
                     /protein_id="AFL48796.1"
                     /translation="MAQSDAASKIGPESQGPEETEPSRDHPDRSKGAAFAKTRRALAG
                     LGRALTRLGRALAEEVPVAARRAGKKSAAATRGAIERLRRTTVRDSAVAGRSASLWLK
                     ARRAARTEEQQAVPKSRSSRRTILLRSAAAAALASFVLLAIVFAWALRDVPWEEIAEG
                     SLKPVVVLETADGKPLVSQGPFQGSYAARKDFPPHLVEAVLAREDRRFYEHSGIDLRG
                     IARAIYTNLGAGEVVQGGSTITQQLIKILYLERDRTWKRKIQEAVIAFWLERKLGKDE
                     ILTRYLNNIYLGAGATGVPAAARIYFDKEVQELNIGESAMLAAIIRAPSQLNPLTNPD
                     GARQQAELVLDAMVKVNRITSEEAKVARADVGKLQPTSPAIRSGSWFADWIMQDAREL
                     AGPYRGTIKVRTTMVPRLQAIADKVVADALKREGGKAGVSQAALVAMTPEGAVVAMVG
                     GRDYTKSTFNRAFSAMRQPGSAFKLFVYYAALKRGLTPFDPVEDAPIEINGWSPENFG
                     GGYSGMVSIAEAFARSLNAATVALATEVGIDEVIAAARELGIDAKLADTPSLALGSSE
                     VNLLDLTGAYASVRAGRAPIEAWGIESLHAEGQPQAFRVGPSKEAVTDISQYRPDLVS
                     LLRLVVERGTGREADIGTLAAGKTGTSQNHRDAWFVGFTEPLIVGVWVGNDDETPMKD
                     VTGGKLPARIWRNFMTAALAEGTPAESGAQVAGSAPACNFRACARAYRSFRPDDCTFQ
                     PYYGPRRLCEK"
     gene            complement(221942..222079)
                     /locus_tag="USDA257_c01970"
     CDS             complement(221942..222079)
                     /locus_tag="USDA257_c01970"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48797.1"
                     /translation="MDVRYDSPIARAAALLPWPAICLVHKEHHFSLYLFAMRGFILAL
                     F"
     gene            complement(223156..223638)
                     /locus_tag="USDA257_c01980"
     CDS             complement(223156..223638)
                     /locus_tag="USDA257_c01980"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48798.1"
                     /translation="MRYKLPTEIRHLIHARNQLRARYERFGLKFTPDGNLVGDLGEAV
                     AAELFDLQLVDQRGYKGIDAHTREAVPRSVQIKATGRGDNLIFTHTDAPADILIGLVL
                     RYEQEEVEVVYNGPYDVGLFGFHTAWQGQRSQRVSRFRLWNANVKNDDRLQPTLPPLA
                     "
     gene            complement(223862..224212)
                     /locus_tag="USDA257_c01990"
     CDS             complement(223862..224212)
                     /locus_tag="USDA257_c01990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48799.1"
                     /translation="MYTIELIGSFVARHVESGLTVDLTSRRNRSTTKGPLSPLCRKLV
                     ELGHDPDGRVHVIRKALDRDGHIPVFQRDRTLETWANRDCVESETRSVHVQKYRPYPD
                     AVEATQKGQHLSTI"
     gene            complement(224843..225193)
                     /locus_tag="USDA257_c02000"
     CDS             complement(224843..225193)
                     /locus_tag="USDA257_c02000"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48800.1"
                     /translation="MILRIHNLERISMSAAALPANGIARSRFFHVTYFRDELLLDNLE
                     RLIVAPTTDAARTAVHDLGPIEDDHEALLKELSEQEFKTFCRLFERIDRNRQWVAVVK
                     TEISLHPPAMPRKE"
     gene            complement(225337..226086)
                     /locus_tag="USDA257_c02010"
     CDS             complement(225337..226086)
                     /locus_tag="USDA257_c02010"
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase domain protein"
                     /protein_id="AFL48801.1"
                     /translation="MAEIYLTQRSLTFDNSLACCLQQRRADMQQYVIYTRVSTEDQGR
                     SGLGLEAQERDIAIFLDKFSDIPFEIIGEFCEVQSGANSERPELNKALELVRKTGAEL
                     LVAKLDRLSRKVSFIATLMDDKRVKLRVAQMPQADKFQLHIYAALAEQERTFISERTK
                     AALKAAKGRGVRLGGLRDKTMKRNKAIQLKADAEATKVMKIVGPLRASGQTLSAIAET
                     LDSMNIPTSRGGKWTPTQVSRVLERVGARLS"
     gene            226586..226831
                     /locus_tag="USDA257_c02020"
     CDS             226586..226831
                     /locus_tag="USDA257_c02020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48802.1"
                     /translation="MGVSQRTIQRSIKSLEAKGFISKSRTEDGRPFYDVAPTKERLLP
                     YAEKLLQEKRQLRQLKQMLPRSDQGQSNAGAIDGTER"
     gene            complement(227194..230406)
                     /locus_tag="USDA257_c02030"
     CDS             complement(227194..230406)
                     /locus_tag="USDA257_c02030"
                     /EC_number="3.1.21.3"
                     /codon_start=1
                     /transl_table=11
                     /product="putative type I restriction enzyme hindVIIP R
                     protein"
                     /protein_id="AFL48803.1"
                     /translation="MADTPKDIHYGIPEGTRATLTGFSEDGLVEKPAIELLESLGWSH
                     FNLYVETFGPDGSPFRDTLRDPYLTKTLRTALARLNPDLTPDALDLAFDTLTQDRASM
                     VPMAANREVLELVRDGVDVEYRDEDGGMAKERVRVIDWRDLNANDFTLISQVWISGEL
                     HRRRTDLIGFVNGVPLLFIELKAGHRRIEDAYRDNVRDYRDSIPQLFGPNGFVLVSNG
                     LDTRIGASAYSPWDTFKEWKRVDDETEPGRVSLETAIRAAATPERLIDLVENFLVFEE
                     TKDGLVKKIVQNHQFLGVNKAVQAVVNLGENRGKLGVFWHTQGSGKSLSMLTFTRKVL
                     RTIPGAWTFVIVTDREELDKQISDVFAACGAVTKDVREVRAGSKEHLKTLLRGNERFV
                     FTLIHKFGTAKGETFPILSDRSDIIVIADEAHRSQYDTLAANMRRALPNAAFIGFTGT
                     PLMAGEEKTRDVFGDYVSTYTYQQSTEDGATVPLYYENRIPELEFANESFAEDVEAVI
                     EEADLDEEQERELEKRLGTQYHLITREDRLDRIAEDLVRHFVGRGYRGKAMFVAIDKA
                     TAVRMYDKVRRAWDAEIGRRDAALASASSDEREALAAIVAFMRETDMAVVVSQGQNEI
                     ADMEAKGLDIRTHRRRMIEEDLDERFKKGSDPLRLVFVCAMWITGFDVPTCSTIYLDK
                     PMKNHTLMQTIARANRNAPGKKAGLIVDYVGIFRNLEKALAIYAVGGATNAKPIEDKS
                     ALVEDLAQAIEDALVFCRARNVDPSAILEVTGFDRLARLGDAVEALNGTDPERRTFLA
                     LATNVWSTFKSVLPDARAEPYRRVSAAIEVIAERIRSLAERPDISEVANRIEALLDNS
                     IAGVEITAPIRENGDTEGLFDLSRLDIERLRAMFAQNNRQRTETQRLRRAVEDRLEEM
                     AARNPTRRGLVERFETLIAAYNAGSLTAADFFEQLLALVGDMNAEDQRAIREGLTEEE
                     LAIFDILTQPEPKLGPEDEDLVKRVAKSLLEKLRAEKLVLDWRLKERAKAAVKAAIQQ
                     LYDDGLPQVYGQGIFDEKVERTYQWVFEKYPGGSETSTVQ"
     gene            complement(230410..231675)
                     /locus_tag="USDA257_c02040"
     CDS             complement(230410..231675)
                     /locus_tag="USDA257_c02040"
                     /codon_start=1
                     /transl_table=11
                     /product="type-1 restriction enzyme MjaXIP specificity
                     protein"
                     /protein_id="AFL48804.1"
                     /translation="MKTEKLGNLAEFRNGLNYTDADNGSGLAVVGVSDFQDKVVIDTG
                     NLPQLSLSALSKPDALIHEGDVLFVRSNGNRELIGRSVYVNTEPTMPTSHSGFTIRCR
                     FHDRRCYPRYYAYLFRGSIIRQTLSSHGGGTNISNLNQQILADLDVPVPDLWMQERIA
                     GILSAYDDLIEVNQRRIAILEDMARRLFDEWFVRFRYPGHEAVPLIETELGMVPEGWQ
                     IETARQALTYTGGGTPSKAEHRYWRDGDIQWFTPTDLTKSGQTFLRRSSLMITKEGLA
                     KSSARLFPAFSIMMTSRATLGVFAINTEPATTNQGFITFLPSSRTPVYFLVHMLKREF
                     PRMEAVASGATFKEITKGALGELVFAFPPETLTHRFEQLATPMMEQIATVSRQNDSLR
                     AARDLLLPKLISGEIDLSAAEETFAEAAE"
     gene            complement(231672..233252)
                     /locus_tag="USDA257_c02050"
     CDS             complement(231672..233252)
                     /locus_tag="USDA257_c02050"
                     /EC_number="2.1.1.72"
                     /codon_start=1
                     /transl_table=11
                     /product="putative type I restriction enzyme MjaXP M
                     protein"
                     /protein_id="AFL48805.1"
                     /translation="MSDDLKTISDKLWTTADKLRANSGILPAEYARPVLGLLFLRHAD
                     ERFSEVEAKVAPREGSRVRPSPEAYKAEGAIFLPPEARFTFLLSLPEGSNLGRALTTA
                     MREIEAKNPELADVLPKTYQSIPDDVLVELLRALQPLKIAGDAFGHVYEYFMGNFAKD
                     TMQKGGEFYTPSSIVRLIVEIIEPFHGRILDPACGSGGMFVHSADFVKRHQKEPDKEL
                     SIYGVERTRETWRLAQMNLAVHGLSGKILDADTYRDPVFEEVMPKKNDKGRYEGPGGF
                     DFVMANPPFNVKELDKSKLLDVANRFPHGVPSADNANYLWIQFFWSRLSETGRAGFVM
                     ANSAADARGTEQEIRRKLIESGSVDVIVSVGPNFFLTVTLPCTLWFFDKGKTRGPRAD
                     EVLFLDARHIFRQIDRAHRDFTEEQVEALANIVRLWRGEEPEFFTQSKAWLEERFPGL
                     VYGDIAGLCRSATRANIEGQGWSLNPGRYVGVAAGQVDDEDFREKLEELHEELEVLNI
                     EAARLQSAIAQNLAEVLR"
     gene            complement(233363..235060)
                     /locus_tag="USDA257_c02060"
     CDS             complement(233363..235060)
                     /locus_tag="USDA257_c02060"
                     /codon_start=1
                     /transl_table=11
                     /product="putative integrase"
                     /protein_id="AFL48806.1"
                     /translation="MPSHTRLFRRGNVWWHRGPVPRDIQDTYPKTEETFSLKTSDHKE
                     ALRRLPRAMAEVQERFDEHRRMLARQQEPALLELTPEQLKHIEDVYYWHLMDEDEEVR
                     LAGLDDAGFEELNDLIDLAEDVGRYEFARGQMYSPFTESEAAEVLTWSSVDLKLDKAS
                     SSWPRLYRAIQTATVRAAQARRQRSEGSPVETPPEPQVNKPADRHLASTLIGEWVAEK
                     SRVKGGWTPATAAANKLWAERFVEMASDRPIDGYGKSDAREFKTALLSLPPNWTKVKG
                     LEKLAMKEAAKRAAELKIEPMSGKNVNKVLGFVRAFWNWAKANYDVPSNPFDGLNVKI
                     SGKARDERQPFTLAELSTIFKSPIYTGCQSVRYHNSPGDLIPNDNGVYWVPLVGLFTG
                     CRSGEIIQLRTKDVKAEGGIAYIEVTDEGEELSLKNSGSRRRIPVHRKLKEFGFLRFV
                     ERQRKLGHKRLFPDFPKAKDGTYSTAYSRKFSNLLKALEVKHDKISFHSFRHTFEDAC
                     RNSRIPLDFVNALQGHAQQGMAGRYGNGLYGLKLLSEEMEKLQYDGLDLSHLFTKKV"
     gene            complement(235155..235229)
                     /gene="trnT2"
                     /locus_tag="USDA257_c02070"
                     /note="tRNA-Thr-GGT"
     tRNA            complement(235155..235229)
                     /gene="trnT2"
                     /locus_tag="USDA257_c02070"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACC"
     gene            235869..237161
                     /gene="murA"
                     /locus_tag="USDA257_c02080"
     CDS             235869..237161
                     /gene="murA"
                     /locus_tag="USDA257_c02080"
                     /EC_number="2.5.1.7"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase MurA"
                     /protein_id="AFL48807.1"
                     /translation="MDRIRIVGGNALHGVIPISGAKNAALPLMIASLLTDDTLTLENV
                     PHLADVEQLIRILGNHGADISVNGRRERQGESYARTIHFTSRNIVSTTAPYELVSKMR
                     ASFWVIGPLLAREGKARVSLPGGCAIGTRPVDLFIEGLAALGANIEIDGGYVNATAPA
                     GGLIGGRYVFPKVSVGATHVLMMAATLANGTTVIGNAAREPEVADLAKCLNAMGAKIT
                     GAGTGTITIEGVRSLAGARHRVLPDRIETGTYAMAVAMTGGDVILEDTEASLLDTALE
                     AIRRAGAEISETNSGIRIVRNGTGIRPVDIVTDPFPGFPTDLQAQFMGLMTKSSGVSH
                     ITETIFENRFMHVQELARLGAKISLSGQTAKIEGVGRLKGAPVMATDLRASVSLVIAG
                     LAAEGETMVSRVYHLDRGFERLEEKLTRCGAHVERVSD"
     gene            237139..237708
                     /locus_tag="USDA257_c02090"
     CDS             237139..237708
                     /locus_tag="USDA257_c02090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48808.1"
                     /translation="MWNASATDSGLARLHPLRFRARRPMSFAITCLNAGLERTGWNRM
                     DALKLLALDEEDLGVVSAHVQDAVFKVAGILYDARRHQFSLVINRFAWEKAEGKRRSF
                     ERRRALLLFKCVTAVRSLGFDRTDMEAVLDLLALRFSVKGEGPEGTVEIVLAGDALIA
                     LDVECIEAQLADTGGAWETAFKPRHPEGD"
     gene            237742..239046
                     /gene="hisD"
                     /locus_tag="USDA257_c02100"
     CDS             237742..239046
                     /gene="hisD"
                     /locus_tag="USDA257_c02100"
                     /EC_number="1.1.1.23"
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="AFL48809.1"
                     /translation="MAIRLNFLDSGFEREFAAFLTTKREVSEDVNAAVRAIIDDVRTR
                     GDAALADYSARFDGIDFNVTAMKVSAAEIDAAIHAVEPEVLGALKVAATRIEAHHRRQ
                     VPKDDLYEDQMGVGLGSRWTAIDAVGLYVPGGTASYPSSVLMNALPAKVAGVPRIVMV
                     VPAMGGAVNPAVLAAARLADVEEIYRIGGAQAVAALAYGTETIAPVAKIMGPGNAYVA
                     AAKRQVFGTVGIDMIAGPSEVLVIADGDNDPDWIAADLLAQAEHDAGAQAILITDDAA
                     FGEAVEQAVERQLKTLPRAETARASWRDFGAVILVPDLDKAVPLANRIAAEHLELAMA
                     DPDSMVPKIRNAGAIFIGRHTPEVIGDYVGGSNHVLPTARSARFSSGLGVLDYMKRTS
                     ILRLGPEQLRILGPAAIALAKSEGLEAHSRSVAIRLNLGGEG"
     gene            239043..239519
                     /locus_tag="USDA257_c02110"
     CDS             239043..239519
                     /locus_tag="USDA257_c02110"
                     /codon_start=1
                     /transl_table=11
                     /product="UPF0262 protein R00612"
                     /protein_id="AFL48810.1"
                     /translation="MRADRHLRLCDVVLDETIGRSTPDVEHERAVAIFDLLEENLFEP
                     VGHTGGPYRLNLSLVDSKLVFAISTDGGEAVATHILSLTPFRRIVKDYFLICESYYEA
                     IRSATPSQIEAIDMGRRGIHNEGSQTLMDRLSGKIRLDFDTARRLFTLVCVLYWRG"
     gene            239531..239992
                     /locus_tag="USDA257_c02120"
     CDS             239531..239992
                     /locus_tag="USDA257_c02120"
                     /codon_start=1
                     /transl_table=11
                     /product="putative low molecular weight tyrosine
                     phosphatase protein"
                     /protein_id="AFL48811.1"
                     /translation="MTGIALPQQRTPRSILFMCGMNAIRSPMAEALARASLPKGTYVA
                     SAGVRQGERDPFVDVVLDEVGLTIGRHQPRTLEELEDDFFDVIVTLAPEAHHKALELT
                     RSMAVDVIYWPTPDPTVATGTRDQIVGAYRAVRDHLAGLIASRLAGREKVG"
     gene            240171..240389
                     /gene="infA"
                     /locus_tag="USDA257_c02130"
     CDS             240171..240389
                     /gene="infA"
                     /locus_tag="USDA257_c02130"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="AFL48812.1"
                     /translation="MAKEEVLEFPGVVTELLPNATFRVKLENDHEIIAHTAGRMRKNR
                     IRVLAGDKVLVEMTPYDLTKGRITYRFK"
     gene            240436..241056
                     /locus_tag="USDA257_c02140"
     CDS             240436..241056
                     /locus_tag="USDA257_c02140"
                     /codon_start=1
                     /transl_table=11
                     /product="Maf-like protein R00615"
                     /protein_id="AFL48813.1"
                     /translation="MTVTQKLILASGSPRRVELLAQAGIEPARLLPMDLDETPKRAEH
                     PRSLARRLSAEKAKAALAAIKGEPGWDGSYILAADTVVCVGRRILPKPELISEASSAL
                     HLLSGRSHRVYTGICLVTPDRTLRQKVVDTKVRFKRLSGYDIESYLASGQWRGKAGGY
                     GIQGIAGSFVVKLVGSYTNVVGLPLYETVNLLIGEGYDVHGRWLEG"
     gene            241063..241275
                     /gene="yacG"
                     /locus_tag="USDA257_c02150"
     CDS             241063..241275
                     /gene="yacG"
                     /locus_tag="USDA257_c02150"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase inhibitor YacG"
                     /protein_id="AFL48814.1"
                     /translation="MSGEGKNNGSNVEPLRPTRPCPECGRPSAREHFPFCSERCRNVD
                     LNRWLSGSYAIPVADDESKADDDEDR"
     gene            241527..241602
                     /gene="trnF"
                     /locus_tag="USDA257_c02160"
                     /note="tRNA-Phe-GAA"
     tRNA            241527..241602
                     /gene="trnF"
                     /locus_tag="USDA257_c02160"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
     gene            complement(243527..244504)
                     /gene="tdcB1"
                     /locus_tag="USDA257_c02170"
     CDS             complement(243527..244504)
                     /gene="tdcB1"
                     /locus_tag="USDA257_c02170"
                     /EC_number="4.3.1.19"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine dehydratase catabolic"
                     /protein_id="AFL48815.1"
                     /translation="MTMRNYPTIQDIREAQERLKPHVRHTPLLRADKIEKAAGCQLYL
                     KPETLQITGAFKIRGALNKALSLSREEIANGIIATSSGNHAQGLAYAARMLGVKAILV
                     LPVTSPKIKIENTKALGAEVILFDGDTAARWKRVYEIAEENRYAAVHAFEDPIVMAGQ
                     GTIGCEILQDLDDVDTVIVPVGGGGLISGIATAIKETKPSVRVIGAEPALTPKYFHSR
                     INKERTSLPLKNTIADGLRISVPGQNPYPIIEKYVDEIVLVEDEHIIAGMRALAKEAK
                     LIAEPAASIGIGALLAGSIKVKPDEKVCAVLSGGNWDLCDLAEIYKAAG"
     gene            complement(244504..245496)
                     /gene="ocd"
                     /locus_tag="USDA257_c02180"
     CDS             complement(244504..245496)
                     /gene="ocd"
                     /locus_tag="USDA257_c02180"
                     /EC_number="4.3.1.12"
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine cyclodeaminase"
                     /protein_id="AFL48816.1"
                     /translation="MKTLLLKKDEVRRLIGMTEVIGAVEEAYKAFSSDQVEQPDYIGI
                     HLPSLRGEIDFKLGYYKVNEIISMKAHSGGFTNNPAEHGVPNSMGTILLFDARSCALI
                     CIMDGSLITGLRTGASGAVSVKALARKNAGTIASIGTGNQARMQIRAINEIMKIEEIH
                     AWSRTPETISKYKTDIEREFGIPVIVASSKKEAVEQADILITTTRGKGELVEADWVKP
                     GTHIVAIGTDQRGKQELDPELFRNAKIIVDSISQCTEKGETWHPLNKNIIAKGDIHGE
                     IGEVLLGRKPGRESDDEITIFDSTGMAIQDNTTASKIYQNAIANNVGTFFQFFE"
     gene            245577..246671
                     /locus_tag="USDA257_c02190"
     CDS             245577..246671
                     /locus_tag="USDA257_c02190"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="AFL48817.1"
                     /translation="MRLVAAFAATGSRLFCIAYRFWQRVAAGVFPSLGVSAQARHGRH
                     KMRRGRHRLARTLRALPCVGRNCCLLRCTLNLEDTGRNRIMTNQEIVLEKMTPRHLDG
                     ALELSRQVQWPHRREDWELVQSISQGIVALQEDRLVATVMMTPYGDNAATINMVIVDA
                     AMRGRGLGRKMLEEALAKAGERTCYLVATQEGLPLYEKVGFAATGETVQHQGKPLRVE
                     APADVTWSESGDHAYLVALDRAANGHDRSALMEILRERAKFAVIRDDGEIQAFAAIRS
                     FGRGLVIGPVVARNDSEARALIDFLLAHHQGRFVRIDTDVSMDLAGWLTARGLNHAGC
                     GIKMRRRGAACGQSKPTDHRNYALVSQALG"
     gene            complement(246903..247607)
                     /locus_tag="USDA257_c02200"
     CDS             complement(246903..247607)
                     /locus_tag="USDA257_c02200"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acetyltransferase"
                     /protein_id="AFL48818.1"
                     /translation="MSNRRPRLGRCNGRMRRLVSRKVWTKGQVGSFDFARRLMQPSRR
                     RGRSRHFPAAMDKNTVTRFSAPAAKANHAGMNIRPASSADAPAVWSIIEPMIRAGETY
                     ALDPNLSRAEALAYWMGAEKEVFVAEQAGAILGTYYMRPNQAGGGQHVCNCGYVTAPD
                     ATGKGVARSLCEHSMATARAHGYRAMQFNFVVSTNLRAISLWQKMGFKVVGTLPGAFR
                     HTTYGYVDAFVMYQAL"
     gene            247645..247791
                     /locus_tag="USDA257_c02210"
     CDS             247645..247791
                     /locus_tag="USDA257_c02210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48819.1"
                     /translation="MATFRCHGRLINFQMAEATCDLHGDRTREQKTLQFPASAVLKRR
                     VHLF"
     gene            complement(247903..248379)
                     /gene="lrp1"
                     /locus_tag="USDA257_c02220"
     CDS             complement(247903..248379)
                     /gene="lrp1"
                     /locus_tag="USDA257_c02220"
                     /codon_start=1
                     /transl_table=11
                     /product="leucine-responsive regulatory protein Lrp"
                     /protein_id="AFL48820.1"
                     /translation="MKLDRIDVKILNALQKNGRMTNVELAEMVNLTPSPCLLRVKKLQ
                     AEGYIEGYSAQINIGKLGQTLTVFTEITLKNHRQLDFARFLTAIEKVDQVIECHLVSG
                     SYDYLVKFITAGIEEYQTLMERLLDSEIGIDKYFSFVVLKSPLVKAHLPLASLFQQ"
     gene            complement(248589..249662)
                     /gene="ttuC"
                     /locus_tag="USDA257_c02230"
     CDS             complement(248589..249662)
                     /gene="ttuC"
                     /locus_tag="USDA257_c02230"
                     /EC_number="1.1.1.93"
                     /EC_number="4.1.1.73"
                     /codon_start=1
                     /transl_table=11
                     /product="putative tartrate dehydrogenase/decarboxylase
                     ttuC"
                     /protein_id="AFL48821.1"
                     /translation="MREYSIAAIPADGIGPEVIAAGRTVLANLEMRLGDVKFTVENFD
                     WGSDYYKKHGVMMPSDGLEQLKKFDAIYFGAVGAPDVPDHITLWGLRLPICQGFDQYA
                     NVRPTRILPGITSPLRNCGPGDLDWVIVRENSEGEYSGHGGRAHRGLPEEVGTEVAIF
                     TRVGVTRIMRYAFMLAQSRPRKLLTVVTKSNAQRHGMVMWDEIASEVAEEFPDVTWDK
                     MLVDAMTVRMTLKPQSLDTIVATNLHADILSDLAGALAGSLGVAPTANIDPERRFPSM
                     FEPIHGSAFDITGKGIANPVAAFWTAAQMLDHLGEREGSARLMRAVARVTGAGILTPD
                     VGGSATTREVTEAVFDAIHSSNV"
     gene            complement(249897..250673)
                     /locus_tag="USDA257_c02240"
     CDS             complement(249897..250673)
                     /locus_tag="USDA257_c02240"
                     /codon_start=1
                     /transl_table=11
                     /product="putative GntR-family transcriptional regulator"
                     /protein_id="AFL48822.1"
                     /translation="MQPGGTISSPLPYAAACGVGVQTKSTSRAKAMPTLHAKNQAEDL
                     EMNVEPLPASAVEILTHALRRRILSGDFQPGEFLRDVKMCEEHSTSRHTFRTAAQVLV
                     TQGLLRQIPNRGFVVPEFGPDDIVDITRVRGAIEGEAIRLIVLTGVIPSQALEAVEVM
                     HRSTLSSDRSLLVAADRDFHRAIIAASGSARLKRTYSDLEGEIELLLAQRQDFYATAE
                     EMAEEHERLINSLRSRHYDTAREAFQEHWEDLQIKLLDQR"
     gene            complement(250685..252055)
                     /gene="dgdA1"
                     /locus_tag="USDA257_c02250"
     CDS             complement(250685..252055)
                     /gene="dgdA1"
                     /locus_tag="USDA257_c02250"
                     /EC_number="4.1.1.64"
                     /codon_start=1
                     /transl_table=11
                     /product="2,2-dialkylglycine decarboxylase"
                     /protein_id="AFL48823.1"
                     /translation="MSKQATILPKGFRGDMPNGFNPQDTSHLTSEDLAHIARRQRLLG
                     PAYRLFYKSPVEISRAKGVFLYDRHGNEYLDAYNNVVSLGHSHPRVVEAIQKQLEVLC
                     THTRYMQEPLLDYAEALINTFGGELGRTGCAMFTCTGSEANDLALRIARYHTRKTGVI
                     VTAEAYHGNSGAVAAISPSLGKKSALDPYVRTVAAPDSYRLPVEEIGRRMAEDVARQI
                     ADMERHGGGLAAFIADSVFSSDGLYVDPTDVLAPVAEVVRKAGGLFIADEVQSGFGRT
                     GTHFWGHSRHKVDPDIVTMGKPMGNGYPVAGVVLRPELIAEFGSSMRYFNTFGGNSVA
                     IAAARAVLDTILEEGLLDNAAKVGGEILHGLRDLQKKYEFVGDVRGAGLYFAVELVRD
                     RDRKTPDMDRALAAVNALRDRRILISATGADAHILKIRPPLIFTSANAARLLEGVDEA
                     LRSVQI"
     gene            complement(252064..253488)
                     /locus_tag="USDA257_c02260"
     CDS             complement(252064..253488)
                     /locus_tag="USDA257_c02260"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AFL48824.1"
                     /translation="MLAALRPVGAHWHNFVAMAIDCPTIFGRSIVLPLADSLSASLFT
                     QNKLRGDAAKIRDICSLLHVFIRNPAQSSIVIRQKRSIPTARNLYRKNKIVVQKLESD
                     ILRPSSCPFSRQDLNELKMGHKHQCGPARVPELSEACHPVGAAEAEEIAERLYGARGS
                     ATRFETEKDDTFLLNCAAQGKFVLKIAHPSERMEELDFQVALMRHLEQQAPDLPIPRA
                     LRDVDGADLPIVTTSAGERRVVRLITFLPGTPLDRTSATAPQRERIGEILAKLRHSMA
                     DFSHPADGRAVAWDVTHLPDLTDLLSFIPAGGKRAWTVRALERFAEVKPSLDLCRRQV
                     LHNDFNTSNLVVDHASPQFLTGVIDFGDAVRTAIAVDVSTALMNQMPKTFDHGNRRDL
                     FDEPRDVLRGYLRHAELTDEELRLIPFLSMGRLAVRALLTCWRAEIFPENSRYILRNT
                     EAGWAHLEWFHSISTAQISDLLTR"
     gene            253672..254361
                     /locus_tag="USDA257_c02270"
     CDS             253672..254361
                     /locus_tag="USDA257_c02270"
                     /EC_number="3.8.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="2-haloacid halidohydrolase"
                     /protein_id="AFL48825.1"
                     /translation="MTQFRPKYVTFDCYGTLTNFDMAGAARRVYGERLSPEAMAGFVE
                     AFRGYRLDEVLGPWKPFLEVVHNSIERSCKRIGIPFKPEDAQRIYDEVPTWGPHPDVP
                     AGLSRVAKEIPLVILSNSMNSLIMSNVEKLGAPIHMVITAEEVGAYKPLMKGFEYMLD
                     KLGCGPEDITHVSSSFRYDLMTAYDLGIKSKVWVNRGHEPANPYYEYTEIKDIGGLAA
                     AVGLEPALKRA"
     gene            254827..255762
                     /locus_tag="USDA257_c02280"
     CDS             254827..255762
                     /locus_tag="USDA257_c02280"
                     /codon_start=1
                     /transl_table=11
                     /product="2-haloacid halidohydrolase"
                     /protein_id="AFL48826.1"
                     /translation="MHGGMFSVWSRCWKAGLQCFHPFIDWEMAAPPSAPRRSDHRSRA
                     IERAKLTSGPEFSADEPGIPNDTAAGTGLRLLITETDPRQKRTKRMTTFRPKYITFDC
                     HGTLINFQMAEAARDLYGDRMSEQKMLQFIADFSAYRLDEVMADWKPYAEVVHNALAR
                     TCKRNGVDFKDEDAQMVYERVPTWGPHPDVPAGLAKVAKEIPLVILSNAMNSQIMSNV
                     EKLGAPFHAVYTAEEAQAYKPHFRAFEYMLDMLGCGPEDILHCSSSFRYDLMSAHDLG
                     IKNKVWVNRGHEPANPYYGYTEIAGISELPGVVGL"
     gene            256253..257158
                     /locus_tag="USDA257_c02290"
     CDS             256253..257158
                     /locus_tag="USDA257_c02290"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48827.1"
                     /translation="MVLSSEVECTADVTLLNGDRLILKTSARPEGRDSFRFQVAALAG
                     LEGASGFAAPHIVRTSGGTLMFEEEEICGYLQTRLSGVPLHQANATPDVLYQVGQALG
                     RLSLALEPLKLPAMHRPVLWHVGCWPRLMELEQHLPSGSVAESVRLAMSNYVELIKPQ
                     LREVAWQVTHNDPSPFNTLLTDDGVAFIDFGDGCWGPRLQDLAIAASHVVTDPSLALG
                     GAENFIAGYASVLPLSALEAKLLVGLIKARQSALILINYWRAELFPAEAAYIKKNVAR
                     AERGLSILSALGVGEAEMAVRRAVP"
     gene            257247..258581
                     /gene="argD2"
                     /locus_tag="USDA257_c02300"
     CDS             257247..258581
                     /gene="argD2"
                     /locus_tag="USDA257_c02300"
                     /EC_number="2.6.1.11"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine aminotransferase ArgD"
                     /protein_id="AFL48828.1"
                     /translation="MSTDLMPNRFTPGEATIPPRESELIARRDNVLGASYRLQYRRPV
                     HFVRGEGMWLYDPDGHRYLDFYNNVPSLGHCNPEINAAMAEQASRMSANTRYLEPRLV
                     DYAERLVATFPEELNRVVFTCTGSESNDLALRIARLTSDSEGVIVSSHAYHGTSAATA
                     MVSPNLGDAVRLSPAVRMVSLHGPAGVPDWQAATFFEEQVRSAIADLNRRGIGIAALL
                     IDSIFSSDGVWVDPPGFIAGGIKAVREAGGLVIADEVQPGFGRTGTHMWGFERHEVVP
                     DLVTLGKPMGNGFPIGAVVGRKEPMDCFGATARYSNTFGGNTVGIAAADAVLTILQRD
                     RIPEHVHAMSERLRLGLEHLAKLHPGIRGIRNAGLFFGIDIGLDGAGEASRRAMALDI
                     VNLMRDDGVLISTTGANEDTLKVRPPLICQAEHVDRFLEAMECALKKAVAQV"
     gene            258653..259129
                     /gene="lrp2"
                     /locus_tag="USDA257_c02310"
     CDS             258653..259129
                     /gene="lrp2"
                     /locus_tag="USDA257_c02310"
                     /codon_start=1
                     /transl_table=11
                     /product="leucine-responsive regulatory protein Lrp"
                     /protein_id="AFL48829.1"
                     /translation="MKLDRIDVKILHVLQQNGRMTNVELSEVVNLSPSPCLMRVKKLQ
                     SEGFIEGYSAQINVAKLGQTLTVFTEVTLKNHRQTDFARFLAAVEKIDQLIECHVVSG
                     GYDYLLKFVTTGIGEYQEIMERLVELDVGIDKYFSFVVLKSPVGKRHLPLTNLFRP"
     gene            259203..260477
                     /gene="ordL1"
                     /locus_tag="USDA257_c02320"
     CDS             259203..260477
                     /gene="ordL1"
                     /locus_tag="USDA257_c02320"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase OrdL"
                     /protein_id="AFL48830.1"
                     /translation="MKFLPYWHDNTPAFAGAAEGPVDGHYDVAVIGGGFTGLGAARQF
                     AKAGAKVVVLEAEKVGWGASGRNGGHLNNGLAHSYLAAKAELGKQRAIALYKALDDSI
                     DTIESLIGEEGIDCNFRRAGKLKLASKPQHFDAIARNFEAVHAEVDPDTALLGAGDLN
                     QEVGSPFFGAMLSKKSAMMHMGRYVVGLAEAAKRRGATIFEQAAVTEHQQAGSRHQLK
                     TARASVTADAVLVATGAYTPSTFGYFRRRIITVGSFVIATRPLTEAEIAATMPGNRTC
                     VTSMNIGNYFRLSPDNRLIFGGRARFSASADQRSDAKIGGILKASLAAIFPQLANVEI
                     DYCWGGLVDITKDRFPRAGYHDGVWYAMGYSGHGAQLSTHLGMIIADAILDRPDRNPL
                     KGLEWPAVPGHFGTPWFLPLVGMYFKMLDRFG"
     gene            complement(260857..261531)
                     /locus_tag="USDA257_c02330"
     CDS             complement(260857..261531)
                     /locus_tag="USDA257_c02330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48831.1"
                     /translation="MLTRNDRAIPDALEQLPLVLSAGVRHIGFKDIGLPFEVLSDLNR
                     EIRAAGAKSYLEVVSLDRASEIASVRAALTLGVDYLLGGTHVDDVLPLLKGSGIRYYP
                     FPGRIAGHPSVLDGSTTEIVASAKDLAAREGVHGLDLLAYRADVDVADLIRAVCDAVA
                     KPVIVAGSIDRAERIHAVVSGRAAGFTVGTAALEGRFPAAIPGLAHQLLTITSIKNQA
                     KALAEQ"
     gene            complement(261556..262554)
                     /gene="pdxA1"
                     /locus_tag="USDA257_c02340"
     CDS             complement(261556..262554)
                     /gene="pdxA1"
                     /locus_tag="USDA257_c02340"
                     /EC_number="1.1.1.262"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase
                     PdxA"
                     /protein_id="AFL48832.1"
                     /translation="MNTSLPLAVTMGDASGIGPEIVAKTMLARTDLRRNIVGGDPAVM
                     AKAIASLGGGLPMNEIHDVADAKPDGALNILAATRIETPPALGKVSATSGRMAYDAVV
                     AAIDLARTGKVAGIVTAPIHKEALAAAGLPYPGHTEILAAKGGAGRVAMMLANDDIRS
                     VLVTIHCSLADAIRQADFPAQMSAIRLAHQGGRALGFARPRIAVAGLNPHAGEGGLFG
                     DEEIRIIAPAIAAARSEGIDASGPWPGDTVFMQARNGRFDLVVAQYHDQGLIPVKYLG
                     LEKGVNITLGLPFVRTSPDHGTAFDIAGRGIADPRSLETAIDYARRLAKAPCDQED"
     gene            complement(262551..263543)
                     /locus_tag="USDA257_c02350"
     CDS             complement(262551..263543)
                     /locus_tag="USDA257_c02350"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein"
                     /protein_id="AFL48833.1"
                     /translation="MQTDAAHVTRQAVTTLADRPFLYKTIDSTLRGHIRVEIAAAFQA
                     SSRPRLVIAPAFPAAGRTTIDGIQLLHGEPVAQTAYGRDAVHPAHTSRIEDLIEPGLG
                     RIAKISAHAEEGEIGKAIGGAPVVIVDACEQVMLNRRIAQIQKHGPALWVGSPGMAEA
                     LATVVERRTGQDIFTPEATPHRVLVLVGSANHVSHLQCETLAATGASVAIRATDIDET
                     ASVVCIRTPHIRTSDPAKALATLVDEAEIALARHRYDAIVATGGETMHALLERLSLHA
                     FDLIRELEPGFPLGCARLADGRMMLLAMKAGGFGSAVTLRNAADTIRRIGKEHA"
     gene            263796..264680
                     /gene="trpI"
                     /locus_tag="USDA257_c02360"
     CDS             263796..264680
                     /gene="trpI"
                     /locus_tag="USDA257_c02360"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator TrpI"
                     /protein_id="AFL48834.1"
                     /translation="MKRSDLPSLDDLRAFEVVARLGSVRAAASELNLTHGAVSRRVSK
                     LSEHLQIRLLEPDGRGLRLTGEGTRLAQATTNALSLVASALEDIRKVDVSPPIVVSCE
                     RSVAMRWLIPRLSEFQDRQPEIDLHLSVGGGGFDFARDHITLAIRRLDFAIEANWQVE
                     RLIEEEVGPVMHPAMADRFAAGGYVALAAKTRPDAWQKWSAAHPDAPKPRSTRFLDHH
                     FLMVEAAAGGLGVAMCPKIIAIDDIRNGRLDAPLGFQPDGSHYGIIRSALAKKTSGID
                     QFVSWLLATIQEDFYAAS"
     gene            complement(264775..265443)
                     /locus_tag="USDA257_c02370"
     CDS             complement(264775..265443)
                     /locus_tag="USDA257_c02370"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="AFL48835.1"
                     /translation="MSVVLKDFIEAEGLEPGDRLPPERDLALKLGLPRTALRRMLASL
                     EKEGRLIRHVGRGTFIAGSGVTSTALRRPPGSTGDALRTYPAEVFEARLIMEPKIAAL
                     AALRATRQEIDEMQKSIDRGSAAETLVEFEKWDAVFHRIIVGAARNGLLASLYEGIHT
                     VRAGNLWGKMKEQSLTPERMKAYIAKHQATLDAIKDRDSREAERNMYDHIVEARANIL
                     GPNA"
     gene            265670..267334
                     /gene="gsiA1"
                     /locus_tag="USDA257_c02380"
     CDS             265670..267334
                     /gene="gsiA1"
                     /locus_tag="USDA257_c02380"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione import ATP-binding protein GsiA"
                     /protein_id="AFL48836.1"
                     /translation="MAARTEAVSGDDAALSVRGLTVDLPKGMERTHAVENISFDLKRG
                     QILCIIGESGSGKSVTANTIMGLLPKLIPVSSGVIHLDGTAIIGAPAKKLRGLRGRVV
                     SMIFQDPLSALNPLMTVGEQITEVLTAHGVGTKASRRKRAIELLTEVGLPDPELMYYQ
                     YPFRLSGGQRQRVMIAMALALEPAVLIADEPTTALDVTTQAQILKLIRDIQRRKGMSV
                     MFITHDFGVVAEIADSVVVMEKGRVVEQGSADQVLKSPTHPYTQRLIAAVPHLTGKDR
                     EPQEKASNETILKVEGLSKTYRSGSALFGSQRIVPAVKDVSFDLAAGRTLGVVGESGS
                     GKSSLGRLLIKLQDSDGGRILFEGRDIAKLSESEFRPLRPRIQMIFQDPFASLNPRST
                     IGQILTVGPVAHGMPYVQAREEARALLAHVGLDAGAFGRYPHEFSGGQRQRIGIARAL
                     MFKPKLLIADEAVSALDVSIQAQILKLLDQIQRETGVSMIFITHDLRVASQICNEIAV
                     MQKGQIVERGPPSQIFLNPQSAYTRELVAAIPGERPRDTRPIAVNS"
     gene            267371..269035
                     /gene="appA"
                     /locus_tag="USDA257_c02390"
     CDS             267371..269035
                     /gene="appA"
                     /locus_tag="USDA257_c02390"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide-binding protein AppA"
                     /protein_id="AFL48837.1"
                     /translation="MTKDSTTKSGYSRREALRLMAAGGIACFAAPNLLGKPAFADTAN
                     PTGRVVVGLSQEPTVFNPLMAHIEVDDAVHFSVFDALFRMDPKGVLQPNLAAEVPTQK
                     NGGISEDGLKWRIRLRDDVRWHDGEPFTAEDVKFTLELITNPKFRAWRTGGHSLVRDI
                     KVVSPTEITWRMEEAFAPYLSFLAETFIVPKHILEKEADPNAAAFNQAPVGTGAFKWA
                     QRVAGDHLELVANPQYFGEGPYIERLVFKYIPDMTVLYTQFKSGDIDLADQAYITADH
                     YEEASKLPGRVVTLEPGASLESIYLNLEKPQFKDPAVRKALYAAMDRNAIIDAIYFGV
                     GTLTETFMPKESYYYNPNLPAQEFNLDLARKILDEAGWVPGPDGIRAKDGVRLSFANA
                     TTAGNNLREQVQQFLQQTFAEIGVEMTISNLPAAVMWGEFWLKSQFDSAIAGVTYLIA
                     ADPDATNRLHTSAIGAKGGKGSNTAQYSNPEVDALLEKGARTFDPEERRAIYNRVQEI
                     VRQDLPFLPLFAYTNVVGRKEGLEGFEPNANTRTASWKAAAWRWQS"
     gene            269102..270052
                     /gene="appB1"
                     /locus_tag="USDA257_c02400"
     CDS             269102..270052
                     /gene="appB1"
                     /locus_tag="USDA257_c02400"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide transport system permease protein
                     AppB"
                     /protein_id="AFL48838.1"
                     /translation="MRGFLLNRLSQSLVLLLIVSVIGFVVLNLIPGGPLAQFGLDPGM
                     TQADLDRLKEQLGLNRPLWMQYLDWAWRLVQGDWGHSFRDGAPVLDVIGRHLVATLLL
                     MGSSTVIAIAIGTWIGIRGATHRYSIFDYLATVGAMVALSIPTFWFGLVGIYVFSLRL
                     GWLPAGNMYTIGDGSALNYLHHLIMPSIVLALVHVAIWSRYMRTATLDVISQEFVKTA
                     RAKGLSERRILMKHVVGNALLPMITLAGMQLPSVLTGALVTETVFTWPGMGRLFLDSL
                     GYSDYPVVMGLLMFSAILVVLCNLIADIVVAIIDPRIRLS"
     gene            270087..270965
                     /gene="appC1"
                     /locus_tag="USDA257_c02410"
     CDS             270087..270965
                     /gene="appC1"
