LOCUS       CP003284             4329264 bp    DNA     circular BCT 31-JAN-2014
DEFINITION  Anabaena sp. 90 chromosome chANA01, complete sequence.
ACCESSION   CP003284
VERSION     CP003284.1
DBLINK      BioProject: PRJNA30803
            BioSample: SAMN02604187
KEYWORDS    .
SOURCE      Anabaena sp. 90
  ORGANISM  Anabaena sp. 90
            Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
REFERENCE   1  (bases 1 to 4329264)
  AUTHORS   Wang,H., Sivonen,K., Rouhiainen,L., Fewer,D.P., Lyra,C.,
            Rantala-Ylinen,A., Vestola,J., Jokela,J., Rantasarkka,K., Li,Z. and
            Liu,B.
  TITLE     Genome-derived insights into the biology of the hepatotoxic
            bloom-forming cyanobacterium Anabaena sp. strain 90
  JOURNAL   BMC Genomics 13 (1), 613 (2012)
   PUBMED   23148582
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 4329264)
  AUTHORS   Wang,H., Sivonen,K. and Rouhiainen,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-DEC-2011) Department of Food and Environmental
            Sciences, University of Helsinki, P.O. Box 56, Viikinkaari 9,
            Helsinki FIN-0014, Finland
COMMENT     This cyanobacterium strain is available from Kaarina Sivonen
            (kaarina.sivonen@helsinki.fi) at University of Helsinki.
FEATURES             Location/Qualifiers
     source          1..4329264
                     /organism="Anabaena sp. 90"
                     /mol_type="genomic DNA"
                     /strain="90"
                     /db_xref="taxon:46234"
                     /chromosome="chANA01"
                     /country="Finland: Lake Vesijarvi"
     gene            139..1515
                     /gene="dnaA"
                     /locus_tag="ANA_C10001"
     CDS             139..1515
                     /gene="dnaA"
                     /locus_tag="ANA_C10001"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein"
                     /protein_id="AFW92817.1"
                     /translation="MEIPIDGLWNHVLERLQLELAPPTFETWIKTAKAQQLENNCLVI
                     YAPNPFARNWLQKYYIHTIANVVQDIVGYPIEIYITVVEDEEVSHLGKQELGGKLPAI
                     NHILANAPINTQKTSDLNSKYVFPRFVVGANNRMAHAASLAVAEYPGREFNPLFLCGG
                     VGLGKTHLMQAIGNYRWEICPNSKIFYVSTEQFTNDLITAIRQDSMQTFREHYRAADM
                     LLVDDIQFLEGKEYTQEEFFHTFNTLHEAGKQVVIASDRPPNQIPSLQERLCSRFSMG
                     LIADIQTPDLETRMAILQKKAEYENIRLPREVVEYIASNCTSNIRELEGALIRALAYI
                     SIWGLPMTVENLAPILGTPSQKIATTPEIILNIVADALNVSIEDLKSNSRRREISWAR
                     QIGMYLMRQLTNLSLPKIGEEFGGKDHTTVMYSCEKITQLQESDQSLVQTLHQLSDRI
                     QMATRSLK"
     gene            1801..2250
                     /locus_tag="ANA_C10002"
     CDS             1801..2250
                     /locus_tag="ANA_C10002"
                     /EC_number="3.5.4.1"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine deaminase"
                     /protein_id="AFW92818.1"
                     /translation="MDEFMDAAILEAQQGRQEGGIPIGSVLVKDGKIVGRGHNKRVQD
                     GDPVTHAEIDCLRNAGRIGNYRGTILYSTLMPCYLCAGAVVQFGIKKVIAGESKTFSG
                     AKEFMVSHGVEVVDLNLDECEQMMSDFITTNPELWDEDIGCDSLLVE"
     gene            2318..2635
                     /locus_tag="ANA_C10003"
     CDS             2318..2635
                     /locus_tag="ANA_C10003"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92819.1"
                     /translation="MTHITSKKVVRRGRIFPELIIAPEELARREAEDEIFYQRCRAIF
                     ERVRSEYIESHYGWYIAIEPNSGEYFLDQDRMQSHKRMLEKYPQARHFVFCLNETGTT
                     GTI"
     gene            2632..2994
                     /locus_tag="ANA_C10004"
     CDS             2632..2994
                     /locus_tag="ANA_C10004"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92820.1"
                     /translation="MIEGYFGENGQLFFEIELVTNDGLNLAVDALFDSGFAGFMAINT
                     QDLDGLEWLYSGEEMLRTAKGESKFQIYLGQVILDGKQYQIPVNVGKGINEILLGSEW
                     LKLLRLVVDFPENILTLG"
     gene            3088..3402
                     /locus_tag="ANA_C10005"
     CDS             3088..3402
                     /locus_tag="ANA_C10005"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92821.1"
                     /translation="MPTQINAPPAIDYAPLELQGELIAMQELTIEELLTIAQSQIPES
                     QQELHFQLLEKNQNNQLSESDRLLLKSLRVSADYLMLKKAYAYALLKWQGFSLPDFEQ
                     LV"
     gene            3408..3830
                     /locus_tag="ANA_C10006"
     CDS             3408..3830
                     /locus_tag="ANA_C10006"
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease domain-containing protein"
                     /protein_id="AFW92822.1"
                     /translation="MSSISKSLRQQVINEAGYRCEYCRTSSRLTGMPLVMDHILPSSL
                     GGNDERENLAACCYRCNEFKGAKITANDPVKNESISLFNPRLQRWLDHFQWANGGTHI
                     IGITAIGRATVLALRLNNEDVVQARAIWISLSWHPPND"
     gene            complement(3877..4206)
                     /locus_tag="ANA_C10007"
                     /note="XisI protein;
                     with internal stop codon"
                     /pseudo
     gene            complement(4207..4338)
                     /locus_tag="ANA_C10008"
                     /note="prevent-host-death protein;
                     N terminal partial ORF"
                     /pseudo
     gene            complement(4413..4745)
                     /gene="xisI"
                     /locus_tag="ANA_C10009"
     CDS             complement(4413..4745)
                     /gene="xisI"
                     /locus_tag="ANA_C10009"
                     /codon_start=1
                     /transl_table=11
                     /product="XisI protein"
                     /protein_id="AFW92823.1"
                     /translation="METLNYREIVKNFIQKYAQEECVEDSENLEIVFDTERDVYLLLV
                     TGWKDEKRIYWFPIHISIKNGKIWIERDFTEEGIPHQLVELGVPKTDIVLGFRSPYVR
                     QFTGFASV"
     gene            complement(4758..4979)
                     /locus_tag="ANA_C10010"
     CDS             complement(4758..4979)
                     /locus_tag="ANA_C10010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92824.1"
                     /translation="MKHYHINIFYSQEDEGYIADIPDLKYCSGFGLTEEEALQEVLKA
                     KTAWLEAAEIEGKPIPEPRYKPVIYQIAS"
     gene            complement(4979..5233)
                     /locus_tag="ANA_C10011"
     CDS             complement(4979..5233)
                     /locus_tag="ANA_C10011"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92825.1"
                     /translation="MSKKRKLLEKVLSGSKNLQFDDLVTLVEAFGFSLSRINGSHHIF
                     THPTIPELINLQNRNGKAIPYQIRQFLILIEKYSLTMENE"
     gene            5565..7067
                     /locus_tag="ANA_C10012"
     CDS             5565..7067
                     /locus_tag="ANA_C10012"
                     /EC_number="2.1.1.72"
                     /codon_start=1
                     /transl_table=11
                     /product="type II modification methylase"
                     /protein_id="AFW92826.1"
                     /translation="MKSIVKQLSLFELELTKTNPETIVLPKGYKGLAAFHKYWGKKPI
                     ECLAFLIENLTEKGDIVLDPFLGSGLVAREAVIRERRFIGIDINPVAVELSNLLVNLP
                     NPDILKKALDELEISVKSEIYKTYLLEDGKFATHYLWHENELNSVWHLSPRRNESDKR
                     IPTNYDYQAFKQFEGYEPKIPRPIKLFQNSRINTNDTLTLKDLFTGRALHNIDLLLNA
                     IHKQPDSIKSALLLSLTAASGQMSKMVFAITGRGKTKSEPTNKIEVGSWVIGYWRPTL
                     HFEINVWNCFIKRANSLLKSIQEDEFKKGYCVSKKLTDVINNKADVAIFQGDNRKVLN
                     NCPDETISLILTDPPHSDRIPYLELSEMWNCLIDKEPDFSQEIVVSNARSRGKNKNNY
                     VNEMTEFMQTATRILKPGGILALFFNARDADSWQFLKEVIPSDNQLQFRGLFPMNYSA
                     NSVIQDSRKGGLKNDFVLIYQKPGNEDNIKLMLLEKLPNWSKEIPDIHSK"
     gene            7088..8182
                     /locus_tag="ANA_C10013"
     CDS             7088..8182
                     /locus_tag="ANA_C10013"
                     /codon_start=1
                     /transl_table=11
                     /product="type II restriction enzyme"
                     /protein_id="AFW92827.1"
                     /translation="MSYTFSQLSRLYDENKFFELTSSPEGLYFLKLRSLARKDYYLHL
                     FQKAQISSDNLGVKQYLETLFKSNISLETIHDSINQIYEIQREERRIHEQDLLAELYK
                     LRVFDWGGIHQNDINKYLVDNYIKKITNYDNLIEKVKNEILHSLKGFVLCSWYNNWTS
                     IIIEDIFKDHERVLPTVGLIKQVDFFIDDIPFDLKVTYFPKGFMENERRNRKLTIKEL
                     SELKKTAKIFNLPFDQNRPDDELLIDLITAFAESSQQDVKDFYDNFVKIRRDIINNTL
                     KQPRELLRWLYENQGSQRFDASNRLFLVLVDTNSLEDSWKLKRDYTLLKNKIDEYLNT
                     RSFNKDKLLLNWSFNNNQYQSYADVLFVLK"
     gene            complement(8250..9527)
                     /gene="ahcY"
                     /locus_tag="ANA_C10014"
     CDS             complement(8250..9527)
                     /gene="ahcY"
                     /locus_tag="ANA_C10014"
                     /EC_number="3.3.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-L-homocysteine hydrolase"
                     /protein_id="AFW92828.1"
                     /translation="MIATTPRLKHEVKDLGLAPLGRQRIEWAGREMPVLKQIRDRFEK
                     EKPFAGLRISACAHVTTETAHLAIALKAGGADAVLIASNPLSTQDDVAASLVADHEIS
                     VFAQKGEDAATYSRHVQIALDHRPNIIVDDGSDVVAELVQHRQNQIADLIGSTEETTT
                     GIVRLRAMFNEGVLTFPAMNVNDADTKHFFDNRYGTGQSTLDGIIRATNILLAGKTVV
                     VVGYGWCGKGTALRARGMGANVIVTEIDHIKAIEAVMDGFRVLPMAEAAPHGDIFITV
                     TGNKHVVRGEHFDVMKDGAIVCNSGHFDLELDLKYLAANAKEIKDVRPFTEEYKLTNG
                     KSVVVLGQGRLINLAAAEGHPSAVMDMSFANQALAVEYLVKNKGSLAAGLHSIPRDVD
                     EEIARLKLQAMGIFIDSLTAEQIDYTNSWQSGT"
     gene            9934..11565
                     /locus_tag="ANA_C10015"
     CDS             9934..11565
                     /locus_tag="ANA_C10015"
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel family protein"
                     /protein_id="AFW92829.1"
                     /translation="MWKPSITQGGVLVILRFLAVAGTMVITIGSVTKATAQFSPLPFL
                     PTPSSSSNKVDDKMVSGWINLDGRPLFSITASKTKFPERFQNIQQNLQDITHNYLQAS
                     ATEVKVQNRTVKGLPTIFVNDQYLMTITYEDVGQANPLTLANQISDDLKQHLQQAKQE
                     RQTRFLIQQGEIAAVGTLAMIIISWGVRRWQKRLSKNAADSIPAISKDTAPITKLLNQ
                     QQQQHLQEVKTRLFQIAQAGIWGSGSLIILGLFPYTRAFQIGILTIAQIPIKLTIVAV
                     GTYVAVRFTYALIDHFTSTIVSGGALLTPETSERLQLRISTFSGVTKSITTIIFVGAG
                     SLLALISLGIDIVPLLAGAGLVGVAISLASQNLIKDAINGFLIIFEDQYALGDMITVG
                     TVGGLVEKLNLRMTQVRDSEGRLITIPNSEVKIVANLSSRWSRADLSIPVSYQADVDE
                     ALKLIKDVGLEMSQDPAWKHQILEKPNVLGVEHFSDRGVMIRVWIKTQPLKQWNVARE
                     YRRRLKITLDAAGIYIPVPQQANWINEVQLLSSQD"
     gene            11803..12063
                     /locus_tag="ANA_C10016"
     CDS             11803..12063
                     /locus_tag="ANA_C10016"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92830.1"
                     /translation="MKHYILNLNPTAKHEWDRCIIRDPLTAKRPDIAKIISEAVGADT
                     GSYLVSVNIEVTVLQEAPIPSPEQLSLPFPEVSVPTPLREAA"
     gene            12147..12467
                     /locus_tag="ANA_C10017"
     CDS             12147..12467
                     /locus_tag="ANA_C10017"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92831.1"
                     /translation="MSESVQYITNAQGEKVGVLLNLETYQQLTNLSVDSELLIGLSID
                     ELQALAESSLFPKTQTQLQELLIKNSQNQLSKVETETLDKLLAQVDQLNIIKTRARYT
                     LNIL"
     gene            complement(12556..16398)
                     /locus_tag="ANA_C10018"
     CDS             complement(12556..16398)
                     /locus_tag="ANA_C10018"
                     /EC_number="2.1.1.72"
                     /codon_start=1
                     /transl_table=11
                     /product="type II restriction enzyme and modification
                     methylase"
                     /protein_id="AFW92832.1"
                     /translation="MACATLRYQTVSLRQPNLQYKHLRKMNLHKMQPRESLNKAFLKV
                     KPNRNDIEHFKKNLQSLIEEINEVESEEFHKNLIGDFLKNTYYSTNHFINTKGRNDFV
                     IHNGKDAKSSVGVILEAKKPTNKGEMLKVDNLNTKAFQELVLYFLRERLIEKNIEVKY
                     LIVTNIYEWFIFDANSFDKAFIENKTLVKQFTDFAEGRLTSKKTDFFYKEIAQPAIAE
                     IQEQIPFTYFDIRECQEYLQPGENPDDHKLIPLFKLFSPSHLLKLPFANDSNTLDKGF
                     YSELLHIIGLTETKEGGKKLIQRKKENERNPGSLIENAIVQLDSLDKISRIEKPERFG
                     ETYQEQLFNVGLALAITWVNRILFLKLLEAQLIKYHKNDLSFGFLNLEKVQNYHDLNS
                     LFFSVLARKQNERNETVKKIFSHVPYLNSSLFEHTDIEQSSPSIFIQNLRNEKLEIFP
                     ATVLKDNNGKKRIGEINALEYLFEFLNAYDFSSESGEEIQEENKRLINASVLGLIFEK
                     INGYKDGSFFTPGFITMYMCRETIRKAVIQKFNEVKGWNCENIDDLYEKIEDKKEANR
                     IINSLKICDPAVGSGHFLVSALNEIIAIKSELKILLDREGKRLKEYDIEVVNDELIVI
                     DDEKLLFDYNPKSKESQRVQETLFHEKQTIIENCLFGVDINPNSVKICRLRLWIELLK
                     NAYYKTSPLTPLLGGEGNIGELETLPNIDINIKCGNSLISRFSLDADLRTALNRNKCS
                     METYRNAVQTYRNAENKEQKREMERLINDIKGNFKTTLQASDPNKTKFRKLEGELFNL
                     ENQILLFEETKAEKKTREKKIAKLNNEIDKLRVEIEDIEGGKIYENALEWRFEFPEVL
                     NNEGVFVGFDVVIGNPPYIRQEEIKELKPILQQNYQCYTGTADIFVYFYEIGLKLLKS
                     KGHLTYISSNKYFRAGYGEKLRHFLTNSTTIYNLIDFGDFPVFEEAIAYPSIIILSKV
                     KSDVNQIQALSWNAIKKQNIAEFVTVLKEDSLIILQGNLKSDGWRLESSQILNLLTKL
                     QNSGTALGEYVNGKFYRGILTGFNEAFVVDRETRDRLIVEHPSSAEVIKPLLRGRDVK
                     RWCVEYQDLWLIFTRRGIDIQKYPAIENYLSQYKKQLTPGTGRKAGTYKWYEIQDNIA
                     YWQEFEQPKIIYPNICKRNEFAWDESGYYANQKAFIIPTNDKVLLAILNSSVVTFLFH
                     HLLSKLQGDFYEPSSIFMKDFPIPPATESQRKAIENLIQKCLAAKGKDVKNIETEIDQ
                     LVYQLYELTAEEIKIIEG"
     gene            complement(16982..18364)
                     /locus_tag="ANA_C10019"
     CDS             complement(16982..18364)
                     /locus_tag="ANA_C10019"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver domain-containing
                     protein"
                     /protein_id="AFW92833.1"
                     /translation="MKNTGTFTKLPPAGLLRQLSNCYETTCLQAFSNSVSWLIYIEQG
                     KIIYATHSVEPFDRLERQMRRLHQQIPLVDNEVRVQMRLVFEAEDHDHFPNQPPEYEA
                     INWLVTEQHLLPTQATLLIQELVKEVIEWFILIKTGTYELAEPIHDLTKICQLDINTI
                     IEECQNQLQNWRYLGRYISSPYQRPYLLVSSKFQDKRLPPLKENITNWMKGFSLRHLA
                     IIMNQDELQLALSLYPYIVKGSIVLHEPDPPFDKLPKTNGSLLPFSEDSTESVKEKLF
                     ISDVALSKDPPPETLIISENNVAVEQLVTDIADLPPDDLQPETVDSNIDADSQKVKVN
                     PRTTQKTYKIISVDDSPTILKEISRYLEDENFTLVTINEPVKAVMSIIRHKPDLILLD
                     LNMAGIDGYELCRIIRNNSLFKNIPIIFVTSNKGIIDKVKARFVGASGYLTKPFTRAE
                     LLKMIFMHLA"
     gene            19114..19788
                     /locus_tag="ANA_C10020"
     CDS             19114..19788
                     /locus_tag="ANA_C10020"
                     /codon_start=1
                     /transl_table=11
                     /product="von Willebrand factor type A domain-containing
                     protein"
                     /protein_id="AFW92834.1"
                     /translation="MIDTFNLDEVVEFAENPEPRCPCVLLLDTSGSMQGERIEALNQG
                     LLSLKDELVKNSLASRRVEVAIITFDSSVNVVQDFVTADQFNPPILTAQGLTIMGSAI
                     HKALDIIQERKSQYRTNGIAYYRPWVFMITDGEPQGELDHVVEQASQRLQGDESNKRV
                     AFFTVGVDNANMSRLSQIAVRSPLKLKGLNFIEMFVWLSASMSAVSHSQVDEQVALPP
                     IGWGSV"
     gene            19842..20624
                     /locus_tag="ANA_C10021"
     CDS             19842..20624
                     /locus_tag="ANA_C10021"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein phosphatase 2C"
                     /protein_id="AFW92835.1"
                     /translation="MNTSKQISQWRIVAASVCGTSHSKNQQLCQDAHHWQLLANNVLV
                     IAAADGAGSAKLGKVGSMIAVETAIEHLSRQEITSNTLANNDFLGYLLTDAMLAARKA
                     IEIEADICHNQPHDLATTLIVMIATPEIVAVGQVGDGLAVAKNSMGNLIALTIPSNGE
                     YINQTTFLTSPDALETAQLKIWREEIVNVGVLTDGLQMLALNMIVGEPHKPFFLPLFE
                     FVANAEDRILAKEHLMRFLSSDKITQRTDDDLTLVLAAFINS"
     gene            20754..22946
                     /locus_tag="ANA_C10022"
     CDS             20754..22946
                     /locus_tag="ANA_C10022"
                     /EC_number="2.7.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="TPR repeat domain-containing protein kinase"
                     /protein_id="AFW92836.1"
                     /translation="MQVLRRFPNPEILNLSVSVGHGGEACIYAVPLDDNLVAKIYHKP
                     TISYAQKLRAMLANPPVNPTDNLGHIAIAWPQELLQAADSSGKIVGFIMPRIRGMRPI
                     MDFYNPGIRRQHCPLFNYQYLLRTARNLASAFAALHASGYCIGDVNESNILVSDTALV
                     TLVDTDSFQVTEPLENLVYRCSVGKAEYTPPELQNKTFADYDRENYHDLFGLAVLIFQ
                     LLMEGTHPFSGIFQGGIEPPTYQGRILSGHFTYSQKKQVPYLPTPISPGWDLLHPSLQ
                     DLFVRCFEDGHDNPRLRPNAQTWLLALAAVEESLLTCAANPQHLYHNHLDKCPWCERT
                     RRLGGRDPFPSLVAIASKQHLQPRQKPQSKRRYVPTPRITQPLKSNYPVYHWQPINQQ
                     FYHVPSRKKLNPKIYGFIVGVMGLGLLGYLDVMIKFTRPFVSQNPYTQQSLMSRAANQ
                     TPDLTKLSFTDYYQRGHTAYQRQDYEQAVVNFTQAIEKNPQSAKSYIDLANSQYNLNN
                     YEAALANYNQALKLDPQEVKAYVNRGNAYYMLANYSSDPNREYKQAIADFNAAININK
                     NDAEAYIRRGVVRFEINKYINNSFQEYEKSIADFTEAIKLNSSKVDAYFQRGSVRYQM
                     AQYSTDYAAEYKQAIADFTEAIKLNSRLAKIYLKRGMAYYELAQYGEGIADKNHVQAV
                     ADLEAAAKVSLEENDMDNYQQSLSSICIVVANKCDGLLSNSTLLGQSN"
     gene            23597..24373
                     /locus_tag="ANA_C10023"
     CDS             23597..24373
                     /locus_tag="ANA_C10023"
                     /EC_number="2.7.7.33"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate cytidylyltransferase"
                     /protein_id="AFW92837.1"
                     /translation="MKAVILAGGLGTRLSEETSIRPKPMVEVGGKPILWHIMKTYSAH
                     GINDFIICCGYKGYVIKEYFANYFLHMSDVTFDMRFNQMNVHSGYAEPWRVTLVNTGD
                     NTMTGGRLKQVREHIGNETFCFTYGDGVSNINITELIKFHQEQKTLATLSAVQPAGRF
                     GAISLGQEQTKITSFQEKPEGDGAWINGGYFVLEPQVIDFIADTSTVWEKEPLEKLAN
                     LEQLAAYKHDGFWQPMDTLRDKNYLEDLWKSGKAPWQVWE"
     gene            24401..25615
                     /locus_tag="ANA_C10024"
     CDS             24401..25615
                     /locus_tag="ANA_C10024"
                     /EC_number="1.1.5.3"
                     /EC_number="1.5.3.1"
                     /EC_number="1.4.99.1"
                     /EC_number="1.4.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="AFW92838.1"
                     /translation="MYDFAIIGGGIVGLSTAMALGERYANAKILVLEKESEWAFHQTG
                     NNSGVIHSGIYYKPGSFKAKFSRDGSRSMVEFCQKYDIDHDVCGKVIVATNEQELPRL
                     ENLYTRGLENGIPVKRISPQEVKEVEPHVSCVGGIRVFNTGIVNYKQVCLKYAELIRN
                     QGGDLRLNTQVVKITRSGKNQVLETNKGSFETRFVINCAGLHSDRIAKLGKANPQAKI
                     VPFRGEYYELTPAKRYLVKTLIYPVPNPDFPFLGVHFTRMIDNTVHAGPNAVLSLKRE
                     GYKKTDFDFRDFAEVITYPGFWKLAAKHADEGIQEIIRSFSKAAFVKSLQTLIPEVQA
                     EDVIPTHAGVRAQALMNNGALVDDFLIIAGENSIHVCNAPSPAATSSLEIGKAIVKQI
                     PEPTHLHSLASL"
     gene            25750..26787
                     /locus_tag="ANA_C10025"
     CDS             25750..26787
                     /locus_tag="ANA_C10025"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="AFW92839.1"
                     /translation="MKILVTGTEGYLGSLLPSLLMKRGHEVLGVDTGFYKVGWLYNGT
                     HLTAKTLNKDIRDISPEDLEGVEAIVHMAELSNDPTGQLSPTITYDINHLGSVRLANL
                     AKAVGVRRFVYMSSCSVYGVASEGDITESSPVNPQTAYAECKTLVERDVQPLADDDFS
                     PTFMRNATAFGASPRMRFDIVLNNLAGLAWTTKEIKMTSDGTPWRPLVHALDICKAIV
                     CALEAPRDIIHNQIFNVGDTANNYRVKEIAEIVADVFPGCQLSFGTNGSDNRSYRVSF
                     EKINTILPGFKCDWNAQLGAGQLFSLFKQIDMNEDTFLSRGFTRLKQLEYLIRTEQID
                     KDFFWNKQENY"
     gene            27015..27983
                     /locus_tag="ANA_C10026"
     CDS             27015..27983
                     /locus_tag="ANA_C10026"
                     /EC_number="2.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="AFW92840.1"
                     /translation="MQKLLTIAIPTYNRAALLDKQLAWLAIAIKGFESECEIIISDNC
                     STDNTPGVVKKWQSVFSNTVFIANRNRENIGLMPNIAFCLQAAGSKYVWTVGDDDPIQ
                     ERTLAHVVTTIKRNPSLSLMFLNCCGRDHKTNQVLVKHWFPSDSDEIITNSKPVFEQY
                     LQNSFGGVLFMTATIYKTELVQQALQQWTTSCKNLASQAYWTGFCAAHGNVIVTQDNY
                     LECTMHASSLEENPRWSLMMRYVYIPEIYLKLLSLGYSAKFCQRMILENIFKLSDWKI