                     /locus_tag="USDA257_c02410"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide transport system permease protein
                     AppC"
                     /protein_id="AFL48839.1"
                     /translation="MTAIVANSRQERWWNSRTAHRFMNHHLALLGMVMIAVLTLACVL
                     GPYLLPYDSLHIDLRARFAPPFTGHHYLGTDPLGRDLAARLFMAGRISLLVGFSAMLL
                     STLIGTLVGVLAGYRGGWIGTTLMRTVDGFLSFPSIFLVLALAAALKPSPIMITVVIA
                     ATSWMEVARIVEAEVRSLREREFVQAGRMLGLSGTHIMFREILPNAMGPIIVAATLTV
                     ARAILMEAYISFLGYGIQPPLPSWGNMLNGAQQYLGSAPWLAIIPGAAITIAVTSFNF
                     IGDGLRDAFDVRGDHA"
     gene            271072..272454
                     /gene="puuB1"
                     /locus_tag="USDA257_c02420"
     CDS             271072..272454
                     /gene="puuB1"
                     /locus_tag="USDA257_c02420"
                     /EC_number="1.4.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamylputrescine oxidoreductase PuuB"
                     /protein_id="AFL48840.1"
                     /translation="MERCRSSLSAVPEGPWPTQREVSPMEESRIADKNTPYWWEEAPV
                     RPLPRQPLAKNLDVAIIGAGYTGLSAGLVLAREGRSVAAFDAMNPGEGASTRNGGITS
                     GSIRPDYTTITRRFGEEKAIAIEAEGKIAREFLYDFIRTEGLECDFQLVGQFKGVIGY
                     DDYEKTARSAEVLAKRLGIEAYAVPYAEQRNFIGTDFYRGGMARMDIGGLHPAKFHAE
                     LLRVALASGLTVHAGTRVTSVERDGSEFRVLTEAGTVQARQVLVCTDGYTDGAVPFLR
                     RRLVPVRSRIIVTEELAPEVMARLMPKRMMMVEGRQLGFYYRPTPDGKRILLGGRDSS
                     RVGDPAAPKLFLRRGLVNLFPELENVRLSHTWFGNVAMHRDMLPRIFEKDGVVYATGF
                     CGSGVVWAPWIGTRAAHKLLGHGEQARTAFDFRPPAFIPLYRGNPWFMPAIIEGYRMQ
                     DRIALYRARR"
     gene            272541..273875
                     /locus_tag="USDA257_c02430"
     CDS             272541..273875
                     /locus_tag="USDA257_c02430"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase"
                     /protein_id="AFL48841.1"
                     /translation="MPVEVQKVRDSASFPTQVDVVVIGAGIVGTCTAYELSRQGVSVA
                     LLEKGIVGGEQSSRNWGWVRQQNRDLHELALAMYSLRRWEELGTEIGRDLGFRRSGIL
                     YCSKNEADVARWEKWGQAARVQGFHSQILTASEANERASGGTSSWVGGVWSPTDGRAE
                     PSLAVPALSEAAKEKGVSLHQNCAVRGLDITNGRVTGVWTERGIVKASTVVCAGGAWA
                     SRFSHRYGIEVPVANIAGTAIKTTPAPEIVQAGCLSASSFVLRRRIDGSYTVAVPGHG
                     TLDITPRGMRYAFKFYEMYRSKIGKKLKYRLNSSFWNGPDAFGSWENDEISPFEKSRI
                     LDPAPDAELVKLAVKNLESEYPALKGIGVERAWSGLIDTSPDLVPVISRVEELPGYVI
                     AAGFSGHGFAIGPGAGRLVSEIVLNKEPLTDISPYRLSRFSDGSAIRRPEMM"
     gene            273989..274465
                     /gene="lrp3"
                     /locus_tag="USDA257_c02440"
     CDS             273989..274465
                     /gene="lrp3"
                     /locus_tag="USDA257_c02440"
                     /codon_start=1
                     /transl_table=11
                     /product="leucine-responsive regulatory protein Lrp"
                     /protein_id="AFL48842.1"
                     /translation="MKLDRIDIKILSELQKNGRMTYVELAELVNLSATPCLVRVKKLQ
                     AEGYIGGYSAMINMGKLGQVLTVFTEITLRNHRQADIARFMSAIQNIEQVIECHVVSG
                     DYDYLVKFVASSIGEYQSLMERLIEMDIGIEKYFSFVVLKSPITKYHMPLTNLFDI"
     gene            274867..276363
                     /gene="gabD1"
                     /locus_tag="USDA257_c02450"
     CDS             274867..276363
                     /gene="gabD1"
                     /locus_tag="USDA257_c02450"
                     /EC_number="1.2.1.79"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate-semialdehyde dehydrogenase [NADP+]
                     GabD"
                     /protein_id="AFL48843.1"
                     /translation="MQPTPAQKTTPLVSPASTAVVRDAPTQLFIGGEWVSAKEDRTFE
                     VVDPSTGDVIATVSDGDVADGISAVDAAEMAAAAWKATSPRRRSDVLMKCFHLVLEQA
                     EWLAQLITVENGKALADARSEVSYAAEFFRWYAEEAVRAPGEFGPAPSGANQIIVNHE
                     PIGIAVLVTPWNFPAAMATRKMAPALAAGCTCILKPAAETPLTALAIGEIMRQAGVPA
                     GVVNIVTTRKAGSVVSAMLHDERVRKLSFTGSTGVGRTLLREAADQVVSCSMELGGNA
                     PFVVFDDADLETAVAGAMVAKMRNGGEACTAANRFYVQKGILADFTRRFAEEMAAIKV
                     GPGLAPDTQLGPLITEAALAKVERLVDDAVAKGARLVTGGSRLNGDGFYYPPTVLADV
                     SPDAEVLREEIFGPVAPIIAFETEDEVVQMANDTEYGLVSYVFSSDLKRALAVAGRLE
                     SGMVGINRGVVSDAAAPFGGMKQSGLGREGSHHGMLEYLETKYIAASW"
     gene            276498..276851
                     /locus_tag="USDA257_c02460"
     CDS             276498..276851
                     /locus_tag="USDA257_c02460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48844.1"
                     /translation="MSLLKTIDPNPSVEPKHATPAPERLIAGAPAFKTWAQDSDKEGK
                     VNTGVWEATPGETHSIKGETFEFCHILQGVVELTEKGKEPVIYRAGDSFVMKPGYVGV
                     WKTIETVRKIYVTVT"
     gene            complement(277079..277474)
                     /gene="dapD"
                     /locus_tag="USDA257_c02470"
     CDS             complement(277079..277474)
                     /gene="dapD"
                     /locus_tag="USDA257_c02470"
                     /EC_number="2.3.1.117"
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
                     N-succinyltransferase"
                     /protein_id="AFL48845.1"
                     /translation="MRVRLARCMVEGRVTPGVTVGDGSDIGAGALIMGTLSGGGKQRN
                     VIGKGSLLGANAGIGISLGDNCVVEAGLYVTARTKVRLPDGTVVKARELSGRDNILFR
                     RNSQTGAVEALNTSGSIWGGVNDILHDND"
     gene            277494..277646
                     /locus_tag="USDA257_c02480"
     CDS             277494..277646
                     /locus_tag="USDA257_c02480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48846.1"
                     /translation="MHHRGSFREMRTEANPVAVTDPHPAGHDVVEHTREFIHREHYEV
                     VVFGSN"
     gene            277867..278367
                     /locus_tag="USDA257_c02490"
     CDS             277867..278367
                     /locus_tag="USDA257_c02490"
                     /EC_number="1.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aldehyde dehydrogenase"
                     /protein_id="AFL48847.1"
                     /translation="MIERGIAEGAELVAGGPGRPSHLNAGYYVRPTVFARVTNQMTIA
                     REEIFGPVLSIIGYDSEDEAIAIANDTPYGLAAYIQGDPKEARALAGRLRSGTVRLNS
                     SESWALRANEGIAVHADRRRAKAPVLGQFLLRLGPRAAATEEIQTGNRPVNGMWAFTT
                     GDFSTT"
     gene            complement(278301..278777)
                     /gene="lrp4"
                     /locus_tag="USDA257_c02500"
     CDS             complement(278301..278777)
                     /gene="lrp4"
                     /locus_tag="USDA257_c02500"
                     /codon_start=1
                     /transl_table=11
                     /product="leucine-responsive regulatory protein Lrp"
                     /protein_id="AFL48848.1"
                     /translation="MKLDRIDIKILYELQKNGRITNVELAELVHLSPSPCLMRVKKLH
                     EEGYIQGYSAQINVGKLGQILTVFTEITLKNHRQIDFARFLAAVEKLDQVVECHLVSG
                     GYDYLVKFITAGIGEYQMIMERLTDLDIGIDKCFSYVVLKSPVVKAHMPLTGLFPV"
     gene            complement(279173..279637)
                     /locus_tag="USDA257_c02510"
     CDS             complement(279173..279637)
                     /locus_tag="USDA257_c02510"
                     /codon_start=1
                     /transl_table=11
                     /product="putative HTH-type transcriptional regulator
                     y4sM"
                     /protein_id="AFL48849.1"
                     /translation="MAAIDAIDRNILRLLRLNARMSNARLAEEVGLSPSACLRRIRLL
                     EEAGVIRGYTALVDSGSSEDTIAVIINITLERQTEEHLDRFEAAVRKHPEIRECFLMT
                     GGSDYLLRVEVAGAGEFERIHKEILSTLPGVLRIHSSFSIRNVLATRTMKRR"
     gene            279762..280895
                     /locus_tag="USDA257_c02520"
     CDS             279762..280895
                     /locus_tag="USDA257_c02520"
                     /EC_number="5.1.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase, catabolic"
                     /protein_id="AFL48850.1"
                     /translation="MDRHALHIQGREAEAGAGASGYLTIDLAALRRNYQKLSAAVAPA
                     TVAAVVKADAYGLGAQQVSKALHAQGCRQFFVAHLAEAIELRSLLPNDTQIAVLNGLQ
                     PGAEITCAKANIVPVLNSLEQFRRWSFTAQKLGRVLPTVLQFDTGMSRLGVPLQERTA
                     LAAVLKDCRSIEILFIMSHLACADEVDNKQNADQLAEMRLIAAEFADLDVCFANSGGV
                     FLGRDYHGALSRPGIALYGGAPIAGRPNPIEPVVRLDVAVIQTRTVPAGTRVGYGGAH
                     VTSAETRLATIAAGYADGLPRSLSDRGAVFFDGVRLPIVGRVSMDSITVDITALPEGT
                     LSLGSLVEVLGPHQTLEDVAEAAGTISYEILTGLGRRYERRYR"
     gene            280918..282165
                     /gene="dadA1"
                     /locus_tag="USDA257_c02530"
     CDS             280918..282165
                     /gene="dadA1"
                     /locus_tag="USDA257_c02530"
                     /EC_number="1.4.99.1"
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid dehydrogenase small subunit DadA"
                     /protein_id="AFL48851.1"
                     /translation="MKVIVLGAGVIGVTSAYQLAKAGHEVTVVDRQQGPALETSFANA
                     GEVSFGYCSPWAAPGIPMKALKWLFMEHAPLVLRPKLDGAMLAWMYQMLRNCTADRYA
                     LNKSRMLRLAGYSRTSLAEVRAETGIAYDERMHGTLQLFRTQQQLDASGKDVKALAAD
                     GVPYKVLDRDGCIGVEPALKHVREKIVGGLLTPKDETGDCFKFTNALAAKAAALGVRF
                     AYGTQIKGLDVENGRVHGVLTDRETVTADAVVVALGSYSPLLLKPLGIKLPVYPVKGY
                     SLTIPITDASRAPESTVMDETYKIAITRLGDRIRVGGMAEISGYTNDLGHTRRRTLDH
                     SVTDLFPGGDLQRASFWSGLRPMTPDGTPVIGQTKIAGLLLNTGHGTLGWTMSCGSAR
                     LISDLVSGRKPEIDADDLAISRY"
     gene            282203..282583
                     /locus_tag="USDA257_c02540"
     CDS             282203..282583
                     /locus_tag="USDA257_c02540"
                     /codon_start=1
                     /transl_table=11
                     /product="RutC family protein y4sK"
                     /protein_id="AFL48852.1"
                     /translation="MIEAVTTTEAPGAIGPFSQAIKVGNLLFVSGQLPIDPATEEFVS
                     NDPVEQARQCLKNIAAIAEAAGSGIERTVKTTVLLTDLSRFADINNEYATFFLKPFPA
                     RACYEVSALPKGAQVEIEAVIALA"
     gene            complement(283706..284854)
                     /locus_tag="USDA257_c02550"
     CDS             complement(283706..284854)
                     /locus_tag="USDA257_c02550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48853.1"
                     /translation="MGKISLLSTWRKPLRRVIRKWLSNGYDIDALDAVLATAMAHRLG
                     GDPLWLMLVSGPGAAKTETVQVLAGMGAMVTSTIASEGALLSAVPKRNRTKEASGGLL
                     SRIGDDGILVFKDFTTILSMDRHVRGATLAALREIHDGRWQRNVGTDGGRTLTWEGRL
                     TVIGAVTTAWDSAYAVVGAMGDRFLLVRINSYENREQIGRQAIRNIGREKEMRNELAA
                     AVAALFAEPAEVVGEVDEAEFLAIADFVTLARTTTDVDSRGNVLDAHAPEAPTRFAKQ
                     LAQLARGAMAIGLNYAEAERLAIRCARDSVPPVRLQLLQDIDAHPGTTLSSICGRLNK
                     PKTTIERHLAALQLLGLVSAEKAKNTWGYKCGPRLNSKGLRLIARECG"
     gene            285599..286861
                     /locus_tag="USDA257_c02560"
     CDS             285599..286861
                     /locus_tag="USDA257_c02560"
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family protein"
                     /protein_id="AFL48854.1"
                     /translation="MLPRRTEVMSVRKRKWSTGKGVEKEAWIVDYTDTKGVRRLKTFT
                     KKKDADAFAARAAVEVREGVHVADSASVTVVQAGRFWISSAEGARLERSTINQYRQHL
                     DLHIAPLIGEKLLSKLTVPTVREFEDRLRQDGRSPAMVRKVLTSLGSLLADAQERGLV
                     TRNAVREKSRARRKGQERRQEKRHKGKLKVGVDIPTREEIKAVVAVLQGRWRPLFLTA
                     IFCGLRASELRGLRWCDVDMEKKLVHIRQRADRFNEIGRPKSEAGERTVPAPPIVINA
                     LREWCLICPKRDAEQKGADGETQKILDLVFPNGKGKVESLGNIVNRGLIPIQIDAGVT
                     VGSGETDENGNAILVAKYTGMHALRHFYASWCINRREDGGLALPPKVIQERLGHSSIV
                     MTMDVYGHLFPRGDDADEMAEAERSLLA"
     gene            complement(287034..287981)
                     /locus_tag="USDA257_c02570"
     CDS             complement(287034..287981)
                     /locus_tag="USDA257_c02570"
                     /codon_start=1
                     /transl_table=11
                     /product="putative insertion sequence transposase protein"
                     /protein_id="AFL48855.1"
                     /translation="MTRPLSNDLRERVVGAIEAGESCRSVAARFGIAVSSAVKWSQRY
                     RSSGSVAPGKMGGHRKHVLEPHRAFIAERINQTPHLSLHRLKEELAARGVKVSHDTVW
                     RFLRREELRFKKTLFALEQARADIARRRQRWRSWQSGLDPRRLVFIDETWIKTNMAPL
                     YGWGPRGKRLRGFAPHGHWRTLTFVGALRHDRLTAPCVFDGPINGQCFRAYVEQQLVP
                     VLEPGDIVIMDNLGSHKSVAIRQMIRAAGARLWYLPPYSPDLNPIEQAFAKIKHWMRA
                     AQNRTVEHTWQYLGSLVPSLQPDECSNNFANAGYASVKT"
     gene            complement(288075..289085)
                     /locus_tag="USDA257_c02580"
     CDS             complement(288075..289085)
                     /locus_tag="USDA257_c02580"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase domain protein"
                     /protein_id="AFL48856.1"
                     /translation="MGCDHSSKDAEEQARRRTCERFAPPGPIPGKDKSPATSKGNRQG
                     EPDRQESDQLLSCDGGQRWGANAARRDVGTQRRPGRPGGLAGRHVPASGRARLGAERG
                     RGAQRRPDHTHRRRTRVGPGLGLAAGRAVDQATGGRRHRSCIRDRRGADPHAHGPHWR
                     AARRRGKDRLRPDLRIHVAAAEVKFWESPDFSRASMPPGFPDALRSAAKRFVNEYQSQ
                     LRPFEEEYEVAPGVVVRRTGGHTPGHSVVRLASGGDRLTFAGDAVFAVGFDHPDWHNG
                     FEHDPEEAARVRVRLPGAGGDPRTAGGHSPAVPVRLPCGGRRRPLSLGTGRLGLLTWV
                     RS"
     gene            complement(289375..289791)
                     /locus_tag="USDA257_c02590"
     CDS             complement(289375..289791)
                     /locus_tag="USDA257_c02590"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical exported protein"
                     /protein_id="AFL48857.1"
                     /translation="MFANIFRVAMLSLLPLTSAVAGDAKTASKVTLVYDHELPNVPGK
                     SIRGVLVEYDPGGSNAAHTHPPSAFIYATVLEGAIRSQVNDGPEKVYKAGESWSEMPG
                     DRHSVSANDSETAPAKLLAVFVVDTDQRELTYPLEK"
     gene            complement(289803..290582)
                     /locus_tag="USDA257_c02600"
     CDS             complement(289803..290582)
                     /locus_tag="USDA257_c02600"
                     /codon_start=1
                     /transl_table=11
                     /product="NmrA family protein"
                     /protein_id="AFL48858.1"
                     /translation="MKIVIIGGTGLIGSKTAERLRKRGHEVIAAAPNTGVNTITGEGL
                     AGALENAEVVLDLANSPSFEDKAVLEFFETSGKNLLAAEKIAGVRHHIALSVVGTERL
                     PESGYLRAKLAQENLIRTSGIPYTIVHSTQFMEFLSGIAQSGTVGDTVHLSPAFVQPI
                     ASDDVADAMTDVALGQPQNGIVEISGPQRVKLNELIGRYLQKMNDPRKVVADPDARYF
                     GARLETNSLVSDKSPRLGSITFEQWFAVTAQQEKKINMAAS"
     gene            complement(291507..291749)
                     /locus_tag="USDA257_c02610"
     CDS             complement(291507..291749)
                     /locus_tag="USDA257_c02610"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ExsI-like protein"
                     /protein_id="AFL48859.1"
                     /translation="MTNSMNSIDASATCRGHIDIGDAVRQSREAVGYSIEDLALTCGL
                     TGAEITRIELGADVDPGKLRRIAAALRVPTSAFLLN"
     gene            complement(292139..292405)
                     /locus_tag="USDA257_c02620"
     CDS             complement(292139..292405)
                     /locus_tag="USDA257_c02620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48860.1"
                     /translation="MCRNIRPLFNFDPPATDEEIHDAALQFVRKLSGTTKPSKRNEAA
                     FESAVNSIAACARELLDSLETAQPPRNREDEAAKARARMAIRFG"
     gene            complement(292835..297898)
                     /locus_tag="USDA257_c02630"
     CDS             complement(292835..297898)
                     /locus_tag="USDA257_c02630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48861.1"
                     /translation="MTSIISSLSVNQIKSLSTTVIASLTTTDVAAMTTAQVKALSSTQ
                     IAALDTEDVATFTTAQLSAISATSVAGISLDQLAAIDAAKIASLATSQVAALSSAQID
                     GLTSDQAEALTTAQVAALTSTQIAALSSEDVTAFSTAEIAAISVTALAGLSTDNLAAL
                     STDQAAALKTTQVAALKTAQVAALTTDQVTALTSSQVAVLSSTQLKALSTDHIAALST
                     DQIAVLNSKSVAALTSTQIGALTSDQAEALTTAQVAALTSTQIAALASEDIAAFSTAD
                     IAAITVTALTGLTTDNVAALSTDQAAALKTTQVAALKTAQIAALTSDQVVALTSSQVG
                     VLTSAQISALTTDNVAALSTDQVAALNSKTVAALSSAQIGALSSDQVEALTAVQIAAL
                     DSADIAALASEDIATFSTSEIAAITATALSGLSTGNVAALSTDQTAALKTSQLAALKT
                     TQIAALTSDQVVALTSSQVGALSSTQVSALSTDNVAALSTDQVAALNSKAIAALTSAQ
                     IGALSSDQAEALTTAQVAALTSTQIAAFASEDIAAFSTADIAAITVAALAGLSTDNVA
                     ALSTDQAAALKTTQVAALKSTHIAALTSDQVTALTSSQVGALTSTQVKALSTDNVAAL
                     STDQVAALNSKSVAALSSAQVEALSSDQAEALTTAQVASLSSTQIAAFASEDIAAFST
                     ADIAAITVTALTGLSTDNVAVLSTDQAAALKTTQVAALKTAQIAALTSDQIAALSSSQ
                     VGALTSSQVSAISTDNIAALSTDQVAALNSKTVSALSSAQIEALSSTQVEALTSVLVG
                     ALSSTQLAALASEDIATFSTADIAAISVAALAGLSTDNVAALSTDQAAALKTTQVAAL
                     KSTQIAALTSDQIAALSTTQVGALTSTQASAIGTDSLAALSTDQVAALNTKTLASLTT
                     VQIDAMSSDQLEALTSGQVAALTMAQLGALASEDIATFSTADIAAITVAALAGLSTDN
                     VAALSTDQTAALKTTQIAALKTAQIGALTSDQVVALTSSQVGALSSTQISVLSTDNVA
                     ALSTDQVAALNSKTVAALTSVQIDALSSDQAEALTTAQVAALGSTQLAALASEDLATF
                     STADIAAITVSALGGLSTDNLAVLSTDQAAALKTTQVAALSTAQIAALTSDQLTALTS
                     SQVGALTSTQVKALSTDNVAALSTDQVAALNSKSVAALTSTQIEALSSDQAEALTMAQ
                     VAALTSTQIAALASEDIGTFSTADIAAITVTALAGLSTDNVAALSTDQAAALKTTQVV
                     ALKTAQIAALTSDQVAALTSSQVGALTSAQITALSTDNVAALSTDQVAALNSKTVAAL
                     SSAQIGALSSDQAEALTSAQIAALDSADIAALASEDIATFSTSEIAAITATALSGLTT
                     DNVAALSTDQAAALKTGQVAALSTAQIAALTSDQVTALTSSQVGVLSSAQITALSTDN
                     VAALSTDQVAALNSKTVAALTSAQIEALSSDQAEALTTAQVAALGSAQLAALASEDLG
                     TFSTADIAAITVTALTGLSTDNLAALSTDQASALKTTQVAALSTAQIGALTSDQVAAL
                     TSAQIGALTSTQLAALSTDNVAALTTDQVAALSTKVIGALSSDQIDALSSTQVEALTS
                     AQVAALDSADIAALSTEDLATFSTADIAAISTTALAGLSTDDILSLSSDQLLAVTSTQ
                     VEALDGSQVEAIIAAYQAI"
     gene            298431..298553
                     /locus_tag="USDA257_c02640"
     CDS             298431..298553
                     /locus_tag="USDA257_c02640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48862.1"
                     /translation="MTALCRFLRAARRETAQADSVYLERYPLHKQSRRRKPKAS"
     gene            298630..300684
                     /locus_tag="USDA257_c02650"
     CDS             298630..300684
                     /locus_tag="USDA257_c02650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48863.1"
                     /translation="MTIYTHLASDPASPLAGFLERARQQRLPLTELFQFAESFNAAGQ
                     REQAAELYKSWIAYNDSNPLLHLVYFNYSVTLRQMGDLAGSIHALRGCLKLEPRFGQG
                     HINLGRALEDAGLTGQAIQQWQAYAETTSEITPERVAHRLMVLQHMGRVLENAGLMEE
                     AENTLWKAIELRPDKTEAGQHWTSLRQRQCKWPTLVPSEHVSARQLLDALSPLTLACY
                     ADDPVFQLAKAYRYCKSLVGRPDLSDFPKLQPRRKTGTGQRLRVGYVSSDLRDHAVGF
                     ALSEVFETHDKNSVEIYAYYCGEVRTGDATQTRMMSAIDCWRDISTVSDSDAAKRIIA
                     DEIDILVDVNGYTKHARTRIFAYRPAPVIVTFCGYPGTMGSPFHQYIIADEHIIPPEN
                     EIYYSEKVLRIPCNQPVDRKRQIAPRPSRAEVGLPEDAFIFACFNGMQKITAACFDRW
                     MAILSATPGSFLWLLGGGEDVDQRLKQAAEQHGVAPERLIFASKAPNPKHLARIGLAD
                     LFLDTFPYGAHSTAGDALTMGLPVLTFPGNGFASRFCSSIVAAAGVPELICDGPDDFV
                     RKAIGFARDRQSLAAVRQALESRREASVLRDIPALVRRLEELFWQMQGECERGETPVP
                     DLGNLDIYYEIAAEFMKENVEFADSTAYRQQYVAKLAEWHAFSPIPFDSRLWTAATAD
                     VR"
     gene            300715..301965
                     /locus_tag="USDA257_c02660"
     CDS             300715..301965
                     /locus_tag="USDA257_c02660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48864.1"
                     /translation="MAPVILVTFAGRQKRMEILTRYIHSALDAGIIDEWHVWDFTRSQ
                     QDHEWVTREFGPVRYMGSAAPYQSNGSVAPNQALRLSATITNDLHIAIVPNGSEDYFE
                     LVVGGWSNSHSVLRKLPLSQLKSFDRNDVPALWSRPTPGILSPGTANQIVLSIDAAGV
                     PSLHVNNVAIGRWSELDLSSGASVMVRGGWGADLELGNVRSRIQRFVGNPNEQMPYWQ
                     AYDYYAKRLKTFSDSIFLKCDDDIVYMDLEKLSDFIEFRRTNPKYIVVSANVVNNGVC
                     AHWQQVAGSIPEGVGHFERPPGGFGGSLWQSAQRANELHDYFLQTNSKHLPLPSRVIE
                     WTERQSINFIAWLGKDLVHMALPKGDDERALTVDLPMLLERPTAIYSDFTVSHLSFGP
                     QEQGLALDRLIDAYDELMRSALAA"
     gene            302014..303171
                     /gene="rfbD"
                     /locus_tag="USDA257_c02670"
     CDS             302014..303171
                     /gene="rfbD"
                     /locus_tag="USDA257_c02670"
                     /EC_number="5.4.99.9"
                     /codon_start=1
                     /transl_table=11
                     /product="putative UDP-galactopyranose mutase RfbD"
                     /protein_id="AFL48865.1"
                     /translation="MRASGRIGIVGAGLSGAVIGRELAEAGHQVEIFDAREHIAGNCH
                     TERDEDTGVMIHVYGPHIFHTDDREVWDYVNSFQTFLPYKNRVKTTSGDQVYSLPVNL
                     HTINQFFGKTFRPDEARAFIEAQADRSIEDPQTFEEQALRFVGKDLYQAFFQGYTQKQ
                     WGCSPTELPSSILKRLPVRFNYDDNYFAHKYQGMPENGYTDMVGCILDHANINVTLNA
                     RFDRAQKDDFAHVFYSGSLDGYLDHEFGPLGYRTLDFERFNYDGDYQGCAVMNYGDVS
                     VPYTRITEHKHFSPWEEHKGSVCYREFSRTCGPDDIPYYPIRLVRDKEQLAQYVERAS
                     LEASITFVGRLGTYRYLDMDVTIREALDTARLYLARTAENASMPVFLHSPI"
     gene            303607..310683
                     /locus_tag="USDA257_c02680"
     CDS             303607..310683
                     /locus_tag="USDA257_c02680"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48866.1"
                     /translation="MTSIISSLSPTLIKSYSTAAVAAWTTEDVASLTTKQISAMSSAQ
                     IAALDTEDVDVLSSRQLAAISPSAVVGLTLEQLAVLDQSDIESFGTSQVAALTTTQVD
                     GLSTDQAEALSSTQVAVFSALQLSVMSEEDLATFSTVDIAAIGAKAVSGLATEVIASL
                     STDQIAALSTRAIAGLTAAQIAALSTDQIAALMTAQVGALKASQIDALGSDDIAALST
                     DQIAALSASAISGLSTNQFGVLAIDQIEALTVSQVKALTAAQLGSLETDGIAAFSTSE
                     IAAINKAVWGLTTGAIAALSTAQIAALNTTAVANLTTAQMAALSTDQAEAMSALQVKA
                     LNSRQLAALGTDGIATFSTAEIAAITNLAIKGVSTEAIAALSTAQVAALSTSAISGLT
                     TAQSDALSSDQTAVLSAAQLRTLSSAQVAAFGTDDLAALSTDQVAALSTKGVLGLTTD
                     QIAALSTDQIEALSVTQVKVLNARQIAALGTDGLAMFSTGDIAAISNKAILGLDAEVI
                     ASLSTDQIAALSTSAIASLSSTQIAGLSTAQAEALSVSQVKALSSTQLAALGEEGVAT
                     FSTAEMAAITNKGAPGVSVDAIAALSTAQIAALSTSAVASLTTAQIAALSTDQTAALS
                     TAQLKALSSTQIAALNTDNVAALTTAQVAALGTKAVAGLTADQIEALSSDQVGALSTA
                     QVAALGSEQLAVLSAEDIAAFSTADIAAINSSAVAGLSADLIEALTTNQIVALTTKGV
                     AHLSTDQIDALSSDQIAALSSTQVAVLSSTQLSALEPEDIEAFSTADIAAIGSKAISG
                     LSEDVVAALSSTQIAALSTAGIAGLSTDQMATLSSDQVVALSTKQIAALKSTQVAALS
                     TETVAALSSDMIAALGTAGISELTSDQVEALSTDQIVALSTKQVAALTSAQIAALDTS
                     DIEAFSTDQIAALSTTAITGLSTKQIVALSTDQMEALTAAQVGALSSTQIGALGTEDI
                     AVFSTKDIAAISASAMTGLSTAVIAALSTDEIALLSTTGIAGLSSAQLNVLSSSQFAA
                     LSTKQVAALGSAQVAALGTDDLAGLSTDQIAALSVTAVAGLTTRQLVALSTDQVEALT
                     STQVGALSATQLVVLGTEDIAVFSTKDIAAISSSAISSLSTAAVSALSTDRVAALSTA
                     GIAGLSSAQVNALSTSQLAALSTKQVAALSSTQVTALGTSDITALSTDQIGALGTAAM
                     AGLTTKQLAALSTDQLEALTAAQVGALSSTQLAVLGTEDVAVFSIKDIAAISASAIAG
                     LSTSAVASLSTDQIAALSATAVAGLTTKQIAVLNSDQIAALSTDQIGGLTSQQISALD
                     ADDITALSVEDIAAIGADLVSGLSTDVIAAFSAGQIAALSTAAVAALSTKQVDALNSD
                     QLAALTTAQMGALTSRQVDVLSTDDVAALSTDQIAALSAGGVVGLSTADISILSADQV
                     DALTTDQIAALGSKQIAALSTHDIAGFSTAEIAALSSSAVAGLSTDTIAALSAEQIAA
                     LSTAGVAGLTTAQMSTLSTDQIAALSTEQVAVLSSKQAAALGTEDIAAFSADQIAALG
                     TAGIAVLSTAQIDALSAEQLAALTSEQVAALSSTQIAALSTEDLATFSTADIAAISSD
                     AVAGLSTDMIAALSADQIAALSADGVADLSTAQLNALSADQLEALSTDQIAALRSKQV
                     AALGTDDIAALSTEQIATLSTAGVAALSTMQIQALSADQLEALTMSQIAVMSSTQIAV
                     LSTDDLESFSSADIGAISSGAVAGLSTDTIAALSADQIAALSAAGVAGLSTIQIQALS
                     TAQIEALSTDQIAALNSKQVAVLGTDDIAILSTDQIAALGAAAFASLSTAQIDTLNAD
                     QLEALTSAQVAVMSSTQIAALSTDDLESFSTEDIAAISSRAVAGLSTDTIAALSEDQI
                     AALGTGGIAGLSTAQINALNIDQVEALTSFQIAALSSKQIAVLGTDDLETFSTDEIAA
                     ISSTAVLGLSTDTIAALSVDQIGALSSAGISGLSTAQINALSTDQIEGLSTAQISGLG
                     SKQVAALSTDDLAVLSTAQIAALSTAGVAGLGSDQVRALSDDQVDALTTVQIAAMSSD
                     ALSGLSTDDLEGFSADELAAISSAAISGLPTEFIAGLSTAEIAALGTASIAGLSSAQI
                     GAMSAEQIDSLSTDQIAALSADGLAGLTTEDLATFETEELQAINAAAIKGLSTSFVAA
                     LSTDEIAVLRASQVGALSYNQVAAMSTTQIATLSTAQISALNAIQAAALGTDDIAQLS
                     TDHIVALSTSAVSGLTARVVVALTTDQAEALTTVQVGAMTSAQVAALETDDLATFSAE
                     DVASFSASGVAGLSTEDIGNLSSTQLNALMDSQMDALSSDQIAAVIAAYLST"
     gene            complement(310685..311671)
                     /gene="glxA1"
                     /locus_tag="USDA257_c02690"
     CDS             complement(310685..311671)
                     /gene="glxA1"
                     /locus_tag="USDA257_c02690"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator GlxA"
                     /protein_id="AFL48867.1"
                     /translation="MLRVGFILARSFTLSAFSLFVDALRLGSDVEDKSGRVNCDWEVL
                     GSTRNFVMSSCGIQVAPTAPLRPPSEFSYIAVVGGRLNVAEPLDRETIDYLHRAARAG
                     VPIIGVCTGSFVLAEAGVLDGHAACVSWLHHNEFRARFPAIEVTSNRIFVEDAKIITC
                     AGGSSVADLATYLIRRHVGEDAERNALEIMQITRRREASEMQPRNPLGPVPVQDKRIS
                     LALMVMEQHLEDLIGIDDVANVLGISRRQLERLFQNELGATPISVYLKLRLDAAMRLV
                     ASTDKPLIDIALETGFENVSHFIRKFRKAFSITPAAARKQLAAARNAAPGRR"
     gene            311747..311863
                     /locus_tag="USDA257_c02700"
     CDS             311747..311863
                     /locus_tag="USDA257_c02700"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48868.1"
                     /translation="MTIWRGPSPASRHARLGTRFQSSRSASIRQLSPKQRPG"
     gene            312017..312130
                     /locus_tag="USDA257_c02710"
     CDS             312017..312130
                     /locus_tag="USDA257_c02710"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48869.1"
                     /translation="MKRGQGSTQMTLHMMKVLLSLMAALSFGSLMVLVAVL"
     gene            complement(312164..312625)
                     /gene="ywhH"
                     /locus_tag="USDA257_c02720"
     CDS             complement(312164..312625)
                     /gene="ywhH"
                     /locus_tag="USDA257_c02720"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein YwhH"
                     /protein_id="AFL48870.1"
                     /translation="MSLTSVKEFFSEHAPDIDVIELEQSTATVALAAEGHGVEPAQIA
                     KTLALRVGDEVILIVTRGDARLDNKKYKDRFGTKARMLGFEEVELETGHPVGGVCPFG
                     LAKPHTVYCDESLKAFDVVVPAAGAINAAVHINPHRMAELTGAEWIDVSEA"
     gene            complement(312708..312896)
                     /locus_tag="USDA257_c02730"
     CDS             complement(312708..312896)
                     /locus_tag="USDA257_c02730"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48871.1"
                     /translation="MTEFYAEKIESALQTYMSDHPGTVTRQQAISTILENWFASHGYL
                     PPQQEGRRPEDLDASNDD"
     gene            complement(313070..313324)
                     /locus_tag="USDA257_c02740"
     CDS             complement(313070..313324)
                     /locus_tag="USDA257_c02740"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48872.1"
                     /translation="MGIESILVFLIVGAVAGWLAGLIVSGFGFGLIGNIVVGIIGALI
                     AGYLFPAVGITLGTGILAAIIHSTIGAIILLVLIRIVKQA"
     gene            complement(313599..314891)
                     /locus_tag="USDA257_c02750"
     CDS             complement(313599..314891)
                     /locus_tag="USDA257_c02750"
                     /EC_number="5.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sugar isomerase R00627"
                     /protein_id="AFL48873.1"
                     /translation="MTNMISTSAIDAENAKREQALRRDYEGLGERLSRRGIDIDAIKQ
                     KVAAYGVAVPSWGVGTGGTRFARFPGLGEPRNIFDKLEDCGVIHELTRATPSVSLHIP
                     WDKVADLKALKEKGAALGLSFDAMNSNTFSDAPGQAHSYKFGSLSHSEAATRRQAVEH
                     NLECIEIGKALGSKALTVWIGDGSNFPGQSNFTRSFERYLDAMKAVYASLPDDWRVFT
                     EHKMYEPAFYSTVVQDWGTNYLIAQELGPKAFCLVDLGHHAPNVNIEMIVARLIQFKK
                     LGGFHFNDSKYGDDDLDTGSIDPYRLFLVFNELVDAETRAAPGFEPAHMLDQSHNVTD
                     PIESLMTSAMEVGRAYAQALLVDREALEGYQQENDALMASETLKVAFRTDVEPILAMA
                     RLENGGAIAPVATYRASGYRAKVAAERPAVAGGGGGIV"
     gene            complement(314905..317004)
                     /gene="yuxG"
                     /locus_tag="USDA257_c02760"
     CDS             complement(314905..317004)
                     /gene="yuxG"
                     /locus_tag="USDA257_c02760"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase YuxG"
                     /protein_id="AFL48874.1"
                     /translation="MLDKQQGARLANLWDDAKAAGMSEPERLLYRSNLLGSDKRITNY
                     GGGNTSAKVMQKDPLTGETVEVLWVKGSGGDVGTIKMDGFATLYMDKLRALKSIYRGV
                     EFEDEMVGYLPHCTFNLNPRAASIDTPLHAYVPKAHVDHMHPDAIIAIAASKTSRELT
                     KKIFGDEIGWLPWKRPGYELGLWLEKFCLDNPKARGVVLESHGLFTWGDTAKEAYETT
                     IEIINRAIAWFEAENTAPAFGGEARPVLAAGEREAIAKRLMPVIRGLISAEEKKVGHF
                     DDSKAVLDFVTSTSLEPLAALGTSCPDHFLRTKIRPLVVDFDPTQPDVEKTLAGLPEA
                     IAAYRADYARYYERCKRADSPAMRDPNAVVYLVPGVGMITFAKDKATARISGEFYVNA
                     INVMRGASGVSTYVGLPEQEAFDIEYWLLEEAKLQRMPKPKSLAGRIALVTGGAGGIG
                     KATAVRLMQEGACVVLADIDETALENAQNELAARYGKDFVRAVNMNVTSEAAVETGFG
                     DALLAFGGLDILVSNAGLASSAAIEDTTLALWNKNIDILATGYFLVSREAFRIFRSQK
                     AGGNVVFVASKNGLAASPGASAYCTAKAAEIHLARCLALEGASAQIRVNVVNPDAVLR
                     GSKIWSGEWKEQRAAAYKMDVDELEAHYRERSMLKLSVFPEDIAEAIYFLASDMSAKS
                     TGNIVNVDAGNAQSFTR"
     gene            317206..318018
                     /gene="ulaR"
                     /locus_tag="USDA257_c02770"
     CDS             317206..318018
                     /gene="ulaR"
                     /locus_tag="USDA257_c02770"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator UlaR"
                     /protein_id="AFL48875.1"
                     /translation="MHEKERHRIILSAVQEKPVVTVPELVELTGSSEATIRRDVAALH
                     VQKRLRRVRGGAEAINPPQFVGLAGRPFSVNEGLHAREKQAIAREAVALCQDGEPIII
                     NGGTTTFQMVHFLANRRMQVFTNSFPIAEHLLKHSKNTVMLSGGTIYREQNIILSPFD
                     NDVTRNFYARRMFMGAQGLGPLGLMEADPLLIQAEQKLIDQADELVVLVDSSKFHKRS
                     SLILCGLKRIATVITDSGIEDRHASMLESAGVNLVIANAKPKADAQTASTSA"
     gene            318146..319135
                     /gene="lsrB"
                     /locus_tag="USDA257_c02780"
     CDS             318146..319135
                     /gene="lsrB"
                     /locus_tag="USDA257_c02780"
                     /codon_start=1
                     /transl_table=11
                     /product="autoinducer 2-binding protein LsrB"
                     /protein_id="AFL48876.1"
                     /translation="MKILKSLMVTAAVAVALMANAAHAENKKIALVVKALGIGFFEAA
                     NKGAQEAAKELGDVEIIYTGPTSTTAEGQIEVINSLIAQKVDAIAVSANDTDALVPAL
                     KKAMDRGIKVISWDSGVAKEGRLMHLNPSSSPLIGNMIIKLAADNLPEGGDVAVLSAS
                     ATATNQNTWIAEMKKVQGNYEGINVVATVYGDDLADKSYRETQGLIQSHPNLKAIIAP
                     TSVGIVAAAQAVTDAGKIGQINVTGLGLPSEMAGHVKSGASKSFAIWNPIDLGYSATM
                     IAYDIINGAEAKPGAELKMGRMGTVKLDDNNEGAMADPFVYDASNVEEFAKIF"
     gene            319095..320768
                     /gene="rbsA2"
                     /locus_tag="USDA257_c02790"
     CDS             319095..320768
                     /gene="rbsA2"
                     /locus_tag="USDA257_c02790"
                     /EC_number="3.6.3.17"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose import ATP-binding protein RbsA"
                     /protein_id="AFL48877.1"
                     /translation="MMPRTLRNSPRSSDLRSSPAQGCDLRAGCPSGFCRRVPDEPAEM
                     ALLHDTKSVTATPAITLEGISKSFPGVRALSEVSLALYPGSVTALIGENGAGKSTLVK
                     ILTGIYQPESGVIRVAETETTFPTALAAARAGVTAIHQETVLFDELSVAENIFLGHAP
                     RNRFGLIDWKKLNADAAALLHRAGADFDPTIRLRDLGIAKKHLVAIARALSVDARVVI
                     MDEPTAALSHKEIHELYALIERLKADGKAILFISHKFDEIFRIADRYTVFRDGTMVGE
                     GLIADASQDDLVRMMVGRAVDSVYPKKEVKIGEPVLTVSGYRHPTEFEDINFELRRGE
                     ILGFYGLVGAGRSEFMQSLIGITRPSAGAVKLDGNVLVIRNPAEAIRAGIVYVPEERG
                     RQGAIIGMPIFQNVTLPSLSHTSRSGFLKLANEFALAREYTSRLDLRAASLDQDVGTL
                     SGGNQQKVVIAKWLATKPKVIILDEPTKGIDIGSKAAVHAFMSELAAQGLSVIMVSSE
                     IPEIMGMSDRVIVMREGRIAGRFERSELTAEKLVRAAAGIETQLSGRAA"
     gene            320947..322749
                     /gene="rbsC2"
                     /locus_tag="USDA257_c02800"
     CDS             320947..322749
                     /gene="rbsC2"
                     /locus_tag="USDA257_c02800"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose transport system permease protein RbsC"
                     /protein_id="AFL48878.1"
                     /translation="MHRSVDGGEPGALRHGCGHAERGLSRPTDPAHHSCRHGARRSAR
                     HDQRNARLEARHPADRRHPRNADDLSRPDLSSDRRQVDQCARDERHLQGPAAAGSCRR
                     AGALLAVAPDDRSDVPGHGPHAARSRLLCGRRQSACRRLYGDRCRPHPFLRLLPLGYA
                     RRPLRLSLGVALCGRLCRYRRRLRARHHRGLRYRRHFDRRRHRLGGRRRARRALPRRH
                     QERAAGHQHLALCADGDLRNGDHHRRCRQRPGRAAQGQGHSQESGGGLMAHAQLSPRN
                     IPDRLEGRGARLMKSWETLLIVVATLIFLGNSFASPYFLDPWNLSDATFNFTEKAMIA
                     FAMALVIISGEIDLSVASVIALASTAMGYAVQFGFDTPALVAIGLGVGLVCGAVNGLL
                     ITGLGLPSIVVTIGTMSLFRGLSFIVLGDQAFTGYPESFAWFGQGYVWWVFSFEFTLF
                     VLLAVVYGVLLHKTNFGRAVYAIGNNQTAALFSGVRVARVKFALFLLTGLMAGLASIC
                     LTSRLGSTRPSIALGWELEVVTMVVLGGVNILGGSGTIPGVVLAALIMGMVTFGFGLL
                     NVPGIVMSIFIGLLLISVIALPILWKRARRRLAH"
     gene            322760..323074
                     /gene="rhaM"
                     /locus_tag="USDA257_c02810"
     CDS             322760..323074
                     /gene="rhaM"
                     /locus_tag="USDA257_c02810"
                     /EC_number="5.1.3.n3"
                     /codon_start=1
                     /transl_table=11
                     /product="L-rhamnose mutarotase RhaM"
                     /protein_id="AFL48879.1"
                     /translation="MEKYAFRMRLNPGMAEEYRARHDAIWPELVDLLKDAGISDYSIH
                     LDEETNLLFGVLWRAEDHRMADLPSHPVMRKWWAYMADIMETRANNEPVAVPLQTVFH
                     LS"
     gene            323076..324446
                     /locus_tag="USDA257_c02820"
     CDS             323076..324446
                     /locus_tag="USDA257_c02820"
                     /codon_start=1
                     /transl_table=11
                     /product="putative carbohydrate kinase contains FGGY
                     family domain"
                     /protein_id="AFL48880.1"