                     LFGALRRWPVLATNIIITYLQLVGKFIYQLNFNQQKSSINISHLSN"
     gene            28023..29036
                     /locus_tag="ANA_C10027"
     CDS             28023..29036
                     /locus_tag="ANA_C10027"
                     /EC_number="2.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="AFW92841.1"
                     /translation="MNKLLTIAIPTYNRADLLDKQLTWLSQAIKGFETECEILVSDNC
                     STDHTQSIISKWQNILKNITFKSNRNHENIGVMRNIFYCLSAATTKYVWTIGDDDPIQ
                     ERAVTYVMEKIKNIDNLSLLFLNFSGRNQITGEAVHPPKIVGNRWFDADTEDGKGDGK
                     AIFEHCFSKSVGAVIFLTATVYRADLIKRALEIWPTASNNWISLAYLAGYCAANGKVI
                     VTKDIYLECIVGVSYWQKEPKSALLMQYQHIPEVILKLQEIGYSKAYCCRMLLQNYHE
                     VDLKVFLGAMRRWPVSAIKTVIPFLGLASVAVLELIPMREFKVAEAELERTKTLEVRN
                     YKG"
     gene            29087..29923
                     /locus_tag="ANA_C10028"
     CDS             29087..29923
                     /locus_tag="ANA_C10028"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92842.1"
                     /translation="MINKVAEKISVLKDELAYRVSLWHHGKNLPAISAKDQLIVDTLK
                     TSGVYITSLENLGFLSTATMLATANTCADSMVNPRDIHAGYKLPQIYTVTDLPEFFNW
                     GIETRLQNIIEHYIGLPIAFHGVHVRKDFPNKKQLETLLWHKDSEDRRMIKVIIYLND
                     VTEEHGPFEYIPLPTNALDQVKNYQVDYELWRVNFLGINDDKMMKVIPKSAWKSCPGK
                     AGTVIFADVRNIFHHGTVRNQERSTLFFTYTANSPKRPELCTQYHDDTFPKINPQLGL
                     KV"
     gene            30128..30673
                     /gene="rmlC"
                     /locus_tag="ANA_C10029"
     CDS             30128..30673
                     /gene="rmlC"
                     /locus_tag="ANA_C10029"
                     /EC_number="5.1.3.13"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
                     /protein_id="AFW92843.1"
                     /translation="MIFTSTKLAGAFIIDLEEKPDSRGFFARTFCADEFIAHGLKPTV
                     AQCNLSFNHKKGTLRGMHYQTLPAAETKLIRCTQGAIYDVIVDMRPESPTYLAHIGVE
                     LSAENRRALYVPEMFAHGYQALTDGAEVVYQVGEFYTPGYERGLRYDDPILEISWPLS
                     ATEMSDKDRNWPLLESILIGV"
     gene            30676..31989
                     /locus_tag="ANA_C10030"
     CDS             30676..31989
                     /locus_tag="ANA_C10030"
                     /codon_start=1
                     /transl_table=11
                     /product="SAF domain-containing protein"
                     /protein_id="AFW92844.1"
                     /translation="MIIVDKALQARAALGKPVKVAMIGAGFMGRGIANQIINSVPGME
                     LVAISNRHIDNAKRAYLEAGIEDIKIVANLADLEDAIAQNKYAITEDAMLLCEADGID
                     AIIEVTGTIEYAAHLVMCAIAHGKHIILMNAELDGTIGPILKVHADRAGVVLSACDGD
                     QPGVEMNLYRFVKSIGLKPLLCGNIKGLQDPYRNPTTQAGFAQRWGQNPAMVTSFADG
                     TKISFEQAIVANGTGMKVAKRGMLGYDYTGHVDEMTKMYDIDQLQELGGIVDYVVGTK
                     PGPGVFVFATHEDPKQRHYLNLYKLGEGPLYSFYTPYHLCHFEVPLSVARAVLFHDAV
                     LAPIAGPVVDVVTTAKIDLTAGETLDGIGYYMTYGQCENSPIVQQENLLPMGLAEGCR
                     LKRDIPKDQVLTYDDVELPEGRLCDQLRAEQTVYFAPAKTLALTK"
     gene            32248..33345
                     /locus_tag="ANA_C10031"
     CDS             32248..33345
                     /locus_tag="ANA_C10031"
                     /EC_number="2.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 1 protein"
                     /protein_id="AFW92845.1"
                     /translation="MKIALVHDYLTQRGGAERVFELLCKRYPDADIFTSLYDPQKSID
                     LGERIINTTFLQKIPGATKYFRMLAPLYFPAFRSLDLQDYDLIISSSTSFAKAVRKKP
                     EARHICFCHNVTRFLWDTETYLREYGDYRYFAPLIERVFQMMRNVDLKYAQEPDLYIA
                     NSSIVAQRIQKIYHKQAIAINYPIDTSNFVFSDTKEEYYLASARMISYKRLDIIVEAF
                     NWLGWNLLISGDGPEQERLKAHALPNIQFLGHVSDRERKDLFSKATSIIVAALEDYGL
                     VPVEANASGTPVIAYGAGGVLDTQIPGKTGVFFKRQTPCSLQAAILEAGGIAWDYETI
                     RNHAVSNFSEQSFFSKVEQVIGKTSSSSNLF"
     gene            33614..35842
                     /locus_tag="ANA_C10032"
     CDS             33614..35842
                     /locus_tag="ANA_C10032"
                     /EC_number="2.7.10.-"
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide biosynthesis protein"
                     /protein_id="AFW92846.1"
                     /translation="MVQTSLNPNINPASETEPGYGQMFAVILRRFPWLLLVLLSSTAI
                     AGIITLKTEPSFKSTMQLLVEPNYQGKKETDNTESQFTDTNVEVDTATQLNLMQSSGL
                     IKKAVDKLKAEYPDLTVMDLKKSLVLTQIKSPEDKVVTKIFQVDYTSNDPGKTQKVLQ
                     TIQQVYLEYNKQQQNSRLQKGLQVIREQLRKATDEVTVSEANLQRFRRNQNLIDPDAQ
                     AKTVETTLNTVQQERQATRSLYEEALAKQKSLQVQLNRSPQNALVSSRLSQSTRYQGL
                     LNEIQKTELALAQERLRFTDDTPGVQKLNEQLQSQKQLLQKEVSRTLGESTNPVFSSG
                     DNLLAQGQLGQIDLNLTGQLVETQTTIVALTARDQTLAAKEKELQADLKRFPSLLAYY
                     NRILPQLQFSRERLEQLLRAEQKLRQELSKGGFNWEVVEEPQEGSQTGPNMRQNLLLG
                     GVIGLMLGGAAAFIREAADDAVHTTAELEKQAALPLLGTTPKLPPARPRESMIKLPFG
                     KPEVLAPWTIQVLQSSPRWESLDLIYKNIELLNKVSDLRSLMVTSALPDDGKSALALG
                     LAMSAARLHKKVLLIDANLRDPNLHKQLNLPNEQGLSSLLESEVNLPNHISVPYSGSS
                     YIDILTAGPIPTDPAHLLSSPRMIQLMAAFEENYDLVIIDAPSVLGLVDAMLTASSCR
                     SVVMMASIGKVTRTQLNQATRMLSKLNLIGVVANGASPSDSTYVPYVKPKQLVLQPAM
                     EE"
     gene            36410..37162
                     /locus_tag="ANA_C10033"
     CDS             36410..37162
                     /locus_tag="ANA_C10033"
                     /EC_number="2.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="AFW92847.1"
                     /translation="MPISVISSLNNNSIIPQSSENFNFLSCTLQWRRGKLLVKASEKL
                     PQPHLAALENEASLIECLKHSPVSLVSIDPKIGDSLLKVWANACQKANKPIFINISVY
                     RKSSKKGNQIFRNLRIIIDWTWALFLLLFMSPVILGGLITIQIYSPKLLFDYEWYVGE
                     NKQLFRAIKFSPTAKHEMTNLIVVLGTFFLNNLSNGLNLFQGKFCLLNNRCLSLEDAV
                     KLSLEAQSKKLNQKHNFSGAWQIENKVNLPIV"
     gene            37275..38219
                     /locus_tag="ANA_C10034"
     CDS             37275..38219
                     /locus_tag="ANA_C10034"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92848.1"
                     /translation="MQTAICTVFEKDYHYGVGALVNSLYHHGFRGIIWAGYRGNVPPW
                     AKSLKTENGYQEFSLGEGCAIRFVKLTTPKHLGFYKPDFMSQLWENYCPDIDALFYFD
                     PDIVNKCEWDFYENWVSRGIALCGDSWYFVPANHPKRLAWKEFAQNNGFTCDRELDYH
                     YNSGFIGVHKNYKSILKLWQQLEELGEMAGYANLDDLYNDNTFHHYPYLYGDQTYLNL
                     ALMLTNYPLSTVGPDGMDFVPGGTIMSHATIPNIKPWRKKLLLSALEGSSPTITDKLY
                     WQHSQTPIRLYSMAKILWQKFEILCGSALGRFIRRAPM"
     gene            38286..40130
                     /locus_tag="ANA_C10035"
     CDS             38286..40130
                     /locus_tag="ANA_C10035"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter protein"
                     /protein_id="AFW92849.1"
                     /translation="MDSKFLPSTVKIFQATSLWQNNRVILREFKHFRVVAILAIVFSA
                     LAASFEGFGLGFLLVFLQSLTTPGAEPVKTGIGWFDILILGINASATERLYRISALIV
                     VTTCMRASFNYIGQICIQFSEISLVDNLRKRIFQQLEAQTLNYFSHKKSGELVNTLTS
                     EMERIRQIFGGLAFLITRSFTLIVYSISLFILSWKLTIVSILLFSLLAVALSTLNKQI
                     RERSFTITTANDNFTARVLEFIEGIRTIHAFSTQEFERKRYYQASEKIVNTWKSVYWI
                     SLIVKPLAESISTLILISMIIVALTTGLMKVSALLTFFFVLFRIIPMTQDLNGVVAFL
                     STQAGAVENIKELLKTDDKIYFQNGALRFPSFKRSIDLVSVDFDYSPDQRVLHNITLS
                     IKQGEMTALIGSSGAGKTTLADLIPRFHDATDGYIYIDEVDIRKFDINSLRSQIAVVS
                     QNTFIFNTSVWNNIAYGTPTATATEIKEAARLANALEFILEMPEGFDTQLGDRGVRLS
                     GGQRQRIAIARALLKNPEILILDEATSALDSVSERLIQESLEKLSVGRTVIAIAHRLS
                     TIAKANKVVVLEQGRIVEQGKYQELLELQGKLWEYHQMQYEMTSKQDT"
     gene            40257..41402
                     /locus_tag="ANA_C10036"
     CDS             40257..41402
                     /locus_tag="ANA_C10036"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92850.1"
                     /translation="MTNNRSLKFPLKIYFYCDPVENISIGEKFQHLIICLAEGFQELG
                     IPFFSNVNYWQNSLETSEYLFKHHADVTPDDCSIVIFTTNSYHIQEPLPKNLFHPQRQ
                     YITVYLDCEDNNKTYNKIPEFRQFDLILRTHFNSKLNYGNNFQPWVFGLSNRILQELN
                     TIPDFTARKKQILVNFRHWKSGHPVRNISCSKLIPQIENILSINNFVDDPNHHPQAGY
                     HYLQWLQTGGRHYPNYYKRLQESVACTCFGGFFVPTWPNDPSSLINRGIKQLLAKLKL
                     QSNTILQWDSWRFWESLAAGCVTFHVDFEKYGITLPVMPENWRHYIGVDLDNVQATID
                     RITENPEILEYIAQEGRSWAIKNYSPVPTALRFLEIVSQKQTTTKSK"
     gene            41602..42588
                     /locus_tag="ANA_C10037"
     CDS             41602..42588
                     /locus_tag="ANA_C10037"
                     /EC_number="2.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2 protein"
                     /protein_id="AFW92851.1"
                     /translation="MLNINSSEPLVSVIIPTYNRPEYLKQAINSAVQQTYQNLEIIVS
                     DNCSSENPQALVESFPDSRIKFWRHKENIGMLANQFYGFKIATGKYVASLHDDDMWNE
                     DFLSKLVPNLEANPNLILAFCDQYIIDGDSKINIAATENNTRSYKRDQITPGVHENFT
                     QIGLIDKSIPTAAACVIRNGVLNWDNIPSEVDGMWDLYLTYLCCISGYGVYYVPEKLT
                     KYREHEQTDTMLSGSRNVQAKIRKGKSELFCYQTFMKDQQLQEFNSYFKTKWLEANTT
                     LGIGLLRDQKITDARRYFWQTLSEQKFNLRTLVALIISFIPTNLTNKIWKVS"
     gene            42614..43816
                     /locus_tag="ANA_C10038"
     CDS             42614..43816
                     /locus_tag="ANA_C10038"
                     /EC_number="2.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase group 1 protein"
                     /protein_id="AFW92852.1"
                     /translation="MKICIVTHKIRKGDGQGRVNYEVAQEAIRRGHDLTLLASEIAPE
                     LSENNAVNCIYIPVARYPTEFIRNFIFAKKSADWLRKNRANLDLIKVNGAITMGATDV
                     NAVHFVHGSWLKSPVHISHNRKDLYGLYQWLFTAANAYWEKQAFCQSKIIIAVSEKVA
                     QELVNIGVPRLQIRVVANGVDLQEFAPGVSSRTALGLPENVNLALFAGDIRISRKNLD
                     TVLHALVKVPKLHLAVVGGTQDSPYPAMAKALNISERVHFLGYRHDMPQIQRASDLFV
                     FPSRYEPFGLVVIEAMASGLPVITATTTGAADLVNPDCGIVLDDCDDANALAEALELL
                     NSDRSLRQQMGKIARTIAEQHSWSTMAQTYLNIFEELITHEKHSSHPHLSPSSRPSPV
                     SESTATAN"
     gene            43734..44687
                     /locus_tag="ANA_C10039"
     CDS             43734..44687
                     /locus_tag="ANA_C10039"
                     /EC_number="2.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2 protein"
                     /protein_id="AFW92853.1"
                     /translation="MRNTVLIPTYRRPQDLARCLKALQQQTKSVDQAIVVVRDTDTET
                     QQFLHQFPPHLLPLQIVTVTQPGVVAALNAGLAQVQGDILSITDDDAAPHPDWLAKIN
                     THFSVNYTIGGVGGRDWVYQGDKLENGSRPIVGKLQWWGRVIGNHHLGVGAPREVDVL
                     KGVNMSFRTQAIGKLRFDDRMQGTGAQVHFEMSFALTLKRAGWKMIYDPSIAVDHYPA
                     QRFDEDQRHNFNDTALINLVHNETLILLEHLSPLRQIVFLSWSILVGTRESLGICQWL
                     RLFPQQKEIASKKLRASLQGRWLGYQKYRKIGNHHLVGVRS"
     gene            44776..46200
                     /locus_tag="ANA_C10040"
     CDS             44776..46200
                     /locus_tag="ANA_C10040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92854.1"
                     /translation="MISKPILFNTVLKEQFSPQDRSAQSWMIILAFILLITACYFTST
                     GSLRLVFPATAFLVAAFLYLRHPIHYIGFTWWIWFLTPLITRLVDYKIGWDPTRQMLI
                     APYLVVFLTIFTFLKHLPSSLRQGGLPFLLAAIGVSYGCLIGLIYNQPLPVVRSFLDW
                     LSPIIFAFHLFSNWRDYPSYRQHLQRTFIWCVLILGAYGVYQFVVAPEWDRYWLIESK
                     MFTSAGQPIPFGMRVWSTLHSPGPFGTVMQTGLLLLFTSTGPLIFPASAVGYLSFLLS
                     QVRTSWGGWLLGIIMIFGSVKPQIQMRLITIILVMTICVIPLVTIEPLSKVITTRFES
                     FSNLEEDGSFRDRSATYDRNLNLALSNVVGNGFGNIWKVNEKTGQIEVIVIDSGILDM
                     FFTLGWIGAIPYISGLVLLLVTVSNYTEGRFDSFLSAARAIGISSCAQLIIYSGMLSI
                     AGMIMWGFLAMAMAGHKYYSRPQS"
     gene            46384..46827
                     /locus_tag="ANA_C10041"
     CDS             46384..46827
                     /locus_tag="ANA_C10041"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92855.1"
                     /translation="MLKIQPPTIIDFQPAIAAKDKDDKYILIIDVRFSAMYSSPDLNI
                     LKMEEYQHIPFLMFVNSNVMRIFKSPTFTEVARLDTKNVLKHYDVGSIEGIIYQSTLI
                     TLTQSWLRDLAYHWKSETPPYIEEMKEIGLFTLLFDGTTEELDLL"
     gene            46824..47426
                     /locus_tag="ANA_C10042"
     CDS             46824..47426
                     /locus_tag="ANA_C10042"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92856.1"
                     /translation="MIIYLETNSIMAIAKGRNKELEDFVYHSSGNLKFVIPSICLMET
                     LVAIEREEKRSQSFSQTIQIEMNEGKRNKGLTNSQSFANYLELCLIDYGKVLRDFRKR
                     FLNILEYLKNHCELIEPSIKMLEATLTNPLLPGKNQKRDDFILQVILAHAENNLSINK
                     AFFSENTKEFGNTNIQQILANLGINYFSKIPNLEGWLNKQ"
     gene            complement(47446..47667)
                     /locus_tag="ANA_C10043"
     CDS             complement(47446..47667)
                     /locus_tag="ANA_C10043"
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death family protein"
                     /protein_id="AFW92857.1"
                     /translation="MSSIEVTQAINQISELFHLALNGEEIIITENHQPLLKLTALKSK
                     SQRPPLFGTDKDIISIADNFDAPLEEFAD"
     gene            complement(48040..48498)
                     /locus_tag="ANA_C10044"
     CDS             complement(48040..48498)
                     /locus_tag="ANA_C10044"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92858.1"
                     /translation="MNQFKTLIYEQELEHIAGWVQEYPNLETGGDLFGFWTHSGFPVV
                     QFVLGPGKTSRHNQTSFYQDREHLIKAGEILRQKHGLQHIGEWHSHHQMGLARPSGGD
                     EQTVFNALRQYNFPKFLLCIANLHSEREIVGSKYIGERQDTINGDDSFFG"
     gene            48721..50088
                     /locus_tag="ANA_C10045"
     CDS             48721..50088
                     /locus_tag="ANA_C10045"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92859.1"
                     /translation="MTVTEVLQIVDELVFKHTGNHLNDLQRSAVQGIWHGKIYSDIAD
                     EFGYESENHIGNVSRELYKILGKELGEDVTKSNFRWSIERLANSFNQQILGIGIKNHV
                     NWCPNNPDHQKQAINYEDKIKQKTSYINLKQSLKITHFHGRTNELTTLSKWVENSNTR
                     LISILGISGIGKSTLVKHFLDTHIIPFDVIIWKNLKLSNSLNSILTEILTELNVNSKD
                     INTNNFLNQSLELFNQKRCLIILDNLEEIFTPQQYSGQYKPEYQDYKTFLQMITEIEH
                     ESCLILISQEKCQQMISLDSELYPIHSLELSGLDSAATEILKNQGLKNEETWLNLINL
                     YESHPKYLQYISILIKDVFEGEVAEFIKENSLILTEDFKTLFDLIWMRLSEVEKEILL
                     KISQNDQPISRDEIKQLLSLSSMDIINGLQSLTRRFLVSKLENDQKLYTLSPIFKEYL
                     RIYHH"
     gene            50222..51103
                     /locus_tag="ANA_C10046"
     CDS             50222..51103
                     /locus_tag="ANA_C10046"
                     /EC_number="3.5.1.15"
                     /codon_start=1
                     /transl_table=11
                     /product="succinylglutamate desuccinylase/aspartoacylase"
                     /protein_id="AFW92860.1"
                     /translation="MNQIHRVAIVGGNHGNELTGVYLVKKFQQYPHLIHRGSFETLSL
                     LGNPKAIAARTRYIDTDLNRCFNQDKLSSSKISSYEELRAREIQQILQPENQESVDTI
                     VDVHTTTANMGLCIILGNWHPFLLKLAADLSAVNPLVKVYIHEQPQGSGFLRSLCDLG
                     FAIEVGAVPQGILNAELFQQTEQLIYSVLDYFEDYNQGKDLPKNNTLTVYKSIGVIDY
                     PRNEVGEIQAMIHPQLQFQDYEPLHPGDPIFLTFTGEEIFYQGNSTVYPIFINEAAYY
                     EKGIAMHISEKELIKIG"
     gene            complement(51086..53812)
                     /locus_tag="ANA_C10047"
                     /note="glycosyl transferase family 1 protein;
                     inserted by ISAsp2"
                     /pseudo
     mobile_element  complement(51811..53437)
                     /mobile_element_type="insertion sequence:ISAsp2"
     gene            complement(52100..53233)
                     /locus_tag="ANA_C10048"
     CDS             complement(52100..53233)
                     /locus_tag="ANA_C10048"
                     /codon_start=1
                     /transl_table=11
                     /product="ISAs1 family transposase"
                     /protein_id="AFW92861.1"
                     /translation="MKLPPKITIVDHFKDLEDKRVERTKRHKLIDIVTIAICAVICGV
                     DSWVLMEAYGKKKEKWLKQFLELPNGIPSHDTFARVFARIDPQQFQNCFLSWIKSINK
                     ITEGEVIAIDGKTLRHSYDKGKDKGAIQMVSAWATSNKLVLGQCKVEEKSNEITAIPE
                     LIKVLDIAGCLVTIDAMGCQKEIVKSIAEKSGEYIIALKKNQGNLYKNVEEIFKEAIS
                     KGFEGFKYSEFHTKEDKHGREEIRHYLMLSDIEERIDTDKKWVNLQSVGMVEYIRKVN
                     GKTKVETGYYISSLTNNAKLLGESVRTHWGIENSLHWVLDVAFREDDCRIRKDNAPQN
                     FAVIRHIAVNLLGKEKSQKLGTKSKQFCAGWDDEYLEKILECI"
     gene            complement(53873..54655)
                     /locus_tag="ANA_C10049"
     CDS             complement(53873..54655)
                     /locus_tag="ANA_C10049"
                     /EC_number="3.5.1.89"
                     /codon_start=1
                     /transl_table=11
                     /product="LmbE family protein"
                     /protein_id="AFW92862.1"
                     /translation="MNPKKTLTSLEKIIPNKLLNQIQYIHCSLVSWWILHWGSQPLNF
                     SEKSAMVFSPHQDDETFGCGGMIARKREQGIQVGITFLTDGRGSHGLDPLMQNQVIQI
                     RQQESLIALDILGVNTSEIHFLNYQDGSLASLNIEKRQQIITEISELLNLYQPGEVYV
                     PHRKDCHQDHEATYNLVKEAIIQSKITTEILQYPIWVFWRSPLFILLKLQDIAAAYRL
                     SVTSVKEKKQKAIAAYPSQLEMLPRGFINRFLYSEEIFFKSE"
     gene            55309..57102
                     /locus_tag="ANA_C10050"
     CDS             55309..57102
                     /locus_tag="ANA_C10050"
                     /codon_start=1
                     /transl_table=11
                     /product="WD-40 repeat-containing protein"
                     /protein_id="AFW92863.1"
                     /translation="MQMNWISLLKAQQTDFLNRVKKPKTADLSLLESRVKGYHSEVMA
                     FAGDSFTKILECSRQQAEILAKNPPPIPPEYPEYPDWIIPFPTYFQRQAEDYLVREQI
                     VDWMITERLGKLVRKVPQDTLDNMVLDDEGNLRSESKFTYLLANNPKVSIQIHVADGE
                     SFNGIKKDKIRWSVSQEDIINHQVLIFLCLFYPGNNKLGYHKQTVITGFLPTNQLDFS
                     NAKTYLTPSSLLYAGGLNWYLQSLGGKPDDVPITDEKMMVETIQTLPSDHPKKKIIGD
                     WECWQTLIGHTRGINCLAYAIKTLVVEDAGSKNVKTIPMLASGSRGETKLWDLAKGEL
                     IETLSEYPWVISDHVNEVNSLAFSTDGQTLVSVGADSTVKIWHTGALDLIDILHKHHG
                     DVRCVAFTPDGKMLATGGHDRQILFWNLRDRQVENTLSLDDTAAHSMVLSQDGKILIT
                     GSYRKIKVWETSSTLNQKKLPDIQPIYTLMGHSHIVSSLAISADAKFLVSGSQDQTIR
                     VWNLATGELVHTLKGHRDSVNTVALSPDEQIIASGSADKTIKLWHLQSGELLGTFTGH
                     ANTVTALSFTASGEMLVSGSLDKTIKIWQRS"
     gene            57310..57873
                     /locus_tag="ANA_C10051"
     CDS             57310..57873
                     /locus_tag="ANA_C10051"
                     /codon_start=1
                     /transl_table=11
                     /product="putative restriction endonuclease"
                     /protein_id="AFW92864.1"
                     /translation="MTIATERQITLENFLKLPETKPASEFINGEILQKPMPQGEHSRL
                     QIKFCTNINQVAETPKIAYAFPELRCTFGGSTIVPDIAVFRWERIPKTESGRIANRFE
                     IHPDWVIEILSPEQPQKKVLTKLLHCSRHGTELGWLLNPEEESVLAVFPGQKIEIYEG
                     DDKLPILENINLELTVKEIFGWLSFGS"
     gene            complement(57905..58897)
                     /gene="pheS"
                     /locus_tag="ANA_C10052"
     CDS             complement(57905..58897)
                     /gene="pheS"
                     /locus_tag="ANA_C10052"
                     /EC_number="6.1.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase alpha subunit
                     protein"
                     /protein_id="AFW92865.1"
                     /translation="MTSNLEDQLLALRQEGETAIAAADSLERLEELRVNYLGKKGQLG
                     LLLRSMGQMSAEERPQIGAIANTVKEAIQNSLDQQRTTLESAQILVQLEAETIDVTMP
                     GIYRPQGRIHPLNGIIDQTLDIFVGMGYTVAQGSEMETDYYNFEALNTPPDHPARDMQ
                     DTFYLPDGNLLRTHTSSVQIRYMEKEEPPIRVVAPGRVYRRDDVDATHSAVFHQIELL
                     AIDEGLTFTDLKGTVKIFLQSIFGDLPIRFRASYFPFTEPSAEVDLQWKGRWLEVMGC
                     GMVDPNVLKSVGYDPEVYSGFAAGFGVERFAMVLHQIDDIRRLYNSDLRFLQQF"
     gene            59196..59993
                     /gene="surE"
                     /locus_tag="ANA_C10053"
     CDS             59196..59993
                     /gene="surE"
                     /locus_tag="ANA_C10053"
                     /EC_number="3.1.3.5"
                     /EC_number="3.1.3.6"
                     /codon_start=1
                     /transl_table=11
                     /product="stationary-phase survival protein"
                     /protein_id="AFW92866.1"
                     /translation="MKLLISNDDGISALGIRTLANTLAAAGHEVTVVCPDRERSATGH
                     GLTLLQPIRAEIVESVFHPDIKAWACDGTPSDCVKLALWALLDSPPDLVLSGINQGAN
                     LGTEILYSGTVSAAMEGVIEGIPSIAFSLTSHTHKDFQPAAKFAEVLVAKIAAQPLPE
                     LMLLNVNVPPLSWEEIAGVTFTRQGVRRYVDVFDKRTDPRGKTYYWLTGEVIEDVEPP
                     IELNLPTHIPLDVHAIQKKYISITPLQYNLTYGHGLNQLSTWEFKLP"
     gene            complement(60156..60431)
                     /locus_tag="ANA_C10054"
     CDS             complement(60156..60431)
                     /locus_tag="ANA_C10054"
                     /codon_start=1
                     /transl_table=11
                     /product="PIN domain-containing protein"
                     /protein_id="AFW92867.1"
                     /translation="MKILIDTNIILDYLLEREPFLEDAEMLFQAIDSGQIIGYVTATT
                     LTDIFYIARKPTQSIELARQAISTTLTIMDRLSDLHVVKGQIGLHNL"
     gene            complement(60431..60658)
                     /locus_tag="ANA_C10055"
     CDS             complement(60431..60658)
                     /locus_tag="ANA_C10055"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92868.1"
                     /translation="MSLQELKEQAFQLPESDRLELVRAIIESLQNQPSQKSERTRIIK
                     QMKGLLKTNQPAPTDEQVNGMLEEHRVEKYI"
     gene            complement(61037..62752)
                     /locus_tag="ANA_C10056"
     CDS             complement(61037..62752)
                     /locus_tag="ANA_C10056"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="AFW92869.1"
                     /translation="MSQCLNPACIYQNPQGTTYCQKCGGKILLDDRYRPIKFLGEGGF
                     GRTFQAVDEKRLNTPCVIKQFLPQQAGSGALQKATELFQQEAKRLQELGKHPQIPDLE
                     AFFPQDGRLYLVQDFIDGQNLLQEFQNQGTLNEPQIRNILIELLPVLQFIHDNKVIHR
                     DIKPENIIRSKNGQLFLIDFGVSKETSGSILTRIGTTVGTPGYAPPEQLRGTAYHNSD
                     LYSLAVTCVRLLTGHFPKSDGSDQLFDTNRMEWQWRKYVSLSQELTTVLETMLQDIPV
                     NRYQSATEVLAALSNQKTIVIPTPPPQTSQNPFQQIFQFISPPTNPPKPPTNTSLNIN
                     PQSSFTEDLGKGIKLEMIAIPGGTFLMGSPDNEVERDSDESPQHQVTVPSFFMGKYQL
                     TQAQYQAILGLNPAHFKGKNRPVECVSWDDALAFCQKLTQKTGKSYRLPSESEWEYAC
                     RAGTKTPFSFGDNITPDLVNHDYKYQQTTDVGKFPPNAFGLYDMHGNVWEWCEDDWYC
                     DYINAPTDGTAYNSLRGRNYRLLRGGSWNEPARRCRSASRYTYLCATRHSNYGFRVVS
                     SFRTL"
     gene            complement(62975..63523)
                     /locus_tag="ANA_C10057"
     CDS             complement(62975..63523)
                     /locus_tag="ANA_C10057"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92870.1"
                     /translation="MLGGISLGTLGLTVGSILTITGFVAYFMDNATLNLVGFFYGFPL
                     LLGGLALKANELKPIPFSQTTTPSILELRKQQATVTQTKIRKDITRFCYGQKSHLDLA
                     LAYLGLSPTDEVRPVVTGLRETEINGAYTLILEFDSPLITFDTWQQKHEKMTKYFGPG
                     VEVNIKQPREDYIELSLMKTLI"
     gene            63660..63842
                     /locus_tag="ANA_C10058"
     CDS             63660..63842
                     /locus_tag="ANA_C10058"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92871.1"
                     /translation="MDIQTVKDRISTVQGKRERLLSLLEQPNLGTLRVDVNQALEELD
                     DLIDEFKRTIPQAGNN"
     gene            complement(63989..64423)
                     /locus_tag="ANA_C10059"
     CDS             complement(63989..64423)
                     /locus_tag="ANA_C10059"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="AFW92872.1"
                     /translation="MLMLSRESSNLRVLIVDDHELTRLSLQLVFSVQENIQVVGLASN
                     GQEAIEIVQCYQPDVIILDLQMPIMDGWSASHYIKAISPNTQILAYSSVDEVSFGKNK
                     TRHNFDKVCKKDIPTKELIALVRELGNRHRYSSFPEEILNSA"
     gene            complement(64882..67047)
                     /locus_tag="ANA_C10060"
     CDS             complement(64882..67047)
                     /locus_tag="ANA_C10060"
                     /EC_number="2.7.4.1"
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase"
                     /protein_id="AFW92873.1"
                     /translation="MAKPKKNSDSINLSDPQYYINRELSWLEFNHRVLHEACDPRTPL
                     LERLKFLAIFSSNLDEFFMVRVAGLKQQVEASINLLTPDGRTPAKQLDDIRLHLTPQL
                     KKHNAEFEEVLRPQLVKQGIYILDYIQLNQRQRNYLNNYFEEQVFPVLTPLAVNPGHP
                     FPHISNLSLNLAVVVKNPDTEEESFAIVKVPKVLPQFLPLPPELGIQEDGKTAHWIGV
                     PLEQAIAHNLESLFPGMSIQEYHPFRITRDADLELEEDEADDLLLAIEQELRKRRMGG
                     NTVRLEIRSQTPASIRSRLLQDLGLTESDIYEIDGLLALRDLMYFLALPLPELKDPPR
                     QSVVPSRLQRLREPCIDADVPELEEGRDFFSIIREKDLLVHHPYQSFSGTVVRFITSA
                     AHDPHVLAIKMTLYRTSGDSPIVNALIAAAENGKQVSVLVELKARFDEENNIYWARRL
                     ESVGVHVVYGLVGLKTHSKIVLVVRREKDRMRRYVHIGTGNYNPKTARLYTDLGLFSC
                     REELGADLTDVFNFLTGYSRQKSYREIMVAPVNMRDRFLELIKREIENVHNGFSGRIV
                     AKMNALVDPQIISTLYEASRAGVQIDLIIRGICCLRPGVPNLSENIRVISIIGRFLEH
                     SRIFYFYNNSQEEIYIGSADWMRRNLDRRVEVITPIKDQDIAKDLQEILGIMLADNRH
                     AWELQPDGSYIQRCPCDNCPEANSQKTIMSMTLRSVGIN"
     gene            67535..68065
                     /locus_tag="ANA_C10061"
     CDS             67535..68065
                     /locus_tag="ANA_C10061"
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease domain-containing protein"
                     /protein_id="AFW92874.1"
                     /translation="MTVMQRIAIPSKIKRAVLVEAGHRCAIPTCRSTTTEIAHIVPWA
                     KTKDNSFENLIALCPNCHTRYDQKKEIDQTSVQMYKQNLGILNNRYGEVERRLFEALA
                     KSEDRVFVLGAAGDLMVANAVRDGFFLDKQIDGMSYLADSPSGIRKMFPLTFTYWVTD
                     KGVEFIKRYASGFDIS"
     gene            68296..69819
                     /locus_tag="ANA_C10062"
     CDS             68296..69819
                     /locus_tag="ANA_C10062"
                     /EC_number="2.7.13.3"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="AFW92875.1"
                     /translation="MSIYLFQATRRRLAIWYTTITAILLLLFASGVYLYVRSTLIERI
                     DDTLYHVVEVVERSLVIEPINFQPNQVRVNVEASFPNNAENAEDDRIDLEWFSPNGEL
                     LWSTFSQILDIPIHTHHTGETVRIEGMGGWGESAQLFRQVTKRIEKGRQVLGYLRVSH
                     PWFEVTKPSRELIFDLALGITLMILSVAASGWFLSGKAMEPVGESYQRLKQFTADASH
                     ELRSPIALIQTNVQIALADLDAREEEKNTVQYKQQLKVVERLTQRLGKLVNDLLFLAR
                     QDSGINTDLFSSCPLDALLMEVVEEQQFVAREKQINLGLNLVDSPLTEVNPELLENWF
                     TLTGNWEQLVRLFTNLIGNALQYTPPQGVIKVELARIEGINRVTGMRYTNSHLQVKVS
                     DTGSGIPADALPKLFDRFYRVDPARSHKGGKTATATTTGSGLGLAIAQAIIEHHQGQI
                     QVASNLGEGTTFTVILPIFDKRSQESGVRSQEEEEEEEEEEGRRKKEEGRIKLLIDN"
     gene            69940..70800
                     /locus_tag="ANA_C10063"
     CDS             69940..70800
                     /locus_tag="ANA_C10063"
                     /codon_start=1
                     /transl_table=11
                     /product="TRP repeat-containing protein"
                     /protein_id="AFW92876.1"
                     /translation="MPKYIRLISLLVACSVWSLPKAAHAQAFIPHTVQVDNAQLEKQG
                     LNLAQQAAQLAQFQQVEPALLRAQLATKLAPQNDKVWWLLGSLHLQNKEFDQAVTSLS
                     KAQTLNPKNPEVQFALGSAKFQKKDYQGAITNYQAGLKLKPNYSGGLFDLGNAYFMLQ
                     KFPDAIAQFNLAVNQDKKFWPAINNIGLIKYEQGDVTGAIQQWQTAVSIDKKAAEPLL
                     ALAVASYNQGDKQKSLQMGVSALRIDSRYADLDFLKENLWGDRLLTDTKKFLELPQIK
                     SASQPQEEAP"
     gene            complement(70881..71279)
                     /gene="devR"
                     /locus_tag="ANA_C10064"
     CDS             complement(70881..71279)
                     /gene="devR"
                     /locus_tag="ANA_C10064"
                     /EC_number="3.1.1.61"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein DevR"
                     /protein_id="AFW92877.1"
                     /translation="MKTVLIVEDDLINARVFSKILSKRGGLGVKHTENVEEVMEIAQA
                     REIDLILMDVSLSRSVYQGKSVDGIKITQMLKSNPQTANLPVILVTAHAMEGDRENFL
                     NQSGADAYISKPVVDHQLFIDKIMALLPPE"
     gene            71495..74038
                     /gene="gyrA"
                     /locus_tag="ANA_C10065"
     CDS             71495..74038
                     /gene="gyrA"
                     /locus_tag="ANA_C10065"
                     /EC_number="5.99.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase, A subunit"
                     /protein_id="AFW92878.1"
                     /translation="MAKQLNLLSKGQVITTALHTEMQRSYLEYAMSVIVGRALPDVRD
                     GLKPVHRRILYAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQSVYDALVRLVQDFS
                     SRYPLLGGHGNFGSVDNDPPAAMRYTETRLAPVGHEGMLAEIADETVDFTGNFDNSQQ
                     EPTVLPAQLPFLLLNGCAGIAVGMATNVPPHNLGEIVDGLIALIDNPELSDEKLFQLI
                     PGPDFPTGGEIVDHGGIREAYTTGKGSIIMRGIVTMEEIPATRGTKRRTALIVTELPF
                     QVNKAGWIEKIADLVNQGRLLGISDIRDESDRDGMRVVIELKRDTNPQELLQHLYHQT
                     ALQTNFGAILLAIVDGQPRQLTLRQLLDEFLKFREHTLNRRYSYELGKAENRVNILAG
                     LLKALANLDDVIAILRQAPDGSTAKMTLCNRLDLSDVQADAILSMPLRRLTGLEQQNL
                     QQEFDQLNQEISILRTLLDDRRELLKALKKDLRTLKRKYNDPRRTKIIHTTEKPVSEE
                     KGKAKPAAVAAADNSPAKIPTPKPEAPLEETIVEVTQRGYIRRISPNSKKTKGENGLL
                     DHDFLIQTALTNTHKDLLILTSGGKVYPITVGDIPLTTGRSSTSLTTSSARGTPLITM
                     LTSTAQGNTEGIITRFLLPEKPETLEMVLLTKEGRIKRLSLSEFVNFSRRGITILKLK
                     DKDELAFTQFLSSGEHLILASSSGRLLRFPVNDEQLPIMGRAAMGLQAFRLLKNQQMV
                     GCVNVSKNHQLLLVTEEGYGKIMPANQLRAASRGDLGVQLVKFNNKTDNLAAMVAAKP
                     GSEVALLTNKERVIRVSVDAVPNLNKDSKGESICQLNRDERIISVVEVE"
     gene            complement(74125..74925)
                     /locus_tag="ANA_C10066"
     CDS             complement(74125..74925)
                     /locus_tag="ANA_C10066"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92879.1"
                     /translation="MSSPFPGMNPYLENPDLWSEVHHRLITAIAIAISPTLRPQYRVA
                     IEKRTYRLDTEDSLLIGIPDVAILSVKQAQKPNIHKTAIATLSTETENKAITVTLPLP
                     LEIKEGYLEIREVSTGKVVTIIEILSPTNKKTKEGRKSYLDKREKILQSDTNLVEIDL
                     IRTGEKMPIVTRISDTDYRILIVRSYRFPSAQLFAFSVKQTIPNFPIPLQKGEEEIEL
                     NLQNLFLEIYEQAAFDLTLDYHIPPVPDLLAEDREWMDILLKEQGRRE"
     gene            complement(74988..75497)
                     /locus_tag="ANA_C10067"
     CDS             complement(74988..75497)
                     /locus_tag="ANA_C10067"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92880.1"
                     /translation="MTVLKWYLVLISIIFFTINTSESLAAGGENTTGTTADTNTTSTP
                     NTGTASNLNTNLNTNTINQGVSAFSSSFSGYSSYGSQCGLSISGGYINNGDQNSYQLL
                     TTFNTNPCTNQSDLENIRQNNENKREVVRANANIITACINARTEAVKNRVNPDTICQL
                     NNFQMPRTP"
     gene            complement(75596..76276)
                     /locus_tag="ANA_C10068"
     CDS             complement(75596..76276)
                     /locus_tag="ANA_C10068"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92881.1"
                     /translation="MNPTQHFNPLHIKDKALSYIHRKRKQKVLTFKGLGRFLKTFLVI
                     IMPQLGVKKLDTRISAMLNKLDSSKFVYLLILVFSFILPQSAQADIYRNVGTGKCMNV
                     PGPDRYGNYLNRQISQYNCISNDPEQTFNSDPERDPYRLLRFGKNKSLCWNTINGTTD
                     GAKPFLYVCTWGDSGQMIDYERSIQRLQMSGKGFCIEADATGGNFSPISLKRCRDNYS
                     LQKWTIIK"
     gene            76376..78736
                     /locus_tag="ANA_C10069"
     CDS             76376..78736
                     /locus_tag="ANA_C10069"
                     /codon_start=1
                     /transl_table=11
                     /product="TPR repeat domain-containing protein"
                     /protein_id="AFW92882.1"
                     /translation="MNVEDAMNFANTLVHQQTGQYLNAIQTIIIRQLWSDPRLNYIKI
                     ASDNEYSHEYIKQVGKELWHTLTTSLREPVSKANFKVVFESRWNLQSPPPIIDNPEYD
                     PNFVGRKISISHIDSLINEGAKIIQIIAPGGTGKTILAQKYFQNKFKIVIEFTIAKET
                     KDIASVQSLLAGKLRELDLEPGPELMVSLDRLKQKLQTEEIGIFIDNLEPALDASGQF
                     IEQHRSYVELLRVLTDSSVKSFTLITSREKLHEASIEIETYRLPGLTLEAWKKYFNNQ
                     KIIINTDADKKSLQEIRDAFGGNAKAMDVISKVIIQDYDVNLEKYWLKNKEYLLIEPT
                     LENLIKEQFKRLQSIDLNDAYNLLCRMGCYRYQDVPTVPEKGLFCLLWDVGYNKHQRI
                     IRVLKERGLVEFKHNQYWLHPVIREEAIDKLRNSQDWEKANIQTAEFWTESVKSVETV
                     KDALTAFESYYHYLNIENYDKAGYVIAKKLSNRIEQNVPLGVEFYRFGLLEEMKAAIN
                     IIIDKVKTSYTLSRLHNIVGDLYWMTGELSKAIKHHQKCQEIAIQLILDKKDNNHINY
                     IHNLNVASSFNMGLCYIDLWDFTKAANCVNKSICLYEELKSEQRYLENSIFILAYIHS
                     QINSQEESLNLLNQCNFEFDSYQRSVWGVGYSYIFYALTCKNLKKINDSFESYQQAIN
                     FAEEVNYPQVKGKALTGLAELYRIQNDFKTALTHHQESIEILNKISAKCDLAEAYFQQ
                     ALTHQKIGDNVNSEEYFHKAMYLWSPQQIDAPKQIERVLKAMNSEP"
     gene            78815..79051
                     /locus_tag="ANA_C10070"
     CDS             78815..79051
                     /locus_tag="ANA_C10070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92883.1"
                     /translation="MDRLEFPVEYSFDSDSNMVIATIPQLNYISSFGQDFSEAEKNVT
                     EAVLAYLETLEKRGLPIPRIEKNSGTFLIIELVS"
     gene            79048..79272
                     /locus_tag="ANA_C10071"
     CDS             79048..79272
                     /locus_tag="ANA_C10071"
                     /codon_start=1
                     /transl_table=11
                     /product="YcfA family protein"
                     /protein_id="AFW92884.1"
                     /translation="MSDKLSAITPKKALRKLKKAGFIENHQKGSHLVLEHSDGRMVVL
                     PMHSKDIPIGTLYAIVIHQAKLSLEEWKNL"
     gene            79366..80304
                     /locus_tag="ANA_C10072"
     CDS             79366..80304
                     /locus_tag="ANA_C10072"
                     /codon_start=1
                     /transl_table=11
                     /product="cation efflux protein"
                     /protein_id="AFW92885.1"
                     /translation="MTQDHDHHHHHEHGHHHSHAPATFSRAFAIGTALNVGFVIIEAT
                     YGYLAHSLALFADAGHNLSDVLGLLLAWGASSLSRRPPSHRYTYGLRASSILAALINA
                     VVLLLSMGAIAWEAIRRFNDSGPVSGETIIGVALVGIIINTATALMFMSGRKSDLNIR
                     GAFLHMAADALVSLGVVVAGIAILFTHWLWLDPLVSLVLVAVVVVGTWHLLRDSVNLA
                     LDGVPAGIELRAVKNYLIECPGVLKIHDLHIWAMSTTETALTVHLVMPEGYPGDAFLW
                     EVSQELEHHFGIQHSTIQVETGDSAYPCALEPDHVV"
     gene            80432..80614
                     /locus_tag="ANA_C10073"
     CDS             80432..80614
                     /locus_tag="ANA_C10073"
                     /codon_start=1
                     /transl_table=11
                     /product="chlorophyll a-b binding family protein"
                     /protein_id="AFW92886.1"
                     /translation="MTNATKTAKAPVATDRNAWQWGFTPGAEIWNGRLAMIGFSAAAL
                     IELFSGQGFLHFWGIL"
     gene            81132..81350
                     /locus_tag="ANA_C10074"
     CDS             81132..81350
                     /locus_tag="ANA_C10074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92887.1"
                     /translation="MTVKGAECGLQLSKFENPISREKLRQSLNLPSVDFNNGLQSLKQ
                     RYLVTKIKEYKILFKLSPVFQEYVRTCC"
     gene            complement(81511..82287)
                     /locus_tag="ANA_C10075"
     CDS             complement(81511..82287)
                     /locus_tag="ANA_C10075"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92888.1"
                     /translation="MPELIKLDMVDLALAIGLMAIAIGISAWEQLGLELNLSVATGRT
                     ILQLLVLGYTFDFIFAVNNVWAVLGILAIILTITVIITRNRISQKIPQVLPLAGSAIF
                     VSTSLTLLYTNFLIIQPERWYEPRYIIPLAGILLGNAMNAAAIAGERLVSSINQFPTE
                     IETHLSLGATAEQAIKPYRKEAIRAALMPTLNQMMLIGMVTIPTFTNGQLLAGITPLE
                     AVSYEILIIFMVAVTNLLTTILITKGLCRQFFNSAMQLIR"
     gene            complement(82302..82826)
                     /locus_tag="ANA_C10076"
     CDS             complement(82302..82826)
                     /locus_tag="ANA_C10076"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92889.1"
                     /translation="MRFYLSVVSCQLSVGAKHLEGKLSVIAKNSSPNASPVQLSVGAK
                     HLEDKLSVIAKNSSPNASPVQLSVGAKHLEDKLSVIAKNSSPNASPVQLSVGAKHLED
                     KLSVIAKNSSPNASPVQLSVGAKHLEDKLSVIAKNSSPNASPVQLSVVRIKKEELKRF
                     PCSLFPVIRKVFNC"
     gene            82825..83973
                     /locus_tag="ANA_C10077"
     CDS             82825..83973
                     /locus_tag="ANA_C10077"
                     /EC_number="2.6.1.50"
                     /EC_number="4.2.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="DegT/DnrJ/EryC1/StrS aminotransferase"
                     /protein_id="AFW92890.1"
                     /translation="MIKSVNSIPAFDIKQQYATIETEVSAAVLAVLASGRYIGGPAIT
                     DFEQQFAAYHGVSECVACNSGTDALFLALRALRIGAGDEVITTPFTFFATTEVISAVG
                     AIPVFVDIDATTFNLDVEKVAAAITAKTKAIMPVHLFGLPVDMTGLMEIAKAHNLAVI
                     EDCAQATGASWENQKVGSIGHIGCFSFYPTKNLGGCGDGGAITTNDPAIATQLRVLRE
                     HGSKVRYIHEEIGVNSRLDAIQAVILQIKLRYLDLWNNRRKQIADYYYQHLSQLSDII
                     VPQEFTSGVGVWNQYTIRISGERRNGASGKYRDSVKNQMQEQGVNSMIYYPLPLHLQP
                     VYKNLGYQPGQLPVSEQASQEVLSLPMFPELEQEQQDKVIDTLKNCLS"
     gene            complement(84075..84818)
                     /locus_tag="ANA_C10078"
     CDS             complement(84075..84818)
                     /locus_tag="ANA_C10078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92891.1"
                     /translation="MTMYPNLNRAFAHPVLKVISGLNNFNAASVAATVKAADLGGATF
                     VDIAADVDLVRLAKTLTKLPICVSAVEPEKFVTAVAAGADLIEIGNFDSFYAQGRRFE
                     AAEVLELTRQTRALLPEITLSVTVPHILTLDQQVQLAEDLVKAGADIIQTEGGTSSNP
                     IHPGTLGLIEKAAPTLAAAYEIARAVSVPVLCASGISNVTAPLAIAAGASGVGVGSAI
                     NQLNSEIAMIAAVRSLVEALATANTRTFA"
     gene            complement(85049..85762)
                     /locus_tag="ANA_C10079"
     CDS             complement(85049..85762)
                     /locus_tag="ANA_C10079"
                     /EC_number="1.14.13.81"
                     /codon_start=1
                     /transl_table=11
                     /product="rubrerythrin"
                     /protein_id="AFW92892.1"
                     /translation="MDLSNFTTLQNLESAFGGESMANRKYLFFAAVARKLGFSDLAKL
                     FKETADQETEHAFAHFELLHPELVVKDAAVLTDAQKREIISRCLSLAIAGETYEYTTM
                     YPEFAAAAQTDRDHPAAAEFLQQAQESSDHANTFRTAAHRFGLLKFIENHHADRYTEA
                     LEVLNGGEAVTRVVSEDPQTQKWICRQCSMIYDPVTGDPDSGIAPGTAFADIPDDWNC
                     PICGATKKTFKPLEEKVAG"
     gene            85829..87214
                     /locus_tag="ANA_C10080"
     CDS             85829..87214
                     /locus_tag="ANA_C10080"
                     /EC_number="1.2.1.3"
                     /EC_number="1.2.1.5"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="AFW92893.1"
                     /translation="MITNELPKCVEIIAKQRQFFQTGKTKNVTFRIGQLKILKQLVIE
                     NKTAIIQALKADLRKPEFESYATEIGVNKEIDYALKHINTWTKPKKAAVPLDLFPYSA
                     KIYPEPLGVILIISPWNYPFQLIISPLVGAIASGNCTIIKPSELAPHTSNLITELIHK
                     YFDPEYITVVPGAVETSQQLLAEKFDHILFTGGTAIGKIVMEAAAKHLTPVTLELGGK
                     SPCIIDTDINLEHTAKRIIWGKFINAGQTCIAPDYLLVDAKIKPNLVNALQKCLKEFY
                     GENPAKSPDYARIIHQKHFDRLANLLKCGKVIIGGETNREELYIAPTLLENVSLEDAV
                     MQEEIFGPILPIIEYTDINEAITLINSRPKPLALYLFSQNKNLQNRILQETSSGGVCI
                     NDTVMQVAVSSLPFGGVGDSGMGSYHGKAGFDTFSHDKSVLQNSFRLDINWRYAPYQG
                     KLSLLKKIIGI"
     gene            88686..90533
                     /locus_tag="ANA_C10081"
     CDS             88686..90533
                     /locus_tag="ANA_C10081"
                     /EC_number="3.4.22.-"
                     /codon_start=1
                     /transl_table=11
                     /product="caspase domain-containing protein"
                     /protein_id="AFW92894.1"
                     /translation="MVNYWAIAIGINQYQSFQPLSCAQADAEAIKDFLVTQAGFLPEK
                     CLLMTNTSPPIGEQSSYPTKENILSLLEELAATFWQPEDCLWLFFSGYGVNHKEQDYL
                     MPVAGNPDQVPETGIEVRSLLQSLQVTGLNILLIFDINRAFGTQADAPVGQEIIELAQ
                     ELQMGAIISCQPEEFSHESTELGHGFFTAALLEALGSAKGYNFADLAAYLTYLTPKLC