                     /translation="MKTVAIIDIGKTNAKVALVDLERFEEIAVRKMPNVVVGEGLYPH
                     FDVDHLWRFILDGLAALHREHPVEAISVTTHGATAVLLDAAGGLALPVLDYEFAGPDA
                     LAEEYGQARPPFSETGSARLPMGLNVGAQLFWQQRLFPEYFDRVATIVTYAQYWSYRL
                     TGVATNELTSLGCHTDLWNPKAATFSTLTEAQGWTPLFAPVRKAGDVIGGLLPPLAAA
                     TGLPSGLPVYCGIHDSNASLLPHLLTRRAPFSVVSTGTWVVMLAVGGDQVELDETRDT
                     LINVNALGEPVPSARFMGGRAFSMLVGDNPPEVSAEAEARVFAEGCMLLPSVPGGSGP
                     FPSARSRWTVDEAGLTPAERLAAVSFHLALMTATCLDLIGARGGIVVEGPFAVNSAYL
                     RMLAAATGRSVLVNRLSSTGTSLGAACLVAGAHIRTGAEALSAAIPQAYVDYAREWQR
                     LTAEHV"
     gene            325139..326752
                     /gene="mcpE"
                     /locus_tag="USDA257_c02830"
     CDS             325139..326752
                     /gene="mcpE"
                     /locus_tag="USDA257_c02830"
                     /codon_start=1
                     /transl_table=11
                     /product="putative chemoreceptor McpE"
                     /protein_id="AFL48881.1"
                     /translation="MQQEASEQARKSQAGSLLERLRFAGLDEAACALLRDHRQALSPR
                     IELALRDLFHRLQTNPDAIRHFDNDRQLDRLHDLQSSHWNVLTDARFDGLYAERVKVL
                     ADTEARMGLDPRWQLASHAVVLEHLIVGAIEEAWPKSLLPFGKARRNELCRLVAALVR
                     AACVDSEIAVSLRFNALRQQQQRQLSEQRKGDESEVTALFSDFIQALGTGDLGARLPT
                     DAPDVYRPIVAGLNAALDQIQQALLSGDKRAAAAESMVESLRSRTSEFSGSAGGEAEA
                     LTGQVAALGAMTDRMRSGAMRISAAEAKTNETRHAAERSGEIAGQAISAMADIEASAE
                     KIGQIIGVIDEIAFQTNLLALNAGIEAARAGDSGRGFAVVAQEVRALAQRSGEAAREI
                     KQLVNGTKSQVEAGVEIVGQTQNAISSIVDQVISINAAVSGIAREAESQVGDLAAAAS
                     DIGGISKAMSRSAALAGEAAASTEDLHGTILELGQTIRRFRFERQAGLRASTFALPPA
                     LPPQIDEDEAAMPFSDDAASGRQVAAWRR"
     gene            326782..327075
                     /locus_tag="USDA257_c02840"
     CDS             326782..327075
                     /locus_tag="USDA257_c02840"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48882.1"
                     /translation="MASRNTAKKSLKLASVLDLNEATALHERLLSLKGSPVEIDASAV
                     ERVGTLCAQVLMAGARRWEEDRLSFTFAKVSDAFVKTTQLIGVDIAPLMAKEI"
     gene            327079..327444
                     /locus_tag="USDA257_c02850"
     CDS             327079..327444
                     /locus_tag="USDA257_c02850"
                     /codon_start=1
                     /transl_table=11
                     /product="putative two-component response regulator
                     receiver protein"
                     /protein_id="AFL48883.1"
                     /translation="MKKRVLTVDDSRTIRNMLLVTLNNAGFETIQAEDGVEGLEVLET
                     ANPDVIVTDINMPRLDGFGFIEGVRKNDRYRAVPILVLTTESDAEKKNRARQAGATGW
                     IVKPFDPTKLIDAIERVTA"
     gene            327464..329767
                     /gene="cheA"
                     /locus_tag="USDA257_c02860"
     CDS             327464..329767
                     /gene="cheA"
                     /locus_tag="USDA257_c02860"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheA"
                     /protein_id="AFL48884.1"
                     /translation="MDMNEIKEIFFQECEEQLAELESGLLKLNDGDRDPETVNAVFRA
                     VHSIKGGAGAFGLDDLVSFAHVFETTLDCVRSNRLEPNQDVLKVMLKSADVLADLTNA
                     ARDGGSVDEVRSRQLIKELEALANGELPQTAVAEPVAKQAPAATPVPAPAPAAAVNEE
                     GFQPVAFSFDDFEASEPPAIEPTTFEVLFRPKSELYAKGNDATLLLRDLSRLGEMSIH
                     CDMDELPALGSMNPEAAYFAWKISLKTDKGEDAIRSVFEFAEWDCELDVTLAGGDHAG
                     AGDELPMQPVPFDLSLLDEEVPASTGAADDDEQLATQQRAVRDEAVSAAATASNVLQM
                     AKAARTPAESTRSAASASAAQAAAQQAAASAATPTIRVDLDRVDRLINLVGELVINQA
                     MLSQSVIENDTNGTSSINMGLEELQQLTREIQDSVMAIRAQPVKPVFQRMSRIVREIA
                     DMTGKSVRLVTEGENTEVDKTVIDKLAEPLTHMIRNAVDHGLETPEKRVAAGKNPEGT
                     VRLTAKHRSGRIVIELADDGAGINREKVRQKAIDNDLIAADANLSDEEIDNLIFHAGF
                     STADKISDISGRGVGMDVVKRSIQALGGRINISSKPGQGSVFTMSLPLTLAVLDGMVV
                     TVANQTLVVPLTAIVETLQPEASAIHSFGAAQRLISIRNSFCPLVDVGRILNFRAIQA
                     NPVEGVALLVESEGGGQRALMVDAIQGQRQVVIKSLEANYTHVPGIAAATILGDGRVA
                     LILDVDAIVGASRGHSLKPEMSLAAAG"
     gene            329773..330240
                     /gene="cheW1"
                     /locus_tag="USDA257_c02870"
     CDS             329773..330240
                     /gene="cheW1"
                     /locus_tag="USDA257_c02870"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheW"
                     /protein_id="AFL48885.1"
                     /translation="MTYAAKNLTTGGRELIAFRVGGQEYCVNIMAVREIRGWTPATAM
                     PHAPNYMLGVINLRGAVLPIIDFSARLGMKPAEPTVRHVIIVAQVKSQVVGLLVDAVS
                     DILTVSDADIQPTPDIASDFERSFARGVLAVEGRMICLVELDSVFPQEEREAA"
     gene            330237..331145
                     /gene="cheR"
                     /locus_tag="USDA257_c02880"
     CDS             330237..331145
                     /gene="cheR"
                     /locus_tag="USDA257_c02880"
                     /EC_number="2.1.1.80"
                     /codon_start=1
                     /transl_table=11
                     /product="putative chemotaxis protein methyltransferase
                     CheR"
                     /protein_id="AFL48886.1"
                     /translation="MRVQATFEQKLSPDECLAAGEYPLTRRDLTDIAAMIYADAGIYL
                     NESKASLVYSRLSKHIRNLGLKGFRDYCQLVASPAGAAARRDMLSHLTTNFTRFFREN
                     HHFEHLKTDVLPGLIARAKNGGRVRIWSAACSDGQEPYSIALTVLSLLPNAADYDFRI
                     LATDIDPKILALARAGAYDATALETVSPAMRKQWFRETEIGGRGKWQIDDRVKRLITF
                     NELNLMAQWPVKGPFDVIFCRNVVIYFDEPTQMKIWSRFAGMLDTGGHLYIGHSERVS
                     GDAKAIFDNIGVTTYRHTGKFHGGRA"
     gene            331142..332194
                     /gene="cheB1"
                     /locus_tag="USDA257_c02890"
     CDS             331142..332194
                     /gene="cheB1"
                     /locus_tag="USDA257_c02890"
                     /EC_number="3.1.1.61"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis response regulator protein-glutamate
                     methylesterase of group 1 operon"
                     /protein_id="AFL48887.1"
                     /translation="MNAPARVLVVDDSPTMRGLISAVLNADPEVKVVGQAADALEARQ
                     AIKQLDPDVITLDIEMPNMNGLEFLDKIMRLRPMPVIMVSTLTHKGAEATIAALEIGA
                     FDCVGKPHPGDPNPFGGLVEKVKAAARSQRKSMITSNRAASAPAVGTVSDYRAGRKII
                     AIGASTGGVEALIAVLQKFPANCPPTVITQHMPHTFTKSFSERLNRLCAPSVLEATDG
                     ARLEVGKVYLAPGGDRHLQVANASAPCCRLIDREPVNGHRPSVDVLFDSVAELAGRNA
                     IGVILTGMGRDGAAGLLKMRHAGARTFGQNEKTCVVYGMPRVAHELGAVETQLPLGSI
                     GEEILKTAAARKEGSE"
     gene            332194..332583
                     /gene="cheY"
                     /locus_tag="USDA257_c02900"
     CDS             332194..332583
                     /gene="cheY"
                     /locus_tag="USDA257_c02900"
                     /codon_start=1
                     /transl_table=11
                     /product="putative chemotaxis protein CheY"
                     /protein_id="AFL48888.1"
                     /translation="MSIAEKIKVLIVDDQVTSRLLLGDALQQLGFKQITAAGDGEQGM
                     KIMAQNPHHLVISDFNMPKMDGLGLLQAVRSNPNTKKAAFIILTAQGDRALVQKAAAL
                     GANNVLAKPFTIEKMKAAIEAVFGALK"
     gene            332580..333134
                     /gene="cheD"
                     /locus_tag="USDA257_c02910"
     CDS             332580..333134
                     /gene="cheD"
                     /locus_tag="USDA257_c02910"
                     /EC_number="3.5.1.44"
                     /codon_start=1
                     /transl_table=11
                     /product="putative chemoreceptor glutamine deamidase CheD"
                     /protein_id="AFL48889.1"
                     /translation="MMLEAAGRRVHVIQGEFKVVNDPDVVLSTILGSCVAACMRDPVA
                     GVGGMNHFLLPGSSTSPTSAGDATRYGVHLMELLINGLLKQGARRDRLEAKIFGGAKT
                     IARFSNVGEQNAAFAREFLLDEGIRIVGESTGGEHGRKLEYWPVTGRARQYALTGVEA
                     QRAIHQDQRPAPAPKPVESSIEFF"
     gene            333196..333588
                     /locus_tag="USDA257_c02920"
     CDS             333196..333588
                     /locus_tag="USDA257_c02920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48890.1"
                     /translation="MQTDHQSYMPHAEESLPEVLMRIVTELHDVAYLIERIEPQLWSG
                     RAASATDPADKMMVLQGVDLAVQKTRGLAEFIDTITASIPDTCLVDISTAVNLIKLAD
                     MKKALGSGLLRHGHSQPLTKAAGDFEAF"
     gene            333969..335648
                     /gene="fliF"
                     /locus_tag="USDA257_c02930"
     CDS             333969..335648
                     /gene="fliF"
                     /locus_tag="USDA257_c02930"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar M-ring protein FliF"
                     /protein_id="AFL48891.1"
                     /translation="MNLFDQFSTFTKNLSNLGQSKLIALAVAGIVAIGFVLGAAVYVN
                     KPAFETLYVGLERSDVTQISIALAEANLNFEVGADGGSIQVPVGMTGKARLLLAERGL
                     PSSANAGYELFDNVGSLGLTSFMQEVTRVRALEGEIARTIQQISGIAAARVHIVMPER
                     GSFRKAEQTPTASVMIRASATVGRGAASSIRHLVASSVPGLDVDDVTILDSTGQLLAS
                     GDDPASSALNQSLGVVQNVQTDLEKKIDNALAPFLGMDNFRTSVTASLNTDAQQIQET
                     VFDPESRVERSTRVIKEEQKSSQQQPDNAATVQQNVPQAAPRGGAGQQSSDEAEKKEE
                     QTNYEINSKTIATVKNSYSIERLSIAVVVNRGRLAAMVGETADQVKIDAYLQDMQKIV
                     ASAAGVDPSRGDVVTLNAMDFVDTQLLDQPVTGPGVMEMLTRNLGGIINSLAFIVVAF
                     LVVWLGMRPLARQMGFGGRSGQLEGEGAGLELPDFSPAAAGAAGGALMEGFGSDFGFD
                     STDDLLNLGDDSSGFNRRVKEGPERRLARMVEISEERAAKILRKWSLDRAA"
     gene            336382..337242
                     /locus_tag="USDA257_c02940"
     CDS             336382..337242
                     /locus_tag="USDA257_c02940"
                     /codon_start=1
                     /transl_table=11
                     /product="putative LuxR family transcriptional regulator"
                     /protein_id="AFL48892.1"
                     /translation="MYSLDIDSCPGLRTGNAGFDWLSVGRASVPGASNPARGLKVMEI
                     SPTGAAWSLQTAAPRMSSRGISREQLIRKLGEAAERSSLANGLAILTEYVGATHYLLA
                     RHDLSQDGGLDFVLCSDWPFDVVRRLSSIVIGLNAKTTELEKCLTALQPCFQALPDDI
                     DLPRGVNRSYCSVTFNVGRSRFSMMLLFPEDVILSQEGLRDIAVLASYLASFKADAGV
                     RHDRDFELTERELECLFWIAEGKTSEEMAVILGISRNTINNYITSVMRKTATRTRSEA
                     IAHAVRHNLV"
     gene            337253..337993
                     /locus_tag="USDA257_c02950"
     CDS             337253..337993
                     /locus_tag="USDA257_c02950"
                     /codon_start=1
                     /transl_table=11
                     /product="putative LuxR family transcriptional regulator"
                     /protein_id="AFL48893.1"
                     /translation="MVHLDSEGRSDHVRLGRSARAARAATLVTRLQVMQRQINAKNFA
                     VLRVNGRGMPTTRKLTCVLHNWGAASEANAHELLKVYGEELLQHLDRSPLAVLWDGQG
                     EHQAADVPDMALFSHRLKGRKLSYSGIAFPIRLGAQGNGCVVFAGSYIDAPAEQILDL
                     HGRCAQVMIDMLAADERRLFKGESLSDREIACLQMAGDGYISEEIAEKMGLSVHTVNA
                     YLGAATTKLDSVNRIQAIAKAIRLGYIS"
     gene            complement(338146..338586)
                     /locus_tag="USDA257_c02960"
     CDS             complement(338146..338586)
                     /locus_tag="USDA257_c02960"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein R00649"
                     /protein_id="AFL48894.1"
                     /translation="MKKCEFSEKREKLVAEAIRPVATELRLIDAADFIALLRFESYAS
                     LADLVESAAELYFLPGTVNFGLGGNYNLDWNSRPEIILDLELKPRGVTVYARLVLAGE
                     AAGIEISHINFQHPSTDPDENTAFLARSLEEARFVKSYPLRLAS"
     gene            complement(338589..339671)
                     /gene="flhB"
                     /locus_tag="USDA257_c02970"
     CDS             complement(338589..339671)
                     /gene="flhB"
                     /locus_tag="USDA257_c02970"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthetic protein FlhB"
                     /protein_id="AFL48895.1"
                     /translation="MSEDQDKDSKTEAPSEKKLSDATEKGNVPFSREVTAFASTLAVY
                     IFIVFFLSEGAASTAEALKDIFEQPEAWRLETATDAVGLISHVVLKSAGLVLPIFLLL
                     IIFGVGSSIFQNLPRPVLDRIMPKMNRVSPIAGFKRIYGIPGLVEFAKSLFKIIVVSI
                     IVVVVLWNDYFATLDLMFSDPVTIFATMTSDLKQIVTVVLLATAALAIVDLFWTRHHW
                     YTELRMTKQEVKEELKQSQGDPIVKARLRSMQRDRARKRMIGSVPRATLVIANPTHYA
                     VALRYVREENDAPVVVAMGQDLVALKIREIAEKNGIPVFEDPPLARSMFAQVSVDSVI
                     PPVFYKAVAELIHRVYAAQPQQKRVT"
     gene            complement(339898..340929)
                     /gene="fliG"
                     /locus_tag="USDA257_c02980"
     CDS             complement(339898..340929)
                     /gene="fliG"
                     /locus_tag="USDA257_c02980"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliG"
                     /protein_id="AFL48896.1"
                     /translation="MMDFESFEAQALARPLSQTEKAAAVLLAMGKSVAGKLLKFFTQS
                     ELQSIIAAAQSLRAIPPHELEALVNEFEDLFTEGAGLMDNAKAMESILEEGLTPDEVD
                     GLLGRRATFQSYEASIWDRLQECDPVAVAQLLAKEHPQTIAYVLSMMPSSFGAKVLLQ
                     LSDRQRPDVLNRAVNMKNVSPKAASIIETRVIEMIGEMEAERNSPGPAKIAEVMNELE
                     KKQVDTLLASLETINTDSAKKVRPKIFLFDDILYMPQRSRVQLFNDVSTDVITMALRG
                     SAPELRESILASVGARQRRMIESDLAVGDAGINPRDIAIARRSITQEAIRLAASGQLE
                     LKEKESEAA"
     gene            complement(340958..341575)
                     /gene="fliN"
                     /locus_tag="USDA257_c02990"
     CDS             complement(340958..341575)
                     /gene="fliN"
                     /locus_tag="USDA257_c02990"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliN"
                     /protein_id="AFL48897.1"
                     /translation="MPEASFNWNNPHMVRKKAASIEEQTAFAGDAELDQAIDDLRGVL
                     KQDGAATDFGAEFGAAEPFGQAADFGADLGAGGFGGDFGDASLGDGLDVGAGFAGSDF
                     GGDDFGAAMSGVESAPGSGMAANMDLIMDIPIDVQIVLGTSRMQVSGLMGLTEGATIA
                     LDRRIGEPVEIMVNGRVIGRGEITVLEGDVTRFGVKLIEIKGSRK"
     gene            complement(341597..342544)
                     /gene="fliM"
                     /locus_tag="USDA257_c03000"
     CDS             complement(341597..342544)
                     /gene="fliM"
                     /locus_tag="USDA257_c03000"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliM"
                     /protein_id="AFL48898.1"
                     /translation="MNPSTASNVHAFDKRLLARMTGALGDDKTIGRTTLELGHVFSEL
                     LPDMLKQETGHDIAIGYAGFNMGLRNELIADLGEAVLLSDVSLRNWCAEFQIGCDSPV
                     LIALVEALLGAEPTDIEEPLPRALSKIEIDVAMPVFERIAEVVRMAVNAPGGFEPLVG
                     RPYNGAERLPPDPALEDVYAASIDMTFGLGPVLSTFSVIIPQSVLLKSQIVLPRSAGQ
                     NENMKTGWTEQLEEQIRRSAVTLEARIQLESLTLETISRLQPGDVIPFHDGQDVRVEV
                     NANGRDLYVCEFGRSGSRYTVRIKDTHGSEQDILRHIMS"
     gene            complement(342549..343427)
                     /gene="motA"
                     /locus_tag="USDA257_c03010"
     CDS             complement(342549..343427)
                     /gene="motA"
                     /locus_tag="USDA257_c03010"
                     /codon_start=1
                     /transl_table=11
                     /product="motility protein A"
                     /protein_id="AFL48899.1"
                     /translation="MNIIIGLLVTFGCILGGYLAMGGHLEVLNQPFELLIIGGAGIGG
                     FIMANSMKVVKDTGKALGEAFRHKVPKERHYLDTLGVLYSLMRDLRTKSRNEIEAHID
                     NPEESPIFQSAPTVLQNKELTAFICDYVRLIIIGNARSHEIEALMDEEIHTITHDKMK
                     CYHSLTTMGDALPAIGIVAAVLGVIKAMGAISEAPEVLGAKIAAALVGTLLGVFLSYS
                     IVGPLVANIKSVREKQNRLYVIVKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAV
                     EQEMMNPGGGSESKAA"
     gene            343611..344390
                     /locus_tag="USDA257_c03020"
     CDS             343611..344390
                     /locus_tag="USDA257_c03020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48900.1"
                     /translation="MTTTYTSYKLITADLTRSLERVSDQPDVARETKYYLSKIGSIKT
                     LDEFFADSRLYDYAMKAHGIEDMAYAKAFMRKVLTEGIDSDDAFANKLADSRYKALVE
                     SLNFARHGDTATSFERAQKGVVDKYTRQRLEQNAGEENTGVRLALYFERMAPLITSGY
                     EIIADEALAQVVRTALQLPEEFAAADVDRQAKAYEEAIDLKDFQDPVKLAAFIDRFTA
                     LWEINNSSDSYDPLAVFGSSSGYGISPDLLLSINNLKLGGA"
     gene            344392..345117
                     /gene="flgF"
                     /locus_tag="USDA257_c03030"
     CDS             344392..345117
                     /gene="flgF"
                     /locus_tag="USDA257_c03030"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein FlgF"
                     /protein_id="AFL48901.1"
                     /translation="MQTGLYVALSSQMALEKRLNTLADNIANANTVGFRATEVKFDQV
                     LGDTKPNRVSYVSEGEEYLSTNNGALARTGSALDFAVKGNAWFSIDTPGGPALTRDGR
                     FTLTETGELVTIKGYPVLDAGGAPIQLNGGAGEITVGADGAIHQNGVQVALLGLYEAD
                     FSSGFVRYDNSAVMPAAQPEPVVDRFDVGVMQGFLEESNVNAVQEMTQLITVTRAFDN
                     ITALMRDSEGSLEEAIKTLGGER"
     gene            345205..346605
                     /gene="fliI"
                     /locus_tag="USDA257_c03040"
     CDS             345205..346605
                     /gene="fliI"
                     /locus_tag="USDA257_c03040"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellum-specific ATP synthase FliI"
                     /protein_id="AFL48902.1"
                     /translation="MERQGSDILPASTSLAALAGLVERYANPDFSIAPGGHVQTISPG
                     HYTVTGLSRHVRLGDFVAHKSATGTHLGEVVRVEPERVVVCPIEPGDPIGIHDTVIRK
                     GAFRIAPTDNWCGRTINALADPIDGRGPLMQGDIRRPISNTAPPSMTRRRVEQGFKTG
                     VRAVDIFSPLCLGQRLGIFAGSGVGKSTLLSMLARADAFDKVVIALVGERGREVREFI
                     EDTLGDNLAKSVAVVATSDESPMLRKMAPLTAVTIAEHYRDKGDNVLLIVDSVTRFAH
                     AIREVATAAGEPPIARGYPASVFTELPRLLERAGPGAEGTGTITAIISILVDGDNHND
                     PVADSARGILDGHIVLDRSLAEEGRYPPIDPLASISRLARKAWTPDQEKLVARLKSLI
                     HRFEETRDLRLIGGYRAGGDPDLDMAIKQVPVIYDVLKQTPGERSATDAFTDLANALK
                     AAAMGNQPAAGIRGKG"
     gene            346608..347159
                     /locus_tag="USDA257_c03050"
     CDS             346608..347159
                     /locus_tag="USDA257_c03050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48903.1"
                     /translation="MTDNDADEIVRQRRRDAKMPLTDKVLGAIGLAMAAFATFFPWYA
                     FLHQDQFSIPPLWQGTTRDLPERPGRGVVSVSPLAMTDVDEETAAAIDRLTTATVPGL
                     EHQPAAAAGEPEAGLEQPFPEPSGFKLMHVANGRALIEDATGMYIVRIGSVLPDNSRL
                     ATFEERNGRWVMITSKGEVYQAN"
     gene            347341..347721
                     /gene="flgB"
                     /locus_tag="USDA257_c03060"
     CDS             347341..347721
                     /gene="flgB"
                     /locus_tag="USDA257_c03060"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein FlgB"
                     /protein_id="AFL48904.1"
                     /translation="MDPIQLFDLASRQAQWLTVRQNVVAGNIANANTPHYKAKDVQPF
                     ESVLQNTGIQMAATHRAHFTESPDAAQVTDVSMIDDVAVQQSGNTVALEQEMMKTGEI
                     KRDYELNSGLVKSFHRMMLMTVRK"
     gene            347726..348145
                     /gene="flgC"
                     /locus_tag="USDA257_c03070"
     CDS             347726..348145
                     /gene="flgC"
                     /locus_tag="USDA257_c03070"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein FlgC"
                     /protein_id="AFL48905.1"
                     /translation="MDPLTSALKVSASGLQAESTRLRVVSENIANARSTGDVPGADPY
                     RRKTISFAAEVDRASGASLVEIQRLGTDDSEFTIEFDPGNPAADERGMVKMPNVNVLI
                     EMADMRESNRAYEANLQTIKQSRDLISQTIDLLRASQ"
     gene            348145..348480
                     /gene="fliE"
                     /locus_tag="USDA257_c03080"
     CDS             348145..348480
                     /gene="fliE"
                     /locus_tag="USDA257_c03080"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-basal body complex protein FliE"
                     /protein_id="AFL48906.1"
                     /translation="MIDAIQSVGAFSTLKEAEGTSPVASTALSLPSAGASAPQSQSFA
                     DMLGNMTTDAIRSMKSAEGVSLQAIRGEANTREVVDAVMSAEQSLQTALAIRDKVVTA
                     YLEIARMQI"
     gene            348492..349280
                     /gene="flgG"
                     /locus_tag="USDA257_c03090"
     CDS             348492..349280
                     /gene="flgG"
                     /locus_tag="USDA257_c03090"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein FlgG"
                     /protein_id="AFL48907.1"
                     /translation="MKALSIAATGMNAQQLNLEVIANNIANINTTGYKRARAEFSDLL
                     YQTERAQGVPNRSNQAIVPEGAIVGLGVQTAAVRNLHVQGSLVNTSNDLDLALVGRGW
                     FQVETPNGETVYTRSGAFNTNATGQLVTIDGYTVVPGITVPQDATEITVSASGQVLVR
                     IGDATETQEIGQLTIANFVNEAGLEPQGENLFKQTAASGEPIVGTPADPGFAQVKQGY
                     LESSNVDPVKEITDLISAQRAYEMNSKVIQAADEMAATVSKNLR"
     gene            349299..349808
                     /gene="flgA"
                     /locus_tag="USDA257_c03100"
     CDS             349299..349808
                     /gene="flgA"
                     /locus_tag="USDA257_c03100"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FlgA"
                     /protein_id="AFL48908.1"
                     /translation="MMFRRSAKTAAIESGSGRLKRSLASAAIAAALLSPALVSAQQPT
                     AVIPKQTIYPGETIEASMLEVVDVTNPDLADGYVGSLHEVEGKVTKRTLLPGRVILAS
                     ALRDRFAVERGSTVRLIFSNGGLTITASGSPLQDAAVGELIRARNIDSGVIVSGTVMA
                     DGTIHVVAK"
     gene            349805..350920
                     /gene="flgI"
                     /locus_tag="USDA257_c03110"
     CDS             349805..350920
                     /gene="flgI"
                     /locus_tag="USDA257_c03110"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar P-ring protein FlgI"
                     /protein_id="AFL48909.1"
                     /translation="MTMRVSKWLLTFALLFAATLTPAHAASRIKDVASLQAGRDNQLI
                     GYGLVVGLQGTGDSLRSSPFTDQSIRAMLQNLGISTQGGESRTRNVAAVLVTATLPPF
                     ASPGSRVDVTVGSLGDATSLRGGTLVMTSLSGADGQIYAVAQGSIVVTGFSAQGDAAT
                     LSQGVTTAGRVPNGAIIERELPSKFKDGFNLVLQLRNPDFSTAVGMAAAINKFAAAQF
                     GGRIAEALDSQSVLVQKPKMADLARLMADIENLVVETDVPARVVVNERTGTIVIGQDV
                     RVAEVAVSYGTLTVQVTETPTVVQPAPFSRGETAVEPNTTIEAQSDGGTVAILNGSSL
                     RSLVAGLNSIGVKPDGIIAILQSIKTAGALQAELVLQ"
     gene            350917..351456
                     /locus_tag="USDA257_c03120"
     CDS             350917..351456
                     /locus_tag="USDA257_c03120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48910.1"
                     /translation="MTGILNHLLGRSRRTLMAAAGAALMLAMPGAFAQDVTAPPAENA
                     AANEVQQFCTNIADAARDQRYLLQRKELETLQASVDERIATLEKRRAEYEDWLKRRND
                     FLKQAELGLVDIYKTMKPDAAAGKLEMVRPEIAAAIVMKLPPRQSSLILSEMSDEKAA
                     VLTNIISSASDPNTSKEPS"
     gene            351453..352163
                     /gene="flgH"
                     /locus_tag="USDA257_c03130"
     CDS             351453..352163
                     /gene="flgH"
                     /locus_tag="USDA257_c03130"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar L-ring protein FlgH"
                     /protein_id="AFL48911.1"
                     /translation="MRMQLTAALAASLLAGCQNQAFKEIGQAPAMSPIGSGLQYTQAP
                     QLAMYPKQPHQMTAGYSLWNDQQAALFKDARAINVGDILTVDIRIDDKASFNNETDRS
                     RTNSSGFNLGAAGESQTSDFEWSGNLKYGSNTKTEGDGKTERSEKLRLLVAAVVTGVL
                     ENGNLLISGSQEVRVNHELRILNVAGIVRPLDVDADNIISYDRIAEARISYGGRGRLT
                     EVQQPPYGQQIVDLISPI"
     gene            352175..352663
                     /gene="fliL"
                     /locus_tag="USDA257_c03140"
     CDS             352175..352663
                     /gene="fliL"
                     /locus_tag="USDA257_c03140"
                     /codon_start=1
                     /transl_table=11
                     /product="putative flagellar basal body-associated protein
                     FliL"
                     /protein_id="AFL48912.1"
                     /translation="MEEIDSKQSKSPSLVMTIAAVAVLTLVAGGGGWLVGALLAPPPA
                     QKTEAAEVPPDATGEEDIPKIATEANGVVQLEPITTNLAYPAENWVRLEVALQFEGAP
                     DVALAEEIHQDIAAYLKTVSLQQIQGPRGFQYLRDDIQERVDLRSDGRVTNVMFRTFV
                     IQ"
     gene            352671..353408
                     /gene="fliP"
                     /locus_tag="USDA257_c03150"
     CDS             352671..353408
                     /gene="fliP"
                     /locus_tag="USDA257_c03150"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthetic protein FliP"
                     /protein_id="AFL48913.1"
                     /translation="MLRIAAFIIAMMAMSGIAGAQSFPADILNTPVDGSVASWIIRTF
                     GLLTVLSVAPGILIMVTSFPRFVIAFAILRSGMGLATTPSNMIMVSLALFMTFYVMAP
                     TFDRAWRDGIDPLLKNEISETEALTRVSEPFREFMLANTRDKDLQLFIDIAREKGQTV
                     VVDDKVDLRAVVPAFMISEIRRGFEIGFLIMLPFLVIDLIVSTITMAMGMMMLPPTSI
                     SLPFKILFFVLIDGWNLLVGSLVRSFT"
     gene            353693..354601
                     /gene="flaA"
                     /locus_tag="USDA257_c03160"
     CDS             353693..354601
                     /gene="flaA"
                     /locus_tag="USDA257_c03160"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin A"
                     /protein_id="AFL48914.1"
                     /translation="MASILTNSSATAALQTLRSISSSMEDTQNRISTGMRVGSASDNA
                     AYWSIATTMRSDNAALSSVTDALGMGAAKVDTAYAGMEAAIDVVKEIKAKIVAATEEG
                     VDGAKVQEEIDQLQDQLLSIAESASFNGENWIAGEAATKTVVTGFVRASDGTVSIKTS
                     SYALTDAADGTLLFADDGAGGLDTATGILGTDGTNGNNVYGLDISAMDATALGEALSD
                     VEDALTAMTSAASSLGSMSTRIDLQADFVSELSDSIENGIGRLVDADMNEESTRLKAL
                     QTQQQLAIQALSIANSDSQNILSLFR"
     gene            354628..354750
                     /locus_tag="USDA257_c03170"
     CDS             354628..354750
                     /locus_tag="USDA257_c03170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48915.1"
                     /translation="MPHRWKRAATEPGRGFFAFFFLLQHSLTILLFPKAIETAG"
     gene            354850..355770
                     /gene="flaC1"
                     /locus_tag="USDA257_c03180"
     CDS             354850..355770
                     /gene="flaC1"
                     /locus_tag="USDA257_c03180"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin C"
                     /protein_id="AFL48916.1"
                     /translation="MTSILTNIAAMSALETLRSIGNNMETTQGRVSSGLRVGEASDNA
                     AYWSIATTMRSDNMALSAVQDALGLGAAKVDTAYAGMESAIEVVKEIKAKIVTATEEG
                     VDKAKVQEEIDQLQEQLLSIAESASFSGENWIGGVAGNTVTVVSGFVRASDSTVSVKT
                     TSYALVDGVSGGNLLFSDDGTGALDTATGILGTAGASAGGYDVYSLDISALATADMND
                     VLSDVDDALSAMTSAAAELGSISMRIGLQEDFVAKLSDSIDSGVGRLVDADMNEESTR
                     LKALQTQQQLAVQSLSIANSNSENVLQLFR"
     gene            356086..357003
                     /gene="flaC2"
                     /locus_tag="USDA257_c03190"
     CDS             356086..357003
                     /gene="flaC2"
                     /locus_tag="USDA257_c03190"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin C"
                     /protein_id="AFL48917.1"
                     /translation="MTSILTNTAAMAALQTLRAIDDSMETTQARVSSGLRVGEAADNA
                     AYWSIATTMRSDNMALSAVQDALGLGAAKVDTSYAAMESAIEVVQEIKSKIVAATEEG
                     VDKTKIQEEIDQLQEQLMSIAESASFSGENWVAGDAAVKSVVSGFVRASDGTVSVKTT
                     TYTLDDTATGNLLFGGDGAGAIVDTNGILGTTGGATIGVSIYALDITGFDTTEMAEAL
                     TLVEDGLQAMTSAASELGSISMRIGLQEEFVAALTDSIDSGIGRLVDADMNEESTRLK
                     ALQTQQQLAVQSLSIANTNSENILQLFRQ"
     gene            357320..358282
                     /gene="flaC3"
                     /locus_tag="USDA257_c03200"
     CDS             357320..358282
                     /gene="flaC3"
                     /locus_tag="USDA257_c03200"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin C"
                     /protein_id="AFL48918.1"
                     /translation="MTSIMTNAAAMAALQTLRSINRNLDETQSRVSSGYRVETAADNA
                     AYWSIATTMRSDNAALSTVQDALGLGAAKVDTAYAALDTVIDLMSEVKAKLVAAREPG
                     VDKSKIDKEISQLKDQLVSAAQSASFSGENWLYNDASAAVGTKSIVASFNRSADGSVS
                     VTTLDYDTSGSILVDVQDASRGLLTMAVDADALTSAPTGTAREYYLIDAGSPPAGTEI
                     ALSDATTDSELDDMISVVDDLVSQLTDSAATLGAITSRIEMQENFVANLMDVIDKGVG
                     RLVDADMNEESTRLKALQTQQQLGIQSLSIANTNSENILRLFQE"
     gene            358310..358426
                     /locus_tag="USDA257_c03210"
     CDS             358310..358426
                     /locus_tag="USDA257_c03210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48919.1"
                     /translation="MLRTPFHFRRAAVIGIRRDWLDRAVALARSNTFIFAQV"
     gene            358528..359343
                     /locus_tag="USDA257_c03220"
     CDS             358528..359343
                     /locus_tag="USDA257_c03220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48920.1"
                     /translation="MRIENAGPVADESDEDRRRHYRRVRRFGFLDHAAAPACRAERAD
                     IGCEPSGEPPMSASLSRYLKDFSAPKIELTRMTPKYFPDLEADFPAADRSPQRPTMPE
                     IDVEAERREAFVQGRAEAAAELTLEHQRELAELKARHAEELDAVKHRLAEETASKLAA
                     GFAEITERLALALGDQTARVLAPVMEEALIKRAVEDLATMIRQGIGAGEGLTITVKGS
                     PVLFEALKQHMDDDMLAFRHVATDDIDLTVEMGEAVLVTRMAAWSETVRKVLA"
     gene            359340..360545
                     /gene="motB"
                     /locus_tag="USDA257_c03230"
     CDS             359340..360545
                     /gene="motB"
                     /locus_tag="USDA257_c03230"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein motility protein B"
                     /protein_id="AFL48921.1"
                     /translation="MSDESPHNGRNEIIIVKRSGDGHDGHHGGGWKIAYADFMTAMMA
                     FFLVMWLINAANEETKAAIASYFNPVQLTDQKPAEKGLKNPAKDAQGEETQQRSKADG
                     AQAKSGGSAKTGDQLTATSGEETKYSDADFFENPYSVLSEIAREVGRQANISVRGEGG
                     AAQSGPATGADGGEAYRDPFDPDFWTKQVEVKDAGNATESEVAAAVKDAAQADAAQVA
                     PPSDTLARTADAAAKGEMPLNEKPEAQEQQKAAEALKAEIEKAIGGEAGRLLEGLVVT
                     PSEGGLLVTISEQTDAPMFAVGSAVPQKELVLAMEKIGKLLGERQGAVAIRGHTDGRP
                     FKDGTYDNWRLSAARAQSAYYMLVRGGLEEERVNQISGFADRRLQVANDPYAAANRRI
                     EILLQSGQG"
     gene            360551..361858
                     /gene="motC"
                     /locus_tag="USDA257_c03240"
     CDS             360551..361858
                     /gene="motC"
                     /locus_tag="USDA257_c03240"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein MotC"
                     /protein_id="AFL48922.1"
                     /translation="MLKRLRAILATSVLAAPLAIGLAHAGETEELAPFKMVRSLQYVQ
                     DSVVLGDHSAIEMQRFMLGEIDKRLRAAEETTFRDPRNVDAALVYVMSGGNPETLDYL
                     TDRDVEGNFDARVTDALRQYLRGKGPLIVENLSKAAPEYKNSRVGPYLFLILGNATSQ
                     QDPVAAMKFYDWARLTAPGTIIEEAALRRSVSLAARAGDPGRGFRYALTYARRYLTSP
                     YASQFADVFVDLAVANFDGAVEQKVSEILAFMDEARQREVYLRVARRAAIGGNQTLAR
                     LASSRAEELARDGGGQSQLLASFYEGLAAVPSEDVFTAAQTLAAIPDEKLSPRDRALR
                     EAARAIAEEVVRLPQDESPAQASMPIPEVDIGATSDGGETGETGSGMSPFAKAGDTVP
                     APDDEPPVSAETAAASDPALDGFMANGRSKIKEIDALLAEEGL"
     gene            361855..363318
                     /gene="motD"
                     /locus_tag="USDA257_c03250"
     CDS             361855..363318
                     /gene="motD"
                     /locus_tag="USDA257_c03250"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein MotD"
                     /protein_id="AFL48923.1"
                     /translation="MRPLEETFRAPAAAIGARSGSRQGGNEQAAGEPGAFESAIADAG
                     RQKASNQAVAQDPGQGAVDSLADGAQASAAEFTLGNGQAGVLMASTVTGAGRLSTPSV
                     QGGGQAEAEGALQKDQTSSELGALREDGNRQRSAGKASVKSDEAGEPDGTAVTVKPKG
                     HAPAESGATETVEARATSEGDTSSAAPPNGSVSDLLTLLAGNAPPVTDIQITDKTTPT
                     TGDRAAAAEIVNVTVDAAAGGSDSRTEQQDDIGSDRLFRFARADGKGQAVSMTISADG
                     EATAVENSRSSANAKAETVTVLEARRYLGIAMNDNSASVTGAIAGDGEWAQALQSSAV
                     SAQPEALRQAGKTLNTLKIQMHPIELGTVTATLRLKDDELQVELKVETGEAFRQLRDD
                     QGEMVKALRAQGFAVDQVNVVFNAGGDASNGSGSQPQAQSQLGQSGRERAGDDGGQGR
                     QRQNGGEAAMIETWRGNDGTDDASGSVERARTGHVYM"
     gene            363254..363820
                     /locus_tag="USDA257_c03260"
     CDS             363254..363820
                     /locus_tag="USDA257_c03260"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lytic transglycosylase-like protein,
                     catalytic"
                     /protein_id="AFL48924.1"
                     /translation="MMERTMRLAALSALALVTSTCSALASAGICEREIASAAAKYGIP
                     AGILYSVGLTETGRKGSLQPYAMNIEGKAYFGTSVQDVLSRFGAARAQGAKLIDLGCM
                     QVNYHFHGEHFSSPGEMLDPRKNVDYAARFLSNLRARHESWTMAVARYHAGPNNDPAQ
                     KKYVCRVIANLVATGYGKWTPNAAQFCQ"
     gene            364093..364764
                     /gene="ftcR"
                     /locus_tag="USDA257_c03270"
     CDS             364093..364764
                     /gene="ftcR"
                     /locus_tag="USDA257_c03270"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar transcriptional regulator FtcR"
                     /protein_id="AFL48925.1"
                     /translation="MIVVVDERELVKNGYASLFGREGIPSTGFDPKEFGEWVNTAADS
                     DIDAVEAFLIGQGESAFSLPRAIRDRSQAPVIAMSETPSLENTLALFDCGVDDVVRKP
                     VHPREILARVAAIRRRLKAIANYTDIGPIRVFADGRDPEINGDVFALPRRERRILEYL
                     VANRGRRVSKSQIFNAIYGIFDEDVEENVVESHISKLRKKLRKKLGFDPIDSKRFLGY
                     CIDWS"
     gene            364855..366069
                     /gene="flgE"
                     /locus_tag="USDA257_c03280"
     CDS             364855..366069
                     /gene="flgE"
                     /locus_tag="USDA257_c03280"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook protein FlgE"
                     /protein_id="AFL48926.1"
                     /translation="MSLYGTMRTGVSGMNAQANRLSTVAENIANSSTAGYKRASTEFS
                     SMILPSSNGSYNSGGVETSVRYSISDQGSTTYTTSASDLAIDGDGFFIVQGANGQEYL
                     TRAGAFVQDDAGNLVNAAGFTLMGYEYEAGVDPTVVVNGFDGLTEVNLASEGLTAAGS
                     TAGSMGANLPSGAANGDVSTTSLIVYDSQGNTRILDFNYTKVADNQWELEIVDRTSAL
                     SLGTATLDFDSAGALITSPATLTLDPTALNPISGTGAELNAITIDFSETTQLGTSFTP
                     DGGSIDGNAPSKVSGYQIDTDGVVYIKYANGELEPRYRIALANVQSPDKLVPESGNVY
                     SQGVDSGVIVTGFAGSGSFGEILSGALESSNVDIADELTSMIESQRNYTANSKVFQTG
                     SELLEVLVNLKR"
     gene            366091..367521
                     /gene="flgK"
                     /locus_tag="USDA257_c03290"
     CDS             366091..367521
                     /gene="flgK"
                     /locus_tag="USDA257_c03290"
                     /codon_start=1
                     /transl_table=11
                     /product="putative flagellar hook-associated protein FlgK"
                     /protein_id="AFL48927.1"
                     /translation="MSLSSAIAIAQSAFSTTASQTATVSKNVANASNADYSRRMAMLG
                     TTSDGAQIVSIYRAQNEALLKQNLTSISQSSAQSSLLSGLELLKSALGGNDYETAPST
                     YLSAFRNSLQTFASTPGNSTIAATVVADASDLANSISTTATAVQDLRLDTDKQIAEEV
                     DNLNALLASFETVNNAVKQAMASGADATAALDERDKFLKQISELVGISTVTRADNDTV
                     IYTSDGIVLFETQARQVTFTATSAFDASTTGNAIFVDGVSLSAGTGADTTAQGKLASL
                     LQLRDDIAPTFQSQLDEMARGLVSLFQEDGGPGLFTWADGTVPADGTIEPGIAASLSV
                     NAAAQADPFLLRDGGFNGLVSNPGGATDPNSGYTDLLDGFITAMDGDINFDAAAGLDS
                     TSSIMEFAASSIGWFEQIRSAASTADDNKTALLARTEEALGNVTGVSIDEELSLLLDL
                     EQSYKASAKLISTVDAMMASLLEAVR"
     gene            367524..368576
                     /gene="flgL"
                     /locus_tag="USDA257_c03300"
     CDS             367524..368576
                     /gene="flgL"
                     /locus_tag="USDA257_c03300"
                     /codon_start=1
                     /transl_table=11
                     /product="putative flagellar hook-associated protein FlgL"
                     /protein_id="AFL48928.1"
                     /translation="MKTSFVSNLAVQNAMRLTIQQGQEELLKLQTEVSTGRHADVGLE
                     LGSSTARSVNLQRELARLETLVDTNSVVTQRLASSQEALGTMAEAAEQVRNTLVTFKG
                     NDSVDQLSVQKTEIESAMSLFTASANTSFNGEFLFAGINTDVKPFEDYAASGSAAKTT
                     FDDALATYMSANGISSMSDFDQAQMEDFITNTLEPLYTDDTQWATDWSAASSQNMTSR
                     ISTSEVVQSSTNATTTGFRMFALASVISSELMDEEIGSDVRAYIGEASLGYVEQAITG
                     LTAERSTLGISEARVEKANTSLEVQIKLINTHITDLEGVDTYDASTRMNTLLTQMETS
                     YTLTGRIQQLSLIDFL"
     gene            368614..368961
                     /gene="flaF"
                     /locus_tag="USDA257_c03310"
     CDS             368614..368961
                     /gene="flaF"
                     /locus_tag="USDA257_c03310"
                     /codon_start=1
                     /transl_table=11
                     /product="putative flagellar protein FlaF"
                     /protein_id="AFL48929.1"
                     /translation="MYQFAYAEIMEEGVAVSKDREWQVLNRSIALLEAAKQQKGYSKE
                     AIEAIYYTRRVWIRFIEDLRAPDNQLNDELRANLISIGIWILNETEKIRKRDSSNFQG
                     IIDITTIIRDGLK"
     gene            368958..369407
                     /gene="flbT"
                     /locus_tag="USDA257_c03320"
     CDS             368958..369407
                     /gene="flbT"
                     /locus_tag="USDA257_c03320"
                     /codon_start=1
                     /transl_table=11
                     /product="putative flagellum biosynthesis repressor
                     protein FlbT"
                     /protein_id="AFL48930.1"
                     /translation="MKSTLRISLKSGERIFVNGAVLRVDRKVAVEFLNDVTFLLENHV
                     LQPEDATTPLRQLYFIAQMILINPEGAEQSTAMFRKSIVMLLACFKNEEVLAELKRID
                     GLVTQGRAFEALKAIRGLYPVEERILNNQEITPATIDQIRKEIAPWR"
     gene            369398..369841
                     /gene="flgD"
                     /locus_tag="USDA257_c03330"
     CDS             369398..369841
                     /gene="flgD"
                     /locus_tag="USDA257_c03330"
                     /codon_start=1
                     /transl_table=11
                     /product="putative flagellar hook capping protein FlgD"
                     /protein_id="AFL48931.1"
                     /translation="MAVSGVSSSTSTSTTSTSSTSTSGTDAADATLNYQSFLKLLIAQ
                     MQNQDPTDPMDATEQISQLATFSQVEQSIKTNSNLESLLASESLTQASTYIGKTITSS
                     DGKTSGVVAEVEVTSDGVTAITTDGKEIAIETGITVSTTSSDSET"
     gene            370030..370296
                     /gene="fliQ"
                     /locus_tag="USDA257_c03340"
     CDS             370030..370296
                     /gene="fliQ"
                     /locus_tag="USDA257_c03340"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthetic protein FliQ"
                     /protein_id="AFL48932.1"
                     /translation="MNEADALDIVQAAIWTVIVASGPAVLAAMVVGVVIAFIQALTQV
                     QEMTLTFVPKILAVMVTAAISAPFVGAQISIFTDIVFSRIQSGF"
     gene            370408..372495
                     /gene="flhA"
                     /locus_tag="USDA257_c03350"
     CDS             370408..372495
                     /gene="flhA"
                     /locus_tag="USDA257_c03350"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhA"
                     /protein_id="AFL48933.1"
                     /translation="MAQQATLTIPKLAPKSRDVGFALGIVMILSILFLPIPPFLIDFG
                     LAFSIAFSVLILMVALWIQRPLDFSSFPTILLISTMTRLALNIATTRVILSHGHEGHD
                     AAGGVISGFASLVMSGDFVIGLIVFLILITVNFIVITKGATRIAEVGARFTLDAIPGK
                     QMSIDADLSAGLIDEKEAQRRRRELEEESSFFGAMDGASKFVRGDAIAGLIITAINVF
                     GGIIIGYLRHDMPIGEAADVFVKLSVGDGLVSQIPALIVSLAAGLLVSRGGTAGSTDQ
                     AVVGQLSGYPRALMVAAGLIVLLSVMPGLPFVPFAVLGGGMAFLGWAIPRQIEAANAE
                     KRAQEAEKAQQTKDSDRDSVKSVLKTAEIELLLGKQVSTRLLGAHQELAFRVGKMRRK
                     FALQYGLVVPEIKVSDDITIPDKAYHIRIHGTTIASNTVRVGEVLVVTGGGRRPSVPG
                     DEIREPAFGMPALSILETFTEDLKREGFHPIDNVSVVLTHLSEVIRNNLPQLLSYKDV
                     KVLIERLDPEYRKLADEICTSHMSYSGLQAVLKLLLAERVSIRNLHLILEAVAELAPH
                     VRKTEQIVEHVRVRMSQQLCGDLAENGVLRVLRLGSKWDMVFHQALKRDAKGEIVEFD
                     IDPRHLEEFSEQATKVIREHLDRGVPFVLVSSPESRSYVRMIIERLFATLPVLSHVEL
                     AKGLEIKIIGALS"
     gene            372492..373244
                     /gene="fliR"
                     /locus_tag="USDA257_c03360"
     CDS             372492..373244
                     /gene="fliR"
                     /locus_tag="USDA257_c03360"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthetic protein FliR"
                     /protein_id="AFL48934.1"
                     /translation="MITDPEGTVLALFAAFCRIGACIMIMPGFSTARVPMQVRLFIAV
                     ALSMAILPIMWADIYPEVAGKGHTYIYLIATETVIGAVIGLVARYYVLGLQFAGTAIT
                     MLIGFNSPPATDVLEETAENQLTSMISFAGLMLLFMLDFHHVIFEAIAQSYRAMPIGI
                     GFDPQGMLITLSNSLGQTFLIMLRLASPFIIYGLLFNVAIGMVNRLAPQVPIYFISQP
                     YLIMGGLFLFYLGVAAMLRLFADGFASVMQGG"
     gene            373257..373670
                     /locus_tag="USDA257_c03370"
     CDS             373257..373670
                     /locus_tag="USDA257_c03370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48935.1"
                     /translation="MKARSEKLKRLVDVQRHLERMAESELAETTRQRGVLAETIDVVV
                     DAMGSAHPMHRVFSGHYAAQLGRLVQKDQMLLGIQQVHEARMLKERAKGDRLEESMQE
                     ARLTEDREADDNQVLDLIDQHVAGYAPASGKVEGR"
     gene            373770..374321
                     /locus_tag="USDA257_c03380"
     CDS             373770..374321
                     /locus_tag="USDA257_c03380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48936.1"
                     /translation="MAISPPSDLVLDVVRAADPAEVQEAQARLKANRSAFQATSLAEN
                     GKGFAAAVSVLNSSEGSTGLGDISNRVEPKKVPETYRKFEAMVLQNFVKSMLPSESEN
                     VFGKGTSGEVWKGMMAEQIANVLADGGGIGIADRMAGSEMPERTNARLDDNTSNIAAG
                     MVQEYERKAISGFLSTDEKKNQA"
     gene            374390..374758
                     /locus_tag="USDA257_c03390"
     CDS             374390..374758
                     /locus_tag="USDA257_c03390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48937.1"
                     /translation="MEAVASHDLRIQNVLGRLEMIIDNENSRIGVDPKFDIKTSNAHK
                     SRCLYELTMLHRAAAPGEISPSFTSQTRHLRQKLKLNAQKVEAHLEAVRSVVDLLKTA
                     AQDADADGIYTEAQFRYSDF"
     gene            374758..375324
                     /locus_tag="USDA257_c03400"
     CDS             374758..375324
                     /locus_tag="USDA257_c03400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48938.1"
                     /translation="MLKLVLTGVWVCAVTLGSVYFSMQYASAPVLSDAEADRRASEEY
                     VPGEIITIPVIEDGAVQGYFLAKLSFSATREGIAKLHAPLRQVVTDELYDMLVGSKFV
                     NLADTGTFDLASFKGAVKDGLNKKLGSEVVTEVLVEQLEYLGKDDVKRAANGENRPYQ
                     EPVPVVDRNGKVAGDKIPEGAVKATSGH"
     gene            complement(375351..376340)
                     /locus_tag="USDA257_c03410"
     CDS             complement(375351..376340)
                     /locus_tag="USDA257_c03410"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glycosyl transferase family 2"
                     /protein_id="AFL48939.1"
                     /translation="MQPTGQDISIHFQTELENPADIELVVVLPTFRRPDHLIKTLKTI
                     VSQRPDVACATVVVENDPDASAGAEAAKAFFLEHRSDSTVIVAHRRGHSHACNAGLET
                     ALDLYPNLRALAVIYDDAVAAPEWLDGLIAVQEGHGADIVGGPQLPVFEDPDGQKWKH
                     HPIFSPHYDATGPVPRLYSAGNVLITRAVLDAMPRPFLNPALNFVGVSDGDFFNRCRA
                     KGFSFAWAAEAWVAETVPPEHTTASWIRARSLEQGAISTLLEHQRDATFTGRLRTLGK
                     SMALLAASLPLGLKLWAKTGLATASLYHFHVAIGRLTASIGFAGEQFRSAGES"
     gene            376720..377619
                     /gene="folD1"
                     /locus_tag="USDA257_c03420"
     CDS             376720..377619
                     /gene="folD1"
                     /locus_tag="USDA257_c03420"
                     /EC_number="1.5.1.5"
                     /EC_number="3.5.4.9"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional protein FolD"
                     /protein_id="AFL48940.1"
                     /translation="MTTVIDGKAVAASVIETVKSATKTLETEAGVRAGLAVVIVGDDP
                     ASHAYVSAKSRMAKECGFLSVQHTLLKETSQEELAALVAELNADPSIHGILVQLPLPK
                     HLQSEPIIQSILPEKDVDGLHVVNAGKVATGDLDGGLVSCTPAGAMVFVRRTHGDDLS
                     GLNAVVIGRSNLFGKPMSALLLAANATVTTAHSRTKDLPTVCRNADILVAAVGRPEMV
                     RADWVKPGALVIDVGINRVPAPERGEGKTRLVGDVAFEECAKVASVITPVPGGVGPMT
                     IAMLMANTIIAAYRKAGRKPPKF"
     gene            complement(377624..378655)
                     /gene="aglR1"
                     /locus_tag="USDA257_c03430"
     CDS             complement(377624..378655)
                     /gene="aglR1"
                     /locus_tag="USDA257_c03430"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator AglR"
                     /protein_id="AFL48941.1"
                     /translation="MAVNLKQLAEILGLSQTTVSRALNGYPEVNADTRQRVLQAVRET
                     GYRPNRAAQRLATGKAYSIGLVMPIAPGIDSDIHFGEFLAGLAEEALKHDFHFVLNPS
                     APDDEEATFRRLAASGNVDAVFLAYMRANDPRIAMLKALSIPFVVHGRSIGGSRDYPF
                     LDIDNTQAFYDATRLLLQLGHHRIALINGPEYLAFSIRRKKGVTRALQEWGLGLDEEL
                     VHHSVMADEYGYRSMQSFLERPDPPTAVLCSSTVLALGAVRAINRAGLVIGSDISIIA
                     HDDVLPMLKPENFSVPLTTTRSSLRAAGARIATRLISGIIGRGDYPQQELWRAELIVR
                     ASTGPAPGR"
     gene            378952..380310
                     /gene="aglE"
                     /locus_tag="USDA257_c03440"
     CDS             378952..380310
                     /gene="aglE"
                     /locus_tag="USDA257_c03440"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-glucosides-binding periplasmic protein
                     AglE"
                     /protein_id="AFL48942.1"
                     /translation="MKRSLLIGVAALALLAGTAGAADLKFKPGEDSKFNWGSFEEFKK
                     GHDLKGQTLTIFGPWRGEDEALFKSVFAYFVEATGVEVKYSSSENYEQQIVIDTQAGS
                     PPDVAILPQPGLIADLAAKGLLTPLGDETKQWLLDNYAAGQSWVDLSTYNGKDGTAAL
                     YAFPYKIDVKSLVWYVPENFEDAGYEVPKTMEELKALTEKIAADGEKPWCIGLGSGGA
                     TGWPATDWVEDLMLRTQSPEVYDKWTKNEIPFTDPAVIGALDEFGWFARNDKFVDGGA
                     AAVASTDFRDSPKGLFASPPKCYLHHQASFIPSFFPEGTVVGEDADFFYMPPYESKKE
                     LGNPVLGAGTLAMITKDTPAARAFIDFLKTPIAHEVWMAQTSFLTPYKSVNVDVYGNP
                     PLKKQGEILLNATTFRFDGSDLMPGKIGAGALWTGMVDFVGGKSSADVAAGVQKAWDA
                     IK"
     gene            380460..381467
                     /gene="aglF"
                     /locus_tag="USDA257_c03450"
     CDS             380460..381467
                     /gene="aglF"
                     /locus_tag="USDA257_c03450"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-glucoside transport system permease
                     protein AglF"
                     /protein_id="AFL48943.1"
                     /translation="MQLLAAILTMIAGVLACAAYFWATSLILDWIFPSKGLSGAAASR
                     NLRITNAIRPWLFLAPALFALTIYLIYPVVQSVWLSFHDRGGQNFVGARNYNWMITDG
                     EFRQSIFNNFLWLLVVPALSTFFGLIIAALTDRIWWGNIAKTLIFMPMAISFVGAAVI
                     WKFIYDYRAEGSEQIGLLNAIVVAFGAAPQAWITLPFWNNFFLMVILVWIQTGFAMVI
                     LSAALRGIPEETIEAAVIDGANGWQIFFKIMVPQIWGTIAVVWTTITILVLKVFDIVL
                     AMTNGQWQSQVLANLMFDWMFRGGGDFGRGAAIAVVIMILVIPIMIWNIRNATKEAGG
                     H"
     gene            381469..382617
                     /gene="aglG"
                     /locus_tag="USDA257_c03460"
     CDS             381469..382617
                     /gene="aglG"
                     /locus_tag="USDA257_c03460"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-glucoside transport system permease
                     protein AglG"
                     /protein_id="AFL48944.1"
                     /translation="MNPSTRSPLTWAVHLSVLLLVVLWTMPTAGLLISSLRDKDQLAV
                     SGWWTALATSSRNDVARAPSAENQVERDGRFVISGNLLEGQGGGQVSAFGFSSREPGK
                     FKPGETAELNDGERLTVQADGSFEIVSDKKMEGSRGQRIFYTASTPPRFTIDNYIEVL
                     SAAGIGTSFLNSLTVAIPSTVIPILIAAFAAYALAWMPFPGRAILLAVVVGLLVVPLQ
                     MSLIPLLQLYNGVGAFLGVPAKTYLGIWLAHTGFGLPLAIYLLRNYMAGLPREIMESA
                     RVDGASDFDIFVKIILPLSFPALASFAIFQFLWTWNDLLVAIVFLGAGEDNLVLTGRL
                     VNLLGSRGGNWEILTASAFITIVVPLIVFFTLQRYLVRGLLAGSVKGG"
     gene            382647..384302
                     /gene="aglA1"
                     /locus_tag="USDA257_c03470"
     CDS             382647..384302
                     /gene="aglA1"
                     /locus_tag="USDA257_c03470"
                     /EC_number="3.2.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="putative alpha-glucosidase AglA"
                     /protein_id="AFL48945.1"
                     /translation="MNMTETSKAVLAADKDWWRGAVIYQIYPRSFQDTNGDGIGDLKG
                     ISARLPHVAALGADAIWISPFFTSPMRDFGYDVSNYTDVDPIFGTLKDFDQLIAEAHR
                     LGLRVMIDLVLSHTSDQHPWFVESRSSRSNGKADWYVWADSKPDGTPPNNWLSIFGGS
                     AWAWDPTRLQYYLHNFLTSQPDLNLHNAQVQEALLAVERFWLERGVDGFRLDTINFYF
                     HDRELRDNPALAPARRNASTAPAVNPYNYQEHIYDKNRPENLDFLRRFRAVMEEFPAI
                     AAVGEVGDSQRGLEIAGEYTSGGDKVQMCYAFEFLAPDALTPERIAEVLRDFQKVAPE
                     GWACWAFANHDVVRHVSRWGTGVADHVGHAKLLASLLMSLRGSVCIYQGEELALPEAE
                     LAYEDLQDPYGIQFWPDFKGRDGCRTPMVWESLPDGGFSSAKSWLPIPEAHLPQAVAV
                     QEGDPASVLEHYRRFLHFRKAYPAFAKGDIEFVETRAPLLGFIRTHGNERLFCLFNMS
                     EEPAAADLPEGAIEPLEGHGFISDIRDNKISLPAWGAFFARLA"
     gene            384323..385411
                     /gene="aglK1"
                     /locus_tag="USDA257_c03480"
     CDS             384323..385411
                     /gene="aglK1"
                     /locus_tag="USDA257_c03480"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-glucoside transport ATP-binding protein
                     AglK"
                     /protein_id="AFL48946.1"
                     /translation="MTGLLLKDIRKSYGAVDVIHGINLDIKQGEFVVFVGPSGCGKST
                     LLRMIAGLEEITGGDMYIDGERVNEVPPSQRGIAMVFQSYALYPHMTVYDNMAFGMRI
                     AKESKEEIDRRVRAAAEMLQLTKYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEP
                     LSNLDAALRVATRIEIAKLSERMADTTMIYVTHDQVEAMTLADRIVVLSLGHIEQVGA
                     PLELYERPANLFVARFIGSPAMNVIPSTITATGAQTTVTLAGGKSVTLDIPTNASEAG
                     KKASFGVRPEDLQATEGQDFLFEGTIAIVEALGEVTLLYIEGLVENEPIIAKIPGILK
                     VGRGDKVRFTADKAKLHLFDADGRSYRV"
     gene            385565..385975
                     /locus_tag="USDA257_c03490"
     CDS             385565..385975
                     /locus_tag="USDA257_c03490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48947.1"
                     /translation="MSGAAPVMPRHFLNKEESFMYDREANFPMEDTRNDARIEFTERG
                     MQNLSSRRCEIIKLSKSSAVIGIVTKFQLPQNFYLDIPSARIPLIGCLLKRIHANNLV
                     EARFLRLLSDRDLNRIFVYSTHPHHRNRTLDIYR"
     gene            386019..386384
                     /locus_tag="USDA257_c03500"
     CDS             386019..386384
                     /locus_tag="USDA257_c03500"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48948.1"
                     /translation="MQRPYRLSCHCREIAIEVDAELSRLVECNCSTCRRSGFLHWKVD
                     AAAIRLVTEKRRMSTYIWRGITEGHHFCPTCGTAIMRSGYPGGRVSLNARCVEGVDVF
                     TLDVERYDGRNDMPPGPQP"
     gene            386509..386868
                     /locus_tag="USDA257_c03510"
     CDS             386509..386868
                     /locus_tag="USDA257_c03510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48949.1"
                     /translation="MNVQKIYTALLTADLAAAEGWYTKLLGRGPDYRPMETLVQWELF
                     GQGGVALSTDDEIAGRGVMFLVVDDVAAERRRLQGLGIMLGDDIEGDYSTLAQVRDPD
                     GNLLTLATPPSRPYPPA"
     gene            complement(386903..388765)
                     /gene="edd"
                     /locus_tag="USDA257_c03520"
     CDS             complement(386903..388765)
                     /gene="edd"
                     /locus_tag="USDA257_c03520"
                     /EC_number="4.2.1.12"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphogluconate dehydratase Edd"
                     /protein_id="AFL48950.1"
                     /translation="MKIKESEDSGTGCAMSADSRIAAITARIVERSKPYREPYLERIR
                     SAAANGPHRSVLGCGNLAHGFAVCSPAEKVALAGDRVPNLGIITSYNDMLSAHQPFET
                     YPALIRDAAREAGGVAQVAGGVPAMCDGVTQGQPGMELSLFSRDLIAMAAAIGLSHNM
                     FDAAVYLGVCDKIVPGLVIAALTFGHLPAVFVPAGPMTSGLPNDEKAKVRQLFAEGKV
                     GRDELLEAESKSYHGPGTCTFYGTANSNQMLMEIMGFHLPGASFINPGTPLRDALTKE
                     AAKRALAITAMGNEFTPAGEMIDERSIVNGVVGLHATGGSTNHTMHLVAMARAAGIVL
                     TWQDISELSDIVPLLARVYPNGLADVNHFHAAGGMGFLISQLLKKGLLHDGVRTVFGQ
                     GLEAYAIDVRLGENGTVRREPSPEESADPKVLSTIDEPFQHTGGLKMLTGNIGKAVIK
                     ISAVKPERHVIEAPAKIFNDQAELNAAFKAGKLEGDFIAVVRFQGPKANGMPELHKLT
                     TVLGILQDRGQKVAIVTDGRMSGASGKVPAAIHVTPEAKDGGPIARIQEGDIIRIDAV
                     KGTIEVKIEDIALKTRVPAHIDLSDNEFGMGRELFAPFRQIAGTADHGGSVLFR"
     gene            complement(388850..389548)
                     /gene="pgl"
                     /locus_tag="USDA257_c03530"
     CDS             complement(388850..389548)
                     /gene="pgl"
                     /locus_tag="USDA257_c03530"
                     /EC_number="3.1.1.31"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconolactonase Pgl"
                     /protein_id="AFL48951.1"
                     /translation="MSETLHLFENGAALAEGLADAVSARLAAAAAARGKASIAVSGGS
                     TPKAFFRALSERDLDWAKVTVTLVDERFVPPESDRSNHALVGANLLQDKAAAARFVPL
                     YHAAPTAEAAAAIASEKTAGIAAPFDVVVLGMGTDGHTASFFPGGTRLEEALDASTPR
                     GVITMEAGGAGETRLTFTFSSLQDAGYLVLHIEGEGKKEVLDRAKAAGEETKMPIRAV
                     LRRAASPLQIYWAP"
     gene            complement(389558..391033)
                     /gene="zwf"
                     /locus_tag="USDA257_c03540"
     CDS             complement(389558..391033)
                     /gene="zwf"
                     /locus_tag="USDA257_c03540"
                     /EC_number="1.1.1.49"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate 1-dehydrogenase Zwf"
                     /protein_id="AFL48952.1"
                     /translation="MSSQIIPVEPFDYVVFGGTGDLAERKLLPALYHRQIEGQFTEPT
                     RIIGASRAALTHEEYRRFASDALKEHLKPGEFDEAEVEKFTSRLYYVSVDAKSEQGWD
                     DLKKLLEEGRDRTRAFYLAVGPAIFGDISEKIRDHKLITKNTRIVVEKPIGRDLASAT
                     ELNDTIGKVFREEQIFRIDHYLGKETVQNLMALRFANALYEPLWNSAHIDHVQITVAE
                     SVGLENRAGYYDKAGALRDMVQNHILQLVCFVAMEAPTSMDAEAVRDEKLKVLRALKP
                     ITAANVEQVTVRGQYRAGASAGGPVKGYLEELEGGVSNTETFVAIKAEISNWRWAGVP
                     FYIRTGKRMAGRMSEIVITFKQIPHSIFDNSAGRISANQLMIRLQPNEGVKQSLMIKD
                     PGPGGMRLRNVPLDMSFAEAFGVRNADAYERLLLDVIRNNQTLFVRRDEVEAAWQWID
                     PILKAWETAGQQVQGYTAGTWGPSQAIALIERDGRTWNDTI"
     gene            complement(391195..392481)
                     /gene="ordL2"
                     /locus_tag="USDA257_c03550"
     CDS             complement(391195..392481)
                     /gene="ordL2"
                     /locus_tag="USDA257_c03550"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase OrdL"
                     /protein_id="AFL48953.1"
                     /translation="MAWQSPISPGISWYEATVPDRPAYPAMPGSRRADVAIIGGGYTG
                     LQAACNLAKGGADVTLIDACRFGDGASGRNGGQFGTGQRAWADEAEEMLGHERAQLLF
                     DMAENAKRYVLDFASEHGIDIEFVPGQLSVGHKKSFETDYRRHVEAMAERFGYSHLSF
                     MDREETVSRLGSSHYHFGIRDTGTGHIHPMKLLVGLARQAALAGANLYEQTKALKIEK
                     KGGAVVIETNRGTITAERALIACNAYIGNLEPVTASHVMPIRSFIGATPVLTDHPEIL
                     PGGESVDDSRFVVRYFRKTKDGRLLFGGREAYTADNPRDISSHIRRQIREIYPALADV
                     AIPHAWGGSVGITMPRQPFYREVMPGVTSIGGYSGHGVMLANYCGKLYADVALGRATE
                     LDLLNDLKIPAFPGGTRFRSALLFLALTWYALRDRI"
     gene            complement(392498..393934)
                     /gene="puuA"
                     /locus_tag="USDA257_c03560"
     CDS             complement(392498..393934)
                     /gene="puuA"
                     /locus_tag="USDA257_c03560"
                     /EC_number="6.3.1.11"
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamylputrescine synthetase PuuA"
                     /protein_id="AFL48954.1"
                     /translation="MTSKRSVVQQTAKVSKSSGVPLALHAPRGVKTWKDAVDWLKIRG
                     IEDIECITPDLAGVPRGKMMPTSKFTSNTSLALPSAIYRHTISGEYPEETGQFRYDSR
                     DSDIKLVPDLSTISIVPWESDPTAQVICDIAGSQGEQISYTPRNVLKRVVDLYRQKGW
                     KPVVAPEIEFYLVAQNDDPDYPLRPPKGRSGRSILGGQGYSIAGINEFDELIDDIYHF
                     SEKQGLEIDTLIHEEGPAQLEINLRHGDPIELADQVFLFKRTIREAALKHGIYATFMA
                     KPMQGQPGSAMHIHQSVIDIETGRNIFSSPDGSPSKEFFSFLGGMQHYVPKTLAMMAP
                     YVNSYRRLTPDMSAPVNTAWGYDNRTTAFRIPVSDPVARRIENRLPSSDANPYLALAA
                     SLGCGYLGIMEDLQPTPPSEDTANEGEIDLPRGLLEAISLLESAPSLAEVFSAEFIAI
                     YAGVKRGEFETFMQVISPWEREFLLLNV"
     gene            394146..395330
                     /gene="yhiN"
                     /locus_tag="USDA257_c03570"
     CDS             394146..395330
                     /gene="yhiN"
                     /locus_tag="USDA257_c03570"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein YhiN"
                     /protein_id="AFL48955.1"
                     /translation="MIEKQDVVIIGAGAAGMMCAIEAAKRGRRVVVIDHAKAPGEKIR
                     ISGGGRCNFTNIHAGPKNFLSDNPHFCKSALARYRPQDFVSLVERHGIAWHEKTLGQL
                     FCDHSAKDIIRMLLAEMKEAGAVLRLETAISAVERIASGFRVATSAGTIEAASLVVAS
                     GGKSIPKMGATGLAYKIAEQFGLPVVETRPALVPFTLDPAQLAKLGTLAGVAADAEVR
                     FGKVAFREAVLITHRGLSGPAILQVSSYWREGAEIVLRVMPDIDIASILKGMRRTSGR
                     QAAQTALADILPRRLAQFFAEEAKLAGRLLADLSDKAIDALSTSIQAWTLKPAGTEGY
                     RTAEVTLGGVDTRALDSRTMQSTSIPGLYFIGECVDVTGWLGGYNFQWAWASGFAAGQ
                     DV"
     gene            395552..395692
                     /locus_tag="USDA257_c03580"
     CDS             395552..395692
                     /locus_tag="USDA257_c03580"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48956.1"
                     /translation="MTQQRRRPRAIAIARADESRSQGELIAFAATFALFAIAASAIFS
                     SL"
     gene            complement(395798..395932)
                     /locus_tag="USDA257_c03590"
     CDS             complement(395798..395932)
                     /locus_tag="USDA257_c03590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48957.1"
                     /translation="MFFGDHAARAANPSAIIAGPHRSGGEDLTDSRLSHIGFERLRIL
                     "
     gene            396031..398556
                     /locus_tag="USDA257_c03600"
     CDS             396031..398556
                     /locus_tag="USDA257_c03600"
                     /codon_start=1
                     /transl_table=11
                     /product="putative chemoreceptor y4fA"
                     /protein_id="AFL48958.1"
                     /translation="MLIDRILARFKIQTKVLFFILPFVVSITAVGITGLYASGLLQGR
                     MEISNSVLQTLSGFKDVYAGMNHFLHETTEESRKAVQDTIAAQKQVLADTAAQVAGAS
                     GETELAAAIGATNDIEARIDGLWTLHEGEQKLRAATTANLERLAVEQLKVKGETDSLQ
                     YAVRKDENAAKTMLRNAEKLLRASRFYTEFATEVSKAVTVEEKLKVAQGLFPKISRTQ
                     RDIFVLLPKGEKSLAETVNSAAGAIGALIRSPAAPETLAGLSKYVDRFRNASFRLEAA
                     SVGKMREATQIFSELDGKIASTESVLTATRRLSVSITEIQIATAAFLGNPTEENRQKL
                     LDKILAVQANLTTLRGIAKDVSFFDATADAVVPIIDAMKKDSVALVEITDKRTAEFNA
                     AGASINEIWNDLTGFAEQQKVAAGTERQEANQISVAATVAGVVIALLAGIALTLTLKR
                     PIGQITAAMRRLADGMLDTAIDGDARRDEIGDMARALGVFKENALSKVRIEAESAEER
                     ARAEVERTRNDADKRELDRQIDLAVSELAAGLGRLAQGDLSQQIEVPFHGRLEQLRQD
                     FNGSLIRLQDTLAQIRGNAQAIQQGGANMHHSADALSQRTEAQAASLEQTAAAVDQIT
                     ATVRSSAERAHEANQAVSETKRSADSSATVVANAIAAMGRIEDASRQIEQIIEVIDDI
                     AFQTNLLALNAGIEAARAGEAGKGFAVVAQEVRELAQRSAEAAREIKGLINKSTDEVS
                     SGSLLVKETGAVLASISAQIVTVSQHVEMIATASRDQATALHEVNGSVNQMDQMTQQN
                     ASMVEEATATSRALATQADTLMMLVEQFRLEPESGAGQVYRAA"
     gene            complement(398648..398839)
                     /locus_tag="USDA257_c03610"
     CDS             complement(398648..398839)
                     /locus_tag="USDA257_c03610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48959.1"
                     /translation="MDMMAMAVLFDMASRNRRREDQFEPRSKGRRETFGEHMLAALFR
                     KPRPAERRDDCDGVPCIAP"
     gene            398928..399803
                     /locus_tag="USDA257_c03620"
     CDS             398928..399803
                     /locus_tag="USDA257_c03620"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, LysR family"
                     /protein_id="AFL48960.1"
                     /translation="MKNVDWDIYRCFMTVARGGGLTGAAQATGLSPATIGRRMLELEE
                     RTGRLLFIRSQTGYALTAEGRFLFEQLQEMEAAARKVESWQKEGEGATIVRIAAGTWG
                     SWLIAENFPAICTERDMFGISLSIGEARASLAYRESDIGIRAFEPEETYLASRPVGEV
                     AYAAYRQKNAPGGSDRWVAVAEEDALSAYLRWPHENASGRIVATVSRPRSLLDLARAG
                     AGKAVLPCFVGDLDPQLERAGDEIGPLRHRQWIVMNNEDRHRRDIRTVVDRMTRLLRS
                     HADLFAGKRPRRSAA"
     gene            complement(399984..400223)
                     /locus_tag="USDA257_c03630"
     CDS             complement(399984..400223)
                     /locus_tag="USDA257_c03630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48961.1"
                     /translation="MTVQTRVKERAEEQSSAMTPDQQAAIRMVANDLHRLNQSVMKAV
                     EAGVSVELVRSARHHGGDGNWGDLLIPVIVTQGRA"
     gene            complement(400345..401634)
                     /gene="aceA"
                     /locus_tag="USDA257_c03640"
     CDS             complement(400345..401634)
                     /gene="aceA"
                     /locus_tag="USDA257_c03640"
                     /EC_number="4.1.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate lyase AceA"
                     /protein_id="AFL48962.1"
                     /translation="MTDFYKPVPSAPQGRFDGIERPYSAADVQRLRGSVEIRYSLAEM
                     GANRLWKLIHEEDFVNALGALSGNQAMQMVRAGLQAIYLSGWQVAADANTASAMYPDQ
                     SLYPANAAPELAKRINRTLQRADQIETSEGRGLSVETWFAPIVADAEAGFGGPLNAFE
                     IMKAFVEAGAAGVHYEDQLASEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGTPTL
                     VIARTDAEAAKLLTSDIDERDQPFVDYDAGRTVEGFYQVRNGLEPCIARAVAYAPHCD
                     LIWCETSKPDLEQARKFAEGVHKVHPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGA
                     MGYKFQFITLAGFHQLNFGMFELARGYKDRQMAAYSELQEAEFAAEANGYTATKHQRE
                     VGTGYFDAVSLAITGGQSSTTAMKESTEHDQFLPAAQ"
     gene            complement(401743..401862)
                     /locus_tag="USDA257_c03650"
     CDS             complement(401743..401862)
                     /locus_tag="USDA257_c03650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48963.1"
                     /translation="MSLPLQNFRYSAFDNIYMFTAPHCQTQDKVTPFSLAMQE"
     gene            401863..403272
                     /locus_tag="USDA257_c03660"
     CDS             401863..403272
                     /locus_tag="USDA257_c03660"
                     /codon_start=1
                     /transl_table=11
                     /product="putative HTH-type transcriptional regulator"
                     /protein_id="AFL48964.1"
                     /translation="MAENKIFAGPRVRRIRNGLQLTQTAMAEALGISPSYLNLIERNQ
                     RPLTVQLLLKLASVYKVDLDELQGEAGGSLAQLREVFADPLLAGELPGDQELIEVTEA
                     APNVSGGVVKLYRAYREQASRLKDLAELLAGQGHMATLADTRLPIDEVRETFEARPNH
                     FARIEEAMEAFHASLSPGDDLAAALKAWLKREHGLVVRTLPVHVMPNLRRRFDRHSMR
                     LFISERLSPFDQTLEIAMEVASIACHEAIDAELDQIPFSTAEARRIGRFELARYAAHA
                     LMMPYAAFHAAAQRAKYDVDLLRARFQVSFEQAASRLTTLQRPGAAGISFFLMEIDNA
                     GHRLRRAGAQGFPHARFGGACPKLNIHAAFAVPGQILVDRVEMPDGGEFLTVARTVEG
                     PQAAFQERVRRTALLVGCDAGFAQETVYGAARLPAIAVGPVCRLCERQGCLARAEPPV
                     TRPLGLDEMATGLSVFDFQ"
     gene            403477..404571
                     /gene="potF"
                     /locus_tag="USDA257_c03670"
     CDS             403477..404571
                     /gene="potF"
                     /locus_tag="USDA257_c03670"
                     /codon_start=1
                     /transl_table=11
                     /product="putrescine-binding periplasmic protein PotF"
                     /protein_id="AFL48965.1"
                     /translation="MSKLIVAALAAAMLAGSATLASAQERVVNVYNWSDYIDDSILAD
                     FTKETGIKVVYDVFDSNEILETKLLAGGSGYDVVVPTAYFLQRQIAAGVFQKLDKSKL
                     PNLSNMWNVIMERTAQYDPGNEYAVDYMWGTTGIGYNVEKMKEILGSDEKPNWDVVFN
                     PEIAAKFKDCGIHLLDSPTDIIPSALAYLGLNPDSHEQADLDKAAELLLKVRPYIRKF
                     HSSEYINALANGDICLAVGFSGDIFQARDRAAEAKSGVTVDYSIPAQGAQMWFDMLAI
                     PADAPHVAEAHEFINYMMKPEVIAKASNYVFYANGNKASQQFLDKEVLEDTAIYPPEA
                     VMQKLFTVTPFEPKEQRILTRLWTKIVTGQ"
     gene            404699..405844
                     /gene="potG"
                     /locus_tag="USDA257_c03680"
     CDS             404699..405844
                     /gene="potG"
                     /locus_tag="USDA257_c03680"
                     /codon_start=1
                     /transl_table=11
                     /product="putrescine transport ATP-binding protein PotG"
                     /protein_id="AFL48966.1"
                     /translation="MMKSLGSIRRSFAPWADPASRPFISVKNVTKKFGDFIAVDDLSL
                     NIYTREFFALLGASGCGKSTLLRMLAGFEQPTSGEIILDGQNLAGIPPYRRPVNMMFQ
                     SYALFPHMNVETNIAFGLKQDGMPKPEIAERVAQMLKLVKLEKFAQRKPHQLSGGQRQ
                     RVALARSLAKRPKVLLLDEPLGALDKKLREETQFELMDLQQELGLTFVIVTHDQEEAM
                     TMADRIAVMSHGKVVQVATPAEIYEAPNSRFVADFIGDVNLFDGTVTAAEGGTVRVET
                     TGGIPVRMGSAEKVANGASAAVAIRPEKIRISRQAPAHAPVNAAEGEIWDIGYLGDMT
                     VFHVRLKDGKVVKASSLNAVRAVEDPLGYDQQVWISFGEDAGVVLKD"
     gene            405849..406760
                     /gene="potH1"
                     /locus_tag="USDA257_c03690"
     CDS             405849..406760
                     /gene="potH1"
                     /locus_tag="USDA257_c03690"
                     /codon_start=1
                     /transl_table=11
                     /product="putrescine transport system permease protein
                     PotH"
                     /protein_id="AFL48967.1"
                     /translation="MAKLASALVSRLVIIVPYAWLLFFFLIPFFIVFRISLSQTAIAM
                     PPYTPVLDLAGGLAGILEKAREFSVDNYVWLTEDALYFNAYLSSLTIAAVSTLLTLLI
                     GYPIAYGMAKAPRSIRPTLLMLVILPFWTSFLIRVYAWIAILKPEGLLNQFLITIGVI
                     DQPLIILNTNTAIYIGIVYSYLPFMVLPIYSALEKMDNALIEAAQDLGCTQISAFWRV
                     TFPLSLPGVVAGCLLVFIPAVGEFVIPDLLGGSETLMIGKTLWNEFNANRDWPVSSAV
                     ATVLLMILVIPIVYFQNVQAKADGEGR"
     gene            406764..407585
                     /gene="potI"
                     /locus_tag="USDA257_c03700"
     CDS             406764..407585
                     /gene="potI"
                     /locus_tag="USDA257_c03700"
                     /codon_start=1
                     /transl_table=11
                     /product="putrescine transport system permease protein
                     PotI"
                     /protein_id="AFL48968.1"
                     /translation="MEKWSRFNVASVVLGFGFLYLPIVLLVIFSFNESKLVTVWAGFS
                     TKWYSQLWHNQGLLDAAWVTIRVALLSATCATVLGTLAALALVRYTRFRGRVLFSGMV
                     YAPLVMPEVITGLSLLLLFVAIGLDRGFWTITLAHITFTMCFVAVVVQSRLLSFDQSI
                     EEAALDLGATPVRTFFAITLPVIAPAVFSGWVLAFTLSLDDLVISSFTTGPGATTLPM
                     KIYSQVRLGVTPEINAICTILIGIVALGVVVASIVTKRREVQREKDERAAFAAIG"
     gene            complement(407593..409518)
                     /locus_tag="USDA257_c03710"
     CDS             complement(407593..409518)
                     /locus_tag="USDA257_c03710"
                     /codon_start=1
                     /transl_table=11
                     /product="AsmA protein family"
                     /protein_id="AFL48969.1"
                     /translation="MGASLSRRRHFHVSCICPLQGLSKRFHRRRRPPTDMTRLIRKIS
                     RVLRLRLRRRHFVWSAAIGVVLAIGYNAALPLLVSTTGVRATMERTLDSWSGGKSRIN
                     GEPEIRFWPELLLTLPSATIESTGLEPRRLAEIGRITASFNPLSALLGDPTLEDISLV
                     DPIITIERQADGTINWQKPQWIAPPEAAAPAQESPIGDIAVVNGRVIVLDRMAAGNDV
                     DIPGISGTIKWPAFAERLSAQLSARLSGEEVAWAFVCEDPLAFFARRNASLKTSITSA
                     PLTFSFEGVGNLSSVPFASGHLQMSAPSLATLVQWYQGTSATTLSPGGISIDTRVTTG
                     EKTLKLDDLAFTMGGASATGVLDIALQDGKAPRMEGTLAFDRIDLNGVPVTALTPLGR
                     DDHLWRLVETFVGAWHTDIRLSSQEVLAGPFHLTDVAAGVLIDGKRASLDIGDSNFAN
                     GSLSARAVFSEQGLEHGGRLQARLKDADFAAVLGGFGLNGPVPAGRGILSIDVGTDHA
                     VWATRLGDISGNLTFSLANGSITGFDAHAFADLVRKGEFFSLSQANEASFDFQAANIK
                     ASFADGTARLDRADFVGTSGNMSVTGVIPYRNGSLALAGTLQTETPSSNQPVRFFVGG
                     SWPNAVISPLSVLVAPK"
     gene            409581..411533
                     /gene="acsA1"
                     /locus_tag="USDA257_c03720"
     CDS             409581..411533
                     /gene="acsA1"
                     /locus_tag="USDA257_c03720"
                     /EC_number="6.2.1.16"
                     /codon_start=1
                     /transl_table=11
                     /product="acetoacetyl-coenzyme A synthetase AcsA"
                     /protein_id="AFL48970.1"
                     /translation="MQTDRPLWVPDAETLARSPMAQFMAWCEERFGQRFSDYGAFHDW
                     SLAERGDFWTAVWEHCGVIGERGDQALVNGERMLEARFFPDAKLNFAENLLRGSGDGD
                     ALIFRGEDKVRYRLSWDELRSLVSRLQQALQAEGIGVGDRVAAMMPNLPETIALMLAT
                     ASLGAIWSSCSPDFGEQGVLDRFGQIGPKLFVTCDGYWYNGKRQDVDAKVLSVAKTLG
                     VPTLVVPYAGDSAALAAGIEGGVTLPDFVAVFEAKPLVFERLPFSHPLYILFSSGTTG