                     QHHWRPVQNPMTVIPTTQPAILPTLTLDENSEALIFPAESFAITRTAPPLENSPSSAT
                     DKAWWTENASVETTLSQIKTGGNLAPPPASESLISSNYTLATSPESKPGGRFIPALPT
                     ANTYPSSQSELPIWQQFIIWGGGTMVVVGLIATFLLRNHESFRFKNFSKTVSNNRTGK
                     LPLPQIFPTPQNPSTAQINSNTDSHKRNQAISDLEKMSLVPTKPSNLSIAISKAQRTP
                     ADAPLYAKAQENIQVWCQMILELAQAQAKQGKYENAIATAQLITKKEPLHTQAQTVIQ
                     KWQLEAKQYVSNKTLLDAATALIIPEQASTYNRAIEVAKKIQKGQPGFEIAQTSINQW
                     SEKILDLAKIRATQGDFNAAVATAILVPKVTIAYEDAQDAIQKWQQQKN"
     gene            complement(90654..91031)
                     /locus_tag="ANA_C10082"
     CDS             complement(90654..91031)
                     /locus_tag="ANA_C10082"
                     /codon_start=1
                     /transl_table=11
                     /product="Mo-dependent nitrogenase family protein"
                     /protein_id="AFW92895.1"
                     /translation="MKVSKNTSKNIFLASWISINPVEASAANVNPLHHVAANSIWDFL
                     RPVRNWLDNIQVSDRLLAHRLCKYIPAQCPFERDVKVFGKTLFHIPPMCKLNPLYEEV
                     VGLRFKAMCYLADTCGEDISQYC"
     gene            91420..91740
                     /locus_tag="ANA_C10083"
                     /note="citrate transporter protein;
                     partial ORF"
                     /pseudo
     gene            complement(91737..93503)
                     /locus_tag="ANA_C10084"
     CDS             complement(91737..93503)
                     /locus_tag="ANA_C10084"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase domain-containing protein"
                     /protein_id="AFW92896.1"
                     /translation="MVKNEANSALKIIPLGGLHEIGKNTCVFEYEDEIVLLDAGLAFP
                     TEAMHGVNIVLPDTTYLRENRHKIKGMIVTHGHEDHIGGIAFHLKQFDIPVIHGPRLA
                     MAMLEGKLEEAGVKDRTELRTVMPRDMVRIGKHFLVEYIRNTHSIADSFTVAIHTPIG
                     VVIHTGDFKIDHTPVDGEKFDLQRLAEHGEKGVLCLLSDSTNAELPGFTPSERAVFPN
                     LDREFSHATGRLFITTFSSSVHRINMILQLARKHNRVVTIVGRSMLNLIAHARNLGYI
                     KCEDSLFQPLHTVRGMPDERVLILTTGSQGERMAAMTRIANKEHPHIKIRQGDTVLFS
                     ANPIPGNTIAVVNTIDKLMIQGAKVVYGRDKGIHVSGHGCQEEQKLMIALTRPKFFVP
                     FHGEHRMLVKHSETAQSMGIPAENMIIIENGDVIELTEHSIRVAGKVPAGIELVDTSS
                     SGMVSSKVLQERQRMASEGTVTIAAAIDWSGKLMAKPELLMQGVVTSIERSLLQKWVQ
                     QRIEEILSVRWSEFSPVEGQPADTDWGGLQETLERELARSMRRELQCQPSLTLLMQVP
                     EEPAAKVSDGRRRRTRSTAVAS"
     gene            complement(93724..94626)
                     /gene="dapA"
                     /locus_tag="ANA_C10085"
     CDS             complement(93724..94626)
                     /gene="dapA"
                     /locus_tag="ANA_C10085"
                     /EC_number="4.3.3.7"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase"
                     /protein_id="AFW92897.1"
                     /translation="MGDFGTVVTAMITPFKADGSISYDVVAKLADYLVNNGTDTLVVC
                     GTTGESPTLTWEEEYQLFAEVLQTVAGKAKVMAGCGSNDTKEAIAATQKAAKIGVHGS
                     LQVVPYYNKPPQAGLYRHFQAIAQCCPDLPMMLYNVPGRTGQNLSSETVVKLAEINNI
                     VAIKEASGNLDQVSEIRRLTPKEFEIYAGDDSLTLPMLAIGSQGIVSVASHLVGNQIQ
                     EMIQAWKVGKTQIATDIHLQLFPLFKALFLTTNPIPVKEALKLQGWEVGSTRPPLCDA
                     DTDVSKKLESVMQKLNLIPTTIGE"
     gene            94671..94841
                     /locus_tag="ANA_C10086"
     CDS             94671..94841
                     /locus_tag="ANA_C10086"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92898.1"
                     /translation="MGKINYRSLPKIVLQMLRPYSCRLLVGAKHWEDKLSVIAKNSSP
                     NASPVQLSVVSY"
     gene            complement(94871..95902)
                     /gene="asd"
                     /locus_tag="ANA_C10087"
     CDS             complement(94871..95902)
                     /gene="asd"
                     /locus_tag="ANA_C10087"
                     /EC_number="1.2.1.11"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="AFW92899.1"
                     /translation="MSKSYRVAILGATGAVGTELLELLESRNFPLADLKLLASERSAG
                     KTLRFKGEDIPVEAVSDRSLENIDIVLASAGGSISKTWAGIAVQKGAVVIDNSSAFRM
                     NPDVPLVVPEVNPQAAFTHKGIIANPNCTTILMSLAVWPLHQVKPVKRIVAATYQSAS
                     GAGAQSMEEVKIQSDAILQGKQPVAEVLPYPLAFNLFTHNSPMTAWGYCEEEMKMVNE
                     TRKIFGSQEIRITATCVRVPVLRAHSEAINLEFETPFDPDEAREILRKSPGVKLVEDW
                     QANYFPMPIDASGKDEVLVGRIRQDISHACGLELWLCGDQIRKGAALNAVQIAELLVE
                     KNLLKLTTV"
     gene            96719..98128
                     /gene="tig"
                     /locus_tag="ANA_C10088"
     CDS             96719..98128
                     /gene="tig"
                     /locus_tag="ANA_C10088"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /transl_table=11
                     /product="trigger factor"
                     /protein_id="AFW92900.1"
                     /translation="MKVTQEKLPASQIGLEIEITSEITTQKYEQVLRNLTKTVNIPGF
                     RKGKVPRQILIQRIGTTRVKATALEEIIQEGIEQAIKQEAITALGQPQLRSSFDDLIN
                     SYEPGKPLTFAVAVDVIPEIKLNQYTGLEAKAEEIKYDPTQVDTVIEAQREKLGTLVP
                     VEGRATEIGDMAVIDFKGVIAKTQGDDPDSEPKPIPGGEGTDFQVELQEDKFIPGFVL
                     GIVGMNPGETKEVSAQFPDPYGNEELSGKAALFTITLKEIKVKELPELDDDFAQEVSD
                     FETLEELRASLTQRYEKEAADKTRNNQQEALLTELLNHVEIDLPTTLIDQEVDAMLSQ
                     TAMKLSEQGIDVKKLFTQEIIPQLRDRSKPEAIERLKRTLSLQEIGKRESIEVAAAEV
                     EARVTELLTEYADQDLDEKRLRGVVQEELLTTKIVDWLLERSSVELVAEGSLTPPEEP
                     DSEAEAAEAVQEEETSNPE"
     gene            98277..98954
                     /gene="clpP"
                     /locus_tag="ANA_C10089"
     CDS             98277..98954
                     /gene="clpP"
                     /locus_tag="ANA_C10089"
                     /EC_number="3.4.21.92"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent ClpP protease"
                     /protein_id="AFW92901.1"
                     /translation="MLVSQSGNYPINSLSPIGASGNLSTSSNIVPMVVEQSGMGERAF
                     DIYSRLLRERIIFLGTPIDDVVANSIVAQLLFLDSEDAEKDIQLYINSPGGSVYAGMA
                     IYDTIQQIRPDVVTICFGLAASMGAFLLTSGTAGKRMSLPDSRIMIHQPLGGAQGQAI
                     DIEIQAREILYIKGELNQLMSKHTGQPLERIETDTERDFFMSAEEAKNYGLIDQVISR
                     QNLPTAG"
     gene            98985..100328
                     /gene="clpX"
                     /locus_tag="ANA_C10090"
     CDS             98985..100328
                     /gene="clpX"
                     /locus_tag="ANA_C10090"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent ClpX protease"
                     /protein_id="AFW92902.1"
                     /translation="MSKYDSHLKCSFCGKSQEQVRKLIAGPGVYICDECVDLCNEILD
                     EELLDTNTAAASQPTQKSEPAEKRRTRSSNLSFNQIPKPREIKNYLDEHVIGQDEAKK
                     VLSVAVYNHYKRLAILQAKGSAKVEADDAIELQKSNILLIGPTGCGKTLLAQTLAKIL
                     DVPFAVADATTLTEAGYVGEDVENILLRLLQVADLDVEEAQRGIIYIDEIDKIARKSE
                     NPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSNILFVCGGAFV
                     GLEKVVDQRVGKKSIGFVQPGDVQTKEKRAADTLRHLQPDDLVKFGMIPEFIGRIPMV
                     AVVDPLDEDALMAILTEPRSALVKQYQKLLNMDNVQLDFKPDALRAIAQEAYRRKTGA
                     RALRGIVEELMLDVMYELPSRKDVTRCTITKEMVEKRSTAELIVHPSSLPKPESA"
     gene            100787..101614
                     /locus_tag="ANA_C10091"
     CDS             100787..101614
                     /locus_tag="ANA_C10091"
                     /EC_number="3.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase family protein"
                     /protein_id="AFW92903.1"
                     /translation="MSYINVRGVDHYYEWMKKSSDVMKPVMVFLHGWAGSARYWQSTA
                     EALLDNFDCLLYDLRGFGRSQCQPHLSYELTEYAEDLAVLLNELNLDRVYINAHSMGA
                     SIATLFFNRYPQKVEKGILTCSGIFEYDEKAFSAFHQFGGYVVKFRPQWLSKIPLADR
                     MFMARFLHRSIPKAERQAFLEDFINANYDAALGTIYTSVSQEQAETMPGEFAKLTIPT
                     LLIAGEYDIIIPAKLGKTAAALSDKVELNIIPNTGHFPMLEDAETYLAKVKEFLSCS"
     gene            complement(101812..103344)
                     /locus_tag="ANA_C10092"
     CDS             complement(101812..103344)
                     /locus_tag="ANA_C10092"
                     /EC_number="1.1.3.-"
                     /EC_number="1.1.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-methanol-choline oxidoreductase"
                     /protein_id="AFW92904.1"
                     /translation="MTVNYYDFIIIGTGAGGGTLAYKLASSGKKILVLEQGNFLPKEK
                     ANWDTQEVSRKERYRTSEVWYDKHGKAIKPLTHYYVGGNTKFYGGTLFRLREQDFEKV
                     IHEDGISPEWPLKYQDFAPYYDEAEKLYDVHGKRGLDPTEPQINQEYPFPPLSHEPYV
                     QEVNDSLKAQGFHPFYQPLAIKLNEVNRSLSACIRCHTCDGFPCLIDGKADADITCVR
                     PAMTYENITLITEAKVIRLHTSPSGREVTGVEVEIGNQRQIFSGDIVVVAGGAVNSAL
                     LLLKSANDHHPNGLANSSHLVGRNYMTHNFAVVMTLNTKLNNTIFPKTLAFTDFYWGN
                     QDFAYPMGSVQLLGGANKDKILAYGPPLMPNFIAEAIANHSLSWLVITEDLPDFNNRV
                     LSKNGQVFLEYTHNNQRAFNKLIQQWIQVLQSISVFQSPGTLHIPQKMGLREVTHQCG
                     TCRFGEDANTSVLDINCRTHDVDNLYVVDGSFFPSSAAVNPSLTIIANALRVGEHLLT
                     RK"
     gene            103576..104919
                     /locus_tag="ANA_C10093"
     CDS             103576..104919
                     /locus_tag="ANA_C10093"
                     /EC_number="5.4.2.1"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase"
                     /protein_id="AFW92905.1"
                     /translation="MTRVIIVRHGQSTYNIEKRIQGRTDASSLTAKGQNDASQAGKAL
                     SSISFQAIYSSPLQRAKSTAEIIRSQLATQSPVIQIDENLVEVDLPLWVGMTTSEVKE
                     NFTEDYRTWKELPHEFRMVVNEDSGTREHFPVLALYAQAKQFWQEILPQHQGETILIV
                     GHNGINRALISTALGISPSRYHCLQQSNCGISILNFTGGLGEPVQLESMNQTQHLGET
                     FPSLRPGHEGVRLLLVRHGETEWNRQGKFQGQIDIPLNDNGRNQAAKAAEFLKDVNID
                     FAVSSTMSRPKETAEIILKYHASLKLELFAGLREISHGLWEGKFESEIEQEFPGELES
                     WRTIPANVQMPEGENLEQVKKRSVADWNTIVENAQSQQLQLGLVVAHDATNKTLLCHI
                     LGLSNENFWNFRQGNGAVSVIDYPDGIQGYPVLQAMNITGHLSNGVLDKTAAGAL"
     gene            105158..106030
                     /locus_tag="ANA_C10094"
     CDS             105158..106030
                     /locus_tag="ANA_C10094"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92906.1"
                     /translation="MKASAKFDFEDEKFNAPPSQVIPWGLMINPRYGTDGLQSYGLAI
                     SRDNAQSVGFEADDNWQQVEHEFSSGEVETIFITTTPKLVIVRRGPLSVQDRETKIRL
                     GTYKDYKEEFLADKLKFKIYTRHLIFLVGEDKKFLHQSPLQLTLSGSPGASFGKNYAE
                     YQQGRITGGFAGELEKAYAGFQKKPLTPKGPLFHAHGIFCPIIEPEERGIEPNIALVA
                     STVDYKHPTISTLIDYMIASDSPESAIICKTFEEYKEFGKEVIKPEAPKVETSGVTSS
                     YVYADDDEFSYPPY"
     gene            complement(106093..107301)
                     /locus_tag="ANA_C10095"
     CDS             complement(106093..107301)
                     /locus_tag="ANA_C10095"
                     /codon_start=1
                     /transl_table=11
                     /product="MltA domain-containing protein"
                     /protein_id="AFW92907.1"
                     /translation="MLALSLGIALINPLSSVVAQAPNSQPVTIPVTPEVPPAVLPALE
                     PINLETVCTPQNCLGLDEQLWGKQGDKQALLSSIDNSLRYLATNRAIAIYQTYPIKEI
                     TLNRVQRSLLRFRQLVVSSQSAAELQAAVRREFVFYQSVGNDGKGTVKFTAYYEPVYT
                     ASRVRTSVYKYPLYRLPPDFQKWPKPHPKRIDLEGKNGLLGDKSRLRGLELLWFSNRL
                     DPYMVHIQGSAQIKLTNGRRTSVGYAGGTDYAWTSIGKELAKDGKLPLSGLTMPKLIT
                     YFRQHPKELSNYLPRWERFVFFAETNGTPATGSILVPVTAERSIATDKSLMPPGALAL
                     IINSFPYPTNGGKLESRLVNRFVLDQDTGSAIKGPGRVDYFMGSGQLAGDRAGISGGN
                     GLLFYLLLKE"
     gene            complement(107322..107570)
                     /locus_tag="ANA_C10096"
     CDS             complement(107322..107570)
                     /locus_tag="ANA_C10096"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92908.1"
                     /translation="MPRTPSEYAVFLLLDNGHREEVRFPTIQEFQKWYSGELVPKSAS
                     HDFISVPIKNIQGEYMVVRPSKIAGIRVEPIFNSSIER"
     gene            107731..108441
                     /gene="eda"
                     /locus_tag="ANA_C10097"
     CDS             107731..108441
                     /gene="eda"
                     /locus_tag="ANA_C10097"
                     /EC_number="4.1.2.14"
                     /EC_number="4.1.3.16"
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxyphosphogluconate/4-hydroxy-2-
                     oxoglutarate aldolase"
                     /protein_id="AFW92909.1"
                     /translation="MECFDPVPRLCLYLRFLTSWLQVTVKMSNQVWLSQLKIHRAIAV
                     IRAPKMVWGEQMAIAVASGGMQLIEITWNSDHAPELISQLRAKLPNCMIGTGTLFNVQ
                     QLEDAIACGAQFLFSPHTDPEMIQAAVAKNIPIIPGALTPTEIITAWNYGASCVKVFP
                     VQSVGGTSYIKSLQGPLGHIPLIPTGGVTLENAKDFLQVGAVAVGLSSELFPQASVLQ
                     KNWQAISQQAKTLMQRLQ"
     gene            complement(108614..109402)
                     /locus_tag="ANA_C10098"
     CDS             complement(108614..109402)
                     /locus_tag="ANA_C10098"
                     /codon_start=1
                     /transl_table=11
                     /product="MOSC domain-containing protein"
                     /protein_id="AFW92910.1"
                     /translation="MMPYLAKILLYPIKSLDGIEVEKATILDRGALEYDREFAFFDAE
                     NKFVNGKRYPKILLLRSEFSLEQRLVKLKFPGENSEQVFHLDQQRPALAAVVSDFLGF
                     PVQLQQNTAMGFPDDTVSPGATVISTATLTEVASWFSGINVDEMRRRMRANIEIDGVP
                     AFWEDGLFAASGETVPFKLGDIQFLAINPCQRCVVPTRDSYSGAVYPNFQKIFGQKRQ
                     ATMPASVITGQFNHFYRLSVNTRVPISEAGKMMRLGNRIEISYF"
     gene            complement(109404..110060)
                     /gene="lsp"
                     /locus_tag="ANA_C10099"
     CDS             complement(109404..110060)
                     /gene="lsp"
                     /locus_tag="ANA_C10099"
                     /EC_number="3.4.21.89"
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase I"
                     /protein_id="AFW92911.1"
                     /translation="MQNQASDKNSSQEPDNSWIVELGKTMILSIFLALGIRTFVAEAR
                     WIPTGSMEPTLHGVKDQWLADKIIVDKVKYKFANPERGDIVVFLPPQEIQNNPEREAF
                     IKRVIGLPGEKVELREGKVYINSQPLPENVYLSSSVRTFVEACNSSGLQPPFLAKPEI
                     IPANSYLMLGDNRPNSYDGRCWGVVPRKNMIGRAVARFWPLDRMGAIDKAPAYSSPKP
                     "
     gene            110343..111686
                     /gene="pyrC"
                     /locus_tag="ANA_C10100"
     CDS             110343..111686
                     /gene="pyrC"
                     /locus_tag="ANA_C10100"
                     /EC_number="3.5.2.3"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="AFW92912.1"
                     /translation="MSNPQSLLIRHAEIILPNGESMIGDVLIEGRHITQVGQEIANAT
                     PTHEIDAKGLTLLPGVIDPQVHFREPGLEYKEDLFTASCACAKGGVTSFLEMPNTRPL
                     TINQSALDDKLQRAAQKCLVNYGFFIGATADNLPDLLSAQPTPGIKIFMGSMHGDLLV
                     SQEDSLEAIFAQGSRLIAVHAEDQARIKQRKQEFAGITDLAVHSQIQDNQAALLATQL
                     ALKLSKKYQRRLHILHMSTAEEAELLREDKPSWVTAEVTPQHLLLNTNAYNTIGSLAQ
                     MNPPLRSPHDNEVLWQALRDGIIDFIATDHAPHTLEEKAQTYPNTPSGMPGVETSLPL
                     MLTAAMDGKCTVAQVVQWMSKAVAVAYGIANKGEITPGYDADLVLVDLKNYHEVKREE
                     VVSKCGWSSFEGWNLTGWPVTTIVGGEIVYDSYGALRYHGQLNTQVRGQALTFSG"
     gene            112251..114518
                     /locus_tag="ANA_C10101"
     CDS             112251..114518
                     /locus_tag="ANA_C10101"
                     /codon_start=1
                     /transl_table=11
                     /product="TPR repeat domain-containing protein"
                     /protein_id="AFW92913.1"
                     /translation="MIMRNRIFSILLLTLSLTTTPQLVFAQNTVQQLFKQGETAESVG
                     DNSQAETIWRKVLQVEPNNGKAYNNLGNALRRQGKLPEALTAHQKALQLNPNDAEAYV
                     GIGNVLNAQGKPDEAVAAYRKAIEFDPKYAKAYNSLGNALYDQEKLKEAVAAYRKAIE
                     FDHKYAAAYYNLGNVLYEQKELDEAVAAYRKAIELNPKYATAYNNLGNALSDQKKLDE
                     AVAAYQEAIKLNPKDATAYNNLGIALSDQKKLDEAVAAYQKAIELDPKYATAYYNLGN
                     ALSDQKKLDEAVAAYQKAIELDPKYATAYYNLGNALSDQKKLDEAVAAYQKAIELDPK
                     YATAYYNLGNALRGQKKLDEAVAAYQKAIELNPKYATAYNNLGIALSDQKKLDEAVAA
                     YQKAIELNPKDATAYYNLGIALSDQKKLDEAVAAYQKAIELDPKDAAVYNNLGNALSD
                     QKKLKEAISNYKTALSLPEDTSTTPTTAHTLANNNLGLALQDQEKFAEAIKYFDKAEE
                     LDPNFIYASNNNIEARKLWTEKQNKLASVDSDIEFLPKNDPNLPVKRSVVLITAKFSN
                     SQRQGIEVGTGVVIQRDANRTLILTNRHVIFDGNEQGENIQVEFFSSPPLGKVRMRRN
                     AKLLQKTPTDELDLAVLEITDKLPADIQPLSMSTTINPAMSIQIIGHDAKRGEDKSWS
                     VKSGKIIIVQNRKLEISETELKPGYSGSPVIDSKNRLIGIVYARKPGETKNFAYPISV
                     VKKQLSTWKITLTQP"
     gene            114515..115255
                     /locus_tag="ANA_C10102"
     CDS             114515..115255
                     /locus_tag="ANA_C10102"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92914.1"
                     /translation="MSYKVLLASLLILSINPLSAVASCPQGNARSIDYIRRQPPNRCE
                     GIKLEPLSGNSLSLISIATRNIANYGENITLQVPRIKNGKNPQVIVKSLNDNYHYQLD
                     DLLLSNNGANFGFSWNTYVLKTANIPANKLRAVASYSLGSQNVYVPVTLGKTSGKYEF
                     VFYSQDRVKFTSVKIVPLTDQKDQQPVYRTSRTTPNSGEISFTWDGSKSPKGRYELHY
                     IANIERSNEPSDRIERRIIFEHNPTWLK"
     gene            115259..116515
                     /locus_tag="ANA_C10103"
     CDS             115259..116515
                     /locus_tag="ANA_C10103"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92915.1"
                     /translation="MGYRQKGRQKSSHNSRFSKINNFIITKSGLIQTKFNNINHNFLQ
                     RLPNLKQYLIQQKSSILVIILLVVLCIITIGAIVPGTHTFEGNLIFKEMSFTYDDNQP
                     KLFLGNIKNIKELETEGKQTLTFTGSFQSQSLPEINKLNSLEIQLTDRESKIIITPAN
                     SSTESEINLKELRLQPQTRIARLNYDFYRQQLAFSLLPNSQNNPNPLEIYLGEQPIKV
                     IIEGYKIPSLNLPKSQDDQAQLEFIVNPNNKEFTFNIQENTNIYLTLSKPPKYESEQW
                     FRGKIKTKDVTFTHVDKNGGNLRDDLEISTIVEGKIRMAEQDREIEENQFLMGEDTNK
                     PLNIQLIRNLQIISDKKGIEARFSGKTKQIQIGLDQDFPVSSIQGSWLDGVLPRDAII
                     ALFSFGAATVANLLSWLFSNTNSRKP"
     gene            complement(116578..117006)
                     /locus_tag="ANA_C10104"
     CDS             complement(116578..117006)
                     /locus_tag="ANA_C10104"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92916.1"
                     /translation="MTKIFLPDIEATQQLGITLGETLTAGSVILLEGDLGAGKTTLVQ
                     GIGKGLGIIDSIVSPTFTLINEYTEGRIPLYHLDLYRLEPQEVTGLNLESYWEGIEVT
                     PGIVAIEWAERMPYLPDSYLKVCLNYGENGSRQAEIIAVN"
     gene            complement(117203..118003)
                     /locus_tag="ANA_C10105"
     CDS             complement(117203..118003)
                     /locus_tag="ANA_C10105"
                     /codon_start=1
                     /transl_table=11
                     /product="putative restriction endonclease"
                     /protein_id="AFW92917.1"
                     /translation="MTSFIISQTEPPLPPWETLPTMYDLPSENPEEKGLPDDFHFLQP
                     LLLYLTFQPINWNPEIVYSAADLNLYYDLQNPLWYKRPDWFGVVGVPKLYNGQDLRLS
                     YVTWQEPANPFVVVELLSPGTEDEDLGNRESKIGKPPTKWEVYERILRIPYYIVFSRY
                     TNEVRAFQLVGGHYEPMNMIEGRLLMPELGLSLGLWQGTFRDIPKLWLRWFTLTGELI
                     PEPTEEAAAANERVILAEQETIEAKRKVEQLGQLLRDLGVNPDTLDNA"
     gene            complement(118060..119433)
                     /locus_tag="ANA_C10106"
     CDS             complement(118060..119433)
                     /locus_tag="ANA_C10106"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92918.1"
                     /translation="MFIGFLKQAINSLQLESHSRTSHRVNQWFKWLSPGLAVKRWLLI
                     TVGGVVLASLGLAIWVKLTPIFWILELLKGLLGLLADILPNYISGPLLLICGVLLVLW
                     GQSRTVGSITEVLRPGVNEEELIDVLLAHRRLYRGPKIVVVGGGTGLSTLLRGLKTYS
                     ANITAIVTVADDGGSSGRLREEFGVLPPGDIRNCLAALADEEKLLTELFQYRFRAGDG
                     LTGHSFGNLFLTAMTDITGDLVQAIAASSKVLAVRGQVLPATLSDVRLWAELTDGRRI
                     EGESNIPKAAGKIVKIGCIPENPPAVPAAIKAIQEADYIIIGPGSLYTSLIPNLLVGE
                     IADAIAATNVPRIYICNIMTQPGETDGYSVAEHIQAIDDACGNRRLFDAVLVHKKTPS
                     AQALIRYAQQNAHPVFLDRESVTQLGRRIVPANILFEDEYGAVRHDPQKLAKVLLKWY
                     SGAHHGK"
     gene            119624..120115
                     /gene="ruvC"
                     /locus_tag="ANA_C10107"
     CDS             119624..120115
                     /gene="ruvC"
                     /locus_tag="ANA_C10107"
                     /EC_number="3.1.22.4"
                     /codon_start=1
                     /transl_table=11
                     /product="crossover junction endodeoxyribonuclease"
                     /protein_id="AFW92919.1"
                     /translation="MKKRILGIDPGLATVGFGAINWQQSQNKGQETTVEMVDFGVIRT
                     NADVEMTQRLCILFDDLHSVMEDLQPDLVAIEKLFFYRMANTIVVAQARGVLMLVLGQ
                     RKLPYVEFAPPQIKQALTNYGKADKAEVQEAVMRELDLDEIPRPDDAADALAVALTAS
                     FQL"
     gene            120634..123372
                     /gene="hsdR"
                     /locus_tag="ANA_C10108"
     CDS             120634..123372
                     /gene="hsdR"
                     /locus_tag="ANA_C10108"
                     /EC_number="3.1.21.3"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction enzyme"
                     /protein_id="AFW92920.1"
                     /translation="MSANEANTRTQLIDPALILAGWNIKDPHQVGLEIPVDGYHAEPW
                     NGVTDYCLYQPNGEVIAVVEAKRQSSDPQIAQTQVEYYVKEIEKHQSFRPFAFMTNGE
                     EIYFWDVGNSAKRQVAGFFSPADLENLLYIRQNKIALSSLPINTQIAGRDYQQEAIRR
                     VCETFDEGKRRTLLVMATGTGKTRTAMAIIDLFLKANQSRKILFVADRDNLVKQALED
                     GFMEHIPHEPCDRIFSYNIDKTKRLYVVVEKTLRNSYKKFSPAFFDLIIFDEAHRSIF
                     NLFQEVMDYFDGRMIGLTATPADFIDRNTFITFHCFDGIPSFLYTYKQAVEEKNLVDF
                     SLYQAQTKFQSEGIKGAKLSEEERNVLIAQGTDPDDIDFSGTDLEKKVSNKDTLRKQW
                     EEIMEVCHKDESGQLPAKTIVFALTQEHAFRLCETFEEMYPQYSDLVRVITHKTEYKG
                     KLTGNFKKNDMPRIAISVDMLDTGVDVPELMNLVFMKPVQSQIKLWQMIGRGTRNQKA
                     CKKLEWLPNRTKQEFLIIDFWENEFESKVQTEVAQTIPVLQRIFNTRLDLLELYLHDQ
                     ESPECQAVIASLREQITQIPTDSFTVKKKMLDMDIAEAWTDLFWNYITKDKLKSLRFK
                     VAPLLRFVPGVEIAAATFTSKVERLKLEIQTEGAKPDTVQSIVEDVSRLPDFVHQDKR
                     KQDAIKLCLSSRLNNATVKELNQIINDLAEEMKNRRQRPSIFLELDLADFVATRGFIT
                     VGEGGEQVYVEEYKKRVEEKINEIVDVHPTIKAIQEGKAVTDWQLIELERTLRQGLGG
                     GNIQLSESNIRKAYGLKANSLLAFLRHLLDLDAIPDYDEVVKRQFEDFIAKHQYNANQ
                     INFLRAVQSVFLQKQRLEVADLYEGALARFGKNAVDRFFSDDEVDDLLAFTELLAA"
     mobile_element  124035..124716
                     /mobile_element_type="insertion sequence:ISAsp20"
     gene            124144..124620
                     /locus_tag="ANA_C10109"
     CDS             124144..124620
                     /locus_tag="ANA_C10109"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS200-family protein"
                     /protein_id="AFW92921.1"
                     /translation="MALWRLYYHVVWATKKREPLITNDVEEKFYGYLIGKADHLGCII
                     HAIGGIEDHIHFVVSIPPKLSIAEFVKTLKGSSAYHYNHTFGKTQQFAWQEGYGVFSL
                     GGKQLQEAIDYVDNQKIHHQNKTTIPLLEQETDLDKPPENKTKPKIPEIPGNKFPD"
     gene            124846..126516
                     /gene="hsdM"
                     /locus_tag="ANA_C10110"
     CDS             124846..126516
                     /gene="hsdM"
                     /locus_tag="ANA_C10110"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="type I modification methylase"
                     /protein_id="AFW92922.1"
                     /translation="MDAIEQFSFLLFLKRLDETEDLNERQAKRRKEDYQPKIPLEMRW
                     RNWTQKKAEDALNHVKNKVFPWLKEMGNSDNEEENEEGNEQETNEDKSSFSEYMQTAE
                     FKINKPSLLIEACKSIDEMKISEQNQDVQGDLYEYLLNKLSIAGRNGQFRTPRHIIRM
                     MVEMVEPKPTDRIGDLAAGTCGFPVNAYQYILEKNTSPEILFDEKGNKHLVGDLLTLE
                     QQEFLQTEAFTAYDNDSGMTMLRIGSMNFMLHGIEQPRFFAKDTLSKRFDDENTLDLV
                     LMNPPFKGAVDAADVHPKLAGLSKKSELLFLHLILRVLDMGGRCAVIVPDGVLFGSSK
                     AHVEIRKKIIEENRLDGVVSMPSGVFKPYAGVSTAVLLFTRGGTTDRVWFYDMEHDGF
                     SLDDKRQAVTENDIPDILDCWKNRFNADVTKQNEERLAELKMQIAPLKAERLLLHKEI
                     NRLTFENAVAPADDEATRQALETDKQKLALLHEKISPVQNEINRLNRQFWVTKAQVKG
                     NKYDLSASRYRQVEQDEVFYDVPQVTLERLLKLEDVMGAEVRELERLL"
     gene            126837..128249
                     /gene="hsdR"
                     /locus_tag="ANA_C10111"
     CDS             126837..128249
                     /gene="hsdR"
                     /locus_tag="ANA_C10111"
                     /EC_number="3.1.21.3"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction enzyme"
                     /protein_id="AFW92923.1"
                     /translation="MTDTNSCEIRDLDIVLNLKDEIMEYFNKKTDYKQPNWIKTTLGK
                     CFRLINGRAYSQVEMLNSGTPIIRIQNLHGSEKWYYSDLQLPEDQYCDKGDLLFAWSA
                     TFGPFIWNGTKSIYHYHIWKVEPTPAIDKKFAYYLLTNITTSIKAASHGISMLHMTKE
                     GMEKWEVDIPPLPEQKRIAAILEKCDRLRRTRRYSLQLSETFLQSVFLEMFGDPVTNP
                     MGWFIKNLDDVADIASGVTKGQKFNGKQTVQVPYMRVANVQDGYLDLTDIKLIEALPQ
                     EVEQLKLQKGDILMTEGGDYDKLGRGAIWHGQIENCIHQNHIFRVRTNRKIILPEFFA
                     KLLLTQYTKLYFLQCSKQTTNLATINMTQLKALPVPLPPLPLQEKFAQIVQKHERFRT
                     QQREAERQAEHLFQTLLYRAFRGELTSSDSNELDISALSAENHPQQPKPKSTDKPENL
                     PIPATQPQINALQLTLPGLE"
     gene            complement(128316..129257)
                     /locus_tag="ANA_C10112"
     CDS             complement(128316..129257)
                     /locus_tag="ANA_C10112"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease protein"
                     /protein_id="AFW92924.1"
                     /translation="MILKYMSQLTSKQWILMQQRITPYLFLLPALIILALTVFYPAVQ
                     AFYLSFTNYENIGDPPQWIGWKNFLRLSKDPVFWQTLQNTFIYLIGVVPILVFLPLAL
                     AILVNQKLRGMNWFRTAYYTPVVISMVVAGIAWKWLYAENGLLNQILKTLGIFTDGIP
                     WLTSPDKILGIVPISLASIMAVTIWKGLGYYMVIYLAGLQAIPADIYEAAAIDGSDSV
                     RKHWDITLPLMQPYLALVAVISAISATKVFEEVYIMTQGGPLNSSKTIVYYLYEQAFG
                     NLEISYACTIGLVLFLIILGLSILRLVVNQDGNDFSV"
     gene            complement(129501..129977)
                     /locus_tag="ANA_C10113"
     CDS             complement(129501..129977)
                     /locus_tag="ANA_C10113"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92925.1"
                     /translation="MPQRIIIEVNNLFKRDRIVRNLELFQDIIVISLCVSLFCVMLIR
                     LGDMFLSFLSPLDLRQVTSDILFILILVELFRLLVDYLQERSISVGAAVEITIVSALR
                     EVILRGVLEISRDQLFGLSVFLLILSGIFLALPWMPRLLEQVKINQHETVDTKPEL"
     gene            130435..132159
                     /locus_tag="ANA_C10114"
     CDS             130435..132159
                     /locus_tag="ANA_C10114"
                     /codon_start=1
                     /transl_table=11
                     /product="flavin reductase domain-containing protein"
                     /protein_id="AFW92926.1"
                     /translation="MVLLTEKLEKRLTINTVEISEDTTAIRSLDWDRDRFDIEFGLQN
                     GTTYNSFLIRGEKIALVDTSHEKFRKLYFDTLTGLINPQDIDYLIVSHTEPDHSGLVK
                     DLLQLAPHLTVVASKVAIQFLEDMVHQPFNRKIVKNGDRLDLGNGHEFEFVIAPNLHW
                     PDTIFSFDHKTQILYTCDAFGLHYCSESTFDDDLAAIEADFQYYYECLMGPNARSVLS
                     AMKRMAELKTIRMIATGHGPLLYHNVEELTGRYRSWSQGQTKAETPVGIFYVSEYGFG
                     DRIAQSIANGMTKTGVAVEIVDLASVNELQELRELVGRCTGLVVGMPPTSGNSNIQAA
                     LSTVLGSAKEKQAIGIFETGGGDDEPTYPLLNKFRALGLHLSFPVIEIRETPTANTYK
                     KCEEAGTDLGQWVTRDKSIKAMKSLAADLDKALGRISGGLYIITAKKADVSSAMLASW
                     VSQASFKPLGFSIAVAKDRAIESLMQVGDRFVLNILEEGNYQPLMKHFLKRFAPGADR
                     FQGVKTQPAENGAPILTDALAYVECEVVSRMDCGDHWAVYSTAYAGRVSNPDAMTAVH
                     HRKVGNHY"
     gene            132235..132348
                     /locus_tag="ANA_C10115"
                     /note="flavin reductase domain-containing protein;
                     N terminal partial ORF"
                     /pseudo
     gene            132390..132617
                     /locus_tag="ANA_C10116"
     CDS             132390..132617
                     /locus_tag="ANA_C10116"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92927.1"
                     /translation="MEIAPHISVDSGIHHGTPVITETRVPISIIIGSLAGGMSKEEVM
                     QEYELSKNQVEAALSYAADLVKYTQVTALGA"
     gene            132637..134457
                     /locus_tag="ANA_C10117"
     CDS             132637..134457
                     /locus_tag="ANA_C10117"
                     /codon_start=1
                     /transl_table=11
                     /product="flavoprotein"
                     /protein_id="AFW92928.1"
                     /translation="MKICPVPSKIGKLKILTFAPLLLCAFARNIIHTNHQSPMTTKPR
                     DVQILPIGTDTIVLRSRSWARLRFEIEYALAKGTTANSYLIQGDKNALLDPPGETFTE
                     IYLQALQQRFDVKKLDYVILGHINPNRAATLKALLEIAPQITFVCSNPGAINLRAALE
                     KDDLQILVMRGEDTLDLGKGHHLQFIPTPNPRYADELCTWDRQTEILFSDKLFGAHIC
                     SDQVFDEGWEVFNEDRRYYFDCLMAPHARQIETALEKLADLPVRMYATGHGPIVRYGL
                     IDITKGYREWTKQQTSADMTVALIYASAYGNTATLAQAIARGITKAGVNVEAINCEFT
                     EPEEIKAAIEKSAGFVIGSPTLGGHAPTPVQTALGIVLSTATNNKLAGVFGSFGWSGE
                     AVDLIESKLKDAGYRFGFDTIRVKFKPNEVTLQTCEEAGTDFAQALKRAAKKSVVAKQ
                     PASNVEQAVGRIVGSICVVTASQGDVKTGMLASWVTQASFNPPGLTIAVAKERAMESL
                     SYTNNKFVVNILAEGKEIRKQFMKVYAPGQDRFAGLDTQEANNGGIILNGALAYLECS
                     VQSRMESGDHWLVYATVDDGKVLNQDGVTAVHYRKSASYY"
     gene            complement(135038..135196)
                     /locus_tag="ANA_C10118"
     CDS             complement(135038..135196)
                     /locus_tag="ANA_C10118"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92929.1"
                     /translation="MSYVLCVVLALLILALLSLAFISSKTAEIANSGVLMFRSIEHIL
                     ERWINRNK"
     gene            135509..136270
                     /locus_tag="ANA_C10119"
     CDS             135509..136270
                     /locus_tag="ANA_C10119"
                     /codon_start=1
                     /transl_table=11
                     /product="putative restriction endonuclease"
                     /protein_id="AFW92930.1"
                     /translation="MYQTDPPRSAQEFLPTMYDLPSEDPEEAGLPDEFHLLQPQLLRE
                     TFCPSKFPENQVFIATDLNLYYDVHHPLWYKRPDWFAVVDVPRLYAQKELRLSYVVWQ
                     EGVNPFVVVEFISPGTEKEDLGRTLRDASQPPTKWEVYERVLRVPYYLVFDRYTDQLR
                     AFQLQGSSYAELEINQLRVWLNDIELGLGLWQGVYQGIERQWLRWYDASGNWVLTPAE
                     RERKQGERERRRAERLAAQLRALGVEPDFGDDEEG"
     gene            136271..136435
                     /locus_tag="ANA_C10120"
                     /note="putative restriction endonuclease;
                     C terminal partial ORF"
                     /pseudo
     gene            complement(136484..136810)
                     /locus_tag="ANA_C10121"
     CDS             complement(136484..136810)
                     /locus_tag="ANA_C10121"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="AFW92931.1"
                     /translation="MSIYVGNLSYEVTQEALSAVFADYGAVKRVQLPTDRETGRLRGF
                     GFVEMGTEAEEQAAIDALDGAEWMGRLLKVNKAKPKEDRGPGGGGSRGGYGGGGGNRG
                     GGGGRY"
     gene            complement(137177..139246)
                     /locus_tag="ANA_C10122"
     CDS             complement(137177..139246)
                     /locus_tag="ANA_C10122"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component hybrid sensor and regulator"
                     /protein_id="AFW92932.1"
                     /translation="MAQAHYQILFLEDSPVDRVLYSRFLSQDTLATYEITEAKSGLEG
                     LTKLAESQPDLILLDHQLQDMNGLEFLNQLQLQLSSPHIPVIILTGTGDEKIAVQAMK
                     NGVQDYIVKDKITPQGLCRAIHEVLEKTRMMKNMQALYIPLQQAELYQDLQKLNASLE
                     KKVQKLTEELAVSESKYRAIFNQRFQFTGLLDLEGMVLELNQASLEFTGLQMADLINR
                     PIWEVYGWQISQATQDQLKHAIARAAQGDFISSQVEVQGIDNQILTIDFSIGPLRNNA
                     GEVVMLISEGRDITEAKLNEAKCKQAEATLKFQAQILEEIHDAVITTDINGIIQSWNL
                     GAENYYGYTAAEMIGQSVSILYLDPVELQTNIMSTLLAKGRHEVEVAACRAKSGDIVY
                     INLRLSVIRDNHGNITHIVGCSHDITKQQAAIKERNDILKQEQAARKQVEAANQIKDE
                     FLAVVSHELRTPLNSILGWASLLKKGKLKPEETDEALSIIERNAKLQVYLINDLLDMS
                     RIFQGKGTMKVSSVNLATIISAVSETLFLAPKTKKIQIQTIIAANIGLVAGDPVRLQQ
                     IVWNLLSNAVKFTPHGGQIEVRLECVGFDAQITVSDTGKGISPEFLPYIFDYFRQEDS
                     STTREFGGLGLGLAIARNLAELHGGTIQADSSGLGQGATFTFRLPLMNANSENADYPQ
                     PQDGYLA"
     gene            complement(139473..141542)
                     /locus_tag="ANA_C10123"
     CDS             complement(139473..141542)
                     /locus_tag="ANA_C10123"
                     /EC_number="3.4.21.26"
                     /codon_start=1
                     /transl_table=11
                     /product="prolyl oligopeptidase"
                     /protein_id="AFW92933.1"
                     /translation="MSNSKQPLTYPTISKSDQIDNYHGTVVADPYRALEDPDTEETKA
                     WVEAQNQVTFSYLNEIPAREKIKQRLTKLWDYEKYGTPFKEGESYFYFKNDGLQNQSV
                     LYTLPTLESEPRVLLDPNQLSEDGTVALSGIAISENGQLLAYGLSSSGSDWQEWKVRD
                     IATGEDLQDHLQWIKFSGAAWTHDHQGFFYSRYDEPNEKTKLEDVNYYQKLYYHKLGT
                     QQSEDILIYHRSDEKEWGFGGNVTEDGKYLIISIWLGTDSKNLVFYQDLTNLNSEIIE
                     LINQFAADYSFINNDDHIFYFRTDLNAPKGRVIAIDTKKPTSENCQEIIPQAVETLES
                     VGILNNQFVADYLQDAHSQIKIFDLKGNFIREVELPGIGSASGFGGKRHDPETFYSFT
                     SFTTPGTIYRYDMKTGKSEIFRQPKVDFNADEYETKQVFYESKDGTKVPMFITQKKGI
                     KLDGNNPTYLYGYGGFNISLTPSFSVSLLIWLEMGGVYAVPNLRGGGEYGEEWHQAGM
                     KLQKQNVFDDFITAAEWLIANNYTKPAKLAIGGGSNGGLLVGACMTQRPDLFGAALPA
                     VGVMDMLRFHKFTIGWAWVAEYGSSENAAEFTNLYAYSPLHNLKMGTAYPPTLIITAD
                     HDDRVVPAHSFKFAAALQAAHNGNAPVLIRIEIKAGHGAGKPTAKIIEEAADKWGFLV
                     RVLAIDV"
     gene            complement(141656..142306)
                     /locus_tag="ANA_C10124"
     CDS             complement(141656..142306)
                     /locus_tag="ANA_C10124"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S16 domain-containing protein"
                     /protein_id="AFW92934.1"
                     /translation="MTSSSKIAVRELPLFPLPEVVLFPTRPLPLHIFEFRYRIMMNTI
                     LESDRRFGVLMIDPTKGTIANVGCCAEILHYQRLPDDRIKLLALGQQRFRVLEYVREK
                     PYRVGLVEWIEDQPPAKDLRPLASEVEQLLRDVVRLSAKLTEQEIELPNDLPDLPTEL
                     SYWIASNLYGVAPEQQALLEIQDTVARLEREAEILTSTRNHLAARSVLKDTFNEME"
     gene            complement(142532..142720)
                     /locus_tag="ANA_C10125"
     CDS             complement(142532..142720)
                     /locus_tag="ANA_C10125"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92935.1"
                     /translation="MWKINYRLLPKIVLQMLRPYSCQWSVGAKHLEDKLSVIAKNSSP
                     NASPVQLSVVSRGEALGR"
     gene            complement(142844..143161)
                     /gene="rpsJ"
                     /locus_tag="ANA_C10126"
     CDS             complement(142844..143161)
                     /gene="rpsJ"
                     /locus_tag="ANA_C10126"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S10"
                     /protein_id="AFW92936.1"
                     /translation="MATLQQQKIRIRLKAFDRRLLDTSCEKIVETANRTNATAIGPIP
                     LPTKRKIYCVLRSPHVDKDSREHFETRTHRRIIDIYQPSSKTIDALMKLDLPSGVDIE
                     VKL"
     gene            complement(143326..144555)
                     /gene="tuf"
                     /locus_tag="ANA_C10127"
     CDS             complement(143326..144555)
                     /gene="tuf"
                     /locus_tag="ANA_C10127"
                     /EC_number="3.6.5.3"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor Tu"
                     /protein_id="AFW92937.1"
                     /translation="MARAKFERTKPHVNIGTVGHVDHGKTTLTAAITMTLAANGQAVG
                     KGYDQIDNAPEEKARGITINTAHVEYETTARHYAHVDCPGHADYVKNMITGAAQMDGG
                     ILVVAATDGPMPQTREHILLAKQVGVPSLVVFLNKQDMMDDEELMELVEMELRELLTT
                     YDFPGDDIPIIKGSGLKALEAMIANPKTQRGENEWVDKIYELMDAVDASIPTPERDVD
                     KPFLMAVEDVFTITGRGTVATGRIERGIVKVGDTVELIGIRDTKTTAVTGIEMFKKSL
                     DQGMAGDNAGVLLRGLKKEDIERGMVIAKPGTIKPHTDFEGEVYVLTEKEGGRKTPFF
                     SGYRPQFYVRTTDVTGTIKAFTSDEGADVEMVMPGDRIKVTVELINAIAIEEGMRFAI
                     REGGRTIGAGVVAKILK"
     gene            complement(144578..146656)
                     /gene="fusA"
                     /locus_tag="ANA_C10128"
     CDS             complement(144578..146656)
                     /gene="fusA"
                     /locus_tag="ANA_C10128"
                     /EC_number="3.6.5.3"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor G"
                     /protein_id="AFW92938.1"
                     /translation="MARTNPLEKVRNIGIAAHIDAGKTTTTERILFYSGIIHKIGEVH
                     EGTAVTDWMEQERERGITITAAAISTSWNDHQINIIDTPGHVDFTIEVERSMRVLDGV
                     IAVFCSVGGVQPQSETVWRQADRYKVPRIAFINKMDRTGANFYRVHDQMVDRLRANAI
                     AIQLPIGSETEFKGIIDLVKMCAYMYTNDQGTDIQTVEIPAGLAEKAAEYRIKLVEAV
                     SETSDVLMNKYFEGEELTEAEICTALRKGTIAGTIVPVLCGSAFKNKGVQLMLDAVID
                     YLPSPLEVPPIQGTLLNGDPVERHADDNEPLSALAFKIMADPYGRLTFVRVYSGVLKK
                     GSYVLNVSKNKKERISRLVLMKADDRQDVDELRAGDLGAALGLKDTLTGDTLCDEGFP
                     VILESLFIPEPVISVAVEPKTKNDMDKLSKALQSLSEEDPTFRVRVDPETNQTVIAGM
                     GELHLEILVDRMLREFKVEANVGAPQVAYRETIRKAVEKIDGKFIRQSGGKGQYGHVV
                     INLEPGEPGTGFVFVSKIVGGIVPKEYVGPAEQGMKECCESGILAGYPLIDVKATLIH
                     GSYHDVDSSEMAFKIAGSMAMKEAASKASPVILEPMMKVEVEVPEDYIGNVIGDLISR
                     RGQIESQSTDNGLAKVVSKVPLATMFGYATDIRSKTQGRGIFTMEFSTYEEVPRSVAE
                     GIISKSKGNA"
     gene            complement(146835..147305)
                     /gene="rpsG"
                     /locus_tag="ANA_C10129"
     CDS             complement(146835..147305)
                     /gene="rpsG"
                     /locus_tag="ANA_C10129"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S7"
                     /protein_id="AFW92939.1"
                     /translation="MSRRGVSQRRTVPPDSVYNSRLISMMMRRIMRHGKKSIAARIVY
                     DALKTIEERTGGSPLETFEKAVRNATPLVEVKARRVGGATYQVPMEVRTDRGTTLALR
                     WLVQYSRQRPGRTMAGRLANELMDAANETGSAIRKREETHRMAEANKAFAHYRY"
     gene            complement(147687..148070)
                     /gene="rpsL"
                     /locus_tag="ANA_C10130"
     CDS             complement(147687..148070)
                     /gene="rpsL"
                     /locus_tag="ANA_C10130"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S12"
                     /protein_id="AFW92940.1"
                     /translation="MPTIQQLIRSERELARQKTKSPALKQCPQRRGVCTRVYTTTPKK
                     PNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTL
                     DTAGVKDRKQGRSKYGTKLPKAGKK"
     gene            complement(148379..148705)
                     /locus_tag="ANA_C10131"
     CDS             complement(148379..148705)
                     /locus_tag="ANA_C10131"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster assembly accessory protein"
                     /protein_id="AFW92941.1"
                     /translation="MIHFSPAAINEIGRLKSKQPSDTLFRLRVKSGGCADLFYDLAFD
                     TTVQFQDRVLALDDIRVVIDPESLNYITGLSLDYSEDLTGGGFRFHNPQATSTCNCGN
                     SFSISQ"
     gene            complement(148850..149266)
                     /locus_tag="ANA_C10132"
     CDS             complement(148850..149266)
                     /locus_tag="ANA_C10132"
                     /EC_number="5.3.1.8"
                     /codon_start=1
                     /transl_table=11
                     /product="type II mannose-6-phosphate isomerase"
                     /protein_id="AFW92942.1"
                     /translation="MAKLSETAPNTLTLQPTINSRSIAAGELRPWGSFTVLEEGRGYK
                     IKRIEVKPGHRLSLQMHHHRSEHWIVVSGTAKVVCGDQEILLSNNQSTYVPQCTTHRL
                     ENPGVIPLILIEVQNGEYLGEDDIIRYQDDYARSDK"
     gene            complement(149494..151344)
                     /locus_tag="ANA_C10133"
     CDS             complement(149494..151344)
                     /locus_tag="ANA_C10133"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92943.1"
                     /translation="MILKILNSVLPLLSTALCLTATYRVFAENTPSLPTPVPSAVSAG
                     NQIILNGRTLPGAWLQPTATTVKGQTYLSDGAVKQLMGIDLLNSSNPGKQPVQWFSGL
                     TNPPILNTNLSEGYRYLDITQLAQTAKWQIQANGSTLVISTPPSQLKNIRLGKQPQGD
                     RVVLDLDIATPWQIRQELPVKKVVDPDEIIPKSTTPPNREWTLTLDGTADPALIQRYN