                     VPKCIVHSAGGALLQHLKEHRFHCGLKQGERLFYFTTCGWMMWNWLASGLAVGATLCL
                     YDGSPFHPDGNVLFDFAAEERFAVLGTSAKYIDAVRKAGLTPAETHDLSALRLLTSTG
                     SPLSPEGFSFVYEGIKSDVQLASISGGTDIVSCFVLGNPLKPVWRGEIQGPGLGLAVD
                     VWNDEGKPVRGEKGELVCTKAFPSMPVMFWNDPDGAKYRAAYFERFDNVWCHGDFAEW
                     TPHGGIIIHGRSDATLNPGGVRIGTAEIYNQVEQMPEVAEALCIGQDWQDDVRVILFV
                     RLAPGVALTEELTQAIKTRIRTGASPRHVPAKIIAVDDIPRTKSGKIVELAVRDVVHG
                     RPVKNKEALANPEALELFAGLEALKS"
     gene            complement(411818..413539)
                     /locus_tag="USDA257_c03730"
     CDS             complement(411818..413539)
                     /locus_tag="USDA257_c03730"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein"
                     /protein_id="AFL48971.1"
                     /translation="MPAPPACCLGTDRLHFATKSLKRRYAKSGSGLRHRLLATWSGLA
                     SAIVLMPIVAIAWLAVTGGGADWPHLIANVIPRATLRTLMLMGLTGAATAVVGILTAW
                     LVATCDFPLRRLLSAALVLPLAIPAYLAAYAFGELLTFTGPVQGMIRALFGFQTSRDY
                     WFPDVRSLGGAVLVMSSVLYPYIYLACRSMFLMQGRAAADVARTLGAGPVKVFLRIQI
                     PMARPAIMIGLTLVAMETMNDIGAVEFLGVQTLTFSIFDTWLNRGSLAGAAQIACIML
                     IFIIGLMMVERAARRSQRFSSQKTTAAVHDAVRLELSGWKKWTAMLVCLLPVLSGFAV
                     PFLVLGNYALKRFDQFLAPRLLDALLHSVLVSGLTALAAVVLGFVLAYAARAGRSPIT
                     EVAGRLASFGYGVPGTVLAIGVLFPLAALDNTLDAWLRHLFGISTGLVMSGTGFAIVY
                     ACTVRFLTMAEGTLEAGFHKLSPHLDMAARALGRTSAQTLRSVLLPMMRPAVLTSALL
                     VFIETMKELSATIMLRPFNFNTLATLVYEDASRAKVEDASVAAMIIVIAGMIPVILVS
                     RSLERRS"
     gene            complement(413581..417042)
                     /gene="pdhS"
                     /locus_tag="USDA257_c03740"
     CDS             complement(413581..417042)
                     /gene="pdhS"
                     /locus_tag="USDA257_c03740"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="cell-division control histidine kinase PdhS"
                     /protein_id="AFL48972.1"
                     /translation="MRLKGARRRRDPSIGLPMPARQYPFIDIAVHARVREHFARGDAS
                     VLFSKDLARVLWANDQGARLFGVASVYDFIDSPLNANDLSLRQLGAAAAQLAAVGDRR
                     QLLIRIAAGFRRLPLNATVEMIRIRPGEDAVLFTAPHNGKALSAEERAAAMIAGLDGP
                     DTHMAVLDDDGDIVARSPGFEHLGLSAEIRRTLVSAVTREKDRLIKRLVATEKGQLPA
                     AIGKISDHPALHLLFAVETTLEAPDAGETIAKDEPDAVDAPAFAEIETGPDAPSPDEP
                     AETPRVEDAVEDSGTPSTTERAEAEEPADAAPIDEKQGELTLQSGDETAEPPQTTIAE
                     TLESVQETAASDAEQDTAAASGFTFTPGSRAVRFVWKIDAEGRFSEISEEFASAVGPK
                     SADVVGTTFAALADRYDLDPDHKINELLHRRDTWSGKTILWPIEGTSLKVPVDLAALP
                     TYSRSREFDGFRGFGIVRIADAVEDARASGLSLGDTGTPRREDMPAEAPVEPAPEGPA
                     AIQDETEAESSPAADAPQSEPEDGATGELSTAEDPFAGERPALRIVDTAARPPSDKVI
                     ALDERRPAGSGALTRGEQAAFREIARQLGAHFDEPAASAAGEDDERSAGPAPPAEAAA
                     SPAADNPSPDEAIADPLEDTGPAVEDEAPPVPRSGVSMSSEILDRLPVALLIHYGDEL
                     LHVNPEFLRLTGYATLDVFEQEGGLEALFAYGNTSGETQPDGTMTLVRANGQLAPVSA
                     HLHSIQWEGRSTLMLALTPAATGAANTASPDADASAGAEARLRMEIDELRSILETATD
                     GVVVLGQDGDIRTMNRSASALFNYDEDEMRGKPFAALFAHESQKAVIDYLHGLSGHGV
                     ASVLNDGREVIGREAGGGFIPLFMTIGRLSSSHGYCAVIRDITQWKRTEEELRNAKRA
                     AETANAHKTDFLARVSHEIRTPLNAIIGFSDMMASEHFGPIGNPRYIEYAGDIGRSGR
                     HVLDIVNDLLDISKIEAGEMELDFSAVDLNEAVSEAVSLVQPQANSQRVIIRTSLSAS
                     VPEVVADGRSIKQIALNILANAIRFTPSGGQIVVSTSYEANGSVILRIRDMGIGMTRS
                     ELDQAMKPFRQVTTGGRKRGEGTGLGLPLTKAMAEANRAQFAISSAPNEGTLVEISFP
                     SQRVLAN"
     gene            417324..417770
                     /locus_tag="USDA257_c03750"
     CDS             417324..417770
                     /locus_tag="USDA257_c03750"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48973.1"
                     /translation="MATRKTEDAFSLSFDPTKFADGFREFAEKGAAQSKDAYAKMKTA
                     AEEATKTVEATLENAQSGSVELGLKAINALRTNAENSLSHMEALLGVKSLSELLDLQT
                     AFIRKQAEVAVEQAKTMQEATRKVAENVAKPGKDAAEKVVSTFKKA"
     gene            417931..418007
                     /gene="trnH"
                     /locus_tag="USDA257_c03760"
                     /note="tRNA-His-GTG"
     tRNA            417931..418007
                     /gene="trnH"
                     /locus_tag="USDA257_c03760"
                     /product="tRNA-His"
                     /note="codon recognized: CAC"
     gene            419022..420518
                     /gene="mmsA"
                     /locus_tag="USDA257_c03770"
     CDS             419022..420518
                     /gene="mmsA"
                     /locus_tag="USDA257_c03770"
                     /EC_number="1.2.1.27"
                     /note="acylating"
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonate-semialdehyde dehydrogenase"
                     /protein_id="AFL48974.1"
                     /translation="MYEVGHFIDGKRVAGQSGRVSNIFNPATGEVQGTVALASDAELA
                     AAVESAKAAQVKWAATNPQRRARVFIKFVQLLNENMNELAELLSREHGKTIDDAKGDV
                     VRGLEVCEFVIGIPHLQKSEFTEGAGPGIDMYSIRQPVGVGAGITPFNFPAMIPMWMF
                     APAIACGNAFILKPSERDPSVPIRLAELMIEAGLPAGVLNVVNGDKGAVDAILTHPDI
                     AAVSFVGSTPIARYVYGTAAMNGKRAQCFGGAKNHMIIMPDADLDQAANALIGAGYGS
                     AGERCMAISVAVPVGEETANRLIDKLTPMVESLRIGPYTDEKADMGPVVTKEAEQRIR
                     SLIDSGIEQGAKLVVDGRDFKLQGYEDGHFIGGCLFDHVTPDMDIYKTEIFGPVLSVV
                     RAKNYEEALSLPMKHEYGNGVAIYTRDGDAARDFASRINIGMVGVNVPIPVPLAYHSF
                     GGWKSSSFGDLNQHGADSIKFWTRTKTITERWPSGIKDGAEFSIPTMR"
     gene            420721..421836
                     /locus_tag="USDA257_c03780"
     CDS             420721..421836
                     /locus_tag="USDA257_c03780"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="AFL48975.1"
                     /translation="MVLAEPLPAQSVGQASFGRAAPGDFHRLSFTGNGSEYFGIWIVN
                     ILLTIITLGIYSAWAKVRRNRYFYGNTVLLGRGFEYHARGGQILIGRLIVFAYLILYN
                     VLLTFAPLAGIALVLLFLCFVPWLVARGLRFSARVTSYRNVRFDFVGRAGGAFLAFII
                     GPILAALTLGILAPLASRWTYRYIGSNLRYGQRVFSTDPSVGAIYKTWGISAAILVLG
                     LLIIGFIAFLNIALVSTAMENPDFLPGAQLSLAVLAVLGYVLILSIFGVAALVYRAGV
                     RNVAWSATTFDGRHRLLSDLSRLRYTWIAISNFVVTLVTIGLMRPWAAVRMARYVNEH
                     TGVRFDGNVGEIFSAIAQEGSAVGAEFMDIEGFDFGF"
     gene            421745..422881
                     /locus_tag="USDA257_c03790"
     CDS             421745..422881
                     /locus_tag="USDA257_c03790"
                     /codon_start=1
                     /transl_table=11
                     /product="putative zinc metalloendopeptidase"
                     /protein_id="AFL48976.1"
                     /translation="MLAKSSRRSPRKVRRSAPNSWISKASTLASDNLAFALGEWHPPG
                     SSRSVTSGLVEAGDRLVASDETGAELAGGSLSTIDISARVGRVPRRVTFPDGSLFETD
                     DNEAIDRFLSRKGRAGAGIVHRLERFHPRLIAFVAATILLGTLIYRYALPALVEVAVV
                     VTPPILPRIMSATTLETMDRTLLGESKLDEARRGRIVDGFRRIASVSAAGRVAYTLNF
                     REGGPIGPNAFALPDGTLILTDELVELAGDDTEMIVGVLAHEIGHVEHKHSLRQIYRA
                     AGVAALIMLIAGDIGSGAEDVLVEGGGLLALSYSRAAEAEADRHSVELMMKAGLDPTA
                     IARFFELLEAKLDDHSETSIFSTHPGTPERHKAILDLIAELRKG"
     gene            complement(422885..423388)
                     /gene="vdlD"
                     /locus_tag="USDA257_c03800"
     CDS             complement(422885..423388)
                     /gene="vdlD"
                     /locus_tag="USDA257_c03800"
                     /codon_start=1
                     /transl_table=11
                     /product="protein VdlD"
                     /protein_id="AFL48977.1"
                     /translation="MEATNDKSQLDMVVLMTPDMANFSGKVHGGALLNLLDRVAFSCA
                     SRYSKQYAVTLSVDQVVFRQPIHVGELVHFRASINYAGRTSMEVGIRVEAENIRTGER
                     RHTNSCYFTMVAVDAEGRPTSVPPYRPEPGIRERRYRAAEVRRELRREFEERFRAAGS
                     TAASDKG"
     gene            complement(423574..424617)
                     /gene="futA1"
                     /locus_tag="USDA257_c03810"
     CDS             complement(423574..424617)
                     /gene="futA1"
                     /locus_tag="USDA257_c03810"
                     /codon_start=1
                     /transl_table=11
                     /product="iron uptake protein A1"
                     /protein_id="AFL48978.1"
                     /translation="MIASKTLIGTLSVAAAFLALTAPARADGEVNIYSYRQPDLIQPL
                     LDAFTKETGITANVLFLDKGLVERIQAEGANSPADVILTVDISRLTEAKDAGVTQPLV
                     NETINKDIPAHFRDPDGNWFGLTTRGRVVYASKERVAQNDITYEELADPKWKGKFCTR
                     DGQHSYNVGLFASMIAHHGEAETEKWLTGLRDNLSKKPDGGDRDQAKAIFAGECDIAL
                     GNSYYVGLMLTNEKEPEQKEWASAIKVLFPNAKDRGTHVNISGMALAKNAPNKENAVK
                     LMEFLSAGEAQKIYAEQVFEYPVLPGAEPSDVVKSFGTIKPDSLPLAEVAANRKKASE
                     LVDKIGYNDGPQD"
     gene            424800..425264
                     /gene="aau"
                     /locus_tag="USDA257_c03820"
     CDS             424800..425264
                     /gene="aau"
                     /locus_tag="USDA257_c03820"
                     /codon_start=1
                     /transl_table=11
                     /product="protein Aau"
                     /protein_id="AFL48979.1"
                     /translation="MRLTKQTNYAVRMLMYCAANSEKLSRIPEIAKAYGVSELFLFKI
                     LQPLTRAGLVETVRGRNGGVRLPKPASEISLFDVIKVTEDSFAMAECFEAGEIDCPLV
                     DSCGLNAALRKALNAFFDVLKGYTIDDLVKARPQINFLLGLDVGPRPQPSAA"
     gene            complement(425371..425499)
                     /locus_tag="USDA257_c03830"
     CDS             complement(425371..425499)
                     /locus_tag="USDA257_c03830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48980.1"
                     /translation="MIRSGGQAQLLANEPSPEATGDVETSKETTQKSAENGLRAIE"
     gene            425672..427267
                     /gene="dppA1"
                     /locus_tag="USDA257_c03840"
     CDS             425672..427267
                     /gene="dppA1"
                     /locus_tag="USDA257_c03840"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic dipeptide transport protein DppA"
                     /protein_id="AFL48981.1"
                     /translation="MKKLTTLFAATALATLMAGTAWSKTFVFCSEGSPEGFDPGLYTA
                     GTTFDAAAHTVYSRLLEFKKGTTETEPGLAESWTISDDGLEYTFKLRPGVKFQTTEFF
                     TPTRELNADDVIFSLERQWKSDNAWHGYVTGGSWEYFAGMGLPDLLESIEKVDDMTVK
                     IKLKRKEAPFLANLAMPFASIMSKEYADKLQAEGKMNQLNQMPLGTGPFSFVGYQQDA
                     VIRYKAHPDYWGGKQKIDDLVFAITTDAAVRFQKLQAGECHLMPYPNAADVGAMKADP
                     NLKVMEQAGLNVAYLAYNTTQPPFDKVEVRKALNKAINKQAIVDAVFQGQAQPATNPI
                     PPTMWSYNEQIEDDTYEPEVAKKLLEDAGVKDLSMKVWAMPVARPYMLNARRAAELMQ
                     ADFAKIGVKVEIVSYEWAEYLEKSKAKDRDGAVILGWTGDNGDPDNFLDTLLGCDAVG
                     GNNRAQWCNKEFDDLVTKAKETSDVAERTKLYGEAQAVFKREAPWATLDHSLSIVPMR
                     KNVEGFVQSPLGDFAFDGVDIVE"
     gene            427376..428380
                     /gene="dppB1"
                     /locus_tag="USDA257_c03850"
     CDS             427376..428380
                     /gene="dppB1"
                     /locus_tag="USDA257_c03850"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide transport system permease protein
                     DppB"
                     /protein_id="AFL48982.1"
                     /translation="MFRFLLGRLAVLIPTFIGVSIIAFSFIRLLPGDPVALLSGERVM
                     SPERHAEISHQLGFDRPIVMQYLDYLWGVLRGDFGVSIVTKKPVIDQFLELFPATVEL
                     SLCAIIFAVVLGIPAGVIAAIKRGSILDQLIMGTALVGFSMPIFWWGLLLIIVVSGML
                     QWTPVSGRISLMFFFPSVTGFMLVDSLLSGQEGAFQSAFSHLVLPTIVLGTIPLAVIA
                     RQTRSAMLEVLSEDYVRTARAKGLPTFRVVGIHALRNALIPVVTTIGLQIGVMLAGAI
                     LTESIFSWPGIGKWMVDSVFRRDYAVIQGGLLIIAAVIMLVNLAVDLLYGLINPRIRH
                     "
     gene            428390..429298
                     /gene="dppC1"
                     /locus_tag="USDA257_c03860"
     CDS             428390..429298
                     /gene="dppC1"
                     /locus_tag="USDA257_c03860"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide transport system permease protein
                     DppC"
                     /protein_id="AFL48983.1"
                     /translation="MTEITATSPISTDPSRRARLAEFWYYFSENRGAVIGLMFFLFLV
                     VLALCAPLVAPHDPTIQYRESVLLPPFWQEGGRAAFLLGTDAVGRDMLSRLIYGTRFS
                     LFVGVIVTTLSLTGGILVGVIAGYFRGWVDTVIMRIMDIILAFPSLLLALVLVAVLGP
                     GLTNAMIAIALVFQPHFVRLTRAAVMTEKTRDYVVAAKVAGAGHLRLMFKTILPNCMA
                     PLIVQATLSFSSAILDAAALGFLGMGAQPPTPEWGTMLAEAREFILRAWWVVTLPGLA
                     ILVTVLAINLMGDGLRDALDPKLKRS"
     gene            429300..430154
                     /gene="dppD"
                     /locus_tag="USDA257_c03870"
     CDS             429300..430154
                     /gene="dppD"
                     /locus_tag="USDA257_c03870"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide transport ATP-binding protein DppD"
                     /protein_id="AFL48984.1"
                     /translation="MALLEIENLVVEFQTATGPFRAVDGVSLKVHEGEVLAIVGESGS
                     GKSVSMLAAMGLLPWTAKVTADKLAFNGRDLLKMPSAERRKIVGKDIAMIFQEPIASL
                     NPCFTVGFQIEEVLRIHMGLDRAARRKRAIELFEAVGIPDPAERLGHFPHQMSGGQCQ
                     RVMIAIALACNPKLLIADEPTTALDVTIQKQILDLLMKLQQEYRMGLIMITHNMGVVA
                     ETADRVVVQYKGRKIEEADVLSLFAAPKSNYTRALLAALPENATGDRLPTISELFNEQ
                     QTLEGAAR"
     gene            430151..430978
                     /gene="dppF1"
                     /locus_tag="USDA257_c03880"
     CDS             430151..430978
                     /gene="dppF1"
                     /locus_tag="USDA257_c03880"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide transport ATP-binding protein DppF"
                     /protein_id="AFL48985.1"
                     /translation="MTHVLEARNLVRDYHIPGSLFRKARTVHALKGVSFTVDEGKTLA
                     IVGESGCGKSTLGRIITLIDPATAGELLIDGKKVDIARDGLTSEMRRKVQIVFQNPYG
                     SLNPRQKIGDILAEPLVINTKVPAGERRELAMTMLKKVGLEEKHYNRYPHMFSGGQRQ
                     RIAIARALMLNPKLLVLDEPVSALDLSVQAQVLNLLADLQDEFKLTYVFISHDLSVVR
                     YIADDVMVMYYGEAVEYGSRDEVFSNPQHSYTKTLFAATPRADVESIRARLARKNAA"
     gene            431159..431503
                     /locus_tag="USDA257_c03890"
     CDS             431159..431503
                     /locus_tag="USDA257_c03890"
                     /codon_start=1
                     /transl_table=11
                     /product="RutC family protein"
                     /protein_id="AFL48986.1"
                     /translation="MEIKRFETGPRMSQAVVYNNTVYLAGQVGNAGDDVVTQTKQALA
                     EVDRLLALAGTDKTRILSATVWLADMADFAKMNSVWDGWVPQGHTPARATGEAKLATP
                     EYLVEVIVTAAL"
     gene            complement(431631..431915)
                     /locus_tag="USDA257_c03900"
     CDS             complement(431631..431915)
                     /locus_tag="USDA257_c03900"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48987.1"
                     /translation="MNRRPRVCSARPTSGSRGQFSAHGFGGPVINAFRAEICGASRKA
                     APAPQGLSTTCRQPPPRSAGTGQSPESPRRSAANKAAAANRPWAIPPRAE"
     gene            431973..433100
                     /locus_tag="USDA257_c03910"
     CDS             431973..433100
                     /locus_tag="USDA257_c03910"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="AFL48988.1"
                     /translation="MDAKSVAAVRSRKRNAEKEIALAEATKAAARKRDGMDLLVAWSI
                     IGLFIVACSAVVYAMTAILMPIAFAIVVGIVLGRAADELARFGLPPILGGLLLALFFV
                     LGLSSLVNALLGPITEVAREAPRLAEGVVERVLPFIERFEWGRIALARSIGADAFADV
                     IVKNAGPFLGAVAASVTPALIQTLIFLAALVLFLLGRVQLRSTIILAFPSREGRLSAI
                     RIMNALEDGLTRYFSTASLIYLALGGFTMMIALVGGLPMPPLWGLFAFVSSFIPYLGV
                     TFMTLSLLVGGLMAHDALVLAFAPATVFFLIHLAMENLVFPAILGRRFEVNPFLIFVA
                     ILFWTWMWGAVGAILAMPLSLIAMTIFEQLREVPPEPQLPG"
     gene            complement(433132..433929)
                     /gene="phyR1"
                     /locus_tag="USDA257_c03920"
     CDS             complement(433132..433929)
                     /gene="phyR1"
                     /locus_tag="USDA257_c03920"
                     /codon_start=1
                     /transl_table=11
                     /product="phyllosphere-induced regulator PhyR"
                     /protein_id="AFL48989.1"
                     /translation="MSLSTRIAPHLPYLRRYARAVTGSQAAGDAYVAAVLEALIEDIN
                     RFPSASSDRISVYKLFCSLFDKLKVDRSNLTSPFAWEQRAAANLSLIAPAPRQAFLLI
                     SVEGFSSAEAAEIMSVDQGAFAKLLAGASEEISRQVATDIMIIEDEPLIAMDIEDMVT
                     SLGHRVTGIARTHREAIDIYRQTSPKMILADIQLADGSSGIDAVNDILTQAAVPVIFI
                     TAFPERLLTGNKPEPAFLVTKPFNPEMVKALISQALFFDEQAQAGSR"
     gene            434139..434294
                     /locus_tag="USDA257_c03930"
     CDS             434139..434294
                     /locus_tag="USDA257_c03930"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48990.1"
                     /translation="MAAGARKSDANGVVASRLRALYQAVESEPVPQQLIDLLRRLDEA
                     ERAQTGD"
     gene            complement(434394..434645)
                     /locus_tag="USDA257_c03940"
     CDS             complement(434394..434645)
                     /locus_tag="USDA257_c03940"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48991.1"
                     /translation="MKKILLVVSVILPLAAACTQTERGAAIGAASGGIIGGAISNDVR
                     GAAVGAAVGGVAGALIGRANEPGYCVYRDRYGRRYTARC"
     gene            complement(434976..435107)
                     /locus_tag="USDA257_c03950"
     CDS             complement(434976..435107)
                     /locus_tag="USDA257_c03950"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48992.1"
                     /translation="MRNHNLHIGRTLRELEMHTEGKSNERLQALLENLERTERGSRR"
     gene            435150..435278
                     /locus_tag="USDA257_c03960"
     CDS             435150..435278
                     /locus_tag="USDA257_c03960"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48993.1"
                     /translation="MSRRDFHFLPEELCFPENAKLWRRFLLSWVGSQLRIDFSSFR"
     gene            435379..435543
                     /locus_tag="USDA257_c03970"
     CDS             435379..435543
                     /locus_tag="USDA257_c03970"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48994.1"
                     /translation="MLYYALIFLVVAIIAGVLGFGGIAGTSAGIAQILFFLFLIFLVV
                     SLVMGIFRRT"
     gene            435620..435775
                     /locus_tag="USDA257_c03980"
     CDS             435620..435775
                     /locus_tag="USDA257_c03980"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48995.1"
                     /translation="MGPDASPFRGACAVPLPLLVRLAIHANILPVDSNQALLPASLGQ
                     IMSKLKK"
     gene            435814..437067
                     /gene="dadA2"
                     /locus_tag="USDA257_c03990"
     CDS             435814..437067
                     /gene="dadA2"
                     /locus_tag="USDA257_c03990"
                     /EC_number="1.4.99.1"
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid dehydrogenase small subunit DadA"
                     /protein_id="AFL48996.1"
                     /translation="MKTDVVVLGAGIVGISSAIHLARRGKSVVLLDRRGAGEETSFGN
                     AGLIQREGVFPYGFPHDFGALFRYALNNTIDASYHFRALPSLVPFLARYWWHSGFTQH
                     QRIAHLYAPLIENSIAEHSDLIDASGAGELIRKDGWMKVFRTEKERDAAYKDAEKLSA
                     GFGVNHQKLSTSELKTLEPSIQVELAGGLRWTDPWSIRDPHSLNKAYLGYFQSLGGRL
                     VSGDAATLEHILEGAGWRVATPEGPLETREVVVALGPWADTVTRKLGYHFPLAVKRGY
                     HMHYGTKDGAQLNNWVLDEEMGYFLAPMLRGIRLTTGAEFALRDAPKTPVQLTRAERV
                     AREFFPLAERRDEEPWIGARPCTPDMMPIIGKAPRHEGLWFAFGHAHHGMTLGPVTGR
                     ALAEAMTGEKTVVDLAPYRPDRFLA"
     gene            437221..437466
                     /locus_tag="USDA257_c04000"
     CDS             437221..437466
                     /locus_tag="USDA257_c04000"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL48997.1"
                     /translation="MKNQTIEFAGEAVGALMPDDGQLRFVAVKYSVWPLDGRRFATAE
                     EALRAVAALHVLRQRGPIGTRAAPTDHCEAVGTAGAH"
     gene            437810..438304
                     /locus_tag="USDA257_c04010"
     CDS             437810..438304
                     /locus_tag="USDA257_c04010"
                     /codon_start=1
                     /transl_table=11
                     /product="putative insertion sequence transposase protein"
                     /protein_id="AFL48998.1"
                     /translation="MAGDRRHCHPGECTSRRRAAQKGGPEAQALGRSRGGFGTKLHAV
                     VDALGLPIRFAIGPGQQNDMAPACGLVAGLASGQVIADRAYDADSLHDAILDQGGEPV
                     IPPRRHRKHQHGYDRIAYRQRWGIEGFFAKLKQWRRIATRYDKLAATFLGFVKLASIM
                     LWLK"
     gene            438390..439586
                     /locus_tag="USDA257_c04020"
     CDS             438390..439586
                     /locus_tag="USDA257_c04020"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase protein"
                     /protein_id="AFL48999.1"
                     /translation="MAGASIETTLELWASSLRDVKARMRGLFTQERVAASANLFLDGL
                     LGDERRKTGWMRAEAAGDPGPWRQQAILGRGRWDADALRDIVREYVVENLATDDAVLV
                     IDETGFLKQGKTSCGVARQYTGSAGKITNCQIGVFAAYVSVRGHAFIDRALYLPKSWT
                     GDPARLAAAHVPQATAFATKPGLAVEMIRRALAADVPFSWVAADAVYGVGDVEGTLRR
                     ACKGYVLGVKSDHHFGSWSGKPPVAGTAQEIARDLDPSAWQRLSAGEGTKGARLHDWA
                     YCELADLDADEYNETKSGLWTRGLLIRRNISDGDLAFFTTWCPAGTDIQTLVSVEGHR
                     WAIEDSFETAKNELGLDHNETRSWHGWHRHVSLVMLAFAMMAVIRYRANDATPPKRPR
                     MPTIRI"
     gene            439583..439738
                     /locus_tag="USDA257_c04030"
     CDS             439583..439738
                     /locus_tag="USDA257_c04030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49000.1"
                     /translation="MIRWSIQEVRRIAIRLAQRRINPAYVIAWSCWRRAHQAAAQRAH
                     LKTKMQL"
     gene            complement(439940..440830)
                     /locus_tag="USDA257_c04040"
     CDS             complement(439940..440830)
                     /locus_tag="USDA257_c04040"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="AFL49001.1"
                     /translation="MRRILRPHRRRQNPRPTNRRRAARRRRRPEEHRERRRRRHLPRW
                     KHSPSRRPRHRHLKERHRSRRPLPHSDRQETIRAGRSLSALKTLNSVAPTRCCLRFSI
                     HSTTISTFMDQILADILVGTRTPYPVIFARLCGAILLGALIGIEREKRQQPAGLRTHI
                     LVSLASAIFAVVAVESVHMASLSGPEVRIDPIRVVEAVTAGVAFLAAGMIVFSKGEVK
                     GLTTGAGMWLAGAVGLSIGFGFWLIAAFAAIASLIVLFILGRMEVALQWKAPEGTEEN
                     GSREARHRDAAPTGSENRGR"
     gene            441294..442439
                     /locus_tag="USDA257_c04050"
     CDS             441294..442439
                     /locus_tag="USDA257_c04050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49002.1"
                     /translation="MEMTGSYENGTFVGRAWRADIEGPSLVTVRAGELIDITSKAVPT
                     MRDLLELPDPVAHVRSAPGEALASVDAVMVKAERGRDEVHLLAPCDLQAIKACGVTFA
                     RSMIERVIEERAAGDAARAEAIRTRITAIIGDSLRNLKAGSPEAAGVKAALIEEGVWS
                     QYLEVGIGPDAEVFTKAQPLSAVGWGAAVGLHPISRWNNPEPEIVVAVSADGRAQGAT
                     LGNDVNLRDVEGRSALLLGKAKDNNASCAIGPFIRLFDETYSIDDVRSADLDLLIEGP
                     DGFRLKGASTMREISRDPLDLVAQTIGPHHQYPDGLMLFMGTLFAPVEDRGEPGQGFT
                     HKIGDVVTISSPALGSLVNTVRLATDCPPWTFGTAALMRNLAKRGLL"
     gene            442655..443020
                     /locus_tag="USDA257_c04060"
     CDS             442655..443020
                     /locus_tag="USDA257_c04060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49003.1"
                     /translation="MKVVIGLAAASLFAAVAAHPLRAEPLQSVEEVSTALGQCWTPPA
                     GIRDSFVTLKFGFRGNGTLMGPPQPTAIRVAGDADQRKAFVAAATAALQNCMPLEFST
                     ELAEEIAGNVFTLQFYSAD"
     gene            443158..446298
                     /locus_tag="USDA257_c04070"
     CDS             443158..446298
                     /locus_tag="USDA257_c04070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49004.1"
                     /translation="MEQMEFLLRQRPTHRPVCSPPPCGYHLAIAPLSPKEQLLAPSQI
                     SNLLTPDRRSDATLEEAMSKKVKSIAPLQATFALDPLAAGYTIPGVGDQTVNGDEGSN
                     SISTGSGLDTINGGLGADTIKAGTGDDEILNRSAAGLLGDKIDGGLGFDILGIDFSGS
                     SKGVSFAAFDPIVSKSVLGATIVNVERFELEGSNFADTFTGGRWDDWFESGAGDDVLN
                     GGLGKDWLEGEDGNDRIYGGNGNDSVLGGAGDDYLSGGYGIDWLSADDGNDTLLGGAG
                     GDYLYGHHGNDNIKGESGTDTISGGGGRDVIDGGSEDDYLAGDGDNDTVLGGAGNDTI
                     RHNMESWAGDGKDVLDGGVGYDEVVLSGLSGTFAAKSSSTKQTLSNGTTIVNFETYRI
                     SGSETADRFTGWTGADTLSGNSGNDTLIGLGGNDHLNGGLGSDVLDGGDGNDLLIVGS
                     GGKDTIKGGTGYDTIWIDRSDSTSGLTFSVSGAVAKLSDGTVVTDGESFSIETGSGND
                     VLSAGTAGHVDFDAGSGNNTLTGGKGNDQFYSTSGNDTVKGGDGDDRIGDNGGGTNKL
                     DGGNGNDHITADTESGTGLTTILGGAGNDIVTVNNAGGSTAGRFSVDGGIGTDTLWIS
                     RYDSTKNLSFALSANATMANGDITAKNFERVHITSGQGNDTLTAGGLDDDLNGSGGND
                     TLKGLGGADDLTGWTGADKLYGGDGDDTIYGSGGIKDTSADQLYGEKGNDLLFMNAGD
                     YASGGDGADRVIIDLAEETFDVSFAFGNGLVKVNANTSVNGMEAVDYIGGSGKDTVTG
                     SAYDDYLDGGAGNDTFKGGGGNDILVDGRGNDKLYGDAGNDEFTRFSDETGTDYFSGG
                     SGVDTLDFDIVSDQSVIVDLENNAKNGGVASGLSLSSIENVVGRTSDDTILGNGVANT
                     LKGGLGDDRLDGRAGNDTIEGGGHGDLLTGGAGADKFIYGSGEAIGSGDQITDFKRGE
                     DKLVIDKGVFHFSNLVLYSGNDLKPTGTAAQFFFERDNGRLWYDADGTGNEADAVLMV
                     TLDKVTSLAATDFLLI"
     gene            complement(446448..446756)
                     /locus_tag="USDA257_c04080"
     CDS             complement(446448..446756)
                     /locus_tag="USDA257_c04080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49005.1"
                     /translation="MLRPSDSSTRSPSADHGPGGASDGNTAAFGATDWLSFAAAPTFA
                     TMALLTGVLGGPPDMLCSSAGDASAITGMVPMYGLMSAFHSAPWLRLISGRRSDAHRS
                     "
     gene            complement(446764..447561)
                     /locus_tag="USDA257_c04090"
     CDS             complement(446764..447561)
                     /locus_tag="USDA257_c04090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49006.1"
                     /translation="MTEHRTGTREEWLKARLQLLEAEKELTRRSDELARQRQALPWVR
                     IDKDYRFETDAGSASLKELFQGRSQLLVYHFMFGPDYTAGCPSCSSIADGFNGIVVHL
                     ENHDVAFTAVSRAPLEKLTAYKRRMGWSFPWASSNDSDFNRDFSVWFTADEQREGRIE
                     YNFRREPPAPEPLAGKTVQEWQLRGSEGPVAQIAAMTGTDVATYTRDRPGLSAFVLDD
                     GVVYHSYSSYARGLDGIWGMYQWLDRAPLGRNENGVWWRRNDEYGQG"
     gene            447653..448873
                     /locus_tag="USDA257_c04100"
     CDS             447653..448873
                     /locus_tag="USDA257_c04100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49007.1"
                     /translation="MDSLITAAARALAGGDPLGALKRVALRDDPPALALRGIAMAQLG
                     DLARAKTLLKNAARGFGPREARARARCVVAEAEIALVSRDLSFPSKALDMARATLEKH
                     DDWVNAAHARNLVVRRLLLVGRVDEAERALADVDPAPLPPASRAAYELVVAGIAIRRL
                     QTKTARAALARAERAARHANIPALTAEVESASLLLDTPAARLIERGEGRPLLLEEVEM
                     LFASQALVVDACRHVVRGTGTVVSLATRPVLFALARALAEAWPGDVPRGALIARAFRA
                     KHADESHRARLRVEIGRLRAELGKLAEVSATKRGFALAPRQAGELVVLVPPVEGQHAA
                     MLAFLADGESWSSSALAIALGASPRTVQRALEALGAAGKVQSFGRGRARRWMTPPVPA
                     FPTVLLLPGPLPGD"
     gene            448923..449555
                     /locus_tag="USDA257_c04110"
     CDS             448923..449555
                     /locus_tag="USDA257_c04110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49008.1"
                     /translation="MKHVQAEILREYGPFPGADNVHGVTFDGQHVWFASGDKLNAFDP
                     ANGETVRAIDVAAHAGTAFDGRHLFQIAEDRIQKIDPKTGRVLSTIPAPGEGGDSGLA
                     WAEGTLWVGQHRGRKIHQIDPETGAILRTIESNRVVTGVTWIDGELWHGTWEGDESTV
                     RRVDPETGKVLETLDMPAGMGVSGLESDGGDRFFCGGGKSGKVRAVRRPR"
     gene            complement(449603..451366)
                     /gene="cya31"
                     /locus_tag="USDA257_c04120"
     CDS             complement(449603..451366)
                     /gene="cya31"
                     /locus_tag="USDA257_c04120"
                     /EC_number="4.6.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="putative adenylate cyclase 3"
                     /protein_id="AFL49009.1"
                     /translation="MANESIRRRLAAILAADVVGYSRLMERDEKSTHTLLMARWKEVL
                     EPLVLIHQGRIFKRTGDGVLVEFGSAVNAVECAAALQQAMAAANRDMPEDQAIVLRVG
                     VNLGDVMVEDSDLYGDGVNVAARIEALADPGGVALSDGIHEYVHGRTDLDFADSGFHE
                     VKNIERPVHIWTWSPNNRPNVPINSAAETPPHLPKKPSIAVLPFDNMSGDPEQGYFAD
                     GITEDIITDLSKVSGLFVIARNSSFAYKGKTPDIRKVSRELGVRYVLEGSVRRAADRI
                     RINAQMIDGTTGGHLWAERYDRGLEDIFAVQDEVTRTIVNALRVKLTAGEEERREGRG
                     KVDPEAYDLLVRARQAILQFSAVSSTEARNMLQRALEIDPGMAAAHASLSIIALTDFI
                     NQWNGATPDNLTQALELAHEAIATDGTEPQGHFTLALALSWMRRLDEAERAAERAIEL
                     DPNSANAHTALGTIRDFQGRHEEALASYTRAHRLDPQFDLSLHFLGRALLSLGRFDEA
                     EIAFKRRLTLAPRSDMTRFYLACLYGRIGHHEEARRYWREVLEVNPNFSIDHLRRALP
                     YRDPGLLDRLLDGLREAGVSI"
     gene            complement(451741..451857)
                     /locus_tag="USDA257_c04130"
     CDS             complement(451741..451857)
                     /locus_tag="USDA257_c04130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49010.1"
                     /translation="MTPDYAWVIKLCFWRSIKPFGRTTPNGWSHPSLLMLTS"
     gene            452590..453327
                     /locus_tag="USDA257_c04140"
     CDS             452590..453327
                     /locus_tag="USDA257_c04140"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein, TetR"
                     /protein_id="AFL49011.1"
                     /translation="MSAKPRRKIVAIEPDGAAAAGEQPKCRRLPSGERRIAILAEAAA
                     LFAEEGFGASTRGLASRLGITQAALYKHFRSKDEIVAALFQESATRWRKEDWHTALTS
                     NEAPLAERLGRLYAGYVGAITGQSMRLFVRAGLDGYGQPGRRGAVLTASILEPVIGAL
                     RREAALPDLSIRPMQHEEREIAMTLHGALMFLAIRKHVYRMPLPEDLTEHAMRQVRLW
                     LPGAIAEMRQLHASPPEEIVPQLAPRQ"
     gene            complement(453379..453912)
                     /locus_tag="USDA257_c04150"
     CDS             complement(453379..453912)
                     /locus_tag="USDA257_c04150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49012.1"
                     /translation="MHKIVAISLASVFATGPVGYTLAGPDRVALPSGYAERFVLYNTV
                     DRPDRKTIRFMYVSPETHTKAKAGEPAPDGTILIMEDHRAKLDASGSVELGPDGRLVP
                     TDQLTNIFVMEKRAGWGEAYPPEVRNGDWDYAHYLPDGAPKADAKFDGCFSCHRNRAG
                     RDFNFTYAKYLLDREDK"
     gene            complement(453925..454164)
                     /locus_tag="USDA257_c04160"
     CDS             complement(453925..454164)
                     /locus_tag="USDA257_c04160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49013.1"
                     /translation="MAGMAYSPSMIEAKVGDMLVFVNDDTQAHNVLIATVGFSTDLGK
                     QDPGSQTTLTVRKSGRFDVECVIHEGMHARVVVRP"
     gene            complement(454364..456673)
                     /locus_tag="USDA257_c04170"
     CDS             complement(454364..456673)
                     /locus_tag="USDA257_c04170"
                     /codon_start=1
                     /transl_table=11
                     /product="amylo-alpha-1,6-glucosidase"
                     /protein_id="AFL49014.1"
                     /translation="MPLELPDHSLIRLRARPETIYVSKGRTVLATGRDGFLDQGPDQG
                     LFVHQTRLLSRYRYLIDGRQPQAVSVSNVAQHSWLGYYIAPPPKASAHHPIISEIAQE
                     TIELRLSRYVGEGLHEDVDLANFTQEDVRFTLQLELDADFADQDETRGNRRQDGKLTF
                     TWDEGEEDPELRFYYEAHHQYDHQGEEGAASIRRGLRVRFSNATTRPRHEDRRIVFRI
                     NLAPHQNWHCCIDFIPVVDGRDLQPIYRCGSFQPRANDYDRSSQVFMREATRFETSES
                     VTLANVVIGTLEQGKRDLDALRLHDLDTAERAWTIAAGLPTYVALFGRDTLTVAWEAA
                     LVTSDIMRGTLPVLAGLQGKEVNDWRDEQPGRMLHEAHTGPVAALNYTPKGRYYGSIT
                     TSGFYPFVVAQLWHWTGDKAFVKPYLDPAIAALKWLEEFCDEDRDGFCGYKTRSELGL
                     ENQAWKDSSDAIVYEDGSQVPKPVATCEEQGIVYAAMMNLAEVLWWFDRGDEAKHLYT
                     TARELKKRFNDAFWMENEGFFAMALDPDKRQVRSIGSNALHCVATGIADTALVPRTLE
                     RLFADDMFTGWGVRTLSSLHPAFNPHSYHRGTVWPVEHGPFAIGAYRYGCHDYVERIC
                     RSQFETAALFDFHRLPECIAGHQRDEDHPFPAVYPAANSPQAWSATTAYTLLQAMLGL
                     QPFAPLRVVFVDPWLPAWLPEITLSNLHVADATITIRFFRKANGRSGYQVLDKRGSLH
                     VVRQPSPWSLTASYWERAKDVLASLTPGH"
     gene            456830..457354
                     /locus_tag="USDA257_c04180"
     CDS             456830..457354
                     /locus_tag="USDA257_c04180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49015.1"
                     /translation="MAYREYIHTPVTPRDMRWGLRQGAIAGIVAGIVFAAFEMIVSAS
                     MMGAEAFFMPLRMIGAIALGPAALDPGYSLVTAGVTGVVVHFVLAIIYGIIFGEIAAM
                     LRGPVAFIGAGGLFGLVLWLINFYVIAPALFPWFLESSPLVQFIAHTFFFGSVLGYYL
                     WKSHQRSGLEDPVV"
     gene            457634..458671
                     /gene="yxnA"
                     /locus_tag="USDA257_c04190"
     CDS             457634..458671
                     /gene="yxnA"
                     /locus_tag="USDA257_c04190"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase YxnA"
                     /protein_id="AFL49016.1"
                     /translation="MVQLVHHSELSGRTVVVTGASAGVGRATAVALAGMGAKVCLIAR
                     QSQGLLDATAEAESRGANAIAIAADVADASAVFAAAAECERRLGAIDVWINNAMATVF
                     SPVAEITPEEVQRVTEVTYLGCVHGTMAALGVMRPRNRGVIVQVGSALAYRGIPLQAA
                     YCGAKHAIRGFTDSLRAELIHEDSKIALTTVHLPAVDTPQFDWARTHMDAQPRPVAPV
                     YRAEVAAAAIVRAALRPKREYWLGNRTSLIILGNIVAPSMLDRLLAWTAVEAQQTDRP
                     ANPNRKDNLFTSVEGMHRTNGSFGIEAGADAIAVSEPRARIAAIIGGALIAAVLGALI
                     GRARRHRRIWR"
     gene            459562..459711
                     /locus_tag="USDA257_c04200"
     CDS             459562..459711
                     /locus_tag="USDA257_c04200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49017.1"
                     /translation="MLLLFDNVGDCGSLRLAAFLFRAKEGFIVCLCRTAKSIALQARK
                     LVCLA"
     gene            459977..460180
                     /locus_tag="USDA257_c04210"
     CDS             459977..460180
                     /locus_tag="USDA257_c04210"
                     /codon_start=1
                     /transl_table=11
                     /product="UPF0337 protein RB0906"
                     /protein_id="AFL49018.1"
                     /translation="MDWNRVEGNWKQVKGKIKEQWGKLTDDDLDRIAGNRDQLEGKIQ
                     ERYGIERDRVRRDLDDWYNRQTW"
     gene            460957..461223
                     /locus_tag="USDA257_c04220"
     CDS             460957..461223
                     /locus_tag="USDA257_c04220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49019.1"
                     /translation="MKIVTLTAAAGVAFTAFAGGALADPWKDESGHGRWRGYYDGPRY