                     SQPTTPPIPASIIQKVEMVNNQTIVRLSVPFGQSLQVSTIPQPNRLVIDIQPDAMVEK
                     TIAWAQGLQWRQQLVALGTDRFPVVWLDINPRAIGLSIKPILTNPQTLTGTAPLLLTA
                     QNYLAVAAINGGYFNRNNKLPLGAIRRDNQWISGPILNRGAIAWNNNGQFYFGRLTLT
                     ETLITNNNQRLPISLLNTGYVQRGIARYTPVWGNTYTPLADNEIIVVVENNQVINQLA
                     GDKSGITAIPIPQNGYLLIFRNQTPQLPMGTKVSLTSNTTTPEFSRYPHIIGAGPLLV
                     QNRQIVLDGPGETFSPAFMKGQAVRSSICTTSRGNLMIAAVHNRAGGGGPTLEEQAKL
                     MQTMGCINALNLDGGSSTSLYLGGQLLDRSPNTAARVHNGIGLFISPKRQ"
     gene            complement(152313..152486)
                     /locus_tag="ANA_C10134"
     CDS             complement(152313..152486)
                     /locus_tag="ANA_C10134"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92944.1"
                     /translation="MLPMPIYFLFVYALLKNYLNPEEPVNSIVLKFAVFLLMAYTILA
                     YSYSWLILIVHQN"
     gene            152627..157318
                     /gene="gltS"
                     /locus_tag="ANA_C10135"
     CDS             152627..157318
                     /gene="gltS"
                     /locus_tag="ANA_C10135"
                     /EC_number="1.4.7.1"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase"
                     /protein_id="AFW92945.1"
                     /translation="MNHQPSNQGQQITVSDTNFPDTYPGPKWLVEERDACGVGFITHR
                     QNIASHEILAKALTALTCLEHRGGCSADQDSGDGAGILTAIPWELLAQENSNAIDFSH
                     LSNMAVGMIFFPQDATAAKAAKTAFEQIAAEEKLNILGWRVVPVCPEVLGVQAKENQP
                     QIEQVIIDCADKSGDELERELYIASKRIMQAGRRISEDFYICSLSSRTIVYKGMVRSA
                     VLGDFYEDLKNPAFKVAFAVYHRRFSTNTMPKWPLAQPMRLLGHNGEINTLLGNINWM
                     MAREATLSHPIWEDRFDELKPLVNVNNSDSATLDNVLELLVRSGRSPLEGLMMMVPEA
                     YKNQPSLAEYPEIVDFYEYYSGLQESWDGPALLVFSDGKKVGATLDRNGLRPARYVIT
                     KDDYIVVASEAGVVDFPEENILEKGRLGPGQMIAVDLNTQEILKNWEIKQRIAKQHPY
                     GEWLQQHRQELSKLVKGQSVVNGNGNGNGNGHLSTNNEQLTTDKIDPQVLLQQQIAFG
                     YTIEDVEMVIHPMASTGAEATFCMGDDIPLAVLSEKSHLLYDYFKQRFAQVTNPAIDP
                     LREKLVMSLTVELGEKGNLLEPKPEYARRLKLESPVLTQTELETIKLSGFATAELSTL
                     FPIATGPNGLKTAVESLQKQAAESVRAGAKILILSDRTGTGIAAEYTYIPPLLAIGAV
                     HHHLIREGLRMKTSLIVDTAQCWSTHHFACLLGYGAGAVCPYMALDTVTAWWHEPKTQ
                     QFMTRGKIATLTLNQARENYRKAIESGLLKILSKMGISLLSSYQAAQIFEAIGIGGDL
                     LALGFRGTTSRIGGLSVSELAQEVLSFHSKAFPELTAKKLENLGFVQYRPGGEYHMNS
                     PELAKSLHKAVNGKQYDHYEVYKQHLHNRPVTALRDLLDFHSERSSIPIEEVESVSNI
                     VKRFCTGGMSLGALSREAHETLAIAMNRIGGKSNSGEGGEDPVRYNVLNDVDTAGKSA
                     TLPHLNGLKNGDTAASAIRQIASGRFGVTPQYLATAQQLEIKIAQGAKPGEGGQLPGP
                     KVSPYIAMLRRSKPGVTLISPPPHHDIYSIEDLAQLIFDLHQINPKAQVSVKLVAEIG
                     IGTIAAGVAKANADIIQISGHDGGTGASPLSSIKHAGSPWELGLTEVHRVLMENRLRD
                     RVILRVDGGLKSGWDVLIGALMGAEEFGFGSIAMIAEGCIMARICHTNNCPVGIASQK
                     EEMRKRFTGIPEHVVNFFYFIAEEVRSLLAKLGYRSLSEVIGRADLLTVRSEVKLNKT
                     QALNLDCLTKLPDTKTNRSWLVHEEVHSNGPVLDDQLLADADIQTAIKRNGTVSKTVT
                     VVNTDRTVGTRLTGAIASRHGDNGFTGQINLNFQGSVGQSFGAFNLDGVILNLVGEAN
                     DYVGKGMNGGEIIIQPPANATYDPAENVIVGNTCLYGATGGALFANGLAGERFAVRNS
                     KGTAVIEGAGDHCCEYMTGGVIVVLGKVGRNVGAGMTGGLAYFLDETGNFPDLVNHAI
                     VKVQRVVSDVGRQQLYDLIKTHERRTGSPKAQEIIANWAEYLPKFWQLVPPSEADSPE
                     AKTEEKQLSSV"
     gene            complement(157846..158793)
                     /locus_tag="ANA_C10136"
     CDS             complement(157846..158793)
                     /locus_tag="ANA_C10136"
                     /EC_number="3.5.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="AFW92946.1"
                     /translation="MENNKSFLGTQGILIGLIGLTGTLSIALMILFKAKISDAQNQNV
                     IVKNKDIAANVKTQQRLEEFKTEMLTSWQQEAQAKGFSTDVPPKFQGIVISEAKLPPE
                     KKVIALTFDDGPWPSSTAKVLDILKKNNIKGTFFVVGQNVKNYPDLTKRVVTDGHIIA
                     NHTWHHWYHHMNAQTAAYEVANTTDIIYKTTGIKTSLFRPPGGNMRNGVAAYAKSNKY
                     AVIMWSSDSMDYSRPGVPRLINNIFREAKPGGIVLMHDGGGDRSHTVKALPEIISKFR
                     KQGYEFVTVPELLEMQDQYPQLVAQNKTKSQKPQKPKKP"
     gene            complement(159110..159478)
                     /locus_tag="ANA_C10137"
     CDS             complement(159110..159478)
                     /locus_tag="ANA_C10137"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92947.1"
                     /translation="MSIPEFILLLISVLISVAGQFSLKMGAIKLGKVHGGNIISLILN
                     MITIPELLLGLTCYGIGAVAYILLLTRVNLSVAAPAVSVGYIFSVFLGYFILKEPISL
                     TRVFGLGLIVTGVILVVWKK"
     gene            complement(159562..160515)
                     /locus_tag="ANA_C10138"
     CDS             complement(159562..160515)
                     /locus_tag="ANA_C10138"
                     /EC_number="2.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2 protein"
                     /protein_id="AFW92948.1"
                     /translation="MMMMNQPIYSLVIPIYNEEENITEMYRRLHHVMEQLDGDVELIL
                     IDDGSRDRSLKMMRELHHRDNRVHYLSLARNFGHQIAVTAGLNFVQGKCIIVMDADLQ
                     DPPELILTMIEKWHQEYQVVYAQRISRQQESRLKRLTAYLFYRILRRLAKVDIPVDTG
                     DFCLMDRQVVDILNSMPERNRYIRGLRAWVGFRQTSVLFERNPRFAGDVKYTFGKSLS
                     LAIDGIISFSTVPLRLATYLGIISAAIAMIMIILVLYWRIFAPVSHLIGYTLITISMF
                     FLGSVQLICIGILGEYIGRIYEEVKGRPLYTLKETGGFTKT"
     gene            160542..162080
                     /locus_tag="ANA_C10139"
     CDS             160542..162080
                     /locus_tag="ANA_C10139"
                     /EC_number="2.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 39 protein"
                     /protein_id="AFW92949.1"
                     /translation="MIMRSFSQKEYFFGLLLASLILWLIGLGNLPLRDWDEGTYAIVA
                     REIYRTGNWLYPTIQGDPFLLKPPLMQWLIAICYHIGGVQEFTTRFPGAFLTALGVPL
                     LYLIGRLAFRENLPALFSALVYLTLLPVVRHGRLAMLDGMTISFFLLLLFCVLKARHD
                     KKYALGIGFCLGLITLTKGMLVVVLAGIAGLFILANKQLAILKNPFLWIGMLLGNFPA
                     IAWYFAQWQHYGNIFLEVHFQSQAFDRLGKAVEGNTGPVWYYLLEVIKYGFPWLLFLP
                     GGLYLSWKNRDTAWGCLTLIGTIVYFAIVSLMGTKLPWYIMPVYPFLALAIGANLSYI
                     WQGGKFRSKFLTGFFGFLIIVGLAGCVYFIMFDKQPLLIIMSIILAITMVITSWLINQ
                     HNRQFISVLLTGMYLVLALLMSSQSWIWELNEKFPVVPVATLIKDNVPPGTQIYTSFP
                     DSRPSLDFYSDCKIIPASIADLQDKFVHKSYLLVDNENLQKMNLKQSKMIGEAKGFTL
                     ISFF"
     gene            complement(162185..163600)
                     /locus_tag="ANA_C10140"
     CDS             complement(162185..163600)
                     /locus_tag="ANA_C10140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92950.1"
                     /translation="MEKLLAKNGLATISWMIAISAFILFACSSLRHFLFQSNALDLAV
                     FDQWVYLASQELPPISSFFGFHLIGDHAAFILYPIALLYKIYPDVHWLFAVQAIALAL
                     GCLPVYALGLQIGLSVKYARAIAISYLLYPCLFNSNFFTDFRPEAIAIPAILWAIWAG
                     IGGKTWQLIVAILLVLICKDSLSLTVVAFGVWLCFTQNQRNYGIGCIAAGAVWYLATV
                     GYLVPMLRGGQAGGVVFYASMGDSPKEIISNIITNPGLILGKFFLPETIFYYLFLVLP
                     VIIGLHWRAAMTIIPALPMFLLNIISDYSAQRDLVHHYSLTIFPFIIVWLLRSIWQYQ
                     KDKKRPWLKPKFLIIWAIISFLVLAKYEFFINRYLSSLSNLNSLHTAVSFVKTQGSVL
                     TTSRIAPHLSQRQIIKLISPDWKPDNTSGEKFDYVLLDLRTKNNNNKLDFNPELGNQL
                     KSNPEFKLTYQQDDVYLFTKN"
     gene            complement(163612..164811)
                     /locus_tag="ANA_C10141"
     CDS             complement(163612..164811)
                     /locus_tag="ANA_C10141"
                     /codon_start=1
                     /transl_table=11
                     /product="mannosyltransferase family protein"
                     /protein_id="AFW92951.1"
                     /translation="MNNSHKTLLNSIKDKFNHILDSCQLPIPRYLLIGIIFAVTIRLV
                     CVPNKSVDYKYFLDPWYDFIASHGGFIALKYGFADYTPSYLYWLLIASTLLSGLPKIL
                     AIKLFAMTVDFICAFLTYKIVKLKYPVGRMANWAFLAVILSPTVIYNSSLWGQCDVIY
                     TTGLIACIYFLSIHKQIPALISFGVALSFKLQAMFLAPLLLILLIKKRIFWFYLPIIP
                     LVYIGAMLPAWIAGRPIKELLLVYFEQSHKYKELAKNVPNFYQWIPNDYYNIVVPIGL
                     LLTVTAIFLLAYLVYRSKLEITQDRLIYLATISVFLMPYLLPKMHERYFYPTDILSTI
                     FAFYFPQYRWVAISVQLASFVSYLGTPIYIQLSSIPLGFTLWFVVRNCDMIYTKSKTD
                     FSLNINK"
     gene            complement(165215..166537)
                     /locus_tag="ANA_C10142"
     CDS             complement(165215..166537)
                     /locus_tag="ANA_C10142"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92952.1"
                     /translation="MVKAQMAISTLVAAIAKFIWTDDFLFPASMWLVSRIFIGTAMLL
                     IAPNLPALQDGITPHFGWGIFDAWDSVHYRAISTEGYEFVDDGKQHNLAFFPLFPVSI
                     FIFMKFGFPFELAGLIINNLAFLGTLYFLYSWVKKQCGISAAHWTISVMAYCPMSLFT
                     GVIYTEGLYLLLSTMALRAFDQKQYVWTAICGAMATATRPTGMALIPAFLITAWKQNK
                     PLTAYIAGLLSATGLLIFSVYCKLNFNDFLAFIAAQKGWRPSLGFDWEGWLNMFMQIP
                     FGNNWYFGWVENDEGGIKDFWYPLFFGLIVISSSCLFYWRKYFNPLIFYAGYAIIILS
                     LIIADQGLINNLLNVSMILGSTYLLWYFRQQLTPVMVVYGFCGIGLLLASGGTISLSR
                     LAYGIVPLSAAIGICLSRYPRQAYLVMGLFITLLGKLAIGFAQEIWVG"
     mobile_element  166582..167121
                     /note="disrupted"
                     /mobile_element_type="insertion sequence:ISAsp14"
     gene            166860..167120
                     /locus_tag="ANA_C10143"
                     /note="IS200/IS605 family transposase;
                     truncated and disrupted"
                     /pseudo
     gene            167448..168290
                     /locus_tag="ANA_C10144"
     CDS             167448..168290
                     /locus_tag="ANA_C10144"
                     /EC_number="3.8.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase family protein"
                     /protein_id="AFW92953.1"
                     /translation="MKYCKHNIKLLPSVPEPKYVVFTDFDETYLAHQNREDYKNDLKE
                     LEEYLLNETYQKQIFFGWVTGSSLTSVFDKINKCGLTLLPHFIASSLGTELIYFNQNQ
                     YAEKDKIWENNLMKTGFSENLVNNLVSFLKLDNIHLTPQPQIADCPFLKNYYYHQQND
                     LIDNQAILKIKELVKKAGIQVNISQANPLSGDPNNCYDVDFIPSGTGKKHIVNFILQQ
                     TNVSYQNSIAFGESGNDIEMLQTVRHGYLVGNATSEARKLHFQIAENEYAKGILSVLK
                     TLIK"
     gene            complement(168425..169180)
                     /locus_tag="ANA_C10145"
     CDS             complement(168425..169180)
                     /locus_tag="ANA_C10145"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase"
                     /protein_id="AFW92954.1"
                     /translation="MSFSLDGHVALVTGSSAGLGKAIALKLGQAGAKVAINYSNNESR
                     AKQALAELEQQGCQAILVRGDVTQEEDVAAIYEAIASQLGAVDILVLNATGNQPQIPF
                     EEYTWQDFQTMLDFFIKSPYLLTRICLPSMKQKQWGRIINISSDVCFRSVNNFSAYVT
                     AKNGQLGFTRSMATELAPFGITVNAVAPGWIPVERHENVPQEKKDAYQVRIPMQQWGT
                     PQDITEAVLYFASHESRFVTGQYLCINGGFTLM"
     gene            complement(169218..170054)
                     /locus_tag="ANA_C10146"
     CDS             complement(169218..170054)
                     /locus_tag="ANA_C10146"
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase domain-containing protein"
                     /protein_id="AFW92955.1"
                     /translation="MLKSNINSLNIGCAAWGWREVEIPEYFHWIANQGIRSVEVNAHP
                     QAPKHLLHDGDDQAVSKIADWAKEAGVDIICIAGRNNFTLSDANELETEIKRVERFVD
                     SAEKLGAKFVRLLSGDHRNDYILPDVFPLLHYAFNKIGDYAEERGIQITIENHGGPTA
                     TGQRVARMMKGIKSPAVGINYDPANFLNQGTDPLMALRYILPWVNYSHWKDVQWVNGS
                     PQFCAFGEGEIVWEPIIKELLNAGYQGYWVVEYEETSDVEQGTKESLNNLSQVLQKFA
                     VV"
     gene            complement(170163..171284)
                     /locus_tag="ANA_C10147"
     CDS             complement(170163..171284)
                     /locus_tag="ANA_C10147"
                     /EC_number="4.2.1.-"
                     /EC_number="2.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal-phosphate-dependent aminotransferase"
                     /protein_id="AFW92956.1"
                     /translation="MSQLLTINQIPFVNLKSQHAAIKSELLAAMGEVLDDGNFILGEQ
                     VAEFERQFAQLCGVRYAVGVNSGTDALIFALKALGIRSGDEVITVPNSFVASATCIRI
                     LGAKPVFVDVGDDYNIDPTKIAAAITPKTKAIIPVHLTGRPCNMKPILDIAQENGIAV
                     VEDAAQSVLAEYQGQRVGSLGIVGCFSLHPLKNLNACGDGGVIVTDDSELYDQLKIMR
                     NIGLRTRDDCVMWSHNSRLDTLQAAILLVKLRYLQEWTQQRQENAHYYQSQLAGIPQI
                     IMPWEREWEKCVYHTFVIQAERRDQLRQFLSDRGIGTAIHYPVPIHLSTAGKELSYPA
                     GSFPVAEMQASRILSLPIYPGLTVQELEQVCENIKLFYQ"
     gene            complement(171287..171709)
                     /locus_tag="ANA_C10148"
     CDS             complement(171287..171709)
                     /locus_tag="ANA_C10148"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92957.1"
                     /translation="MTNSSIRLDQQSIKVQTTGKSLCQITPQVQAVITESGITAGICN
                     LFIRHTSASLLIQEEDAKPDVETFFAKLVPENGQYLLAGQGLDDMPAHIRSALTHTSE
                     QVPIAQGLLQLGRLQDIYIWEHRQSGYIREVVINILGY"
     gene            complement(171712..172719)
                     /locus_tag="ANA_C10149"
     CDS             complement(171712..172719)
                     /locus_tag="ANA_C10149"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="AFW92958.1"
                     /translation="MNSKLNSPKHCLVTGAAGFIGSHLCDLLLKSGHSVVGLDNLVTG
                     RTANLKVAQTYSTFTFIEQDVADISPSILTDIDWVFHLAGLADLVPSIQNPGAYYHAN
                     LHSTFVLLEACRTAKIQKFIYTASSTCYGIPNQYPTSETYPCHPKHPYGLTKYLGEQL
                     VMHWAQVYQLPALSLRLFNVYGPRSRTTGAYGAVFGVFLAQKLAKTPFTVVGDGMQTR
                     DFTFVSDVVAAFIKAAESDITGEIINIGSGKSESVLTLVKLLAGEITHIPKRPGEPDC
                     TWADITKATTLLKWQPQVPLSQGVSEMLANIELWRDAPVWTPETIQQETKSWFEHLGK
                     E"
     gene            complement(172789..174081)
                     /locus_tag="ANA_C10150"
     CDS             complement(172789..174081)
                     /locus_tag="ANA_C10150"
                     /codon_start=1
                     /transl_table=11
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="AFW92959.1"
                     /translation="MNKVWRYVQELLIFKLIYPILLRYIDENLITMTEEMEKDKMENN
                     IPKLEAEYEQLPILKLIYSILFNYLHSNLITRVDLLQQCQAENNLYQLKYDEIIQIEP
                     AISYQEIPAAFREKEGSFEFTNPFAVVVKNVELLGIYGIGFTEDKNIILETVLDRVDV
                     LEHTTISTMKAGFNSQYITPIANIEHFDLACSFVNYWSHLYAHWIYEALTRLEVLEYY
                     SQKTGKKPVLIIDKDIPSWKIRSLELMGYGLENYIQWNGYRAKVNELVICSKRREGGR
                     ISIKACHWVRERILSNVDTYANPNLVLSPNIFISRKKANARRILNEEEVSNTLDKMDF
                     VPYVIEDLDFADQVKLFAQAKFIIAPHGGGVTNIIFSQNLTLIELFGQKISHFYYTVA
                     KGLGFDYACMFCEVKNEDIIVNCEELSRMVDKMTKNRI"
     gene            complement(174192..174728)
                     /gene="gmhB"
                     /locus_tag="ANA_C10151"
     CDS             complement(174192..174728)
                     /gene="gmhB"
                     /locus_tag="ANA_C10151"
                     /EC_number="3.1.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="D,D-heptose 1,7-bisphosphate phosphatase"
                     /protein_id="AFW92960.1"
                     /translation="MIKVAFLDRDGVINIDHHYVFRCEQFEFNDGIFATCRLLQDLGY
                     KLIVITNQSGIARGYYSEQDFLSLTVWMYEQFNNQDITILDVFYCPHHPQSTISNYRQ
                     NCRCRKPLPGMIEQACQKYPIDLQSSILIGDRISDMQAAKAAGIGKFYLLSPEIFIPK
                     ELQVSARLDNLEALKFFI"
     gene            complement(174823..176853)
                     /locus_tag="ANA_C10152"
     CDS             complement(174823..176853)
                     /locus_tag="ANA_C10152"
                     /EC_number="2.2.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase domain-containing protein"
                     /protein_id="AFW92961.1"
                     /translation="MLCWLKRQRNPSTNQGFFQCGQGIVCTMPTLDIISTIKRNKKMT
                     LTTLRFPIDLDVYKSLKLDPTNSTLTNEQREILKANIQLCRDTIVFFTAVAAAKGVGG
                     HTGGAYDTVPEVMILDAFFRGVADKFVPIFFDEAGHRVATQYLMATLQGDLDAENLLH
                     YREAYSLLLAHPERGRTPGVKFSSGRLGHLWAYVNGVAIAHPHQVVFCLGSDGSQQEG
                     NNAEAARLAVAKNLNIKLIIDDNNSTCSGYPTDYLKGYNVGQTLAGHGLTVLTGAGED
                     LDDLYTRLCQAVTINGPVAVINKRPMTPGIVGVEGTPLGHDALSPELAIAYLETRGHT
                     SAVNYLKKVIPLTHTYSFTGSSSKTRHIFDATVVSLLSQMTPTERREKVMCIDSDLGE
                     SCGINKISQAYPEIFYHGGIMERGNFSAAAGFGMEAGKQGIFSTYSAFLEMCISEITM
                     ARLNKSNVLCQFSHSGIDELGDNTCHFGLNNMFADNGLEDAYQTRLYYPADGHQMKAC
                     VETVFDQPGLRFLFSSRSPVPDILDTNSKPLFADGYTFIPGKDDVIREGTAGYIVSFG
                     EVLYRALEVVEILKKQGINVGLINKSTLNLVDEEIMAKIGSTPFVLVVESLNRRTGLG
                     IRFGSWLLERGFSPKYAYMGTHQEGCSGIWEQLPHQGIDTIGIMNKVEEMLK"
     gene            complement(177012..177755)
                     /locus_tag="ANA_C10153"
     CDS             complement(177012..177755)
                     /locus_tag="ANA_C10153"
                     /EC_number="2.4.1.15"
                     /EC_number="2.4.1.36"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="AFW92962.1"
                     /translation="MKYQQSLLLATDLDGTFLGGSQQQQSEFYQYIEKQRDRLLLVYV
                     TGRELDWISNLLIENPHIPKPDYIIGDVGTTIVHGETFEPIYPVQYWIIKQWNNANEK
                     IKTLLANEPGLKLQAVNPKYRVSYYYDSEKLQPNTIQKVINAGFDCIISSYNNIYFYF
                     DVMPKGVSKGPTLLKFLEEIKFNADETIACGDTLNDLSLFETGLKGIAVGNSHPNLVD
                     KIQTMDNVYHSPYPGVMGIWDGLKFYGKD"
     gene            complement(177763..179226)
                     /locus_tag="ANA_C10154"
     CDS             complement(177763..179226)
                     /locus_tag="ANA_C10154"
                     /EC_number="3.2.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase family-13 protein"
                     /protein_id="AFW92963.1"
                     /translation="MTSFYTKINTPDWVKNAVFYQIFPDRFSRSIPTEQKWLLNIPLE
                     DWNTTPTFHGYKGGNLWGIIEKLDYLQDLGINAIYLNPIFTSASNHRYHTLDYYQIDP
                     LLGGEEAFTNLLKEAHHRKIKLILDGTFNHASRGFYFFNDILENGQNSPWLDWFKITG
                     WPISPYDNSRPANYASWCDLRALPEFNTNNLGVREYIMRIGEYWIKRGADGWRLDSAD
                     YIKTPGFWQEFRERIKAINPEAYIVGEIPMNATEWLDGTQFDGVSSLPFLNATTAFIV
                     GDRQVKGHFAEYAPPPPADAAKYGEEINQLLQLYPWEIQLTQLNGINNHDTARLIDVA
                     GGDRPSLYLATLLLFTFPGAPCIYYGDEVGLNGGYDPECRKGFPDKKQWDQDILEYHR
                     QLIKLRLSHPALRIGEYHTLSAQGQVYIFARRLETEILLIAVNAGNEIAMASIQPSWQ
                     NQLKQTLFTYHSSQENWTKEAEFINFKLPPRSGLIIG"
     gene            complement(179269..179988)
                     /locus_tag="ANA_C10155"
     CDS             complement(179269..179988)
                     /locus_tag="ANA_C10155"
                     /EC_number="1.14.11.4"
                     /codon_start=1
                     /transl_table=11
                     /product="procollagen-lysine 5-dioxygenase"
                     /protein_id="AFW92964.1"
                     /translation="MKKSPNIAFYTCCNSVSFSKVQLFLRSAKKQNIDVKVLGEGLEW
                     SANSLRLPLILKELKDVKDDTIVLVTDAFDVLYVQNANSIYEKFIQGGYKILFAAEKW
                     YSHQYEEYKDFYDSIKVPYDYKYLNAGTFMGYKKYVCEMIDNILSYPNFHENGSDQRL
                     YGKYCFENPETVTLDYCCDIFWCTAGEWEILPELYDIHNGFVLNKLTGTYPAIIHIPY
                     SKKYYNVLLRLAEDLGDVVSR"
     gene            complement(180268..181059)
                     /locus_tag="ANA_C10156"
     CDS             complement(180268..181059)
                     /locus_tag="ANA_C10156"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92965.1"
                     /translation="MKTIVYQSYRGNETPNWLETCMQTVKDWAELKGFDYRRVDNFFD
                     YVPDWYIDKSQGKINVIADLARLEIAKKFLEQGYEQTIWMDADVVVFDPDNLNIETTE
                     EYLVCREVWLDTEDDQNLGEGTLFCTEKVTNSLVYFTQKNSFLDFYIYATKSILKNQT
                     GRLSRLAVSTKFLSRLYEIMELPLFPNMGLFSPILMHAIVEDKTEIIELYTKALKSPI
                     YAANLCLSFRNQSHKGIMVTDKLFEQLIDKLLQNKGEMINRYSSP"
     gene            complement(181065..181802)
                     /locus_tag="ANA_C10157"
     CDS             complement(181065..181802)
                     /locus_tag="ANA_C10157"
                     /EC_number="2.4.1.15"
                     /EC_number="2.4.1.36"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-superfamily hydrolase"
                     /protein_id="AFW92966.1"
                     /translation="MTDLDQTLVGDDLALEKLNQWLSKQRRIDGTVICYTTGRSLPLY
                     QQLIAQKELLEPDILVLATGTEIYYPGSETPDSEWKNKISLGWDREQVIEITSRFPCL
                     VPQSPLEQTDFKVSYYTNTKGLSVTLPRLKAIWQNHGLAVQMIDNFGGAFLDILPALA
                     NKAASALFLQQRLGFTNEQTLICGDSGNDLSMFENMLCPAIIVGNAQPKILDWHENSP
                     PGNRYLAKSHFANGILEGLKYFEFYRE"
     gene            182394..183041
                     /locus_tag="ANA_C10158"
     CDS             182394..183041
                     /locus_tag="ANA_C10158"
                     /EC_number="5.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoheptose isomerase"
                     /protein_id="AFW92967.1"
                     /translation="MNKVQQRLHPFSNDYFQQLSTLGEKFQVTDHQGKSFANSAGIDM
                     AAALVEKQNQQCRKVIFIGNGGSAAVASHQAIDYWRNGNIPAICFNDGALVTCISNDF
                     GYEQVFSKPISTFAQSGDVLFAISSSGQSQNILAGVYQALKMNCHVITLSAFQPNNPL
                     RQLGHLNFYVPTMSYGFAEIMHLCICHCIIDGLVEGALPSANVNNYLSLNELKVS"
     gene            183267..184817
                     /locus_tag="ANA_C10159"
     CDS             183267..184817
                     /locus_tag="ANA_C10159"
                     /EC_number="2.7.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-heptose synthase"
                     /protein_id="AFW92968.1"
                     /translation="MQLEIYREKIIDFETCAEVFTVYHQKGRKIVLCNGVFDLLHPGH
                     IAHLQAAKAMGDLLVISLTATPYINRGPGRPIFSDELRVNSIAALACVDYVILTPAVT
                     ALEVIEKVRPHIYCKGDEYAETEKDVTHNIDKEIAQVRAYGGDIRYTQEITFSSTRLI
                     NNYLDVIPPELKRYANDFSQQYAFEDIRNAIEAMQDLNVLVLGDIIIDEFVHCTVQGL
                     TSKGRAPSTRFVKKEQHLGGVFAIANHLSSFAKSVTLASTIGDEPDVHHLIANHVDGT
                     LHLNLHCVEKYSTVTKCRYIEQQGKTKGYTQLFAINSIDEEGLAPQEREKLLDAWEKL
                     LKNCDLVVLADYGHGLIDAEAIELIQSQAPFLALNCQTNSANYGYNLISKYKRADTFC
                     VDEQEIRLAFSNRYGNREELLKRLQYHLGAQQGWLTLGSAGSLGINTHGEMEITPAMT
                     QQVKDTTGAGDAFFALASLSAKLDLPVQLGSFLGNLAGAIAANVLGNEKPVDKGRLLK
                     FAKTISTF"
     gene            184840..185838
                     /locus_tag="ANA_C10160"
     CDS             184840..185838
                     /locus_tag="ANA_C10160"
                     /EC_number="3.13.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="AFW92969.1"
                     /translation="MNPIQQVLVTGGAGYVGAILVPKLLQAGYGVKVIDLYLYGKDVL
                     NAVKDHPHLEEIEGDIRDRQLLEKIMPGCDAVIHLACISNDPSFELDPDLGRSINYDA
                     FFDLVDVAKDAGVKRFIYASSSSVYGIKEIENVTEDLPLMPLTDYSRYKALCEEVLLS
                     KREPGFVTLVLRPATVCGYSPRQRLDLVVNILTNHAINNGKITVFGGQQKRPNIHIED
                     MTDLYLKSLQWSDEAIDGKIFNAGYENHTLMEIAEMTRQVVGESVEIMTTPTDDLRSY
                     HISSEKIKQELGFVPAHTIKEAIEDLASAFKANQIPNSLTDTRYYNVKVMKEINFR"
     gene            185960..186196
                     /locus_tag="ANA_C10161"
     CDS             185960..186196
                     /locus_tag="ANA_C10161"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92970.1"
                     /translation="MLAINVEPGVVAFYEGENTFDEVHRGLIEEGFWLLSLNLQNHSR
                     IKQSTRKALSDKFDQQQIPPIQFDQLPGSPIVVC"
     gene            186190..186621
                     /locus_tag="ANA_C10162"
     CDS             186190..186621
                     /locus_tag="ANA_C10162"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92971.1"
                     /translation="MLILNPLSHKTSCTKCVAYFYEKVPGTDAFGVNYGNTNNFPGNR
                     SKTHKINILAMNPILQQIQHHAAALPISSQAELLNYAVYLEQKAREKTPITSNQARRE
                     GLAQALTQAVALNPFAEIADPVVWQREQRQDRNLFGRDNAD"
     gene            complement(186835..187701)
                     /locus_tag="ANA_C10163"
     CDS             complement(186835..187701)
                     /locus_tag="ANA_C10163"
                     /EC_number="2.7.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative protein kinase"
                     /protein_id="AFW92972.1"
                     /translation="MKNSIAENLKNTLPTNIAQGLESALAYLPGGKTATIEKPQSEGL
                     FNHILLITTATDRCVFRARRDISTEAGDAYMQYMYEATGFIQNGGSFKLRNIGDEVDF
                     IKRALAVGLPVPKLIHADQDWMLIEYVTGKTLLEFLETGEVKFLPKVLQEMNLAHRQG
                     IIYADRWTGNEMIDTQGNVRMIDFDIEWFYQGGNDGTLEALEMAWTIFNAMRVTSKRD
                     ELLTIVETEVLPSLKAWGYEISKMKQFIEGLCKFYLDPNKPGNQWSLPKSLYVAMAKP
                     ANRLIAMFTEAD"
     gene            complement(187707..188126)
                     /locus_tag="ANA_C10164"
     CDS             complement(187707..188126)
                     /locus_tag="ANA_C10164"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="AFW92973.1"
                     /translation="MREAPGADIIILNSQQQVLLVLRDNKSSIPFPNTWAFLGGYIEK
                     NESAEAAIRRELVEEMELELGEIKFFKSYFWQECDEHIFWTRLDLDISQITLHEGQKL
                     AYFSREEINQLEFASHYDQILAEFFDFLAISLKLSIG"
     gene            complement(188487..189851)
                     /gene="matE"
                     /locus_tag="ANA_C10165"
     CDS             complement(188487..189851)
                     /gene="matE"
                     /locus_tag="ANA_C10165"
                     /codon_start=1
                     /transl_table=11
                     /product="MATE efflux family protein"
                     /protein_id="AFW92974.1"
                     /translation="MNLTRTEQYDFLPRFYRLAIANILSNLMIPLAGLISVAFLGHLQ
                     EIDALAGVCIANILFNLVYLILEFLRMGTTGLTAQAVGADDQEAALLVGLRNGLIALG
                     LGIVLLILQYPLREVGFSLLSADIDVKAAGIDYFNARIWGAPAVLLNFVLIGWLLGRE
                     ENSKVVVLSVIGNAANIILNYLFIIQWGWNSVGAGVSQASSQYLMLFIGILLASRKVQ
                     WQEIRAVSPQIMDFSELKTMLALNRDILIRTISEMSVFTIFSNLSAMMGTILFTQNSL
                     LGQITHLNVYLTNGMGFATETLSGNLKGKDSKEKLLPLLKVSVASSLLIGLTVATICV
                     FFPQAVFGILTNHTEITEHIDTYIWCLCFILIFNSVASMLEGYFLGLAEGKIVRNVSL
                     ISATLGFIPSAIAAWYFHNNYLLWLSIILFMFAKMVTMLVYLPKSLSSDTEVNAVSLT
                     TVEN"
     gene            complement(190580..190693)
                     /locus_tag="ANA_C10166"
                     /note="C terminal partial ORF;
                     transposase"
                     /pseudo
     gene            190898..192094
                     /gene="dxr"
                     /locus_tag="ANA_C10167"
     CDS             190898..192094
                     /gene="dxr"
                     /locus_tag="ANA_C10167"
                     /EC_number="1.1.1.267"
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
                     /protein_id="AFW92975.1"
                     /translation="MKAITLLGSTGSIGTQTLDIVSEHPDKFRIVGLSAGRNVELFAA
                     QIRQFRPQIAAISAAEKLPELKEAIKDLNPQPILLAGEAGVIEVARYGDSQTVVTGIV
                     GCAGLLPTIAAIEAGKDIALANKETIIAGAPVVLPLVKKHGVKLLPADSEHSAIFQCL
                     QGVPKDGLRKILLTASGGAFRDWPVEKLPEVKVADAIKHPNWSMGRKITVDSATLMNK
                     GLEVIEAHYLFGVDYDNIEIVIHPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSW
                     PERIYTNWERLNLVKSGDLTFREPDHHKYPCMGLAYAAGKAGGSMPAVLNAANEQAVA
                     LFLEEKIHYLDIARCIEFVCDRHQNDNTQNPSLDDILNADKWARQEVFTAMKKVATQP
                     QIISVG"
     gene            192271..192858
                     /gene="bioY"
                     /locus_tag="ANA_C10168"
     CDS             192271..192858
                     /gene="bioY"
                     /locus_tag="ANA_C10168"
                     /codon_start=1
                     /transl_table=11
                     /product="BioY protein"
                     /protein_id="AFW92976.1"
                     /translation="MFAASNQLLWSMIGLLLTMGGTFLEAYGITAPWNWSQHGIGTFS
                     LGVSYQIGAVLLVGCLGGQNAGALSQIAYLVMGLTLLPVFAEGGGIGYVKLSQFGYLL
                     GFIPGAWICGYLAFKARPRLETLAFSCFCGLFTVHICGIAYLIISYILPWKGTENLSL
                     IQAILKYSCFALPGQLVVVCAVTIVAYLLRHIMFY"
     gene            192956..193417
                     /gene="lspA"
                     /locus_tag="ANA_C10169"
     CDS             192956..193417
                     /gene="lspA"
                     /locus_tag="ANA_C10169"
                     /EC_number="3.4.23.36"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein signal peptidase"
                     /protein_id="AFW92977.1"
                     /translation="MRIKNRFFWIAALIAFLLDQLTKYWVVQTFNPGQTLPLLRGIFH
                     FTYVTNTGAAFSLLSGKVEWLRWLSLGVSLVLMTIALSGPLLSFWEQLGYGLILGGAM
                     GNGIDRFALGYVVDFLDFRLINFAVFNLADSFISIGIVCLLIASWQQTPSN"
     gene            193426..195693
                     /locus_tag="ANA_C10170"
     CDS             193426..195693
                     /locus_tag="ANA_C10170"
                     /EC_number="2.4.1.129"
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein"
                     /protein_id="AFW92978.1"
                     /translation="MSSPQPPQKPTTLLGQVTQAVSTIQARVSSSIKLKPNAKVPKLL
                     VHDAGANTREEHNLLGDRHILGRSSKSCDFVVRNQVVSAIHLSLSRDSTQNTPAFTIK
                     DENSTNGIYLGKRRINALELRHGDVITLGPPELAASVSVQYIDPPDWYVKAATWTAYG
                     IGGVTVLIALSIGVEWMKFSVRPLPTATKAPVVVYARDGSTPLREPRNIAHTDLKKIS
                     DFGPYLASAVVASEDSRYYWHFGVDPLGVLRAVLINSRSGDVQQGASTVTQQVARSLF
                     REYVGSQDSLGRKVKEAVVSLKLETFYSKDDILLTYLNRVFLGADTSGFEDAAKYYFN
                     KSAKELTLAEAATLVGILPAPNAFDFCGSGPRKLGAADYRNRVIKRLLEMGKITQEEA
                     NRARRSTVQISPKVCERQAKTIAPYFYDYVFQELTLRLGPAAAREGNYIIETQLDPAI
                     QAKAETELKNSITKDGSNFGFSQGGMVTLNAKTGGIVAMVGGTDYRKSQFNRSVQAQR
                     QPGSTFKIFAYTAAMEKGISPYRSYSCSPLTWQGFTYRPCRSGAGGSLDIATGLALSE
                     NPIALRVAKEIGLNKVVDMAQRLGVKSDLEAVPGLILGQSVVNVLEMTGAFGAISNRG
                     VWNPPHAISKIRDSSDCKDLKDLQTCRVIYSFDTDPNGNKRVIKKEVANQMTTLMRGV
                     ITNGTGRSAAIGLGEAGKTGTTNNNVDLWFIGFIPSRQLVTGIWLGNDNNSPTSGSSA
                     QAAQLWGNYMGKITK"
     gene            complement(195883..197286)
                     /locus_tag="ANA_C10171"
     CDS             complement(195883..197286)
                     /locus_tag="ANA_C10171"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92979.1"
                     /translation="MNIQRKYSLPNCTLLLEGLSDMTQTANFQELRPQLSILVNAECY
                     ISSYTQPIVGGREFFESLVRAVSAYAQEVLSNIPNPQVQNHNSELVELQKINSNSHRL
                     TVHTEITGDMGGNTSEGQPIQIVLNTVQLFDLVEAVDQFFADSQTLPELSLELHPVNR
                     SYSGSNQTLLKQAIPATMGVSSLAVAALAFSLIPAPQVSPPQVNPEVESSTSIPTPTV
                     AVTPTTTPTTTPTTSATPTAVQDLETLLKTVPEIKDPSQLRALNRQVYNQIHPAWVNR
                     SELPEDLVYRLGVAADGSIVGYKAVNQKASDAIDKTPLPKLLHNPANRVPNEPIAQFK
                     VVFTQKRFLEISPWLGYAKTPEVTGKKITDTSKITDLNQKLYSTIRQNWSVTPTFASN
                     LKYRVAVNKEGVIADYEPLNQVAFDYFRETPLPQMFQSVYGSNVAAPDNKEALAHFRV
                     VFTPKGELEVKPWKGYK"
     gene            complement(197413..198687)
                     /locus_tag="ANA_C10172"
     CDS             complement(197413..198687)
                     /locus_tag="ANA_C10172"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="AFW92980.1"
                     /translation="MSNYALVLDTNKQPLSPCHPSVARKLLDSGKAALFRMYPFTIIL
                     NKSCSDIVNQAIELKIDPGSKTTGIALVQGEKIIFGAELSHRGSAIKASLESRRSLRR
                     GRRNRHTRYRQARFLNRTRTENWLAPSLQHRVETTLTWVNKLIKFIPITRISQELVRF
                     DLQQIDNPEISGIEYQQGTLSGYEVREYLLEKWQRKCAYCGIENVPLQVEHIHPQARG
                     GTNRISNLCLACEKCNIKKGTQDIKDFLAKKPDLLKCILAQAKRPLKDAAAVNSTRWA
                     LFSRLQETGLPVFTGSGGQTKFNRTRLNFPKTHWLDAACVGQIGELEILTNKPLLIKA
                     TGHGTRQMCRTDKFGFPSRYVPRIKFVKGFQTGDIVKAIVTTGKKIGKYIGRVAVRAT
                     GSFNISASKLVQGISYKYCKIIHRKDGYDYAF"
     gene            complement(199022..199648)
                     /locus_tag="ANA_C10173"
     CDS             complement(199022..199648)
                     /locus_tag="ANA_C10173"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92981.1"
                     /translation="MNVSASVTSLNIPKAQGMPMILDTLPDPAIAGQVCPARTRLQID
                     LMLLAIEALEIGGSEAILSFAEELDLQGIIKNRVNLWRMRASNPMRRAHSRRPLDILE
                     AKALVVIACYISRRLTVVIRQLLTIYQQLAEKQIPPEQNLRLANYLERFRAHFKSRMN
                     SRRSGVLALTSNEKLDELAIDLLGKLLFCTGTAGMQRYWISLFDGEVE"
     gene            complement(199754..199873)
                     /locus_tag="ANA_C10174"
     CDS             complement(199754..199873)
                     /locus_tag="ANA_C10174"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92982.1"
                     /translation="MKKQRARSENFPNLCQILPYNVIDDHQEFENLMYMQIFG"
     gene            199901..200419
                     /gene="apt"
                     /locus_tag="ANA_C10175"
     CDS             199901..200419
                     /gene="apt"
                     /locus_tag="ANA_C10175"
                     /EC_number="2.4.2.7"
                     /codon_start=1
                     /transl_table=11
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="AFW92983.1"
                     /translation="MDLKSLIRDIPDFPKPGILFRDVTTLLSDPDGLRYTIDFLAQKC
                     SEIELQVDYIIGMESRGFIFGAPVAYKLGAGFIPVRKKGKLPAAVHSIEYQLEYGTDT
                     LEVHQDALVPGSKVLIVDDLIATGGTASATAKLVQKIDCELIGFGFIIELMDLQGRKH
                     LPDVPIISLVQY"
     gene            200457..201503
                     /locus_tag="ANA_C10176"
     CDS             200457..201503
                     /locus_tag="ANA_C10176"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein dependent transporter
                     transmemrane protein"
                     /protein_id="AFW92984.1"
                     /translation="MTNTKISLDISRDWLIRRVTDETFIYVIKRLLQALLTIFLASAL
                     SFFIMKLSPGDYVDTLRQNPKISPERIEEIRRQFGLDKSWPQQFGFWLKQILTRGDFG
                     TSFVYQRSVSSLLWERVPATLLLAIASLIITWAIAIPLGILAAVKQNRRTDQVLQIVS
                     YAGQGIPSFITVLFLLFFAQLTTPLFPVGNMTSINHADLTWLGKILDIAWHSVLPLIA
                     LSITSFAGLQRIMRGQLLDVLRQDYIQTARAKGLPENRVIYVHALRNAINPLITLLGF
                     ELAGLLGGAFITENFFNWPGLGKLTLQAVLAKDQYLVMASLVMSAVLLIIGNLIADLI
                     LKAADPRIKLEDLN"
     gene            201578..201850
                     /locus_tag="ANA_C10177"
     CDS             201578..201850
                     /locus_tag="ANA_C10177"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92985.1"
                     /translation="MVYYIIRSRTDGKYLTARVDDATSGYLLLFKEDFEALSYLNTHA
                     ADLASRLTVESLASSQIGSLIKRWSFAGVGIVNDPLLPEVEFLQHI"
     gene            complement(202102..203694)
                     /locus_tag="ANA_C10178"
     CDS             complement(202102..203694)
                     /locus_tag="ANA_C10178"
                     /EC_number="3.4.21.-"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S8/S53-domain containing protein"
                     /protein_id="AFW92986.1"
                     /translation="MHKNWILFWSLGFSGLTLPVFAGVKVGNFLGANGINALKLHQAP
                     YNLTGRKIAIGQVEIGRPGMFGWDKAVSKNRAVSPFAVFSRNVPAKSNVGVDPHAYNV
                     SGVMVSQDKAFPGVAPNARLYSSAVGSTKKIGQPEECLSAQHIALQNGGDVRAINFSF
                     GEPLERDPRPEAMLDGNALLTLCIDWSSRVHDVVYSIAGNQGKGGIPIPTDNFNAINV
                     AFSSEREGIFNKVHVSNLASINQGIENRLAGKEFNIGGRSAINIVAPGTNIPLINPDG
                     KLNKSTGTSFAAPQVTATVALLQEFVDRQLRTKQQNWTIDARRHQVMKAILLNSADKI
                     KDSGDGLRLGMTRTLIDKQNQDWLATDAYKNPKIPLDAQMGAGHLNAFRAYQQLNGGE
                     WKPNATVPPIGWDYGIVNANSSREYALQKGLKQNSFVAITLIWDRLVELNDKNNNQEY
                     DIGETFIDKGLNNLDVYLVKENGKNNEVVVCDSVSEVDSVEHIFCPVPTSGNYKIRVQ
                     FKKQVNESTQPYALAWWTVSEK"
     gene            203812..204519
                     /gene="rpe"
                     /locus_tag="ANA_C10179"
     CDS             203812..204519
                     /gene="rpe"
                     /locus_tag="ANA_C10179"
                     /EC_number="5.1.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="AFW92987.1"
                     /translation="MTQNSSQKPIVIAPSILSADFSRLGDDIRAVDKAGADWIHVDVM
                     DGRFVPNITIGPLIVEAIRPVTTKPLDVHLMIVEPEKYVEGFAKAGADIISVHAEHNA
                     SPHLHRTLGQIRELGKKAGVVLNPGTPLELIEYVLELCDLVLIMSVNPGFGGQSFIPS
                     VVPKIRKLRQMCDERGLDPWIEVDGGLKANNTWQVLEAGANAIVAGSAVFNAPDYAEA
                     ITNIRNSKRPSPELAAV"
     gene            complement(205261..205440)
                     /locus_tag="ANA_C10180"
     CDS             complement(205261..205440)
                     /locus_tag="ANA_C10180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92988.1"
                     /translation="MLPQSYQTIFRKHLSEQQYLTLEILLLLIQILKNQGFNPHSAPL
                     TVTNGDYGGKLMKKE"
     gene            complement(205527..205655)
                     /locus_tag="ANA_C10181"
     CDS             complement(205527..205655)
                     /locus_tag="ANA_C10181"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92989.1"
                     /translation="MESDRITVMAQQLNKMGAKIITGVETMPKSISYHTELINLNG"
     gene            complement(205676..206188)
                     /locus_tag="ANA_C10182"
     CDS             complement(205676..206188)
                     /locus_tag="ANA_C10182"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92990.1"
                     /translation="MSQEQCPEMECLDEELYPIKSLELSGLDNPEILKNTGLKNKDSW
                     LKLIKLYEGNLIYLKSISILINKNYDDQVADFLAENTLHITNQMQSHFQETFHHLSPQ
                     EQEIVLELSKFENPISREELRQSLNLSSVDFNNGLQSLQQRYLITKIKEDRILFKLSP
                     VFHEYVRTCC"
     gene            complement(206522..206806)
                     /locus_tag="ANA_C10183"
     CDS             complement(206522..206806)
                     /locus_tag="ANA_C10183"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92991.1"
                     /translation="METITLNSHVGQDGILHLDIPVNIINTDLTITIILKPSDNFQQD
                     NKQKGKGWPANFFEETSGCLKDTPLTIDSECWVSFPQPNLQRQGFIVDSF"
     gene            207085..207306
                     /locus_tag="ANA_C10184"
     CDS             207085..207306
                     /locus_tag="ANA_C10184"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92992.1"
                     /translation="MQQLIIQIADKEKAQMLLKLISALDFVNSVEVIEDNTNISDDEQ
                     DFFSLAGIWENRNITTESIRQEAWRQETK"
     gene            complement(207414..207647)
                     /locus_tag="ANA_C10185"
     CDS             complement(207414..207647)
                     /locus_tag="ANA_C10185"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92993.1"
                     /translation="MESCHICGSDKFTEELVNETFEIEGKLILVEGIPAKVCSRCGEI
                     TFSSETAENIRLMLNSNQKSQRKIEIDVFAFSA"
     gene            complement(207647..207958)
                     /locus_tag="ANA_C10186"
     CDS             complement(207647..207958)
                     /locus_tag="ANA_C10186"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92994.1"
                     /translation="MKSIDEIREQLKSGNFEFTRHGLKRLVERNISRAEIMETGDNAI
                     IIEDYPDDKYSPSCLILGLTINNRPLHLQVSRRESDILTIITLYEPDQTEWIDYSQRR
                     L"
     gene            complement(207998..208360)
                     /locus_tag="ANA_C10187"
     CDS             complement(207998..208360)
                     /locus_tag="ANA_C10187"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92995.1"
                     /translation="MTTVAILPISNASGERSYRAIAGDKQSVGKTAGQALDALTTQLG
                     EVEFRALLIIDNFHPDQFFTRDQQERLSELMTIWRIARDQEQKLPSEIQIELDNLVNL
                     ELNAATARTASLAQQWSQ"
     gene            complement(208428..209777)
                     /gene="aroA"
                     /locus_tag="ANA_C10188"
     CDS             complement(208428..209777)
                     /gene="aroA"
                     /locus_tag="ANA_C10188"
                     /EC_number="2.5.1.19"
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="AFW92996.1"
                     /translation="MSAIVINLETQANSSDHLIIQRPASGLSLQGRIRIPGDKSISHR
                     ALMLGAIAEGETQIQGLLLGEDPRSTAACFRALGAEISDLNTELVKVKGIGLGNFQEP
                     INVLDAGNSGTTMRLMLGLLASHPGRFFTVTGDSSLRSRPMSRVVKPLQQMGAQIWGR
                     KGNTLAPLAIQGQALKPIHYHSPIASAQVKSCILLAGLNTQGQTTVTEPALSRDHSER
                     MLRAYGAELSIDPDRNSVTITGGAKLYGQTVIVPGDISSAAFWLVAGAIVPGSDLVVE
                     NVGVNPTRTGILEALELMGADIQLENQREVAGEPVADIRVRSGGLKSCTIAGDIIPRL
                     IDEIPILAVAAAFAEGTTIIRDAEELRVKESDRITVMAQQLNKMGAKITELPDGMEIT
                     GGTPLVGAAVDSHTDHRIAMSLAIAALNATGTTTIHRAEAAAISYPNFTSTLREICQ"
     gene            210117..210629
                     /locus_tag="ANA_C10189"