                     ERRAYKEEYRRGRCKIERKWDDDEYKEEIKCKRGARPVYGYYRY"
     gene            461455..461886
                     /locus_tag="USDA257_c04230"
     CDS             461455..461886
                     /locus_tag="USDA257_c04230"
                     /codon_start=1
                     /transl_table=11
                     /product="CHRD protein"
                     /protein_id="AFL49020.1"
                     /translation="MKSPRVNSLLTGLAVLAILAAGSVSAETLKFKADLKGASEVPAS
                     DSAGQGMGDITLDTDTKKLTWTVTSSGLSGEVTAAHFHGPAAPGENAGPVVDISKAIA
                     SGSAEITDQHLADLQSGKWYLNIHTAKFPDGEIRGQVEKAQ"
     gene            complement(462157..462525)
                     /locus_tag="USDA257_c04240"
     CDS             complement(462157..462525)
                     /locus_tag="USDA257_c04240"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase superfamily"
                     /protein_id="AFL49021.1"
                     /translation="MFDHVKFGVSDYAASKAFFLKALEPLGVAVVSEGPPTYGVELSP
                     KGKASLCLYQTEEKPAHLHLAFTAENRRQVEAFYRAALEAGGKDNGAPGLRPHYHANY
                     YAAFVIGPDGHNIEAVCHEP"
     gene            complement(462756..463217)
                     /locus_tag="USDA257_c04250"
     CDS             complement(462756..463217)
                     /locus_tag="USDA257_c04250"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49022.1"
                     /translation="MAHIIGEVPQEELDQFFLVCSTVGAYMVFPARKIDRKPTINGVR
                     GLNSKIKDRFHLTLECIRRHYQNQDSPLGEALARYADYFELFGGFEGYVDFFLLQDLI
                     GNDGTSINFFIPFHGFDTAPLPADVDEYRVYKNNVTAFITARNQRIALQSV"
     gene            complement(463445..464665)
                     /locus_tag="USDA257_c04260"
     CDS             complement(463445..464665)
                     /locus_tag="USDA257_c04260"
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family protein"
                     /protein_id="AFL49023.1"
                     /translation="MSVRKRKWTRNGVEKEAWVVNYTDIKGVRRLKTFARKKDADVFA
                     ATAHIGVRDGIHVADSATFTIKQAGEKWFETGTNAGLERSTLDQYRQHLDLHITPFLG
                     SLKLSKINLPTIRQFQDQLRGNGRSPAMIKRVTVSLGSILADAQERGLIVRNAVHEMS
                     RRRKSASKRERRQKAHLRIGTDIPTNEEIRKIIEHSQGRYRPLLLTAIFTGLRASELR
                     GLTWDDVDLAKAEIHVRRRADKYHAIGMPKSDAGQRTIPLPPIVINTLKEWKLACPKG
                     DLNLVFPNGEGNVEWHSNIVKRGLHPVQVAAGVVKPTGELDDEGNPIVGAKYTGMHAL
                     RHWFASWCINRRVDGGLELPGKMVQQRMGHSSIQMTMDVYGHLFPSTDDAEALATAER
                     SLLALGATQTRHGA"
     gene            complement(464669..465403)
                     /locus_tag="USDA257_c04270"
     CDS             complement(464669..465403)
                     /locus_tag="USDA257_c04270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49024.1"
                     /translation="MIPIRLNWQLLTDGFEPVEFKNSNGSKVTIAEPGSARTDPILYE
                     AIHLEDPVVLHFINCETDMEFIAFLARFGTLEETEISKSDEIEGDIEYTLGSFQKPRS
                     SGYRRPAGIGSNSVPVILTVLRDRALSLKALINATRVARHIDAKTKVRDLNELMDSAE
                     VIVHPCFVHSEGTMRFVLKADTLWDFMVMEVAAIYEAGAVATSCEHCRTIFLTGPLTG
                     RRSHAKYCSDRCRVAAMRARNSAKEG"
     gene            complement(465875..466129)
                     /locus_tag="USDA257_c04280"
     CDS             complement(465875..466129)
                     /locus_tag="USDA257_c04280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49025.1"
                     /translation="MRFRGDLRPKLPGNFLRFPASRDLLVIDFGCPLLLAQAGFAGLL
                     KGFSGTRVAIDRLGTAADELESTRMQRVDNAPSSREVTPQ"
     gene            466273..467166
                     /locus_tag="USDA257_c04290"
     CDS             466273..467166
                     /locus_tag="USDA257_c04290"
                     /codon_start=1
                     /transl_table=11
                     /product="virulence-associated protein E"
                     /protein_id="AFL49026.1"
                     /translation="MNLHDLARRLGGELARNGIVTCPGPGHSPKDRSLTVWLESDDVN
                     VHSFAGDDWQTCKDYVREQLGLPSWEAGKGQKGRARRPTSKRTSYDDEGSRIALVRRI
                     WREAKDPRIAPVLAYLEHRGLPPFTNDQIPVFRYHPNCPFGGEHVPALIARFSPIEND
                     PGLEVEPTAIFRIRLDLYDGDRRKLALGPSRGQVIKLDRDISLAGLGITEGIEKGLAL
                     VASGWQPIWVTCGTSTMRNFPLLPWMECLTIFCDRDEPGRDAALVGIDRWRNAGREAR
                     ALAPPAPFKDWDAWTRRGGQG"
     gene            467163..468257
                     /locus_tag="USDA257_c04300"
     CDS             467163..468257
                     /locus_tag="USDA257_c04300"
                     /codon_start=1
                     /transl_table=11
                     /product="RecA-family ATPase-like protein"
                     /protein_id="AFL49027.1"
                     /translation="MTRTVDDIEREAERVDVAVSNGSWTCNLSELGSGGGSAGKSDTG
                     RKAGGMNRQASAPEIYDAADLRMETFPPLRQVAGDIILEGLTILAARPKVGKTWLMLQ
                     IAIAVSEGGYCLGDIQCESGDVLYLALEDNKRRLQRRLTKMLGVHGREWPHFKVAHKW
                     PRADQGGLDQLRKWIDSADNPRLIVIDVFARFRKPASPAKQSYDTDYASISELQTLAA
                     ETGIAIVIVHHLRKSEADDDPLDTVSGTLGLTAAADAILVIKRTGQGTTLYGRSRDAD
                     EIDKAVQFHPGTALWTVIGERDQVQRSEERCAILKVLADAREPMSPKDIAAALRRKDG
                     SIRFLLSKMVKDGEIIKLKRGVYAVSPSPR"
     gene            complement(468876..469616)
                     /locus_tag="USDA257_c04310"
     CDS             complement(468876..469616)
                     /locus_tag="USDA257_c04310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49028.1"
                     /translation="MALDPDLALISEANFIPDDLSGFSFYCEPAMGHNRTPRRFRTCI
                     LAKGKIGPPIELTAKQSWVNEGLTTFPGNFVARKVSFEAWGDVNVVSVHMPARPFPYK
                     EFTSEDVTDVMLPGYRTISMSELLWAALKETMPSLGGDWIVGGDFNTSEFIGRTKRQN
                     DANREVIERMKRLGFVEAIRHICGGPVPSWKSYRKRDIFRHQLDHLYLSGTFRVHLKS
                     AFIGDPEHFFAMGLSDHLPLVAEIESPH"
     gene            complement(469738..469965)
                     /locus_tag="USDA257_c04320"
     CDS             complement(469738..469965)
                     /locus_tag="USDA257_c04320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49029.1"
                     /translation="MNKCLLTPATIFSLFVGDLPAMAQTNNDGQAASEGGEVYFRNCG
                     AARAAGAAPIRAGEPGSRRKLDRDGDGVACE"
     gene            470767..473991
                     /locus_tag="USDA257_c04330"
     CDS             470767..473991
                     /locus_tag="USDA257_c04330"
                     /codon_start=1
                     /transl_table=11
                     /product="SNF2-like protein"
                     /protein_id="AFL49030.1"
                     /translation="MLGYLVQHRLFGCCKVIGFDGRTVDIKFCDGGGRRFFSRSALEG
                     GDFKRAKLHTGALAMGPHGQCAIDALIDGDGEGPRHYRITYEDGLGATVSEVQLLPLP
                     VRLSDSLPARLLQGRTDPYATFSARHRLLVALARFNRQVGGLRALLASRIDLHPHQAF
                     VAGTVILDPVRRYILADEVGLGKTIEAGLIMHDLLSRRPHARILVLTPGPLTRQWLCE
                     MHTSFGGQGFKLADLYPFESVDLGRWSKVICSTNFALDGLDEDLLAVPWDLVVVDEVH
                     HLLNARHLYDLVMQLSHSTRDLLLLSAVPVRRRESELYRLLALLDPQTYGKDGTGEEA
                     FLAIYQAQEPLGRRLNLLSHDLTDLESGEATSGDVIARLERLLSLPIVQNDEQLHALL
                     AAAEADPERAGALAQEAHQTISDRYRVNRRILRNRRERLISQDRLAAITRVPALLRYE
                     PDQIEGEAVTAAEAMLAALAADTNLSPDILRPFSRILLQALVDPIATLEVLTAVRDAK
                     AATVNSYGREMLNSVVGLGGERWRIQLDTVSAGVKAHVDPGLLSSAVRLASNWRSSHT
                     SSVRWEALVSLLRGEIAAGRKTLVFAGFPGVAQRLAALLKNALGEKSVTEFRSDLEDM
                     AKEENVGRFRAEANVSIMVSDESGGEGRNFQFAHSLIHADLPWQPAVIEQRIGRLDRL
                     GREVISSEVVSHILVSADTWEAGLYACYHDGLDLFGKSVSGLEFALRHLQDEIIDAAL
                     TGGQDGMHDLTARLKAIAAEERVRDDSEALLDEASYHAARAERFVRTPSAESELALEA
                     AFLDYFRVLSGGRGVSRHQSADGAEGVWCLRPDNVPYGEITIIDKDATGETGKRVGTF
                     RRKLAQQQRRVEFFTYGNPLFDAVVESVGQRLTGRTYAIACQAVGATSFIGLELIIAA
                     QPRLNASDISPSLLNLAEAIFGAQRRQLFVPLLPGQPVEGSRLAGMLTSLSTKGGGPH
                     WRDLTGDQVQQLVRRFDGDLSTCLNRAMEQLIPAARGVFAKALAEPLASERERIAFQR
                     HQLIKGSDAAGAAEAVMLERYSALIDSWDVVIDGIGFLAVNVRC"
     gene            473993..476440
                     /locus_tag="USDA257_c04340"
     CDS             473993..476440
                     /locus_tag="USDA257_c04340"
                     /codon_start=1
                     /transl_table=11
                     /product="helicase-like protein"
                     /protein_id="AFL49031.1"
                     /translation="MASVAPSPAEPSLAQQFRAALWSGAAPKLILPPPSTWHPEYPRW
                     RFLWLLQRCPVPTLDHGVLLRQAVRWSGGKLFIGGWTPELAAVGEACGVTLSAAGDLI
                     VAPYRPDWLAEKTWPDGQGLDEPPFLAVPDECLPAEPWLWSLSNGQLRSWHSSAQKEA
                     CWQALTAPPGSTTLLGLPTGAGKSLSFQLAARFSAGVTLVVVPTTALAIDQCFAANEI
                     LADFRHLGPRYYSANDPVSDPAAVRAALREGACRLLFASPESCVSGSLRGVIDDLAAT
                     GRLATLVIDEAHIIDSWGGHFRVEFQLLAIRRNQWLALSGGTLRTLLLSATFTPHCVD
                     LLRTMFGGDQWQQFACQRLRPEISYFVGGFTVLDDREVALIDALHHLPRPLILYVTEV
                     DEAIRLREVLVEAGFAATECFHGDTSGADRRQLLLAWRGHQIEIMVATSAFGMGVDKA
                     DVRAVVHACYPENVHRYYQEVGRGGRDGAKSIALWMPVTPKDRKVATSLLPKMLGADL
                     ITLRWQTMMAAARDEDGGILNMPTNAKHQRLMGGRSYGENIRWNKRLLLMMARAGLID
                     LVDLQFEEDGAEPEGRVERVRLRCNVAPGDPRIADLLKAPRERDLSEAGRGITALDAY
                     LTGKAKICRLLRREYGAETIVACSGCIDCRDVPFDRHSIPALDFDPSRPTEPRLDIVS
                     LDIFSTGTKAIGVMADRVADLIGDRRLLHFLCAPDLLGPLTEALAERLVPASRHFYRL
                     DDAREIGRLNVDGSCHVVGLHGRTPDRAMLRLRAGARISHLFPKDAQITDANGRVLLT
                     QEGAFFFPSYDEWLIQV"
     gene            476422..477321
                     /locus_tag="USDA257_c04350"
     CDS             476422..477321
                     /locus_tag="USDA257_c04350"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49032.1"
                     /translation="MADTSMMFTDSEATPARVEMLLEVVRSMSGRRLDAPTIRQLLQP
                     EGLPGRTSTSDQAGRAITAARELDLIEDQADGMIRASRSRDHRSARMAVVEAVDEKVL
                     SDDKIEPWFGLFYAFLLGRDESAASGNEAGKHWEARFERELFGGAKQNNRFNDSKYRG
                     LRRWFRYCGLGWHDGDDRFHPNPYQRLTRKLPAIFGRGHDLSIDAFMERLSEQCPELD
                     GGHLFLRANPGWDRSARTISLGLSHALVDLHLDGALVLNCPLDSDGWSIAKAAPPRDK
                     DYLKSDLASSVCYIPVNGARASG"
     gene            477404..480391
                     /locus_tag="USDA257_c04360"
     CDS             477404..480391
                     /locus_tag="USDA257_c04360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49033.1"
                     /translation="MGDESTSRFLATHAPVSHVRGGERTLTDAEVFEQIVRLSARENV
                     VLVHGAPGTGKSHLINWVKLRYDHAVKSGQLSDVLPVLVRRRTGSLKDALEQLVEQLP
                     ARFHKYLEPVQAAIDRISEKEARKKLATELHLELGVRWEEAGKPPLPRTIRYLAEAFH
                     AEGFGAWLCREGGVIDRNIQQLISPSEVRDRESFPRFTADEFRIENLQQRSAGLNTAN
                     VRRLIDEFADEPESAEHAARLCNESLRAALRELTGLGNAALSTILRSIRQDLRKENKR
                     LILLIEDVSTLSVLDDEVVNAVEPQDDASLCDLTSILGMTEQAYQRLRDNQYQRIAGS
                     GLILSFPKDATAASWTDDSAEIDRFIARYLNAVRLPEPQVDLIANHRQQGGDVSISAC
                     DDCPVREACHASFGKVAFGDTAVGLFPFRPGTAPYLLNQLDDFQTGVRPTQRGLLDHV
                     TKPVMRHVDALAQGDRHPLTMPIRRQPPTDWQTLAETYLGGWPAADQARLRLLVEAWT
                     RKAKAPEIAADLKALLRPFSLPDFSAKTADAAPADQVRDKPHYPDPPPAPPSAPVDAA
                     TQKRLADLLNRLDRWWSGEKLETPRDYQEMLLAFLKGALPLDDIRSPAVPAQRLLREA
                     RRDSIRIEDAATQTALMRVAFSFVRNQESYDLLGALTHFTVEGRGTWDFPQGERYKRI
                     VARWLRKHQAGMLAALDPIGLSTTQPIKYATKFLCMSAMIERRAELPRDTPAALSRVT
                     SSEAITLPTVLTEPLRKLYDDLPERRRMLQSFLVEETNLPQGATGGIVVIDPQIITEA
                     ITDARTDPSIEPLSADYFANYWKSRYQAFDGLKGWAGLADAIASERKAIADLVGDIDY
                     VLARYGCETGGDYAGLVEFIADTARLIDLLRSAFRWPPSEIDFFKRERIVDRSGTFAQ
                     VLANAAAVAEGTKDTQVLLFDAAALQAVAAIIERCRLVVEAASEHAEAKLAHLSAEGD
                     PDVLESEIIAELARVGGIQEAWA"
     gene            480388..481071
                     /locus_tag="USDA257_c04370"
     CDS             480388..481071
                     /locus_tag="USDA257_c04370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49034.1"
                     /translation="MSRISDLVTRMAVIPDKERRAIQLGEMIAVRDKLRISADRAEEL
                     RSLSSALEPVGGTDFVERAKQGLAQASSSALRLKARLESGSGFDRKRSDEALTAINER
                     LENATAAINKGWRTLVDGHGTRFRPLAVAAERASLPGADKLNAAIVRLEEWRDCPPTT
                     PQEATAYVANAARIPASIAELGLEGRAGKFMVDAANGRARARDLQEAEVIAFLDAHPA
                     VWSLLKVGF"
     gene            481072..485637
                     /locus_tag="USDA257_c04380"
     CDS             481072..485637
                     /locus_tag="USDA257_c04380"
                     /codon_start=1
                     /transl_table=11
                     /product="putative helicase"
                     /protein_id="AFL49035.1"
                     /translation="MAAASPSFISDFLNFIEECEQRLQNWGFYDVAFDETDLSTLIES
                     DAPDQLRNAWEVLEADGLELGSLLTQMRRVDLLHLIPDGSGRVRSRFAEGLRLLAHLR
                     QRFSYQDWASGRRLVADMKLHLAPRRYPAIGIAADTAWAGMAPHAPQPAFQRAVFEAL
                     ASRPDGGTFTFAGFQVRSFERIFRSYGAEEQSGTVVCASTGAGKTKAFYIPAFTAIAA
                     ELGKPADRFTKVIAIYPRNVLLADQLREAIAEAGKLSPLLNANGRRPITVGALLGDLP
                     PADHFNLSDKSPFLKQWKRLHNRGWVVPFLRAPFHASRGELVWLDADRKAGRTRLYRV
                     DALDESPEIPDAVIQLTREGLQANPPDILFLSLEMMHRELGNPLWAKTFGIGVEEKPR
                     LFLFDEVHNYSGLSGAQAPWIIARWRQAARLKGLHVVGLSATLRDAPKHLATIGCVNP
                     ERVVECTPTNDELTPEGRDYTVIVKSDAASGASLLATSIQAAMLQSRLLTPTHVSYPP
                     RDSLAGRSLYLRKVFGFTDQLDSLNRWLPDLDDAEWNRLAQYRLPPDKSGQTVSQATQ
                     LAMLVDGQIWSLPDTLGYDLRQSARVSRCSSQDPGADTSSDIIVATASLEVGYDDPDV
                     GAVIHHKAPRSIASFLQRKGRAGRTRGSRPTTLVVLSDWGRDRWLFQNSERLFKPDVE
                     SIKVPLLNPYVQHVQATSFLLDWLGRRVGAADPVRYLRRPRQHDAAARGRAIALLRRL
                     LDLGDDYAAFHRELGWVVRHTQRFGSASDEDIDRVVDKMLWESPRPVLRHAVPSLLRK
                     LEAEWRFADPSRGNKLEDSGARQPLPSFIPAASFADLAASDVTVNFPGTTKDDETRGI
                     APQLIESCPGRVSKRFSVRRQERGYWLAGSELLLTAPSPVMLPARQLFPESIATGNDH
                     ASAALQPLRMALVERPGDVKDSSNAAWLWVSSAEHVGDGRSLPLFGRQYWQAIFKNTR
                     AYLHGDLNAVLIRRRASEGRFDILMNGGVERRGTILLASTSEDGEVVREPVGFEQTVD
                     ALVFQIREEHLRARPPLDDATMGRLRQDYFKHLLMGSSLLRETASSFTLEWVWQTSLA
                     MLTATALKGKCSLEAAQARLDGKRVAAIGRVLSRMFSVSALDDDDADDHHAGGKARQR
                     LEALWSNAACAAEIARAETALWANFGEDFEAWLRQRHLRTLAEACLSAAHAIATDVGE
                     SDLIVDVLDDGGDPLIVISESAPGGIGQIEAFVQMSLDGEGTFERALAHALAFCTRAH
                     ISESLIAVVAHARTSGVLADAFDAARLARGYQQTLSAQASLTAALEEAGLGASRQNIV
                     AVIGRLLQPSSDRTTDAWFDGLNRLWANREGRLGAPIDARVFAYLLVDSPYLRRRFSA
                     MIVRMTGQQPTEAQLFARIQDFLLPGCHDSCPQCLANTNRFARDIRPTRELTTQWLRA
                     SRPETPSLSVAPGWIERLYALLASEDRIEIIGGTDDLGEIARALQTLLTEPFERDYLL
                     VWPVLSGVSRDSDSWRVDVEIRNMGVR"
     gene            485637..486182
                     /locus_tag="USDA257_c04390"
     CDS             485637..486182
                     /locus_tag="USDA257_c04390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49036.1"
                     /translation="MRPVLQSRDIWTHGGGWPLPDLLRSALASLLLLGEHHRPAYFAS
                     PWITDFDLFDNRFRDFAALFPGLAEQPWIRFSDYLSVLSTKLDVRLLTTDNDRSGAFM
                     SIPALKHVSRVSYRLGDSKFHEKGILAPTFYIEGSMNITHHGVRVRGEKVVYHSVVGN
                     GVPPKIAAAYLEFDRHWKTLA"
     gene            486179..488257
                     /locus_tag="USDA257_c04400"
     CDS             486179..488257
                     /locus_tag="USDA257_c04400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49037.1"
                     /translation="MSGSGSIITVLDMFGARLPGDLAFSLSQCGSISADHPLAGEIAA
                     ALGGKAASLPYPRRQDFMWVTLAPTAEQLRCVIEDLRCWVLPSFGWESSPPIVSDGGP
                     AGRMGALLLAQSPQGYFRWHSRPADTDHVIARLATMRAVIAQAPARLSQLRPTLEMLR
                     RQFTLGLATGDRDMALQAIDEIDQRQLDTASNALSMSIRVAAAFGDDQAIVDHPQLDN
                     LLSMRVPQRVIESVLLAHHAVFLADLEAAGDIKAALAAYLPLHDRLSGLAGHPADDAD
                     TGIVRMAAYDAALAEDARRLHLLADRFAGDTVVAALVASPPPIAPLPILEPAGQPAPE
                     TEAQSVEPAFGEPLQPSVAELETVRVAPVAVTAEPALPLGWSDVPALVATSAREPLAA
                     LLQHAALMPDACDPGDGDFLIELLTDSEIIADTKKRAQADQVLTTVIDAYVCEERFPR
                     RERLGLYETVLDIWSSSRALSTDPIDGQLLLTMADALLRLNGHLEAAVATMITRWWEA
                     RPVRSRLAWLGEALELLTEQSSAQDYLGLWYAGAGLINVDHEGFSVADRYLWYRLGRR
                     LGLDGTATDEALGVDWLPLHSADDPLLAAGFRKIAIVSLHERAAREAAAQIEDRTQAH
                     VVLVTDHAAGEGTASAATADVILFVWGAAKHAVYRAFDKVRDRLEYVQGTGSASIVRA
                     LERRVRAAGG"
     gene            complement(488539..489102)
                     /locus_tag="USDA257_c04410"
     CDS             complement(488539..489102)
                     /locus_tag="USDA257_c04410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49038.1"
                     /translation="MNLTNKRWIEGGIFLVGFAACIPLANYMIGNVGTVCVPDGPCLI
                     PVGPGLTAPSGVLLVGLALVLRDLVQRRLGLLWAIGAIVIGAFLSTTFTPPALALASA
                     AAFLTSEVVDLLVFTPLQKKGLVKAAMASSIAGLIVDSIMFLWLAFGSLEFLAGQVVG
                     KTIMVIATLPVLYWMRDRDRRLGLLPA"
     gene            complement(489122..489823)
                     /gene="queC1"
                     /locus_tag="USDA257_c04420"
     CDS             complement(489122..489823)
                     /gene="queC1"
                     /locus_tag="USDA257_c04420"
                     /EC_number="6.3.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="7-cyano-7-deazaguanine synthase QueC"
                     /protein_id="AFL49039.1"
                     /translation="MTATALVLFSGGQDSTTCLAWALDRYDRVETVGFDYGQRHRIEL
                     ECRTKLRSELRDIGKKWAERLGDDHTISLGALGEISNTALTSDIAIEIADTGLPNTFV
                     PGRNLIFLTFAAALAYRRGLKHIVGGMCETDFSGYPDCRDDTIKALQVALNLGMERRF
                     VLDTPLMRIDKAETWRLAKRLGGSKLVDVIVRDSHTCYLGERGDLHDWGYGCGKCPAC
                     ELRASGYERFLAQEV"
     gene            complement(489843..490199)
                     /gene="queD"
                     /locus_tag="USDA257_c04430"
     CDS             complement(489843..490199)
                     /gene="queD"
                     /locus_tag="USDA257_c04430"
                     /EC_number="4.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="6-carboxy-5,6,7,8-tetrahydropterin synthase"
                     /protein_id="AFL49040.1"
                     /translation="MKITQAFTFEAAHRLPHVPATHKCHRMHGHSYRVELQLDGRVNP
                     DTGFVIDFFDVEKVFGPLLGQLDHHTLNDIAGLENPTAENIAAWIWERVKPLLGELSS
                     VRVFETPSCWAEYDGN"
     gene            complement(490196..490828)
                     /locus_tag="USDA257_c04440"
     CDS             complement(490196..490828)
                     /locus_tag="USDA257_c04440"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49041.1"
                     /translation="MSYAVKELFKTLQGEGAQAGRAAVFCRFSGCNLWSGREEDREKA
                     ICKFCDTDFIGTDGVGGGKYHDAESLSRSIATTWGESSRNRYVVFTGGEPLLQLDAEL
                     IDAVHQSGFEIAIETNGTLEPPAGIDWICVSPKAGAPLKLRSGSELKLVYPQPDLLPD
                     DLKDLQFDHYFLQPMDGPGRVENTAAVTEFCLQNPQWRLSLQTHKMIGIP"
     gene            complement(490825..491946)
                     /locus_tag="USDA257_c04450"
     CDS             complement(490825..491946)
                     /locus_tag="USDA257_c04450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49042.1"
                     /translation="MTALNFPAIRARQSETHTVLSFAALASELQKFALIERVARDAEG
                     ALSGFQRPQIAGHIREIRDYLEKPEAILPNPIVVAFTNSVKVKDERPDGRCTVEIDTA
                     YGAPGLVVDGQQRLTALGQVEEKDFQVFVSAIICRDDEELRRQFVLINNTRPLPKSLI
                     YELLPTVAGLPRRLGDRSVAAEIAARLNYDESSSLKGKIYQHTNPTGIIRDTAIQRVI
                     INSMSDGVMREMIREPDGNDLSFRLISEFYRAVQFVFRSEWEEHTPKTSRLVHGAGIM
                     ALGYVMEVLALLDGARTWQEFSRGLACLVDGTAWTSGEWNFADSDRRHWKSIQNVNRD
                     IVTLAQYLIGIVRADVKRRRSTPTDASADPKPPKVASAT"
     gene            complement(491864..493231)
                     /locus_tag="USDA257_c04460"
     CDS             complement(491864..493231)
                     /locus_tag="USDA257_c04460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49043.1"
                     /translation="MKFIFADSLDHVDPGYDFLRDRYSEGRTPYWDDAYPHEIMGYAP
                     YKGMLVSRGIVGGAAVGGKYTEAQAMRFRRVGAREFLRLDKPQFKELPIFGDCGAFTY
                     HKEDKPPYTPEDTAEFYDDAKFTHGCSVDHIIFDFDESLKGFEGGTEEARRRFEITLE
                     NASAFRSATAHMSGRFTPMGVIQGWSPGSMAEGARRLVSMGYDYLALGGTVPLKASQI
                     KACLAAIRAVVPEKTQLHILGFAKADEIDTFGPFKITSFDTTSPLIRAFKDAKANYYL
                     PTTSGKLEYYTAIRVPQALENPKLIRLAKRGSLKQEQLVSMEKDALAALRSYDRGEAQ
                     LDETLDIVLAYAAPAVMGAPLEELPDAKAVKDLGERYRRTLSDRPWRKCSCAICQALS
                     IEVVLFRASNRNKRRGIHNLGVYNALVNQLPANSDRNDSTQFSSDSSQAERNAHSSFL
                     CSASV"
     gene            complement(493228..494409)
                     /locus_tag="USDA257_c04470"
     CDS             complement(493228..494409)
                     /locus_tag="USDA257_c04470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49044.1"
                     /translation="MRAAPIFPIGRSCTWRKDAAMSDSQHIAVRAVKTQQGYGTDVYA
                     FFLPGSDVMKIAEISRIKRDEAELQGFQRQEIRSHVNSIVEFLDSGPVLFPNAIILAL
                     SDEVAFTAARGSKPSEAVEIVTSGTLRIPVRSEGKKVAWIVDGQQRSLALSRAKNKDI
                     PVPIIAFVSQNIEVQRQQFILVNKVKALDTRLINELLPEVSTLLPRDLAANKLPSELC
                     NLLNTHKDSPFFQLIKRRSDQKASSAVVSDSALIAAIKANLKAPTSALSQYTGPDGTS
                     DADEMFHVLVKYWSAVRDTFPEAWGKSPEKSRLMHMAGIRAMGSLMDPIMLRAESVSD
                     AEEDIRRSLERLRPYCCWTDGKWDELGWKWNDVQGTSQHIDRLSQYLIQLDRKLSKAS
                     R"
     gene            complement(495687..496208)
                     /locus_tag="USDA257_c04480"
     CDS             complement(495687..496208)
                     /locus_tag="USDA257_c04480"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase mutator type"
                     /protein_id="AFL49045.1"
                     /translation="MELACRWLPHSSADDWFFNSPRVHFARNVLAHAGKSGRRVVSAF
                     IATAFAQETAEAASLQWRAVADQIRPKVPKLAAIMDEAEHDVLAYMSFPKEHRVKLHS
                     INPIERLNGEIKRRTEVVGIFPNDDAIVRLVGALLLEQNDEWAVQRARYMTLETISQM
                     SDDPLISLPAVAR"
     gene            complement(496177..497574)
                     /locus_tag="USDA257_c04490"
     CDS             complement(496177..497574)
                     /locus_tag="USDA257_c04490"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, mutator type"
                     /protein_id="AFL49046.1"
                     /translation="MLGRKERDQLELYMCGSLRDLVPDDHVLVKVDRVLDLSWLHEEV
                     AELYAAGFGRPGIDPEVAVRLMLAGFLLGIVHDRRLMREAQVNIAIRWFIGFGLHEAL
                     PDHSSLTRIRQRWGAERFRTIFERTVKVCVAAKVAKGEVVHVDASLIRADVSWESLAV
                     RHIDAVTDANEAAESERKSRKTGKYKKVCVTDPDASMATNGRNRRLEPAYKQHAVVDD
                     ACGVILDVEVTTGEINEGQVILSRLDAVAAMTGTIIKTATADAGYAYAKVFAGMEQRA
                     IEAVIPAKAEPIRSPVPMRRFRYDAKHDTLKCPRGKMLKAGRAVKHGRFFTSRAADCR
                     HCDLARLCLSNGRVNKAVVLGDDYPALLRARRRRERWSDEDRALYQRHRWRSEGYHGE
                     AKTWHGLSRAIRRGLINMKIQAYLTAAAVNLKRLASAFLSILLFVYSQEATSSARHPF
                     RQRKVFGIGLSVASA"
     gene            complement(497561..498112)
                     /locus_tag="USDA257_c04500"
     CDS             complement(497561..498112)
                     /locus_tag="USDA257_c04500"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="AFL49047.1"
                     /translation="MAEKALTAVIQEAYIQGISTRSVDDLVKAMGMSGVSKSQVSRLC
                     EEIDGKVKAFLDRPIEGDWPYLWVDATYLKVRRGGRIVSVAVIIAVGVNTDGRREVLG
                     MEVGTSEAEPIWTEFLRKLTRRGLRGVRLVVSDAHEGIKAAVSKVLCATWQRCRVGLL
                     KKCYVSDSIEQSLILWSLHDARP"
     gene            complement(498094..498387)
                     /locus_tag="USDA257_c04510"
     CDS             complement(498094..498387)
                     /locus_tag="USDA257_c04510"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="AFL49048.1"
                     /translation="MTDAMMNLRMLVEKTPDADILREMIGFAAERLMEMEVGASTGAG
                     YGEKNPLRTAQRNGYRDRDWETRAGTVELRIPSSGKAPTSLRSWSRGAWLRRR"
     gene            499686..499817
                     /locus_tag="USDA257_c04520"
     CDS             499686..499817
                     /locus_tag="USDA257_c04520"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49049.1"
                     /translation="MSKYEGLTQRLAKETLSEIILTFAEIETAAGVNLPKSARLPQY"
     gene            complement(500569..500700)
                     /locus_tag="USDA257_c04530"
     CDS             complement(500569..500700)
                     /locus_tag="USDA257_c04530"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49050.1"
                     /translation="MRFVGRNLKIRQTKLLNLRVDEVLDGGPTFYVLLIRDQENSVF"
     gene            501252..501386
                     /locus_tag="USDA257_c04540"
     CDS             501252..501386
                     /locus_tag="USDA257_c04540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49051.1"
                     /translation="MERRLSAILAADVVGYSTLMERDEAGTFDRLRVSANFPAPSVMV
                     "
     gene            501428..501895
                     /locus_tag="USDA257_c04550"
     CDS             501428..501895
                     /locus_tag="USDA257_c04550"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="AFL49052.1"
                     /translation="MMEEGQKLVVRLVGRNGRRRFDPASKDRLISACLEPGASVSKLA
                     LEHGVNANLVWKWIKKAKEFRALPPSSTSAFLPVQITAASSLPMQSSAFALEMPATDG
                     EERRSQSERIDRLSSPAKVSASLPNGVKLTLECSDVDVLAAIIGALGHVQTGR"
     gene            501876..502229
                     /locus_tag="USDA257_c04560"
     CDS             501876..502229
                     /locus_tag="USDA257_c04560"
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 Orf2 family protein"
                     /protein_id="AFL49053.1"
                     /translation="MFRLGADLQVYLHREPIDFRAGINSLAVLVQETMALDPFAPAVF
                     AFCNRRRDRMKLLFFDRSGFVLVLKRLTEDKFRWPRREVAVVTVTTEQLHWILDGIDI
                     DAMVRHPVRQYQVAG"
     gene            502283..503875
                     /locus_tag="USDA257_c04570"
     CDS             502283..503875
                     /locus_tag="USDA257_c04570"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein y4jD"
                     /protein_id="AFL49054.1"
                     /translation="MNRTGEPSVAELMAQLAANAAEIAALKAEKETLSQRVVKLEEEL
                     ALARLHRFAPRSEKHVDRIFNEAEEAADEDGADSHESEVIDIPDTGLPPVESTTGQKR
                     GRRPLPQNLPRERVEYDLPDDQKACPCCRGQMHRMGEAVTEQLHIEVKAKVLQNVRFK
                     YACRHCDRTGINTPVVTAPMPVQPLPGSIATASTLAFALVHKYVDGTPLYRLAQTFER
                     AGVPVSRGALGHWVIGSSEKHLHRIYDALKLRLRSQPLIHGDETTVQVLKEKDKEATS
                     TSYMWAYRSGDDSDEPIVLLDYQPGRGQIHPQTFLGDYRGILMSDGYTAWRTLDGAIH
                     IGCMAHSRRRFVDALKARKKGGGPPEQALRFFEQLYRVERQARDKKPDAGETKADSVR
                     RFRQQHSIPVLTALKVWLDEIAPKVMPDTKLGDAVSYTLNQWDYLTRYTDDGRMPIDN
                     NILERDIRVFATGRKSWLFSDTTDGAKASAVIYSLMLTCRACGVEPLTWLRHVLTELP
                     QRAGDADIDDLLPFNFTQTATA"
     gene            503927..505705
                     /gene="cya32"
                     /locus_tag="USDA257_c04580"
     CDS             503927..505705
                     /gene="cya32"
                     /locus_tag="USDA257_c04580"
                     /EC_number="4.6.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="putative adenylate cyclase 3"
                     /protein_id="AFL49055.1"
                     /translation="MRGKSRLRLRARRIELFEPEIARHHGRIFKLMGDGLLAEFGSVV
                     EAVECAVSLQRGMAERNAAVTEEERFDVRIGINIGEVIVEGEDRYGEGVNVAARLEQL
                     APPGGIYVSGKVAKEVEKKLAFVFDPAGQRKVKNIDEPVDVYQVRIDAPSRRRAFLKR
                     KPAYLWWTLGVPGAIVVLVAAWITFYHPLTATSPVSATMPAVAVLPFKDLSPDKSLGY
                     LGDGVANDIITVLSRFPDIAVVSRTSSFGYKDKEGDVRQIGKDLGVEYILEGSVRKEG
                     ERIRIIAELIDAKTGDHVWADHFDRAGPDPWALQDEMTGKIVGAMTGETGAIRRADYN
                     RAWGKDSTNLQEYDYYLRGHSQLMTYTMEGIEQSELILREGLKTFPESPLLLVNLGWA
                     AMIKVLAFFNEPEANIEEAGRLANQVLSSERLSPQVAKAAHWLHAWVLILRGNHDGAV
                     AEANKAISMAPYDALQLSDTAYIFLQAGDPEKALELADIAAERDPSLSWSFNLSRGWA
                     LILLGRYEDAVEPLKATELSDAPLALAIAYMRLGRTADAKAAVEKMLKANPKITIQTW
                     RQTLNFRDPSILDQLAADLARAGLPE"
     gene            complement(505713..505877)
                     /locus_tag="USDA257_c04590"
     CDS             complement(505713..505877)
                     /locus_tag="USDA257_c04590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49056.1"
                     /translation="MPDMPRAEPSLPLEFLVVEGRSIDPPNSPSSVLLHEGGQLSARS
                     CLHPTIWKDC"
     gene            complement(506190..506597)
                     /locus_tag="USDA257_c04600"
     CDS             complement(506190..506597)
                     /locus_tag="USDA257_c04600"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49057.1"
                     /translation="MAIIEQRLAAMGLERKFARGCVCVSPGYRVRGTRAYISGHVACN
                     KDGTLAKPLGKVGTEVSPRAGLRVSAARCPGPSREPQTGGRIPRSGYGLGLRVFAMVN
                     VAPGFNEMPLVTNGYSDLILDPIGGPTLAPTSL"
     gene            complement(506617..507051)
                     /locus_tag="USDA257_c04610"
     CDS             complement(506617..507051)
                     /locus_tag="USDA257_c04610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49058.1"
                     /translation="MRNEAMQPKNVHALTAKIVRGSDSYVAEQGSVYRSGVSAESVGS
                     SMLWLGTISLPAGRRTSAHRHRGHETALLMTAGKEIEIWSGAALERCETVLPGDYLFI
                     PAGVPHVAVNRSTENAEFLGARNDPAANESVVLMPELDEIVP"
     gene            507090..508742
                     /gene="cya33"
                     /locus_tag="USDA257_c04620"
     CDS             507090..508742
                     /gene="cya33"
                     /locus_tag="USDA257_c04620"
                     /EC_number="4.6.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="putative adenylate cyclase 3"
                     /protein_id="AFL49059.1"
                     /translation="MRGAGASPETRAEKFRKTTKSGVSFPIMNTQHLVFGPFEFITEN
                     GCLLRDNRPVAIGARGASLLAVLLAADGRVVTKSALMDAVWPGLAVEESNLSVQIAAL
                     RKLLGPASDDGDWIVTVPRVGYRFSGPVESRTDGSGSEGHVEARSSPAIAVLPFENLS
                     GEAERQYLADGIADDLIMALARFRWFRVASRGASFARRNGSRDPNSIAHELGVDFLVD
                     GAIRRTGDRMRISVHLADAVKGATIWSEHYDLQVAEVFAVQDAIAERIAAAVEPELLL
                     RHGLQVAPHTGNVTAWDLVRQGTFNFHKVTQPTHLLARRFFREAAELDPMLPEAQIWR
                     ARVNAGLIAYGWTENPAADAKEGLDAALRAIYLDARNPYAHYALAIVSAYTGRADQAI
                     LAAERSIDLGPSFALGYLVLGMARLFVGDAAGARKPLARGLELNPHDPQNAVWFSLLM
                     LALFFSGEVEGALDTGRAGLKARPDWPALLRIQACCHTALGHRQEALRFAAAAGDLPE
                     PAGDALGPFRDGNKEWATCLEGLLREAEHQTTDSGRNAIFPE"
     gene            complement(509167..509829)
                     /locus_tag="USDA257_c04630"
     CDS             complement(509167..509829)
                     /locus_tag="USDA257_c04630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49060.1"
                     /translation="MGTTSRPRTTGVRQFLDLEQQRDWIEGKADFPDAGDRSECLEQR
                     FKYVARFEKLLCRPQAREVLEILGLYGPNCIPIPRKTERYYWSVSCLPSTSDKPLVRV
                     NASWMELFTLYAHGEDVRARFIVHLSDFTTDRSATPSRVNEPFLEQSVAMPEDVSYFF
                     PRGADIFGINVRGSVSIRKLLGSRRVLRAIRTFNLTHMNRGRNAYQASHCYSVADYMQ
                     AG"
     gene            510211..511098
                     /locus_tag="USDA257_c04640"
     CDS             510211..511098
                     /locus_tag="USDA257_c04640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49061.1"
                     /translation="MEELVEITTKYQPAYIERCFNSIAGLHEFSVTFYQDVGNLYDAL
                     TRLKNVDRNPTGFSIDDAPILGLLVRISKLVKEVVKYYEQDNAEIIGVLERPMIEGSI
                     IATYLMLNGTDAITDYRKCSYKDRLRILRDLENGSPFFDTKAGKRLLAAVREKMRFEG
                     LTKDDFAAQKKNGWKLQGKNFRTIFAEIEHDDLYASTYGMMSESIHGSWNESMDWGLV
                     RNDDGTFSAFTDYHPADIRFMAPVLNFTIRPFRMWLERIDVHDDNIKGTMDWIERVNT
                     RLFRTFDGLYAGEYDAKRG"
     gene            511764..512090
                     /locus_tag="USDA257_c04650"
     CDS             511764..512090
                     /locus_tag="USDA257_c04650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49062.1"
                     /translation="MTKLPRHMRHISDEEEAEIQRKIASDPEAPEATDEELAQARPFA
                     EVFPDLAESIKRARGRPAVENPRKQISLRLDPDIIEHYKRKCGKGWQNRMNDDLRKAA
                     GLKKAG"
     gene            512337..512666
                     /locus_tag="USDA257_c04660"
     CDS             512337..512666
                     /locus_tag="USDA257_c04660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49063.1"
                     /translation="MADFKAEFVEAVRRAESGEDVETAYSLEFASYEHMHSVLAPARL
                     DIVKALARQGLLSTHEVSRRANRDVQAVNRDVTTLINAGVIDRTESGIEFPYDGIHFE
                     FDMNVTA"
     gene            512663..513211
                     /locus_tag="USDA257_c04670"
     CDS             512663..513211
                     /locus_tag="USDA257_c04670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49064.1"
                     /translation="MSIYLALVEPGNETTAHGIAFPDLPGVHSAADEAVDILPNALEA
                     LQLWAEDGDMPLPSDIAAIINRDDIRKALAAGSFLLAVPFTRKATGMKPYDFNIGDEF
                     VMANGWRWRVTDIGTRVVVAIRIQPLVLQSTRDGKVRREEISEIEAEHYGWFDGPPYA
                     VAEQVFDECDLEGIEEICRKEA"
     gene            513193..513345
                     /locus_tag="USDA257_c04680"
     CDS             513193..513345
                     /locus_tag="USDA257_c04680"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49065.1"
                     /translation="MPQGSMMARLRHRMKTIRFDIQDFIKTGERRAGIWRPFLRTATL
                     KRSRWL"
     gene            complement(514083..514156)
                     /gene="trnQ1"
                     /locus_tag="USDA257_c04690"
                     /note="tRNA-Gln-CTG"
     tRNA            complement(514083..514156)
                     /gene="trnQ1"
                     /locus_tag="USDA257_c04690"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAG"
     gene            514483..515979
                     /gene="gppA"
                     /locus_tag="USDA257_c04700"
     CDS             514483..515979
                     /gene="gppA"
                     /locus_tag="USDA257_c04700"
                     /EC_number="3.6.1.40"
                     /codon_start=1
                     /transl_table=11
                     /product="guanosine-5'-triphosphate,3'-diphosphate
                     pyrophosphatase"
                     /protein_id="AFL49066.1"
                     /translation="MPRGGKGKRRRRKPTGLSSAIASRSGLPGEAGRPAALNEAEPAR
                     KRKRRRRSKAARPQGQAPAAVSGAAAAHETPITDKKGQKRGKKARHRRGLQGRPLATG
                     GKPLAAERPAETQRPRDVSAAPQQSRKDELRAPYVAPSEPPAPLYAALDLGTNNCRLL
                     VAQPTRPGQFRVVDAFSRIVRLGEGLGASGRLSDGAMERSVEALKICAGKLNARSIRR
                     RRLIATEAARAAENGETFLQRVAEETGLDLEIIDRETEARLAVSGCSSLVDRETKSVV
                     LFDIGGGSSEIAVIRIGDNRSSRLANHITHWTSLPVGVVTLSERHGGEHVTPQSFETM
                     VREVEGMLDRFDGPSVETLDNAAGSGFHLIGTSGTVTTLAGVHLDLPRYDRRRVDGLW
                     LSDDEVSAMQARLLSWDFAARAANPCIGPDRADLVLAGCAILEAIRRRWPSTRMRVAD
                     RGLREGLLTDMMADDGAWRRARPRRYQRGPGHAPAGEERQRPHEGNKA"
     gene            515976..516713
                     /gene="rlmE"
                     /locus_tag="USDA257_c04710"
     CDS             515976..516713
                     /gene="rlmE"
                     /locus_tag="USDA257_c04710"
                     /EC_number="2.1.1.166"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA large subunit methyltransferase E"
                     /protein_id="AFL49067.1"
                     /translation="MTKSPIGGNRSGRKLGQKVKKGKLKASSRRWLERHINDPYVQRA
                     QLEGYRARAAFKLLEIDEKHKILSGARRIIDLGAAPGSWSQIAAKVTNSTDADPRVAA
                     IDFLEMDPIPGVRFLQMDFLDPQSPEKLKEAIGGTPDLVLSDMAAPTTGHRQTDHLRT
                     MHLCEVAAYFAVDVLAKGGHFLAKTFQGGTERDLLNMLKQNFRQVIHVKPASSRAESV
                     EMFLLAKGFKGRQAAASEEASEDAAAE"
     gene            516718..517101
                     /locus_tag="USDA257_c04720"
     CDS             516718..517101
                     /locus_tag="USDA257_c04720"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="AFL49068.1"
                     /translation="MLLYVTLGTNDLRRAGAFYDKTLATLGLKRRKEDEVEIGYGAED
                     DFRCRLWLVTPFNRKAATIGNGSMVALEVESRAAVDAFYAAALASGGTDEGAPGLRPF
                     HPNFYAAYVRDPDGNKLSAVCERPE"
     gene            complement(517118..518527)
                     /gene="hsrA"
                     /locus_tag="USDA257_c04730"
     CDS             complement(517118..518527)
                     /gene="hsrA"
                     /locus_tag="USDA257_c04730"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transport protein HsrA"
                     /protein_id="AFL49069.1"
                     /translation="MNRIVPIILAVALFMEQMDSTVISTSLPAIAHDIGVGPITLKLA
                     LTAYMVALAIFIPLSGWMADRFGAKRIFRAAILVFIVGSVFCAVADSLVAFVLSRFLQ
                     GMGGAMMTPVARLVLVRGTPRSELVSAMALLTIPALVGPLAGPPLGGFITTYFSWHWI
                     FLINVPVGIAGYVLSGIYLPEMERRNPPPVDILGFLLGGIAASGIVFGLSVISLPALP
                     PAIGIASVSTGVAATFLYIFHARRHPAPVLDLRLFRDSAFRVASIGGTIFRISVGAVP
                     FLMPLMLQIGFGLNPFQSGLITFIGAVGAITTKFLARRVLAFAGFRTTLIVAAAIAAV
                     TTFANGFFTPATPYLAMLLILLVAGFARSFFFTSVNALSFADIEDEDASKATSMSAVL
                     QQISLALGVAVAGAILEIETSISGGPLALDDFHIAFMIIAVANLLAAIPFLTMAKNAG
                     ASVSGHRKAIREAEATAGK"
     gene            518724..519707
                     /locus_tag="USDA257_c04740"
     CDS             518724..519707
                     /locus_tag="USDA257_c04740"
                     /codon_start=1
                     /transl_table=11
                     /product="metallo-beta-lactamase family protein"
                     /protein_id="AFL49070.1"
                     /translation="MIRHSLKRRTLFGAGAAALAAPGLLAGIANAQENAENGALTKDS
                     AFKTFKLGTFKVTVISDGTRASENPHETYGTNQPADAVSALLEQNFLPTSGFINGFSP
                     VLVDTGSHVVLFDTGLGEAGRETGTGKLAEGIRAAGYGPEQVSVVVITHMHGDHIGGL
                     MEGGKPAFPSARYVTGQMEFDFWKDGARVGTPAENGHKAVLQNVVPLEEKTTFIADGA
                     EVVSGITAIAAFGHSPGHMIYRLESEGKALILTADTANHYVLSLQRPDWEVRFDMDKA
                     AAGATRRKVFDMIATDRLPFIGYHMPFPAVGFVERQDQGYRFVPVTYQFDI"
     gene            519897..521399
                     /gene="guaB"
                     /locus_tag="USDA257_c04750"
     CDS             519897..521399
                     /gene="guaB"
                     /locus_tag="USDA257_c04750"
                     /EC_number="1.1.1.205"
                     /codon_start=1
                     /transl_table=11
                     /product="inosine-5'-monophosphate dehydrogenase GuaB"
                     /protein_id="AFL49071.1"
                     /translation="MARIIETATGLEALTFDDVLLQPGHSEVMPGQTNIATRIAQDID
                     LNLPILSAAMDTVTEARLAIAMAQAGGIGVIHRNLTPAEQAEEVRQVKKFESGMVVNP
                     VTIGPDATLADALGLMKAHGISGIPVVENGGSGGQKQGRLVGILTNRDVRFASDPAQK
                     IYELMTRENLITVKENVDQQEAKRLLHKHRIEKLLVVDPEGRCVGLITVKDIEKSQLN
                     PNASKDSQGRLRAAAAVSVGDDGFERAERLIDAGVDLIVVDTAHGHSQRVLDAVGRVK
                     KLSNSVRIMAGNVATADGTKALIDAGADAVKVGIGPGSICTTRIVAGVGVPQLAAIMA
                     AVEAGQALDIPIIADGGIKYSGDLAKAIAAGASAVMVGSLLAGTEESPGEVFLYQGRS
                     FKAYRGMGSVGAMARGSADRYFQAEVRDTLKLVPEGIEGQVPYKGAVGGVLHQLAGGL
                     RASMGYVGGATIKDYQERATFVRISGAGLRESHAHDVTITRESPNYPGAA"
     gene            521470..521886
                     /locus_tag="USDA257_c04760"
     CDS             521470..521886
                     /locus_tag="USDA257_c04760"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49072.1"
                     /translation="MTGFEIFWPVVAHVALVFMLYALLSMRRSAVVRAGKAQASQFRE
                     NRQEPSESLVVRNSIANQFELPVLFHACCVLLYVTEADNLLSVGLAWLFVALRYAHAF
                     VHVTSNRLRHRGPLFLAGFVTLAAMWAWLSLWMAMN"
     gene            522044..522919
                     /gene="yghX"
                     /locus_tag="USDA257_c04770"
     CDS             522044..522919
                     /gene="yghX"
                     /locus_tag="USDA257_c04770"
                     /codon_start=1
                     /transl_table=11
                     /product="putative uncharacterized protein yghX"
                     /protein_id="AFL49073.1"
                     /translation="MNKPVITQAMIDAYDEYTHLTLDRRRFMERLTALAGTAAAAAAI
                     APMLAANSAKAEMVAATDERIKGEDITYPGADGEMKGYLVKPANASGKLPAVIIIHEN
                     RGLNPHIKDVARRAALDGFLALAPDFLSPDGGTPADEDKAREMIGALDAGKANSNAVA
                     TVTFLKGHAESTGNIGAIGFCWGGGMVNRLAVNSPDLKAGVAYYGSQPKAEDVPKIKA
                     AMLLHYAGLDVRINAGIDAYRKALTENGKDATIYVYDGVNHAFNNDTSAARYDKAAAD
                     LAWGRTIEFLKTKLA"
     gene            complement(522958..523875)
                     /gene="oxyR"
                     /locus_tag="USDA257_c04780"
     CDS             complement(522958..523875)
                     /gene="oxyR"
                     /locus_tag="USDA257_c04780"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogen peroxide-inducible genes activator"
                     /protein_id="AFL49074.1"
                     /translation="MLTLRQMRYFDALATARHFGRAAELAHVSQPALSAQIMEMEGHL
                     GVKLVERSRGGVFLTGKGEDVLARVRAILSDVDRLEESARANSGTLEGRVRLGIIPTL
                     APYLVPQLIPYLRARYAGIEIELKESLTDRLVADLGDGRLDAIVAALPIDADGITTRP
                     LFSDRFYMAVADNDRNVLMSPLTEAQVDISQLLLLEEGHCLRDQALAVCNTAGKRQLM
                     SFGATSMATLLQMVANGMGMTLIPEIAIPSEAARNAIRIVPFAAPGPAREIGLIWRRS
                     NPRRRDMDALAEAIVDCARSISKETDATG"
     gene            complement(523989..524939)
                     /gene="dgdR1"
                     /locus_tag="USDA257_c04790"
     CDS             complement(523989..524939)
                     /gene="dgdR1"
                     /locus_tag="USDA257_c04790"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator DgdR"
                     /protein_id="AFL49075.1"
                     /translation="MSAPLDIDQLQTFVAIADTGSFTKAADRVFKTQSAVSMQMRRLE
                     ERIGKPLFIKDGRGNRLTVEGDRLLNFARRMLRLNNEAIASFDDNRLEGTLRIGTPDD
                     YADRYMPEIIVRFAKTHPNVELYIVCEPSADLAEKMAKGDLDIALVTHNPRARASDVV
                     RTEPLCWVSSINHPLPENAPIPLAVGRRDCLWRQAACAALDATGREYQILFTSWSSTV
                     VAAAVLAGMAVSVLPESALRPGMKVLTLADGFPALAPVQIGIMKRPGLSPSLSNAITS
                     HITACLDNITPIAVNDDLDNDIKGYPRYPRLRQSHMLPGW"
     gene            525146..525442
                     /locus_tag="USDA257_c04800"
     CDS             525146..525442
                     /locus_tag="USDA257_c04800"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49076.1"
                     /translation="MRTTQHALDLDLAAGKPSLASRTAGVIGVLTAVWRLYRNRCQIA
                     RLHDLDDRQLLDMGLKREDLHEAMTSSFFENPGSFLTRASRNRACLFYRGVRHD"
     gene            complement(525739..526557)
                     /locus_tag="USDA257_c04810"
     CDS             complement(525739..526557)
                     /locus_tag="USDA257_c04810"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49077.1"
                     /translation="MAPLFDMFAQAQNGQAIDLMAKQFGLAQEQMAKATAALMPAFST
                     GFKRNTANPYDFGALLTALSTGNYVKYFEDMRQAFTPQGVADGNDILGQLFGSKEMSR
                     AIAAQAAQMTGIGQEVYKQMLPVMATTLMGGLFKETTSQVNEALANNPMMTLMRQWME
                     ATGFAKKPEPIPNPFDNPFTQAMQGFFSAGKTQEKAKTPDLFADNPFFKAYQDMMRSS
                     SSAAEKPPQENPAFAQFSQMMNSMFDTGLEMQKEYQKNIDALFESYTKGSEDKA"
     gene            complement(526658..528031)
                     /gene="gshA"
                     /locus_tag="USDA257_c04820"
     CDS             complement(526658..528031)
                     /gene="gshA"
                     /locus_tag="USDA257_c04820"
                     /EC_number="6.3.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase GshA"
                     /protein_id="AFL49078.1"
                     /translation="MARDTTDQTPVTSVADLTAYLASGSKPKERFRIGTEHEKFAFFK
                     ADNSPVPYFGEASIQALLKGMAERNGWEPIVDEGNIIGLAEREGNGAISLEPGGQFEL
                     SGAPLENLHQTCKESNQHLAVLREIAEPLGIRFLGIGGSPKWTFEETPRMPKSRYAIM
                     TRYMPKVGTQGLDMMYRTCTIQVNLDFSSEEDMRRKMQVSMKLQSLATALFASSPFTE
                     GKPNGLLSWRGEIWRDTDNRRAGLLPASFRPDFGFADYVEWALDVPMYFVVRDGHYHD
                     CTHVTFRQFMNGALKGEIADWQPTMGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRI
                     CALPAFWVGLLYDEQALADAEALTRDWSYDEVQALRDAVPAEGLAAKFRTASLLDIAR
                     EVLAISRAGLRRRNRLNGDGINESHFLEPLDEVLAKKATLAEDLLALYNGRWNRSVDP
                     VFTEYQY"
     gene            528047..528181
                     /locus_tag="USDA257_c04830"
     CDS             528047..528181
                     /locus_tag="USDA257_c04830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49079.1"
                     /translation="MCGIPPAAGLDGGCLNRNQVRCKSISFKMPSKKLRASPPPSHAL
                     "
     gene            complement(528210..528947)
                     /locus_tag="USDA257_c04840"
     CDS             complement(528210..528947)
                     /locus_tag="USDA257_c04840"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49080.1"
                     /translation="MRANFRMQRLFVGSPLHTGARHEATKEQFNYLVNVLRLDESSSI
                     LLFNGRDGEWRAELSLPSRKHLVLTATEQTRPQPAPSDLAYLFAPLKVGRLDYLVQKA
                     VEMGAGVLQPVMTQHVQGKLGNLDRLRANVIEAAEQCGVLGIPEVETPRKLEELLANW
                     PRDRRIIFCDESNESQNPLPILGGISERRLALLIGPEGGFSEAERVLLRSLDFVTAIP
                     LGPRILRADTAAVAALALIQATLGDWK"
     gene            complement(528959..530461)
                     /locus_tag="USDA257_c04850"
     CDS             complement(528959..530461)
                     /locus_tag="USDA257_c04850"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphate permease"
                     /protein_id="AFL49081.1"
                     /translation="MARPRLEKLTLDKDLDKVSLAEEASQFVMRGLAAPGFGLLFLIL
                     SMAFAASYFTGASGTAIVVAGAAVAAYMAMNIGANDVTNNVGAAVGAKAMTMATALGI
                     AAVFEIAGAVIAGRKVTLTIEAGIIDGARLLSPEILVWVMMAALLSAAVWINIATYAR
                     APVSTTHSIVGGIIGAGLAAEGFASVKWWTIAGITASWSVSPLLGGTIAALFLAFLKE
                     FIIYRDDKIEAARLWMPIVLGVTAGAFTAYVATFGLAHLQVISLRTGLLIGAFAGIAC
                     YGLCKPWIHRQSEGLENRNQSLRKLFRLPLIFSAALLSFAHGANDVSNAIGPLSAIVS
                     AVNGTMSTARSLAPFWVLLIGAFGIALGLLLYGPILIRVVGEEITRLNPMRAFCVALA
                     TAVTVLLASALGLPISSTHTAVGAVFGVGFFREWYTRHSRRRLQHVRRKSGKSDFMEE
                     AIETNFAEVRRRRLVRRSYFLTIVAAWVITLPASALLSALFYRLLAGLFL"
     gene            complement(530576..531268)
                     /locus_tag="USDA257_c04860"
     CDS             complement(530576..531268)
                     /locus_tag="USDA257_c04860"
                     /codon_start=1
                     /transl_table=11
                     /product="putative NTP pyrophosphohydrolase protein,
                     MuT/nudix family"
                     /protein_id="AFL49082.1"
                     /translation="MSLSGKRRGEALHVFATRFRSRNHNACYRLLIGGRHLHASQTRH
                     NFEWLILRNVIRRGVSIPLNLLHRLASDVHLMLRRPARMQYAALCYRIRKKTKSPEIL
                     LLTSRDTGRWVIPKGWPMQGKWAHEVAEREAYEEAGVKGTVQKAAIGSYVYQKRMDHG
                     LKIPCKVQVHALEVDNLCKNFPEKGERKLEWVDYEEAARRVAEPSLKELILGFGKRMA
                     AARPPQPAASED"
     gene            complement(531337..532158)
                     /gene="pdhR"
                     /locus_tag="USDA257_c04870"
     CDS             complement(531337..532158)
                     /gene="pdhR"
                     /locus_tag="USDA257_c04870"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase complex repressor"
                     /protein_id="AFL49083.1"
                     /translation="MRVPSVGEFAVTEDQSDLYARISHSRTADEVVQQIELLILEGVL
                     RDGDRLPGERDLSKRLDVSRPILREALKELEARGLVESRHGGGTFVADVVGQIFSKPL
                     IELIGRHHKATQDYLEYRRELEGLTAELAATRATDFDRDLLTRLIERMREAHASGNFD
                     DELEADVELHNAIGESAHNIILLHTLRACYRLLTQGIFFHRSSVFGAPGARDRLLAQH
                     EAIYTAIMARDPDAAKAAAQSHIDFVAAAAREAERSGEWARIARLRLKQRDRAGS"
     gene            532339..533613
                     /locus_tag="USDA257_c04880"
     CDS             532339..533613
                     /locus_tag="USDA257_c04880"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="AFL49084.1"
                     /translation="MAKASFGFPAAPLRAQALGEIHSRPYALVTTPRVIFQLAFITEG
                     GSTVDHAVLAELSRSRGIAPPGRDANHHAMPWGQGTLRWERHTEFSTYFWDAPAPERF
                     GGEVPIHPFGDGFSPPGLLIAGIRLEIRPDTPETREAIKAFDPTSLCYSETKNGQAVL
                     LTDFRQNGDGLTQILIIDRGMTEAGTGALVQRLLDIETYRTLAMLGLPLAQSLSPAIR
                     RTEDGLTAVTQRMKENVREEADEMLAEITRLAADLEAGAALSLYRFGASRAYYGIVQE
                     RIRTLSEMPVPGYETIGTFLERRLAPAMRTCQSVEERQANLSRKLARATALLRSWIDV
                     ELERQNSALLNSMDRRAKLQLRLQQTVEGLSVAAISYYVIGLFGYLAKAVSHEIPVDP
                     GVLTGLAVPFVVTGVWLIVRRIRRHHEESAQK"
     gene            complement(533626..534522)
                     /gene="ttdR"
                     /locus_tag="USDA257_c04890"
     CDS             complement(533626..534522)
                     /gene="ttdR"
                     /locus_tag="USDA257_c04890"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional activator TtdR"
                     /protein_id="AFL49085.1"
                     /translation="MTNLGDLEVFARVVATGSMSAAARALDLSAAVISKRVKRLEERL
                     GTRLLQRTTRQVSLTEAGQGFYDRVLGVLTGIEEAEAYASGRSSQAQGTLRITAPTSF
                     GRMHIAPHLTDFMKDHPDLKLHIVLSDAFSDIVAEGYDIAIRIGELTDSSLVARKLAP
                     VRRLLCAAPDYLARHGAPKEIGDLAQHICLPAHNNENWKLEGPGGSLAYRPEGPLVTN
                     SSEIIRAAVIAGAGIALRSTWDISTELRDGRLVQVLPEWEGSHGLTLSAIYPSRQFLP
                     AKVRLFVDYLAALYGPVPYWEQ"
     gene            534758..536197
                     /gene="glcD1"
                     /locus_tag="USDA257_c04900"
     CDS             534758..536197
                     /gene="glcD1"
                     /locus_tag="USDA257_c04900"
                     /codon_start=1
                     /transl_table=11
                     /product="glycolate oxidase subunit GlcD"
                     /protein_id="AFL49086.1"
                     /translation="MTETIGFLKPRQAVLDRRGEIIADLADLLPEGCLISDERGLKPF
                     ETDAFLAYRRLPLAVVLPETTEHVSAILKYCSRYGIPVVPRGAGTSLSGGAIPQEDAI
                     VVGLSKMSRILDVDLFNRTATVQAGVTNLNISEAVSADGFFYAPDPSSQLACTIGGNI
                     GMNSGGAHCLKYGVTTNNLLGAKMVLFDGTVIELGGRALDAPGYDLLGLVCGSEGQLG
                     IVTEATVRLIAKPEGARPVLFGFASSEAAGSCVADIIGSGIIPVAIEFMDRPAIEICE
                     AFAHAGYPLDVEALLIVEVEGSEAEMDAMLQSIIEIARRHSVMTIKESQSALEAALIW
                     KGRKSAFGATGRVADYICMDGTVPLSQLSHVLRRTGEIVASYGLRVANVFHAGDGNMH
                     PLILYNINDPADAARAEAAGNDILKLCVEAGGCLTGEHGVGIEKRDLMRYQYNKADLD
                     QQMAVRAAFDPQWLLNPSKVFPLEGRPAA"
     gene            536194..537405
                     /gene="glcE1"
                     /locus_tag="USDA257_c04910"
     CDS             536194..537405
                     /gene="glcE1"
                     /locus_tag="USDA257_c04910"
                     /codon_start=1
                     /transl_table=11
                     /product="glycolate oxidase subunit GlcE"
                     /protein_id="AFL49087.1"
                     /translation="MIVHFEPASEEGIASVVRSAAAERVTLAIVGGGTRSGLGNPVRA
                     DRTLSTRRLSGIVTYNPAEMTMSALAGTPLAEVEAALAANGQMLSFEPMDHRPIFGTT
                     GDPTIGGVFAANISGPRRYVAGAARDNLLGVRFVNGRGELIKAGGRVMKNVTGLDLVK
                     LMAGSYGTLGILTEVTFKVLPVPPAAGTVVVSGLNDAEAAAVMAEAMAQPVEVSGAAH
                     LPESVRGRFIDGVLPEGAATVLRLEGLAASVEMRSEKLVAALSRFGPGSQLDASQTKA
                     LWTEIRDVKPYADGTARPLWRVSVAPSAGHQLVATLRLQTGVDAFYDWQGGLVWLRME
                     AEPEAELVRRYVRALGGGHAMLVRAEGGARAGIPAFEPQAAAVAQLSERVRASLDPAR
                     IFNPGRLAAVA"
     gene            537450..537830
                     /locus_tag="USDA257_c04920"
     CDS             537450..537830
                     /locus_tag="USDA257_c04920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49088.1"
                     /translation="MSDPGPQTPLSRDTDRWLEPGKVNIQIIYLLYLVGFAIGITPLV
                     GIVLAYLNRDKAEGWARTHYIWAIRTFWIALLFAVISALLSVLLIGVLGFVATAVWIV
                     VRCVIGLQKAAREEPITDPESWLV"
     gene            537892..539187
                     /gene="glcF1"
                     /locus_tag="USDA257_c04930"
     CDS             537892..539187
                     /gene="glcF1"
                     /locus_tag="USDA257_c04930"
                     /codon_start=1
                     /transl_table=11
                     /product="glycolate oxidase iron-sulfur subunit GlcF"
                     /protein_id="AFL49089.1"
                     /translation="MQTNFSPEQLADPHVAESEKILRKCVHCGFCTATCPTYVLLGDE
                     LDSPRGRIYLIKDMLENGRAADTETVTHIDRCLSCLSCMTTCPSGVDYMHLVDHARIH
                     IEETYKRPLKDRFARAVIAATLPYPSRFRLALRAARLARPLAGLLKRISSLKTFGVML
                     DLAPRAVPAASDGARPAVYAAKGTPRGRVALLAGCAQPVLRPEINEATIRLLTGQGVE
                     VVVSAGEGCCGALVHHMGREEQALASARHNVDIWLKVAEEDGLDAIVITASGCGTTIK
                     DYGHMLRLDPVYAEKAAKVSALAKDVTEYLAGLDLPERGARGLTVAYHSACSMQHGQK
                     ITLAPKQLLKRAGFAVREPAEGHLCCGSAGTYNILQPEISAKLKARKVRNIEATKPNV
                     IATGNIGCITQIASGTNIPILHTVELLDWAYGGPKPARL"
     gene            complement(539353..540048)
                     /locus_tag="USDA257_c04940"
     CDS             complement(539353..540048)
                     /locus_tag="USDA257_c04940"
                     /codon_start=1
                     /transl_table=11
                     /product="putative exported ErfK/YbiS/YhnG protein"
                     /protein_id="AFL49090.1"
                     /translation="MRLHATRLAALTVAAAAFLAAANASAFSPADMVGAKVKRSDVVL
                     AAQPKKPPQRYWRTKVRFRTNEAPGTVIVDTNNKYLYYIDGPNRATRYGIGVGREGFG
                     WSGVVKVGRKAEWPSWTPPAEMRQRERAKGRILPITQEGGIDNPLGARALYLYKGGRD
                     TIFRIHGTNLPWTIGQNMSSGCIRMMNEDVEHLYDRAPIGTKVIVIGPGNKQGDVSYD
                     DRGVDIFRHIFGG"
     gene            complement(540232..540975)
                     /gene="ybiS"
                     /locus_tag="USDA257_c04950"
     CDS             complement(540232..540975)
                     /gene="ybiS"
                     /locus_tag="USDA257_c04950"
                     /EC_number="2.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative L,D-transpeptidase YbiS"
                     /protein_id="AFL49091.1"
                     /translation="MKKFLLLATCLVCTLPTGAGARDRYRNRPPVIVSPDLTAPWVMQ
                     LTGEGVRPAVYRPQAPAATRKQVERRQMKRRLETAALQPAAARAQRPAKSQLDPQFLP
                     QMVTYETGEKPGTIVIDTNNRFLYLVTGDGQARRYGVGVGKPGFEWAGAHKITRKAEW
                     PNWTPPEEMIAREAAKGHYLPARMDGGPQNPLGARAMYLGSTLYRIHGTNAPWTIGYG
                     VSSGCIRMRNEDVVDLYERVKVGTKVIVI"
     gene            541197..541832
                     /gene="guaA1"
                     /locus_tag="USDA257_c04960"
     CDS             541197..541832
                     /gene="guaA1"
                     /locus_tag="USDA257_c04960"
                     /EC_number="6.3.5.2"
                     /note="glutamine-hydrolyzing"
                     /codon_start=1
                     /transl_table=11
                     /product="putative GMP synthase"
                     /protein_id="AFL49092.1"
                     /translation="MSARGLITGDDGLQRCAWHGNLEDYRRYHDEEWGRPVTDDRRLF
                     EKICLEGFQSGLSWLTILRKREAFRSAFAGFDVDLVAEFGDADIERCLADPGIVRHRG
                     KIVSTINNARRAKELRSEFGSLAAYFWAHEPDGSERPKVMDYETLIANPTTPASVRIS
                     KDLKKRGWTFVGPTTVYAFMQAMGLVNDHLEGCFCRAGIEEMRRQFARPAV"
     gene            complement(541881..542246)
                     /locus_tag="USDA257_c04970"
     CDS             complement(541881..542246)
                     /locus_tag="USDA257_c04970"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49093.1"
                     /translation="MTLKRITAALMLAASVGIPALAQEHQKMHHDSTAAASAPSSKAF
                     AEASAKMHKDMDIVFTGNADIDFVRGMIAHHQGAIDMAKVELEHGKDEAIRKLAEDII
                     KAQEAEITMMKDWLSEHGG"
     gene            complement(542320..542697)
                     /locus_tag="USDA257_c04980"
     CDS             complement(542320..542697)
                     /locus_tag="USDA257_c04980"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49094.1"
                     /translation="MLRWLAIILLLLSAPLGGALPAIAQARDLAAKTVSTHQHDMVIS
                     DTMQHASSGRDSHCAQRAHCPGPAKSDHPLLCSACVAIHAAPIGLTRSAGRSTRLSPQ
                     HHAALLDQVIEPPCPPPRRNVSI"
     gene            complement(542774..543199)
                     /locus_tag="USDA257_c04990"
     CDS             complement(542774..543199)
                     /locus_tag="USDA257_c04990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49095.1"
                     /translation="MLTVMTPGAAAIRPLNPEAHGAWTRVLAKAGYVIDPWRCDVDSG
                     AFVVGHRTLSLLGLRHNPCGVIDLVRAYDEEDRATILSILEQATAASSSFCFSAMVRR
                     PGGSSHQLCCIGNSTIDEGAGGSLQGVFAVPGSGAALPG"
     gene            complement(543272..543442)
                     /locus_tag="USDA257_c05000"
     CDS             complement(543272..543442)
                     /locus_tag="USDA257_c05000"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49096.1"
                     /translation="MEGIPGCEAWSVPSLPDQAKGGKGSGRQRADSPHPERSRNQAAR
                     KSVPLSVTITTP"
     gene            543432..544955
                     /gene="hisS"
                     /locus_tag="USDA257_c05010"
     CDS             543432..544955
                     /gene="hisS"
                     /locus_tag="USDA257_c05010"
                     /EC_number="6.1.1.21"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine--tRNA ligase HisS"
                     /protein_id="AFL49097.1"
                     /translation="MPSMNDKPKKQQKLKARLPRGFVDRSAADIRAVDEMIAKIREVY
                     ERYGFDPVETPLFEYTDALGKFLPDSDRPNEGVFSLTDDDEQWMSLRYDLTAPLARHV
                     AENFNEIQLPYRTYRAGYVFRNEKPGPGRFRQFMQFDADTVGAAGVQADAEMCMMMAD
                     TMQALGIARGDYVIRVNNRKVLDGVLEAIGLGGDGQANARLTVLRAIDKLDKFGPEGV
                     RLLLGEGRKDESGDFTKGAGLDEEQIRRILFFVGITDYAKSADELAELVAGTSRGAEG
                     VQELNTIRSLVLSAGYETDRIKIDPSVVRGLEYYTGPVFEAELQFSVTNEKGEKVVFG
                     SVGGGGRYDGLVSRFMGQPVPATGFSIGVSRLMTALKNLGKLGVEEVVAPVVICVMDR
                     DIDSMGRYQRFVQQLRHAGIRAEMYQGNKKNFGDQLKYADRRGSPIAIIQGGDERASG
                     TLQIKDLIEGKRLSGEIEDNVAWREARVAQVSVPEGELVAKVREILAEQTEDRKRAG"
     gene            544955..546094
                     /gene="hisZ"
                     /locus_tag="USDA257_c05020"
     CDS             544955..546094
                     /gene="hisZ"
                     /locus_tag="USDA257_c05020"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase regulatory subunit
                     HisZ"
                     /protein_id="AFL49098.1"
                     /translation="MPLINLPAFAGDLLADFERLKTLRVDTPVIQPAEPFLDMAGEDL
                     RRRIFMTESETGQSLCLRPEFTIPVCLRHIETATGTPQRYAYLGEVFRQRREGASEFY
                     QAGIEDLGDVDTAGADARAIGDAMLVLANRLPGQRLKVTLGDQSVFEAVIAVCGLPAG
                     WQKRLIHAFGDQKQLQKLLGELADPKSPGVFGHEVERLAIMGILDDEERLVARIGETM
                     EATGYSTNASRSPRDIARRLKEKMELATTRLDKAALTVMREFLAFDLPLSEAPAALHA
                     FAKKSKLKIDDAFALFDARVAALAKAGADPDLIRYRAAFGRPLDYYTGLVFEIEVEGE
                     PAVLAGGGRFDRLLTLLGAREHIPAVGFSLWLDRIERAVATGGGA"
     gene            546095..546789
                     /gene="hisG"
                     /locus_tag="USDA257_c05030"
                     /note="ATP phosphoribosyltransferase HisG"
                     /pseudo
     gene            546899..547606
                     /gene="yfcG1"
                     /locus_tag="USDA257_c05040"
     CDS             546899..547606
                     /gene="yfcG1"
                     /locus_tag="USDA257_c05040"
                     /codon_start=1
                     /transl_table=11
                     /product="putative disulfide bond reductase YfcG"
                     /protein_id="AFL49099.1"
                     /translation="MADLSSFPITSRWPAKNPDIIQLYSLPTPNGVKISIALEELGLP
                     YEAHRIAFDTNEQKSPEFVSLNPNGRIPAIIDPNGPDGKPIGLFESGAILVYLAEKTG
                     KLIPADAAGRYETLCWVMFQMGGVGPMFGQFGHFFKFAADKVANNPYPVERYRDEAKR
                     LLGVLEARLEGREWLMGDEYTIADIATYPWVEGARKFYGGAEVLEYNNFPNVMTWVER
                     GLARPAAQKGIEIPRKE"
     gene            547751..548968
                     /gene="thcD1"
                     /locus_tag="USDA257_c05050"
     CDS             547751..548968
                     /gene="thcD1"
                     /locus_tag="USDA257_c05050"
                     /EC_number="1.18.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodocoxin reductase ThcD"
                     /protein_id="AFL49100.1"
                     /translation="MSGRLVVVGGGQAAFALIAKLRALQDERPITVIAAEASLPYQRP
                     PLSKKYLLRELTLDRLLYRPEAWYAEHGIDIRLSTKVTRVERRAREVMLSDGSRLDYE
                     TLAFATGATPRRLPAAIGGDLAGVYVVRDFRDADRLAEEMKPGRRVLVIGGGYIGLEA
                     AAVARTCGLEVTVIEMADRILQRVASAATSAIVREIHRSHGVDIRERMGIHRLIGEDG
                     RVTAAELADGSIIPVDVVIVGIGVAANDALAHDAGIETSNGILVDSYGRTSDPAMFAI
                     GDCAVLPWQGMRIRLESVQNAVDQAEAVAAILAGGSAPYDPKPWFWSDQYDVKLQIAG
                     FGLGHDETLVRPGQREGSVSVWYFRQGKLIAVDAVNDAKAYVTGKKLLEAGVTPEPAL
                     LADPQVDLKSLLA"
     gene            549146..551986
                     /locus_tag="USDA257_c05060"
     CDS             549146..551986
                     /locus_tag="USDA257_c05060"
                     /codon_start=1
                     /transl_table=11
                     /product="putative signaling protein"
                     /protein_id="AFL49101.1"
                     /translation="MRTSACGAVRLFGRPPMFKILSCLVVEHDLRLVALAAVICALSS
                     YGAVTLLQRARLSRGRPRAIWLAAAGIASGFGIWATHFIAMLAYDPGVVLGYQAGFTT
                     LSLVVSILLTTSALAIATYATGRPAWVLGGLVLGAGVGCMHFLGMAALEVPGSIRWDS
                     TLVVASILAGVLFDMVAIFTINRSGHTPKAHLVATVAMTLGIVVLHFTAMGAVAVEVE
                     FATGIQEGMIQPNFLAFVLAGTAFFLLSAVLIAAGFARQGEILAVASEKEFSRFVRSV
                     KDYAICMLDVDGRVASWNAGAEANKGYVAEEIVGENFACFYSPEEQAAGLPQQALNTA
                     LAEGRYETEGWRYRKDGTRLWANVVIDPLIDDVGRHAGFITIVKDITKRKEDADCIAE
                     VSKNLDIALENMTQGICLFDHADRLLISNRRCLEIFELPDSLAGMGLTFREVLDRMFA
                     RTYSDPAIAEAKAEEAYRKHRLDIAAKGGGDFVEKLSNGRSILVKHRTLPDGGWVSTY
                     EDITERLDSEEQISFLARHDSLTGLPNRLQFNSYLDDELDAAAWFSRKVAVVGIDLDR
                     FKEVNDLHGHAAGDFVLVTIAQRMKEHLQEGEFIARFGGDEFAAVKRFEELAEVHDFL
                     RRIESCLQEEMRFGDFELKSGGSMGVAIYPQDAETADALINNADLAMYRAKAALNQTI
                     CFYEVSMDEAARGRRALANDLWEAVEKNQLALHYQVQKSVATGDVIGYEVLLRWNHPE
                     RGMVPPNEFVPLAEECGAILPIGEWVLREACREAAAWDRQYKIAVNLSPVQLANGDLV
                     SLVNAILVETGLDPKRLELEITESTIIDDKERALLTLREIKALGVTIAIDDFGTGYSS
                     LETLRSFPFDKIKLDKSFMSEVEGSPQAKAIIRAILALGQSLHVPVLAEGVETQTQLD
                     ILQAEGCDEAQGYLLGRPAPMGSVIGIRTQAA"
     gene            complement(552196..553833)
                     /gene="groL1"
                     /locus_tag="USDA257_c05070"
     CDS             complement(552196..553833)
                     /gene="groL1"
                     /locus_tag="USDA257_c05070"
                     /codon_start=1
                     /transl_table=11
                     /product="60 kDa chaperonin"
                     /protein_id="AFL49102.1"
                     /translation="MAAKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSF
                     GAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVRE
                     GAKAVAAGMNPMDLKRGIDLAVTEVVKDLLAKAKKINTSEEVAQVGTISANGERQVGL
                     DIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLDDV
                     FVLLHEKKLSNLQAMLPVLEAVVQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAV
                     KAPGFGDRRKAMLEDIAILTGGTVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVD
                     GAGQKSDIEGRVSQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEK
                     KDRIDDALNATRAAVQEGIVPGGGVALLRSSVKITVKGENDDQEAGINIVRRALQAPA
                     RQIVENAGDEASIVVGKILEKNTDDFGYNAQTGEYGDMIAMGIIDPVKVVRTALQDAA
                     SVAGLLVTTEAMIAELPKKDAPAMPGGMGGMGGMDMM"
     gene            complement(553899..554195)
                     /gene="groS1"
                     /locus_tag="USDA257_c05080"
     CDS             complement(553899..554195)
                     /gene="groS1"
                     /locus_tag="USDA257_c05080"
                     /codon_start=1
                     /transl_table=11
                     /product="10 kDa chaperonin"
                     /protein_id="AFL49103.1"
                     /translation="MASTNFRPLHDRVVVRRVESEEKTKGGIIIPDTAKEKPQEGEIV
                     AVGSGARDESGKVVPLDVKAGDRVLFGKWSGTEVKINGEDLLIMKEADIMGIIG"
     gene            554399..555286
                     /locus_tag="USDA257_c05090"
     CDS             554399..555286
                     /locus_tag="USDA257_c05090"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese domain protein"
                     /protein_id="AFL49104.1"
                     /translation="MPHEASCWNFASNSNQGRRIMASYNSISPEKLARLVGTAKAPVL
                     IDARDEDDFAADPFLVPASFHRTHSDAPQWADEYKGHWVVVLCKHGGKLSEGVAAWLR
                     LAGASAEILEGGIEAWREAGLPLVPVATLPNADPSGGSVWVTRSRPKIDRIACPWLIR
                     RFVDPRAKFLYVTPAEVEAVGERFGATPFDIEGVFWSHRGDDCTFDTMVKEFGLSFPA
                     LEHVARIVRGADTDRHDLEPQASGLLAVSLGLSRMYADDLEQLEAGMTLYDALYRWAR
                     DATQEKHDWVSHGGKGKRT"
     gene            555366..556640
                     /locus_tag="USDA257_c05100"
     CDS             555366..556640
                     /locus_tag="USDA257_c05100"
                     /codon_start=1
                     /transl_table=11
                     /product="chromate transporter protein"
                     /protein_id="AFL49105.1"
                     /translation="MSFGGPAGQIALMHRELVEERRWISESRLLHALNYCMLLPGPVA
                     QQLATYIGWLLHGTRGGVVAGTLFVIPGFVVILALSSAYALFQETDWLASLFFGLKAA
                     VLAIVIDALIRLSRRALKTGFDRWLALLAFLALFAFGLPFPLVVVAAGIAGYVAARHA
                     PGRREAAHAAKAPDLPSVIGADYPEGNPTWGRAAAVIAVWRALWLAPFLLIAATLGSS
                     NVYSDIGVFFSQMAVVTFGGAYAVLAYVAQQAVETYHWLQPGEMVDGLALAETTPGPL
                     VLVLAFVGFMGAYRAPIGVDALASGVLGATLATWVTFIPCFLWIFLGAPYVDRLRANA
                     ALSGALSAISAAVAGVILNLAVWFGLHVLFGRVERLESGPLSLPYPDPTTLDPLALVL
                     TILAAASLLWLKRRIFQTLAICAAAGWLLMLV"
     gene            556758..557606
                     /locus_tag="USDA257_c05110"
     CDS             556758..557606
                     /locus_tag="USDA257_c05110"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-superfamily hydrolase, subfamily IIA"
                     /protein_id="AFL49106.1"
                     /translation="MAVRINSFREIASRYDVVLCDVWGVLHNGVQAFASACEALAEAR
                     AQGVTVVLITNSPRPHPSVKVQIRGLGVPDEAYDRIVTSGDVTRALIASAAKRIFFIG
                     ADRDLPLLEGLGTEIVSAEEAETIVCAGFYDDETETPEHYRVTLVGLARRKIPFICAN
                     PDLVVERGHRLIPCAGAIAKLYEELGGEARIAGKPYKAIYRAALSEAKAVRGNFDLAR
                     VIAIGDGMPTDVKGAQDAGFDLLYISAGIHAQEYMHESRTDEAKLFAFLKQEGATPKW
                     WMPRLA"
     gene            557620..558603
                     /gene="ribF"
                     /locus_tag="USDA257_c05120"
     CDS             557620..558603
                     /gene="ribF"
                     /locus_tag="USDA257_c05120"
                     /EC_number="2.7.1.26"
                     /EC_number="2.7.7.2"
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin biosynthesis protein RibF"
                     /protein_id="AFL49107.1"
                     /translation="MTVFHRNETRDPLPERLRGGVIAIGNFDGVHRGHQSVLNRALDE
                     ARGRGVPALVLTFEPHPRTVFRPDQPVFRLTPAPLKARILEGMGFGAVIEYPFDRTFS
                     ELSASDFIHRILREWLHASHVVTGFDFHFGKGREGGPAFLMAAGAEEGFGVTLVDAFR
                     DENAAVISSSFIRSLLAEGDVSHAAGLLGYRYTAEAEVIGGKKLGRTLGYPTANMRLP
                     QEAELRNGIYAVRFRRADGSLYDGVASFGRRPTVDSDGEPLLETFVFDFSGDLYGEVC
                     AVSFFGYLRDELKFDGLEPLMVQMREDEKEARALLAGVQPLSEIDRQINFA"
     gene            558871..561792
                     /gene="ileS"
                     /locus_tag="USDA257_c05130"
     CDS             558871..561792
                     /gene="ileS"
                     /locus_tag="USDA257_c05130"
                     /EC_number="6.1.1.5"
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucine--tRNA ligase IleS"
                     /protein_id="AFL49108.1"
                     /translation="MQKTMTETAEKIDYSSTLYLPQTEFPMRAGLPQKEPETVARWQK
                     MELYKKLRASSAGRDKFVLHDGPPYANGNIHIGHALNKILKDVINRSFQMRGFDASYV
                     PGWDCHGLPIEWKIEEKYREKGRNKDEVPVNEFRRECREFASGWIGVQTEEFKRLGIE
                     GDFENPYTTMNFHAEARIAGELIKIAKAGQLYRGSKPVMWSVVERTALAEAEVEYADV
                     ESDMIWVKFPVVEGPDALIGAFVVIWTTTPWTIPGNRAVAYSSRYAYGLYEVATAEND
                     YGPQPGEKLIFAKRLAEESAAKAKVTFNFVRDLEADELSTVTCAHPLHGLGGGYAFKV
                     PLLDGDHVTDDAGTGFVHTAPGHGREDFEAWMDSARALEARGISSAIPFTVDDAGYFT
                     ADAPGFGPEAEGGAGRVIDDKGKKGDANDRVIKALIARHALFARGRLKHSYPHSWRSK
                     KPVIFRNTPQWFVYMDKDFGDGTTLRGRALNAIDETRFVPGAGQNRLRAMIEQRPDWV
                     LSRQRAWGVPIAIFADDQGEILVDEDVNLRILDAFEKEGADAWFAEGAKERFLGNDYD
                     HARWHQVMDILDVWFDSGSTHTFTLEDRPDLKWPADLYLEGSDQHRGWFHSSLLESCA
                     TRGRAPYNAVVTHGFTMDEKGEKMSKSKGNTVTPQEVMKDAGADILRLWVMTTDYWED
                     QRLGKTIIQTNIDAYRKLRNTVRWMLGTLAHDKGEVVAVADMPELEQLMLHRLAELDR
                     LVREGYDAFDFKRIARALIDFSNVELSAFYFDIRKDALYCDAPSSLRRRAALHVIRTL
                     FDCLVTWLAPMLPFTAEEAWLSRNPEAVSVHLEQFPAVPAEWRNDALAEKWRKIREVR
                     KVVTGALEIERKDKRIGSSLEAAPIVHVADPDLRAALDGQDFAEICITSAIELNGAEG
                     PDGAFTLPEVAKVSVVPKLAEGRKCARSWRITTDVGSDPLYPDVSARDAAALRELGFK
                     P"
     gene            561884..562549
                     /locus_tag="USDA257_c05140"
     CDS             561884..562549
                     /locus_tag="USDA257_c05140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49109.1"
                     /translation="MAARRARSGGAGRKFMEMARALRVFASIAAVVAGSLVLTGCIGG
                     PTYGTDKTAGEQLVDDLGSAISLAPPKKDPVKYQPRAGLVLPPQGEQAALVQPQQSLA
                     SRETNPAWVESPEEVRQRLREEADANKNNPNYVSPLAKASANGRRLSAKEQQAAYREA
                     RKIEMGAYSDKRRFLSDPPLEYRRLPEGSETDLGESEKDKERRRKKAAQVANSGSKWY
                     WPF"
     gene            562553..563032
                     /locus_tag="USDA257_c05150"
     CDS             562553..563032
                     /locus_tag="USDA257_c05150"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acetyltransferase protein"
                     /protein_id="AFL49110.1"
                     /translation="MALSIRDAVPEDAATILRFITELATYEKAEHEVEATVELLTASL
                     FGSGSISRAVICEVDGKPAGFAIWFYNYSTWQARKGLYLEDLYVTLEHRGSGAGKMLL
                     KHLARIALAEGCGRFEWSVLDWNEPAIRVYEAIGAEPLTEWTRYRLTGKELEALAAS"
     gene            563565..565406
                     /locus_tag="USDA257_c05160"
     CDS             563565..565406
                     /locus_tag="USDA257_c05160"
                     /EC_number="5.4.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative RNA pseudouridine synthase"
                     /protein_id="AFL49111.1"
                     /translation="MTSKDKSTGPGKGKDRKGNFPSGDKKANAARPVKSAAPKADVGI
                     DEPQRISKILSRAGVASRRDVERMIMEGRVKLNGVVLDTPVVNATLADGIEVDGHPIR
                     GIERTRLWLYHKPAGLVTTNSDPEGRPTVFDNLPDDLPRVLSIGRLDINTEGLLLLTN
                     DGGLARALELPSTGWLRRYRVRAHGEIDQEALDRLKDGIAVEGVLYGAIEATLDRVQG
                     SNVWITMGLREGKNREIKNVLGALGLDVNRLIRISYGPFQLSELPEGHVQEIRGRTLR
                     DQLGPRLIAEAKANFDAPLYNDQPAAVEAEIHSDGAADKGRPERSTWREKPEDKRERA
                     LARLDTQRDDSHSRDRRDRPRERFEDRPARAPAKRSRTANVWMAPGARPVAEKKPKAA
                     EEDVSAKPARRERPEGAPKTKRYGRTKDGSATKTSAKFDPDRKTGAAKGAARPDRAPR
                     PSVKRTDEDGDWISASEPVRRKDDARDGGFERRRPFDAGERKSRDHGDRPPRREGSER
                     PRGERPARAAGEGRAFSEKPRTSRSKADRPKGREGGDRPFGDRPTGKPPGGKPAGGKS
                     FGQRSSGPRGGKPGGGRPGGGKPGGGKPGGSKPGGRTGGGKPRGKGK"
     gene            565413..565973
                     /gene="rsmD"
                     /locus_tag="USDA257_c05170"
     CDS             565413..565973
                     /gene="rsmD"
                     /locus_tag="USDA257_c05170"
                     /EC_number="2.1.1.171"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA small subunit methyltransferase D"
                     /protein_id="AFL49112.1"
                     /translation="MRIVGGEFRGRTLAAPKSNDIRPTTDRTRESLFNILSHSYPEAL
                     DGARMLDLFAGTGAVGLEALSRGCRQALFVEQGVEGRGLIRVNIEALGLQGRAKIFRR
                     DATDLGPVGTIEPFHLVFVDPPYAKGLGERALEQAAAGGWLVPGALVVLEERADVRPQ
                     LSGAFEPLDDRAFGDTRMHFYRFLGA"
     gene            566065..566949
                     /locus_tag="USDA257_c05180"
     CDS             566065..566949
                     /locus_tag="USDA257_c05180"
                     /codon_start=1
                     /transl_table=11
                     /product="putative patatin family protein"
                     /protein_id="AFL49113.1"
                     /translation="MEQHVSARRNRPDTIGEPTIAVAFGGGGARGLAHIHVIEALDEM
                     GIRPMAIAGSSIGAIMGAGMAAGMTGKEIRDYTFSTVGNRGEVLNRLWQLRPGSLSEA
                     VSSGFRFGQFNIERVLKAFLPEAIPTRFSDLLIPLKVTATDYYGQTERVCESGDLHQA
                     IAASCALPAIFIPVKIAGRVMIDGGMYNPVPFDHLRELADIVVAVDVVGGPDGDGKTI
                     PSRIDSLFGASQLMMQSIIAMKMKAGAPDILLRPDVGRFRALDFLRAREVLAATAATK
                     EQLKRALCDRIDQWQAGR"
     gene            complement(566977..568902)
                     /gene="kefBC"
                     /locus_tag="USDA257_c05190"
     CDS             complement(566977..568902)
                     /gene="kefBC"
                     /locus_tag="USDA257_c05190"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-regulated potassium-efflux system
                     protein"
                     /protein_id="AFL49114.1"
                     /translation="MTSRLASPPREVESIHDERPRAMQTTQILYTQALMLLGGAVVAA
                     PLFKRLGLGTILGYLAAGIVIGPVAQSITEGEEILHVSELGVVFLLFIIGLELKPSRL
                     WQMRRDIFGLGTAQVAVTGLVLSFLIAFFDLLPPGGSVIAGFGLALSSTAFAMQILDE
                     SNDTNTRYGQRAFSILLLQDLAIVPLLALIPLMAARAPEATTTPLEAFAIAIAAIAAL
                     FAAGRYLLNPLFQVIARTGARDVMIAAALLVVIGAATMMQLAGLSMAMGAFLAGVLLA
                     ESSYRHELEADIEPFRGILQALFFMAVGLSLQLGVIAENYLLIVVAVPLLMAVKSLVL
                     YGLCRATGSHHNDAVRISLLLPQGGEFGFVLFTAAAVAGVFSQGVASLLVAIVTLSMA
                     LTPVAALLSKRLLRKQDDLEDEIEEDFEGAGADVLMIGFSRFGQIAAQILLAGGRDVT
                     IIDHSAARVRQAATFGFRIYFGDGTRLDVLRAAGIEKAKIVAVCTQKKEITDRIISLV
                     QAEYPNARIFARSYDRLHTLELRTMGVEYELRETFESGLLFGRKTIEALGVGGEEAIA
                     IMDDIRRRDEARLVLQEAEGITAGRHMLHSQPVRPEPLVKPKRDVNHTAETEGRILPQ
                     LPAGDNRRAGETLASAD"
     gene            568972..570333
                     /gene="pmbA"
                     /locus_tag="USDA257_c05200"
     CDS             568972..570333
                     /gene="pmbA"
                     /locus_tag="USDA257_c05200"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PmbA"
                     /protein_id="AFL49115.1"
                     /translation="MKGLIMSETIDSAILEKRAAELVDRARQAGAETADAVVVRGRSR
                     SVSARLGKVEATEASESDDFSLRVFVGRRVASVSANPGFDLKVLAERAVAMAKASPED
                     PYASLADPDRLARSYPDLDLFDTREVSSEALTEAALAAEAAALSVSGVTNSSGAGASA
                     GMGGLVLVTSHGFSGSYMATRFGRSVSAIAGEGTKMERDYDYDSRLFFDELRSADDIG
                     RVAGERAVARLNPRQVPTAKNVTVVFDPRMARGFVGHLAGAINGASVARKTSFLRDMM
                     GKQIMKAGIAVTDDPLIVRGSSSRPFDGEGITGSKLSMVEDGVLKHWFLSTSAARELG
                     LETNGRGVRGGPAVNPASTNLALEPGTISRDDLIRGVGTGFYVTELIGQGVNMVTGEY
                     SRGASGFWIENGEITFPVSEVTIASNLKHMFMALTPADDIDRKFGIAAPTFAIEGMTL
                     AGT"
     gene            570397..571215
                     /locus_tag="USDA257_c05210"
     CDS             570397..571215
                     /locus_tag="USDA257_c05210"
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase family protein"
                     /protein_id="AFL49116.1"
                     /translation="MSEAALQTAPSWDEDLKLILAAAVAAGDTALGYFRKSIDVRWKN
                     EGRSPVSEADLAANDILKTRLLAARPDYGWLSEETDDDATRLSRDTVFVVDPIDGTRA
                     FISGKDLWCVSVAVVHRGLPTAGVLYAPALGEIFQATRDGEARKNGAAIAVRDPVPDE
                     RLQVAMAEDIAGKLAVPYRERLARVPHVPSLAYRLAMIADGRIDGTIVKKNAHDWDLA
                     AADLILARAGGALCGLDGLPLSYNRPIVSHGVLGAGSALALPALLAASRPFDSH"
     gene            571274..571510
                     /locus_tag="USDA257_c05220"
     CDS             571274..571510
                     /locus_tag="USDA257_c05220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49117.1"
                     /translation="MAQNTEKKQLLHLVFGGELTTLTDVQFRDLNNLDIVGIFPDYES
                     AHVAWKARAQMTVDNAHMRYFIVHMHRLLDPEND"
     gene            571544..572857
                     /gene="waaA"
                     /locus_tag="USDA257_c05230"
     CDS             571544..572857
                     /gene="waaA"
                     /locus_tag="USDA257_c05230"
                     /EC_number="2.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic-acid transferase
                     WaaA"
                     /protein_id="AFL49118.1"
                     /translation="MSSLRARLALSSYRWLGTAIYPFVGPYLALRAAKGKEDPARRRE
                     RYGHASAPRPPGPLVWFHAASVGETAAVTPLIKEIRRRGIAVVLTTGTTTSARVAAER
                     LGTGVIHQYVPLDFKPGVSRFLEYWQPDLAIIAESEIWPMTIVELGRRHIPQVLVNGR
                     LSDRTFARWKKRPSLADALFENLALVIAQSDIDAERFRTLGALPVMVSGNLKVDTDAP
                     PHDPQVLREYSQQIGSRKTWAAISTFEGEEEAAGVVHHALKQRHGLLTIVVPRHPERS
                     DAVEAALAAKGLKVARRTRGDRLTPDVDIFLGDTIGEMGLYLRLTEVAFVGRSLFAEG
                     GQNPLEPAMLGCAVLSGANVQNFRETYQMLSKNGSAKIVRDVEMLAKGVNYLLGNDDM
                     RRSMIDAGLETVQQMRGALTATMRGLEPYINPLIVKARLEPRAES"
     gene            572877..573581
                     /locus_tag="USDA257_c05240"
     CDS             572877..573581
                     /locus_tag="USDA257_c05240"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphoglycolate phosphatase"
                     /protein_id="AFL49119.1"
                     /translation="MAAGNGIAGILFDKDGTLLDYVKSWVPVNYELARIAARGDESLA
                     RVLLQAGGMDPDTGHVAPDSLLAAGNTVEIATGMVDAGAPFTVEELTTLFDGMFAHSA
                     DYAVPVTDLGAFFAALHAKGYRLGVASSDNERSIRETAKRFGFENYLHYIAGYDSGYG
                     VKPQPGMVLGFCAATGLTPEQVAVVGDNNHDMHMGRNAGVGMTIAVLTGTGSRQSLAE
                     ASDHCLADITELEAVL"
     gene            573718..574758
                     /gene="lpxK"
                     /locus_tag="USDA257_c05250"
     CDS             573718..574758
                     /gene="lpxK"
                     /locus_tag="USDA257_c05250"
                     /EC_number="2.7.1.130"
                     /codon_start=1
                     /transl_table=11
                     /product="tetraacyldisaccharide 4'-kinase LpxK"
                     /protein_id="AFL49120.1"
                     /translation="MVSEAPPFWWTKADWRAYALWPFSWVYGRIAAIRMDRARRAMPA
                     VPLICVGNFTVGGAGKTPTAIALAQAAKARGLKPGFLSRGYGGSLDVTTVVDPGHHRA
                     REVGDEPLLLAREALTVVCRRRVDGARRLAAEGADIIIMDDGFQSARLTFDFALLVID
                     SVRGIGNGHLVPSGPVRAPIADQLRHATALLKIGHGPAADRLIRRAARAGKAIYVADT
                     VRVEDQSLFGVKVLAWAGIADPEKFYRTVRETGAIVEETRSFPDHHHFSEDEIADLVD
                     RAASRGYTLVTTAKDMVRLESGHGRAGELAANSRVIEIEVRFDDPLAPAKIIEATLAA
                     ARARKLRANGKS"
     gene            complement(574786..575019)
                     /locus_tag="USDA257_c05260"
     CDS             complement(574786..575019)
                     /locus_tag="USDA257_c05260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49121.1"
                     /translation="MMNRFDGNSSREAKIRYLDGDFQIVLAGSHVVCAMTGKAIPVDE
                     LRYWSVERQEPYIDAAASLEAERRAGTLPTQQS"
     gene            complement(575157..576974)
                     /gene="mutL"
                     /locus_tag="USDA257_c05270"
     CDS             complement(575157..576974)
                     /gene="mutL"
                     /locus_tag="USDA257_c05270"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutL"
                     /protein_id="AFL49122.1"
                     /translation="MAIKQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEV
                     ATAGGGKTLLRVSDNGSGMSPTDLELAIRRHCTSKIGDALTDIRTLGFRGEALPSIGS
                     VARLSITSRTATASEGAAISVTGGRTEPVRPSPANVGTVVEVLDLFFATPARLKFMKS
                     EKAEAAAISEVVRRMAIAFPKVRFVLSGSDRSTLEFPATGDDRLARMAQVLGKDFRDN
                     AIEIDAEREEVRLTGFAGVPTFNRGNSLQQYAFVNGRPVQDKLVLSAIRAAYAETIPQ
                     GRYPVAVLSILIDPALVDVNVHPAKSDVRFRDPGLIRGLIIGAIREALTRGGARAATT
                     GAQGMMRAFRTEAYRPEPRRAQAPWTAAASPYRPMQFDEPARGFAETPQAIFADFAQP
                     SARAAAAAAETKAPNGSGGSSFPLGTARAQLHENYIVAQTEDGLVIVDQHAAHERLVF
                     EAMRTALHSRPVPAQALLIPEIVDLAEDDCDRLMAHAEELLRLGLSIERFGPGAIAVR
                     ETPAMLGEMDASGLVRQLADELAEWDTANGLAGRLEYLAATMACHGSVRSGRRMRPEE
                     MNALLRQMEATPGSGQCNHGRPTYIELKLADIERLFGRS"
     gene            577321..579045
                     /locus_tag="USDA257_c05280"
     CDS             577321..579045
                     /locus_tag="USDA257_c05280"
                     /codon_start=1
                     /transl_table=11
                     /product="putative two-component sensor histidine kinase
                     protein"
                     /protein_id="AFL49123.1"
                     /translation="MNDVASGGADINRIVLESSCDALGLALLVCGRDDTILYASASML
                     QFFPVQPHLLKTGTRLRDFLGAVYDTGLRPGTLPESSRRRANREDWIAEQMGLHWRER
                     YENVERAGRTRWVCLRKRRLSSGIGILSVSDVSDQKKREEQLQTDLERVELTEQILDA
                     QPNPICVKDRNLHYIAANKAFCAIHDVAPEAILGRSAWDVVDAELAERFEQSDRHVLA
                     TGRPHSEAEHIVRADGSDLWVVTRKYRVGVPGRHFVVTCMNDVTDIAAWYHGAEDGGG
                     NSGLQIRDYSIFTPAQNFYDPFRALNVQQLVEAGSMIETLPARGLRVLLATADREMEA
                     RIVARLRGSGLDACAVRNRDELEAFAAAAEDRSVKLDILALDTAFPARGAILGGWKAC
                     PVLEIPPEADGTTLLGEIFRASSDRQQARSQLPQADWEVSFEGDAAARTGAPEVEVLV
                     AEDNQINQFVFAQILDGLGVSYRIAANGREAVELWHELQPSLILMDISMPVMNGFEAA
                     AAIRDAERQTGRRTPIVAVTAQALDIDLQRCEAAGLDDHIMKPISPDMIEALLRKYMR
                     SASVRMTV"
     gene            579349..580689
                     /locus_tag="USDA257_c05290"
     CDS             579349..580689
                     /locus_tag="USDA257_c05290"
                     /codon_start=1
                     /transl_table=11
                     /product="putative signaling protein"
                     /protein_id="AFL49124.1"
                     /translation="MMLAELATERYGQERLPSVDPLTGLGNAQRLRHKVCELAAERAS
                     DPAPFTIGLANLDGFKPINDLFGPEAGDRILCQVAQRLTACVPEGATVIRTADDEFAL
                     VLPLVFERKGAEKLGQMLKEILSAPFDLGDRTVRLSASFGFAVYPFAGAAFEDLLKSA
                     DTALYRSKRRGRGQITVYSQEIAQEMKRATQLEQALRNAIIAEEIDVHFQPIVDLRND
                     GVVGFEALARWCDPDFGYVSPSVFVPLAEERGFIEALAEMLLRKAAQAALAWPKELFL
                     SFNLSSAQLMDPATSGRLLAIVNKVGLDPRRLELEITETAVMADADVAQKIVSELRAA
                     GVRVSLDDFGTGQSSLCRLRDFSFDKVKIDRAFVSRISADRASEHIVRAIVSMCEGLE
                     LEVVAEGIENFSEVLKLKALGCGMGQGYFYGKPADAVATMRYLSDRHRDTAVAR"
     gene            complement(580662..581630)
                     /gene="gcvA1"
                     /locus_tag="USDA257_c05300"
     CDS             complement(580662..581630)
                     /gene="gcvA1"
                     /locus_tag="USDA257_c05300"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system transcriptional
                     activator"
                     /protein_id="AFL49125.1"
                     /translation="MESLRRLLPSAASLIIFEAAGRHQNFTRAASELGMTQAAVSYAI
                     RGLEDQLGVSLFHRVHRAVELTEAGEKFHADVSVGLARIQKSAEDIRAKGRETNVTLA
                     ASTAFASMWMLPRLTRLREDLPEIDLRIQTGVRDLDLDEEPIPLGIRGGDPGQWPRYH
                     AALLADEVINAVATPSYIEAHGMPETPADLLRHSLIHLEEPVRRACDWTEWFASAGIA
                     YPAQGKRLAINDYVLVIQAVLAGEGIALGWDHLIAGQVRSGALVPVGGHVLRTGQAFY
                     VVWPRSRELNSQAGRIRDWLLREGARDRSQIDDAADDRQRATAVSR"
     gene            581721..583271
                     /gene="mttB1"
                     /locus_tag="USDA257_c05310"
     CDS             581721..583271
                     /gene="mttB1"
                     /locus_tag="USDA257_c05310"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="trimethylamine methyltransferase MttB"
                     /protein_id="AFL49126.1"
                     /translation="MALASAGAGEVTKRTRGGRPHRREGGARNLGVPYIVRNIPTYDI
                     LGEESLERIERTADRILAEVGIEFRDDPAVLDHWRRAGAKLDGVRVTFEPGMLKEIVR
                     SAPSQFTQHARNPARSVEIGGRNVVFSPAYGSPFVMDLDKGRRYGTIEDFRNLVKLAQ
                     SSPWLHHSGGTICEPVDVPVNKRHLDMVYSHIKYSDRAFMGSITAEERAEDSIEMARL
                     LFGVEFVDNNGVILGNVNVNSPLVWDGTMTKSLRAYARANQAAVIVPFILGGAMGPVT
                     NAGAIAQSYAETLAGCALTQLERKGAPVIFGNFLSSMSLRSGSPTFGTPEPAIGSMVV
                     GQLARRLGLPLRCAGNFSNSKRPDAQAMQEGVMSMLSAVHCGANFILHSAGFVDGLLA
                     MSYEKFVMDTDFCGALHSYLAGVVVDDNSLAMDAFVEVGPGSHFLGCEHTMRNYQTAF
                     WDSALSDNEPFEKWVEEGETDMALRANRSWKKTLAEYEAPPLDAAIDEALVDYVARRK
                     ASMADAWY"
     gene            complement(583443..584114)
                     /locus_tag="USDA257_c05320"
     CDS             complement(583443..584114)
                     /locus_tag="USDA257_c05320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFL49127.1"
                     /translation="MPDNVNERQTDMTDKFISSVAAGALLVGVAVAPMSFAQETTTPP
                     APAPETQTMDPAPATPPVTPAPADQAQTPAPADKTTDMAAGSGYLTEQAADQISANTY
                     IGQSVHNPNDESIGEINDLIIKKEGGIAAAVVGVGGFLGIGEKNVAVPFESIEVTEQP
                     DSDALKLTTTETAESLKAAPEFKTKSQLMAERNAAQPVDTSTTSATGTTPAPAPAPAE
                     PAPQQ"
     gene            complement(584373..586097)
                     /gene="ilvD1"
                     /locus_tag="USDA257_c05330"
     CDS             complement(584373..586097)
                     /gene="ilvD1"
                     /locus_tag="USDA257_c05330"
                     /EC_number="4.2.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase IlvD"
                     /protein_id="AFL49128.1"
                     /translation="MSEKKKDLRSRHWYGGTDKDGFIHRSWMKNQGFPDHVFDGRPII
                     GICNTWSELTPCNSHLRILAEGVKRGVWEAGGFPVEFPVSSLGETQMRPTAMLFRNLL
                     AMDVEEAIRAYGIDGVVLLGGCDKTTPGQLMGAASVDLPTIVVSSGPMLNGKWKGKDI
                     GSGTDVWKFSEAVRAGDMSLQEFMAAESGMSRSPGVCMTMGTATTMASVVEAMGLSLP
                     TNAALPAVDARRMALAHMTGKRIVDMVHEDLRLSKILTRKNFENGIIANAAVGGSTNA
                     VVHLLAIAGRAGVDLCLEDFDRVGGQVPCIVNCMPSGKYLIEDLAYAGGLPAVMNRIQ
                     HLMHADAPTVFGVPISKYWEDAEVYNDDVIRPLDNPLRAAAGIRVLKGNLAPNGAVIK
                     PSAASEHLLAHEGPAYVFETIEDLKAKIDDPDLPVTEDTILVLKGCGPKGYPGMAEVG
                     NMPIPRRLVEKGVRDMVRISDARMSGTAFGTVVLHVSPEANAGGPLAIVKTGDRIRLD
                     AMKGELNLLISEEEFAARRAAWQPPEQKWQRGYYKLYHDTVLQADKGADLDFLVGSSG
                     SEVHRESH"
     gene            complement(586227..587111)
                     /locus_tag="USDA257_c05340"
     CDS             complement(586227..587111)
                     /locus_tag="USDA257_c05340"
                     /EC_number="3.1.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="gluconolactonase"
                     /protein_id="AFL49129.1"
                     /translation="MTDLAAFSGRILCDFASELGEGPTYDPRTDTAWWFNIKGQELHE
                     LHLESGHKTIHPLPFLGSVLATIDPGRQLIASDQGLFVRDTASFKLSPFATLEDKPGN
                     RSNDGRVHASGALWIGTMGRSAEKHAGAIYHVAGNRITKLYSNITIPNGICFSPDGAT
                     AYFTDTDVNHLMRVVIDPATALPTGDAVILSDESAAPGGIDGSVCDADGLIWNARWGA
                     GAIEVYKPDGRKVARYAVPATQPSCPAFIGVRADRLLVTSAWQDLDDAAHSADPNAGK
                     TFELGIEVTGRLEPSFRL"
     gene            complement(587108..587749)
                     /gene="dgoA"
                     /locus_tag="USDA257_c05350"
     CDS             complement(587108..587749)
                     /gene="dgoA"
                     /locus_tag="USDA257_c05350"
                     /EC_number="4.1.2.21"
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxy-6-phosphogalactonate aldolase
                     DgoA"
                     /protein_id="AFL49130.1"
                     /translation="MMNRIPLPPMKYPLIAILRGLKPEETESVVGALIETGFTAIEIP
                     LNSPDPFRSIETAVKMAPAHCLIGAGTVLTTADVEQLDDVGGRLMVSPNVEPSVIRLA
                     AAKGMVTMPGVFTPTEALAAVAAGASGLKFFPASVLGPSGIAAIRAVLPSDLEIAAVG
                     GVSETNFADYAKIGVRSFGLGSSLYKPGMSAADVRQRAVATLAAYDAVYGGHE"
     gene            complement(587759..588676)
                     /gene="dgoK"
                     /locus_tag="USDA257_c05360"
     CDS             complement(587759..588676)
                     /gene="dgoK"
                     /locus_tag="USDA257_c05360"
                     /EC_number="2.7.1.58"
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxygalactonokinase DgoK"
                     /protein_id="AFL49131.1"
                     /translation="MTAGYYAAVDWGTSSFRLWIIGEDGAVLAERRSAEGMTTAARTG
                     FHAVLDSHLAAVSAPLHLPIIICGMAGARQGWREAGYLDTPATLGAIAGNAIAVPDVD
                     RDIRILPGLAQRDNRHPDVMRGEETQLLGAAGMLDDGRHLVCMPGTHSKWVRLSRQTV
                     EGFSTFMTGELFDAISKHTILSHAVAEADAIAADSAAFAEAVTRAREKPGLATNLLFS
                     VRAGQLLHGLSAADAKAHLSGTLIGLEIAGALASAGSVNGICLVGSGRLGALYRAALE
                     SQGLAVQLVDADEAVRAGLSTAAQAIWPL"
     gene            complement(588676..589446)
                     /gene="bacC1"
                     /locus_tag="USDA257_c05370"
     CDS             complement(588676..589446)
                     /gene="bacC1"
                     /locus_tag="USDA257_c05370"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="bacilysin biosynthesis oxidoreductase BacC"
                     /protein_id="AFL49132.1"
                     /translation="MTLPSSQFPDLRDRGVLVTGGGSGIGAALVEGFLRQGARVAFID
                     IAEDASRTLADKLAAETGRRPEFIHADLSDVEHAKRAADAAVAALGSIRVLVNNAARD
                     DRQPLEAVTRESWDESLAVNLRHFFFLSQAIAPVMRQTGGGSIINFSSIAFMLNMPEI
                     PAYATAKAGIIGLTKSLAGKLGPDNIRVNAILPGMIVTERQRRLWLTEDSIDRMQERQ
                     CLKRVLVAEDLVGPCLFLASDCSGAMTAQTMIIDGGVF"
     gene            589464..590387
                     /gene="kdgR"
                     /locus_tag="USDA257_c05380"
     CDS             589464..590387
                     /gene="kdgR"
                     /locus_tag="USDA257_c05380"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator KdgR"
                     /protein_id="AFL49133.1"
                     /translation="MLSRTSMFHYVELRFIFWNYRAGAFILSRSMQAKADEMDRKIVT
                     DLESEGPGTGTLGKAMAVLEAVATADRPLRFTDILQSVRQPRGTLHRLLGHLIDEGLV
                     VQRNDLSYEPGLRLLKLAYRSWSGNQFRDIAEPHLLRLHELTGETVHLGILRETEIIY
                     VDKVESRQTVRMSSQIGKASPAYCTGIGKAALSSLARGELERIAAKTQFVPFTERTHR
                     SATSLLAEIEEIRHQGHAFDREEHEAEICCVAAPIVVPEHELVAGISVTGPSYRVTMP
                     QLAAWAADVRNAAGKIEEEARFRLGPGRVGR"
     gene            590593..591330
                     /locus_tag="USDA257_c05390"
     CDS             590593..591330
                     /locus_tag="USDA257_c05390"
                     /codon_start=1
                     /transl_table=11
                     /product="putative LuxR/GerE family transcriptional
                     regulator"
                     /protein_id="AFL49134.1"
                     /translation="MDFNADITSLALPNGRFINGAIGNEDDVKRALDQIADAFGFRGF
                     MVLAIPDSGCHSLAAQALLTSWTAEFLRRYDSAGLIEGSPVIQRLRRSTIPFTYDAHL
                     LARRRVDGKGEAAISVFEQAGMPRGLYLPVHDAKGGRAAIAFGGDREVVSSDEMQVLN
                     LWAGLLYSRLCEVRAGDRRRPGSLSRREIECLRWAAAGKTTVEMARIMALSEYTVNHY
                     LNRATRKLDSVNRVQTVAKAMRAGLIN"
     gene            591468..592241
                     /locus_tag="USDA257_c05400"
     CDS             591468..592241
                     /locus_tag="USDA257_c05400"
                     /codon_start=1
                     /transl_table=11
                     /product="putative LuxR/GerE family transcriptional
                     regulator"
                     /protein_id="AFL49135.1"
                     /translation="MSWNARMQDTMTTGMSDVDLPRGGDFASEIAKLETQFDIIRYMR
                     RITQIFGFKTFLICSIPPIDMERLSAATVISNMPAELLNKYDSLSMLRFSTGVRRLRE
                     TTTPFRITLEDWESEGGKPATATDYIVMLRENGIFQANYFPVHDAEGGRGAVILMGPE
                     ADLPMTAAMELQMIAIHVYNRLAEIGSVWKNSNTTLSEREIQCLSWTAAGKTSAEIAG
                     ILGLSEHTVNHYLNHVTKKLDAVNRTQAVVKAMKKGYIS"
     gene            592623..593855
                     /gene="mrp"
                     /locus_tag="USDA257_c05410"
     CDS             592623..593855
                     /gene="mrp"
                     /locus_tag="USDA257_c05410"
                     /codon_start=1
                     /transl_table=11
                     /product="protein mrp"
                     /protein_id="AFL49136.1"
                     /translation="MQAFKRFEQRLAHRRGIAEAAKRQEGDMPDVTREMVLEKLRSVR
                     GPDMEGNIVDLGLVSDVFISDGKAYFSITVPADRAKELEPMRAAAERVVREMPGVKAA
                     MVALTADRKAAPQAAPAQRPAPHSGHAHAPRPAGGAPAKAGIPGVGAIIAVASGKGGV
                     GKSTTSVNLALALQANGLKVGLLDADIYGPSMPRLLKISGRPQQIEGRLIRPMENYGL
                     RVMSMGFLVDEEVAMIWRGPMIQSALLQMLREVAWGELDVLVVDMPPGTGDAQLTMAQ
                     QVPLAGAVIVSTPQDLALADARKGITMFRKVEVPVLGIVENMSYFVAPDTGKRYDIFG
                     HGGARKEAERIGVPFLGEVPLTMAIRETSDAGTPLVVSEPDGEVARIFRGIAERVSEQ
                     LSTPEGNQNRAMPNIVFE"
     gene            594177..595193
                     /gene="corA1"
                     /locus_tag="USDA257_c05420"
     CDS             594177..595193
                     /gene="corA1"
                     /locus_tag="USDA257_c05420"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transport protein CorA"
                     /protein_id="AFL49137.1"
                     /translation="MVRPHRCHPKGGRMISGYCVNGEAVALSTAEPPAFLRPEIVWID
                     LVEPTRAEELMMEELLGISIPTRDDLKGIEPSSRLYVEQDAVFMTASLVYRSETQIPG
                     LTDVGFILSGGRLVTIRYAEPRAFGLFKAGTHRIPGGCRNGVVILTRLLEAITDRTSE
                     ILEQAVDKIDGLSIEVFGDRAAGRRRPPQLLEARLRDVAGFHRLVAKTRDSLASLSRL
                     LTFVYTVPEVQADKDSRELCRSISRDIQSLSEHAAFISGNITFLLDASLGLINVEQNA
                     IIKIFSIASVVLLPPTLVASVYGMNFRVMPELEWQFGYPWALAAMVLSAVIPFFFFRW
                     KGWL"
     gene            595210..597111
                     /gene="kup1"
                     /locus_tag="USDA257_c05430"
     CDS             595210..597111
                     /gene="kup1"
                     /locus_tag="USDA257_c05430"
                     /codon_start=1
                     /transl_table=11
                     /product="putative potassium transport system protein kup
                     1"
                     /protein_id="AFL49138.1"
                     /translation="MSQLSAPAVHGSENMRRLLALGLGSIGVVYGDIGTSPLYAFREA
                     LRPVAHDGVTDVEIIGLISLMIWSLTIIVTIKYVLFLLRADNQGEGGTLSLLALLMKT
                     ANGHTWILFFMGVAGAALFIGDAMITPALSVLSAVEGLKLVTPALSDYVVPIAVVILL
                     LLFAVQSKGTAAVSNFFGPITLIWFLVMGGIGLVHIADDLSIFAAFNPFYAATFLFNE
                     GYVGIIVLGAVFLTVTGAEALYADLGHFGRRPIQWAWFTIVFPALTLNYLGQGAFILE
                     HPEAMSDPFFLMFPKWALLPVVILATAATIIASQAVITGAFSLTRQAIHLGFLPRMAI
                     FHTSETHTGQIYLPNVNTLLMFGVMALVFLFGSSEALATAYGISVTGAMVVTTMLAFE
                     FLRARWNWSAWWAAAALLPLLTLEFVFLGANMLKIHDGGYVPILIAATFIIVMWTWKR
                     GTEILHAKTRHIDIPLASFIKSIERKSEHAPVSVPGTAIFLTSDPDSTPAALLHNIKH
                     NHVLHQQNFILTVRTANTPKVPKEERVSVRPLSERFTLLEMKFGYMETQNVSQALGLF
                     RKSGLKFDIMSTSFYLGRRKLVPDAQSGMPHWQDRLFIALANAAIDPSDYFRLPTNRV
                     VELGSHVII"
     gene            597321..598487
                     /locus_tag="USDA257_c05440"
     CDS             597321..598487
                     /locus_tag="USDA257_c05440"
                     /codon_start=1
                     /transl_table=11
                     /product="putative hydrolase"
                     /protein_id="AFL49139.1"
                     /translation="MSRRKFRMSLSVWRAPAIIGLAIFLGFPSVAAYSDLATFLSGVN
                     RGDGERWRMYLTRSPAGSVHDVDMVFADPITTGGLDGGAGMTLPDGRRVALTAESKHQ
                     EGTPDEDRVTRKLKKGRIVAVSPVTPPKDFSAGSILQRTGFLMEPDFDGAEKMAFAKP
                     KIKGKEIEIATAFYRRKPPQPDPGVSPVLAKLVTNSEADILATAYVRPEPDYARVSPF
                     DSILREDKNGGRFIPDIAPDDHAWAATALPATVFGKEEQTCLAEGIYFEARSESVKGQ
                     AAVAQVILNRVRNPTYPKTICGVVYQNKAWRNRCQFSFACDMIRDLIYSRSHWKTAKE
                     VAMAVTAGKIWLPEVGSATHYHATYVKPAWAKTMKRVGQIGLHIFYRTYGGGWS"
     gene            598706..599131
                     /locus_tag="USDA257_c05450"
     CDS             598706..599131
                     /locus_tag="USDA257_c05450"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATP synthase protein I"
                     /protein_id="AFL49140.1"
                     /translation="MSAGRLYDRDRVRPRGAAKGSHVTEKPEESLEARLKRLGENIAS
                     KRVKVSDEAEVRSAESRKGYAAAMKLSSEFIAGIVVGAFLGYLLDHFAGTGPWGMIVL
                     LLLGFCAGVLNVLRSAGLVATPDQRGSGSGNSKKDGDDA"
     gene            599192..599944
                     /gene="atpB"
                     /locus_tag="USDA257_c05460"
     CDS             599192..599944
                     /gene="atpB"
                     /locus_tag="USDA257_c05460"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit a"
                     /protein_id="AFL49141.1"
                     /translation="MSNDPTHQFLINKIVPIELGGIDLSFTNASLFMVATVGVAAGFL
                     YLTTSQRGIIPTRMQSVSELSYEFIASMLREGAGSHGMKFFPMVFSLFMFILTANLLG
                     MFPYFFTVTSQIIVTFALAVFVIGTVILYGFYKHGLGFLQLFVPHGVPGVLLPLVVTI
                     EVISFLSRPISLSVRLFANMLAGHITLKVFAGFVTSLSALGALGIGGAILPLIMTVAI
                     TGLEFLVCFLQAYVFAVLTCMYLNDAVHPGSH"
     gene            600029..600256
                     /locus_tag="USDA257_c05470"
     CDS             600029..600256
                     /locus_tag="USDA257_c05470"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase, subunit C"
                     /protein_id="AFL49142.1"
                     /translation="MEAEAAKFIGAGLACLGMAGTALGLGNIFGSYLSGALRNPSAAD
                     GQFGRLVFGFAVTEALGIFSLLVALLLLFAV"
     gene            600332..600949
                     /gene="atpG1"
                     /locus_tag="USDA257_c05480"
     CDS             600332..600949
                     /gene="atpG1"
                     /locus_tag="USDA257_c05480"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit b/b'"
                     /protein_id="AFL49143.1"
                     /translation="MFVTAAYAQQSTTTEGAEAHDAPAAGEVHTETGVAHEGEHGSGV
                     FPPFDSTHFASQLLWLAITFGLFYLVMSKVIIPRIGGILEKRHDRIAQDLDQASRLKG
                     EADAAIASYEQELANAKAKGHSIADAAREEVKSKANADRTAVEAELTKKITAAEARIA
                     EIKSKALADVGAIAEETATAVVKQLIGGNVTKTEIAAAVKASAGN"
     gene            600963..601448
                     /gene="atpF"
                     /locus_tag="USDA257_c05490"
     CDS             600963..601448
                     /gene="atpF"
                     /locus_tag="USDA257_c05490"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit b"
                     /protein_id="AFL49144.1"
                     /translation="MALDATFYALVGLILFFALIAYLKVPGKIAEALDARADKIGNEL
                     AEAKRLREEAQSLVAEYQRKRKDAEAEAANIVAAAQREAERLTAEAKQKTEDYVARRT
                     ALSEQKIKQAESDAINAVRAAAVDLAISAAEKVLATKADASAQETLFEQALGEVKGRL
                     N"
     gene            complement(601818..602516)
                     /gene="rnhB"
                     /locus_tag="USDA257_c05500"
     CDS             complement(601818..602516)
                     /gene="rnhB"
                     /locus_tag="USDA257_c05500"
                     /EC_number="3.1.26.4"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HII"
                     /protein_id="AFL49145.1"
                     /translation="MSRRKSPDSPLFPLEPVLPDFSFEIAAKRDGFWPVAGADEAGRG
                     PLAGPVVAAAVILDPDAVPAGLNDSKLLTAEQREALFEEIMATATISIASSSAARIDA
                     TDILKASLDAMRRAIDGLSIAARFALIDGRDVPQGLPCHAKAIIKGDSRSVSIAAASI
                     VAKVTRDRMMTRADATFPAYGFALHAGYATVKHRSAIDSHGPCSLHRMSFRPFREAQE
                     QPVAISAEPLDVNS"
     gene            complement(602655..603812)
                     /locus_tag="USDA257_c05510"
     CDS             complement(602655..603812)
                     /locus_tag="USDA257_c05510"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized protein"
                     /protein_id="AFL49146.1"
                     /translation="MTELSQLRQGAFAPGNSAELAEAIVTGTGVRIEIDRRRGRGAAL
                     NMGGRFEPQTSEVFDDGWQTLEELPPFKTEVQIEKPRNVITRNESPDISFDRSINPYR
                     GCEHGCIYCFARPTHAYMGLSAGLDFEAKLFAKPDAPRLLERELAKPDYKVRPIAIGT
                     NTDPYQPIEKEWRIMRQILEVLKAANHPVMIVTKSAMVTRDIDLLAPMAEKGLARVGI
                     SVTTLDRKLARTMEPRASTPPKRLEAIRAVSEAGIPAGVLVAPIIPALNDHEIERVLD
                     AAKTAGATEASYVLLRLPLEVSPLFRDWLLRNYPDRYRHVMSLVRSMRGGKDYDAEFG
                     KRMKGAGPYAWQIGRRFELAAKRLELNLTRRQLRHDIFVPPLGTGVQLSLL"
     gene            603988..604524
                     /locus_tag="USDA257_c05520"
     CDS             603988..604524
                     /locus_tag="USDA257_c05520"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glycosyl transferase"
                     /protein_id="AFL49147.1"
                     /translation="MLTIIMETRDNEAELAQTLSVLVAGAVEGLVSDVIILDHGSRDG
                     SVHVADAAGCRFCAEWDLADVVRSARGDWLMLLEPGARPIGRWVDELIEYVSLHRDPA
                     RFSPSRLHRRPLLKRLSQRTAPLEAGYLMRKQDAVAVARADMQLSDIANARAVRKLAT
                     ELVPAWVALGNRSAAERA"
     gene            complement(604827..605369)
                     /gene="moaB"
                     /locus_tag="USDA257_c05530"
     CDS             complement(604827..605369)
                     /gene="moaB"
                     /locus_tag="USDA257_c05530"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein B"
                     /protein_id="AFL49148.1"
                     /translation="MPDIDETRPFIAVGIAVLTVSDTRTRADDKSGDTLEIRIREAGH
                     RLEARALVPDDRQRIYDQVRAWTLNASIDVVITTGGTGFTGRDVTPEALEPLFEKRMD
                     GFSEVFHRISYDKIGTSTIQSRATGGVANATFIFVLPGSPGACKDAWDGILKQQLDYR
                     HMPCNFVEIMPRLDEHLKRG"
     gene            complement(605373..606284)
                     /gene="ispE"
                     /locus_tag="USDA257_c05540"
     CDS             complement(605373..606284)
                     /gene="ispE"
                     /locus_tag="USDA257_c05540"
                     /EC_number="2.7.1.148"
                     /codon_start=1
                     /transl_table=11
                     /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
                     kinase IspE"
                     /protein_id="AFL49149.1"
                     /translation="MQVDGIAGFALTRVAPAKINLALHVVGQRPDGHHLLESLVTFAD
                     DGDRVAFAPADVDNFTVSGPFSRDLQVSADAKSGNLVLRARDLLRRELIDRSDAAGPV
                     HLHLEKNLPIASGIGGGSADAAATLRGLLSLWKAELAPQRLASLALELGADVPMCLDG
                     RPLLAKGIGEELAPLGDLPSFPVVLVNPLIAVSTPVIFRMLAQKRNPPLTVPQGIRTA
                     ADWLKALAGMRNDLERPARALQPAIEAVSGALHAAEADLVRMSGSGATCFGLFDGDEK
                     AAAAAQRISADHPGWYVLATRTAGKRG"
     gene            complement(606289..608121)
                     /locus_tag="USDA257_c05550"
     CDS             complement(606289..608121)
                     /locus_tag="USDA257_c05550"
                     /codon_start=1
                     /transl_table=11
                     /product="TPR domain protein"
                     /protein_id="AFL49150.1"
                     /translation="MRHNTLLRLLGGAAMLALLCVTGSHQAFAEDKAAVEEARPFDIR
                     SVNTFAGAFLAARTADVDRDFATATELYRIALRFEPDNIEVKQRLMITLLMSGKFDEG
                     VKIAEALKSDPAVERITTTVRAIEAIRKREYRSAQKLLNYQGPNDLDRLMSTLLSAWA
                     KSGQGRPKEAIAQIKALEGPEWFRVFKNYHAGAIALAAGDKTTARARLNDAILDREGG
                     SAAPDTFMRAVEALARFEAREGNKQKALDTVSVGESLVNNYTPLEALRKSIEEGEPQE
                     QQVRNAAQGAAAVLFSIGGALNREGAEDIVTLYLQTARRLDPESADILVMLGGIAENL
                     KKQEEAIALYKSVPADSPMRRVSELQLGLALAGVGKVDEAKKHLQALIEVDPENIRNY
                     LAYGSVLSDAKAYKEMGELYDRAVEAIGPVPKRSDWTVFFQRGIAYERQKIWAKAEPS
                     FLKALELNPNQPQVLNYLGYSWVDMNINLDKGLDMIRKAVELKPDDGYIVDSLGWAYF
                     RMDRFEEAVTELERAAELMAGDPTINDHLGDAYWRVGRKLEAVFQWNQALEMKPEEAE
                     VPKIKAKIENGLPPLKQDVPAAADAKETLPKKPGPEVAAPGRKS"
     gene            complement(608287..609255)
                     /gene="ispB"
                     /locus_tag="USDA257_c05560"
     CDS             complement(608287..609255)
                     /gene="ispB"
                     /locus_tag="USDA257_c05560"
                     /EC_number="2.5.1.90"
                     /codon_start=1
                     /transl_table=11
                     /product="octaprenyl-diphosphate synthase IspB"
                     /protein_id="