     CDS             210117..210629
                     /locus_tag="ANA_C10189"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW92997.1"
                     /translation="MLTHHRKPVCLSMISTDLPIWSVVDTAGTLIQKNTDKFHLLLTA
                     PPLISCEVGSYLNPEDTIYPTKNNFSPPSSPRILWLEISSRRLIMTMQGNAQVSYRHF
                     WELGVYGISRFWLPNESLQPHQPIRLRNFTKSFTLSGHPFPENLRLEYELWTGKIQLG
                     CYILNLEIQH"
     gene            complement(210773..211348)
                     /locus_tag="ANA_C10190"
     CDS             complement(210773..211348)
                     /locus_tag="ANA_C10190"
                     /EC_number="1.11.1.-"
                     /EC_number="1.11.1.15"
                     /EC_number="1.11.1.7"
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase/thiol specific
                     antioxidant family protein"
                     /protein_id="AFW92998.1"
                     /translation="MVLTASTMLPLGTKAPDFHLPEVVSGKIISLDNFADKKALLIMF
                     ICRHCPFVKHIQQELARLDQDYNNSDLGIIAISANDAKNYPNDAPESLKDMAIELGFD
                     FTFCYDETQETAKAYTAACTPDFFLFDSDRKLVYRGQLDDSRPSNNQPVTGKDLRAAI
                     TAVLNNQPVISEQKPSIGCNIKWKSGNDPSY"
     gene            211592..213205
                     /locus_tag="ANA_C10191"
     CDS             211592..213205
                     /locus_tag="ANA_C10191"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding family 5 protein"
                     /protein_id="AFW92999.1"
                     /translation="MTKLLSLFCLCLLLVVSCTPKQQTNAPQPNAINAPAGDGRITVG
                     TTEKPRTLDPADAYELGSLSLVFNMSDRLYTYEPGSTEIKPQLATALPKVSADGLTYT
                     IPIRQGVVFHDDTPFNAKAMEFSLQRFIENKGKPSFLLSDTVASIKATGEYELTIKLK
                     KPFAAFPSLLAFSGVCAVSPKSYEIGAGKFKPNIFVGTGAYKLAKYGTDSLKFDVFDK
                     YWGTKPENKGVNVQIQTSPVNLFNAFKTGAIDVAYLSLQPDQIQSLEASAKKGDWQAI
                     SAQGSVVTYLTLNRNQKPLDQVEVRQAIASLIDRKLLNDRVLLSQADPLYSMIPTTFN
                     VSQPLFQDKYGDGKFAEAKKSLVAAGFSQENPAKVQIWYPASSMTRSLVAQTLKSLAD
                     TKMDGILQFEVKTVEGATFYKEISKGLYPSTLTNWYPDFLDPDNYVQPFLACEQGSVA
                     KGCETGGSQTQGSFYYSEAMNKLIDQQRKEQNPEARKKIFADIQTQVLTDVPYIPLWQ
                     SKDFVFAQKGVANVNLDPTQNLIYKTIKK"
     gene            213414..214439
                     /locus_tag="ANA_C10192"
     CDS             213414..214439
                     /locus_tag="ANA_C10192"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system
                     permease"
                     /protein_id="AFW93000.1"
                     /translation="MSRSKALQYYIFSRLLFAPLQLFTIITIVFLLLRATPGDPADAI
                     LGGRAPESAKEELRKQLGLDLPIWLQYLNYLGKLLQFDLGTSLTSRGQNVGEIIGQYF
                     PATVELAFASMAVALIVGVLVGTISASRPGTAFDIGGRLFGIITYALPMFWAGMLLQL
                     VFSVQLGWFPNSNRFPPNLPAPTNITGLYTIDSLLSGNLSQFFTALHHLALPSLTLGI
                     LLSGIFERIVRVNLKQTLKADYVEAARARGISENKILVSHALKNALIPVITVLGLTFA
                     SLLGGAILTEVTFSWPGLANRLYQAISDRDYPTVQGVLVFFGAIVVSASILIDILNAY
                     VDPRIRY"
     gene            complement(214536..215651)
                     /locus_tag="ANA_C10193"
     CDS             complement(214536..215651)
                     /locus_tag="ANA_C10193"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system
                     protein"
                     /protein_id="AFW93001.1"
                     /translation="MNWWQRLNKNPLARTGAIVLFSLYLAVIGADFIAPYNPYDSQTN
                     GSLLPPTQIHWVSQSGQFIGPHVYPTTQGDTNLETGERKIIIDQTKPSPLRLFVTGTK
                     YQLFNLSISLPPKWQEVTIIPGISLNWHLFGVIGDAKLNILGTDEQGRDQFSRLLHGG
                     RISMFIGIFGIIITYPLALLIGGISGYFGGIIDSIIMRLAEVLMTFPSIYLLVALSSI
                     LSPKLTSTQRFLLIILITSVISWAGLARIIRGQVLSIKELEFVQAAKVMGGNPIYIIV
                     RHVLPQTATYIIISATLTIPSFIGAEAVLSLIGLGIQQPDPSWGNMLSLASNASILVL
                     QPWLILPPAILIIITVLSFNVLGDGLRDALDPRSVQR"
     gene            215737..216903
                     /locus_tag="ANA_C10194"
     CDS             215737..216903
                     /locus_tag="ANA_C10194"
                     /EC_number="2.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase class V protein"
                     /protein_id="AFW93002.1"
                     /translation="MNNLHHHRSQFPALSNKLYFNYGGQGPMPQGAMDAISQSQAHIQ
                     SIGPFGSDAYAWIAPQIQASREAIASTLNVPSNTITLTGNVTIGCNIAMWGIDWHAGD
                     HLLLSDCEHPGVIATAQEIARRFGVEVTTCPLMATLNEGDPISIIAENLRPKTRLVVL
                     SHVLWNTGQVLPIDKIVEVCRSNNSLLLIDAAQSVGVIPLDLTALGVDFYAFTGHKWL
                     CGPAGVGGLYVRPETRESLHPTFIGLSGIITNNQAQPTGWQPDGRRYEVSTLPTSLYV
                     GLKQAITIHEQWGTAQERYEQICQNSNYLWQKLNSLPNVKCLKNSPPESGLVSFQVTN
                     QPSFKLVQSLESENILTRTIANPNCIRVSVHYLTLESEIDQLIAAISSRLGCET"
     gene            217044..218117
                     /locus_tag="ANA_C10195"
     CDS             217044..218117
                     /locus_tag="ANA_C10195"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93003.1"
                     /translation="MERPIIYIAITNHGFGHATRTASIANTIQKLCPEALLILVTTAP
                     RWLLESYIEGDFILRPRAFDLGVVQVDSLTMDKSATLEKLREIKKNHKSLIASEVNFI
                     RQNRVNLILADIPFLAAGFAEATNIPCWMISNFGWDFIYRDWGGEFTEMADWISDWYG
                     KCDLLFRLPFHEPMSAFTNITDVGLTGGSPHFSIDKLRTNWGINTPPEKTILLTFGGL
                     GLQAIPYTNINKFSDWQFITFDASAPDLPNLIKVTNRQYRPVDFMPICGRIISKPGYG
                     TFSEATLLDVPVVTIPRDDFAEAAFMLAGITNYNHHQILTVPEFFQGDWDFLYQSPQP
                     PKQTKIIDKNGNETIAKAVIDYL"
     gene            218204..218617
                     /locus_tag="ANA_C10196"
     CDS             218204..218617
                     /locus_tag="ANA_C10196"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93004.1"
                     /translation="MIHYQKLLRVSTHGKSFHNITAKIEAIVAESGIETGLCSLFLRH
                     TSASLVIQENADPDVLVDLANFMAKIVPEGNHYIHDAEGPDDMPGHIRTVLTHTSEQI
                     PINRGHLVLGTWQGIYVWEHRQQNNVRELVVHISG"
     gene            complement(218665..219357)
                     /locus_tag="ANA_C10197"
     CDS             complement(218665..219357)
                     /locus_tag="ANA_C10197"
                     /EC_number="3.1.1.61"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator protein"
                     /protein_id="AFW93005.1"
                     /translation="MKILLVDDEVELTDPLSRLLTREGYSVDATYDGTSGSNLAEIGS
                     YDLLILDWMLPGKTGLDICQELRRQGKTTPVLFLTAKDTLDDRVQGLDAGADDYLVKP
                     FELRELLARVRALLRRTGTESYSSTTGKLVVADLELDIENQIAYRHGRIIELSQKESQ
                     LLQYFMENAGKLLTHGQILQHLWQNEEQPNSNVIAALIRLLRRKVEGVGKTPMIHTVY
                     GKGYRFGSTGIE"
     gene            219433..220077
                     /gene="hisG"
                     /locus_tag="ANA_C10198"
     CDS             219433..220077
                     /gene="hisG"
                     /locus_tag="ANA_C10198"
                     /EC_number="2.4.2.17"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="AFW93006.1"
                     /translation="MLTVAIPKGGLLEPSLRILQSVGLDFSAFLESGNRQLQITDASG
                     QAKALLVRAQDVPVYVEYGQAQLGIVGYDVLREKQPQVAQLVDLKFGYCRMSVAVKAA
                     SSYKSPLDLPAHGRVASKYVNCAREYFQGLDLPIEIVPLYGSVELGPITGMSEAIVDI
                     VSTGKTLKENGLIEIATLYESTARLIVHPLSYRLNTGNLDKLIAQMRSEMLTTA"
     gene            complement(220125..221492)
                     /locus_tag="ANA_C10199"
     CDS             complement(220125..221492)
                     /locus_tag="ANA_C10199"
                     /codon_start=1
                     /transl_table=11
                     /product="ResB family protein"
                     /protein_id="AFW93007.1"
                     /translation="MTSDQTTSTELSWWLIPGRFIRREVLPVLTDLRLAIILLLIIAL
                     FSVSGTVIEQGQLPDFYQSNYPEHPALFGFLSWKVIQVVGLDHVYRTWWFLSLLVLFG
                     TSLTACTFTRQLPALKAAQKWKYYEEPRNFTKLALSAELEGVSLPSITPILQQKSYRI
                     FQEKDDILYARKGIIGKFGPIIVHIGIVAILLGGIWGAMTGFMAQEMISSGDTFQVKN
                     IVDAGAWSSQDVLKDWSVRVNRFWIDYTPTGGIDQFYSDMSVLNNEGKEVNHEKIYVN
                     KPLRYHGVVFYQTDWGISSVRVRLNKSPIFQLPMAQLDTKGKGRLWGTWIPTKPDLSE
                     GVSLLAKDLQGMVLIYDAQGKLINTVRAGMSIPVNGVNLQIFDVMGSTGLQIKFDPGI
                     PIVYTGFALLMLGVVMSYFSHSQIWALQTGETLYIGGKTNRAQVAFEQEVLEILDQLS
                     AVKKP"
     gene            complement(221496..222236)
                     /locus_tag="ANA_C10200"
     CDS             complement(221496..222236)
                     /locus_tag="ANA_C10200"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein"
                     /protein_id="AFW93008.1"
                     /translation="MLETLETQIYQLEQFANTLVANQLTHLSFVSIAIIFAAGLLTSL
                     TPCMLSMLPITIGYIGGYEAKTRLQAAAQSTWFALGLATTLAGMGIVAGLVGKVYGQI
                     GIGLPIIVSIIAIIMGLNLLEALPIQFPSLNETNWISQDLPPGVRSYSIGLTFGLVAS
                     PCSTPVLASLLGWVANTQDLVLGAVLLLAYTAGYVTPLILAGTFTAAIKKLLELRRWS
                     GWINPISGVLLVGFGVFSLLSRIPIGSF"
     gene            222476..222883
                     /locus_tag="ANA_C10201"
     CDS             222476..222883
                     /locus_tag="ANA_C10201"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="AFW93009.1"
                     /translation="MTRKINKVFQQSGVIPYRINDGKVEVLLITTRSRQGWVIPKGGL
                     CKGMSPHDSAAKEAWEEAGVVGRVTTEELGNYKYRKRGNTYQVNLFLLPVETVLEDWP
                     EATARERKWLEVNQAAELVKETSLKRIIQTSWI"
     gene            complement(222940..223434)
                     /locus_tag="ANA_C10202"
     CDS             complement(222940..223434)
                     /locus_tag="ANA_C10202"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93010.1"
                     /translation="MSTLSKIQELPSQLITPENFQPYGQVIYASKDGKNFDQEDAQLN
                     LQNGIPHFYIMRLQKNGRKFHQITRHVKCTQCLGSLDSKDWLMAVCPANNDTNAPGLS
                     ELAAFRIPGNCFIKLDMGTWHAGPYFDHDFVDFYNLELSDTNVVDHFTHNFLKSHNLA
                     FEMI"
     gene            complement(224226..224486)
                     /gene="psaKI"
                     /locus_tag="ANA_C10203"
     CDS             complement(224226..224486)
                     /gene="psaKI"
                     /locus_tag="ANA_C10203"
                     /codon_start=1
                     /transl_table=11
                     /product="photosystem I reaction center protein"
                     /protein_id="AFW93011.1"
                     /translation="MLTSSLLATATASLEWSPNISIIMIVANIFAIAVGKFTIEHPHA
                     KPELPAPQFFGGFGLPAVLATTSFGHILGAGIILGLHSIGKI"
     gene            224714..225142
                     /locus_tag="ANA_C10204"
     CDS             224714..225142
                     /locus_tag="ANA_C10204"
                     /codon_start=1
                     /transl_table=11
                     /product="SufE family protein"
                     /protein_id="AFW93012.1"
                     /translation="MSSTLDSLPPALNKIVHRFQRATEPKRRYEQLIWYAQKLQEFPE
                     SGKLPENKVPGCVSQVYVTASLEDGKVIFQGDSDSQLTKGLLALLIEGLNGSTPTEII
                     QLTPDFIQETGLNVSLTPSRANGFYNIFKTMQKKALESKL"
     gene            complement(225318..225638)
                     /locus_tag="ANA_C10205"
     CDS             complement(225318..225638)
                     /locus_tag="ANA_C10205"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93013.1"
                     /translation="MLHLLYILAFTVLAFMAVGNLIRNLIMFSFDRERTYSNNQSSPG
                     GFGYYAARRQYVPHPELLDSAGNMIKEPLLVMRSINVEDAREQLDALYESSPSQKIDR
                     SEGA"
     gene            complement(225885..226199)
                     /locus_tag="ANA_C10206"
     CDS             complement(225885..226199)
                     /locus_tag="ANA_C10206"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93014.1"
                     /translation="MGDSNLPNADLLKSVLEPLLEDFQDWFERYRQILENEKIQFMSE
                     QEQFDLLKRVKNAQNELKTARMLFKATDQQVGLDMATVMPWHQLVTECWSVGMRLGQS
                     KE"
     gene            226749..228569
                     /gene="thrS"
                     /locus_tag="ANA_C10207"
     CDS             226749..228569
                     /gene="thrS"
                     /locus_tag="ANA_C10207"
                     /EC_number="6.1.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="threonyl-tRNA synthetase"
                     /protein_id="AFW93015.1"
                     /translation="MSPNQETQPVEKIYLPRTSESETLKKIRHTASHIMAMAVQKLFP
                     KVQVTIGPWIENGFYYDFDSPEPFSDKDLKTIQKEMVKIINRKLPLIREEVSREEAQS
                     RIEAINEPYKLEILGDIKQEPITIYHLGEQWWDLCAGPHLENTSEINPKAIELESVAG
                     AYWRGDENKAQLQRIYATAWETPEQLAEYKRRKEEALRRDHRKLGKELGLFIFSDLVG
                     PGLPLWTPKGTLLRTILEDFLKKEQLKRGYLPVVTPHIARVDLFKTSGHWQKYKEDMF
                     PLMAEDEEARAIEQGFVLKPMNCPFHIQIYKSELRSYRELPMRLAEFGTVYRYEQSGE
                     LGGLTRVRGFTVDDSHLFVTPEQLDSEFLNVVDLILSVFKSLQLKNFKARLSFRDPAS
                     DKYIGSDEAWDKAEGAIRRAVQQLGMEHFEGIGEAAFYGPKLDFIFSDALEREWQLGT
                     VQVDYNLPERFDLEYVAEDGSRQRPVMLHRAPFGSLERLIGILIEEYAGDFPLWLAPV
                     QIRLLPVGDLQLDFTKEVAAKMVALGIRAEVDTSGDRLSKLIRNAEKDKIPVMAVVGA
                     KEVETNSLSIRTRASGELGVIILDEVVDKITEAITNFSNF"
     gene            228808..229026
                     /locus_tag="ANA_C10208"
     CDS             228808..229026
                     /locus_tag="ANA_C10208"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93016.1"
                     /translation="MLNLEYLTNEEGNKIAVVIPIDIWRKLLPTEDTSLDELTEAIED
                     YCLNKAMDESMNTPLLDRNQALAYLEEE"
     gene            229029..229298
                     /locus_tag="ANA_C10209"
     CDS             229029..229298
                     /locus_tag="ANA_C10209"
                     /codon_start=1
                     /transl_table=11
                     /product="RelE/StbE family protein"
                     /protein_id="AFW93017.1"
                     /translation="MKVQYRQTFLKDLKQLKSSESYQRIYELAFTTLENINSLDEILD
                     IKAMKGYPNRYRIRIGNYRLGIEVNGDLIEVMRVLHRREFYRYFP"
     gene            complement(229538..231130)
                     /locus_tag="ANA_C10210"
     CDS             complement(229538..231130)
                     /locus_tag="ANA_C10210"
                     /codon_start=1
                     /transl_table=11
                     /product="NACHT domain-containing protein"
                     /protein_id="AFW93018.1"
                     /translation="MNGRSLSCSPKGIQKAKKALIRFSLTQKALAEELGVTRQPVGKF
                     FTGKPVDRNIFVKICDYLELDWEEVVTQVNEPETEAKQENSIDIDNLVQEVRAKIKPL
                     IQERCGTMRVLDMTQPIGLNEIYTSVNILENITGMQRLTIEELEKLSQQYTQEDFDRF
                     GLEAIKIERVPGLQVVQKYSKLMILGKPGAGKTTFLKYLAIQCIAGEFLAHLVPRFIT
                     LKDFAEDNYQNSLVNFIIFDTCNQFFTSQNEAETLLQQGRLLILLDGLDEVREEDSKR
                     ILKEIQHFAQRFPQNRFVMTCRIAAREYTFEKFTEVEVAEFNDKQINNFATNWFKNKP
                     VKPDKFIQRLRENYPIKQLASNPLLLTLLCLVFEEAGDFPANRSELYKEGLDALLKKW
                     DTKRGIKRDEVYKKLSVQRKEDLLSKIALTTFDQSNYFFKQKLAEYYITDYISNLPDA
                     STNTEKLQLDSEKIIKSIEAQHGLLVERAKGIYSFSHLTFHEYFTAREFVLVQQSSDN
                     ALQSLASHFTEKRWREVCLLAK"
     mobile_element  231698..233157
                     /note="truncated and disrupted"
                     /mobile_element_type="insertion sequence:ISAsp5"
     gene            231698..233155
                     /locus_tag="ANA_C10211"
                     /note="IS1634 family transposase;
                     frameshift"
                     /pseudo
     gene            complement(233553..234182)
                     /locus_tag="ANA_C10212"
     CDS             complement(233553..234182)
                     /locus_tag="ANA_C10212"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="3'-5' exonuclease"
                     /protein_id="AFW93019.1"
                     /translation="MTLPDFQVGDGDLNDATLSEYLKSPAIAVDTETMGLLPQRDRLC
                     LIQLCNPEGQVTAIRISRGQTVAPNLQILMEATHIVKVFHFARFDVATLRQNLDIVVQ
                     PIFCTKIASKLARTYTNRHGLKDVVLELEKVELDKSSQCSDWGNASNLSDAQLSYAAN
                     DVRYLLSVREKLTAMLQREERWQVAQECFQVLSTIVSLDLLQFKDLFEH"
     gene            complement(234566..235129)
                     /locus_tag="ANA_C10213"
     CDS             complement(234566..235129)
                     /locus_tag="ANA_C10213"
                     /codon_start=1
                     /transl_table=11
                     /product="SCP domain-containing protein"
                     /protein_id="AFW93020.1"
                     /translation="MLRQTAFGIALSTLVLASGYMTAANPDNSSAKQTGRYQHSSLVT
                     SQAKISNLTVQTTNLELAVFTQINQYRAKRGLKKLNLNGKISQQARIHSQNMASGKVP
                     FSHQGFEQRVMTIPLKYSSAAENVAYNTGYSNPANEAVSGWLKSPGHLKNLQGKYNLT
                     GVGVAANEQGEVYLTQIFLNTNTSGQN"
     gene            complement(235486..236619)
                     /gene="trpB"
                     /locus_tag="ANA_C10214"
     CDS             complement(235486..236619)
                     /gene="trpB"
                     /locus_tag="ANA_C10214"
                     /EC_number="4.2.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit beta protein"
                     /protein_id="AFW93021.1"
                     /translation="MPALAELEAAYQQYRNEPGFQAELQGLLKDYVGRATPLYFAERL
                     TANYARPDGTGAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKRIIAETGAGQHGV
                     ATATVCARFGLECIIYMGVHDMERQSLNVFRMRLMGAEVRPVSAGTGTLKDATSEAIR
                     DWVTNVETTHYILGSVAGPHPYPMMVRDFHAVIGEETRVQALEKWGRLPDILVACVGG
                     GSNAMGLFHEFVKEPSVRLIGVEAAGEGVNTGKHAATLTKGQVGVLHGSMSYLLQDDD
                     GQVIEPHSISAGLDYPGVGPEHSYMKDIGRAEYYSVTDAEALDAFQRLSKLEGIIPAL
                     ETSHAIAYLETLCPQLAGSPKVIINCSGRGDKDVQTAAKFLIH"
     gene            complement(237162..238346)
                     /locus_tag="ANA_C10215"
     CDS             complement(237162..238346)
                     /locus_tag="ANA_C10215"
                     /codon_start=1
                     /transl_table=11
                     /product="McrBC 5-methylcytosine restriction system
                     component"
                     /protein_id="AFW93022.1"
                     /translation="MNPANFKILEITEYQTQSFSREEIPEEVGIILYEKYNSKVNVEF
                     PSPKTRYQWKITAQGYVGYIPLNSDVALKINPKVPIKNLFGMLEYTYNLEIFKFEGLM
                     NCESIEDFYNHLAYVLADKIIERCRKGLYRTYVPKTEQLAYVRGRLNVQQIIKKPWNV
                     KLQCAYQEHTADIIDNQILFWTLFHIGHSGFCTEKVSLIVRKAYHAMQGMVSLQPYNS
                     EDCIDRIYHRLNEDYHLLHQFCRFFLDNTSPNHEKGKNTTLPFLINMANLYEMFVAEW
                     LKKNLPQNFTLKTQERINIGEKIYFKTDLILYNTTDLTPKYILDTKYKNPEYSSPKDI
                     AQVVTYAVSKDCPETVLVYPTELNHSLDKYLGKIRVRNLTFSLDDKIEDAGNKFLTKL
                     FS"
     gene            complement(238343..240100)
                     /locus_tag="ANA_C10216"
     CDS             complement(238343..240100)
                     /locus_tag="ANA_C10216"
                     /codon_start=1
                     /transl_table=11
                     /product="putative restriction enzyme"
                     /protein_id="AFW93023.1"
                     /translation="MNKKQIIAWGDISYTVRLITSIYTNHEWQFLELIWEVWSVIIDH
                     GMATYSNKIELCEVLFRFIAILSFCLQFRFNDWDNDWEWLFERRYPSVFAMIYEILKS
                     INLNISNQHEILNFIYNKNYNLDIDYSSYGNYKNIYEFFEDFRHDNITLIFLVRKFRE
                     QIYELLIDNYEYEFTNFEYLLLNQKFNNEEYTDDNEYDDYEYSFDRFKTEKAFEKQQD
                     IKRLNELEEIYELYYKNQKEYRKLYQLETLIIDQFIDESEFHHSEYWDDENKDYNLVF
                     RQKNNMSYQIKDELKEEVLIAARKLAEYFSYPKLNKKYNINQCSEEICFEETTIERWI
                     RATNRKKQAIFYGSPGTGKTFIAEKLAKHLISEGDGFSELVQFHPAYSYEDFIQGIRP
                     QSEDGKLTYPLVPGRFLEFCKKAESFQDICVLIIDEINRANLAQVFGELMYLLEYRNQ
                     EIPLAGGNRFRIPENVRIIGTMNTADRSIAQIDHALRRRFAFIELRPNYDVLIKYHLN
                     TNFAVMDLINILKQLNQAINDKNYEIGISFFLTPNLREDIEDIWKMEIEPYLEEYFFN
                     NLEKVDEFRWDKIEKQITI"
     gene            complement(240173..240610)
                     /locus_tag="ANA_C10217"
     CDS             complement(240173..240610)
                     /locus_tag="ANA_C10217"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93024.1"
                     /translation="MNHEGAKFTKEEEEGRMRRLGDEVERLAYAVIGAGIEVHRMLGA
                     GFLERVYQEALGLEFRLRGIPYKPKHLVAVKYKGYPMGEGELDFLVGDSLVVELKAVE
                     KLAPIHEAQVISYLKMTNCPLGLLINFNVPVLKEGIKRIILSS"
     gene            240719..241069
                     /gene="sui1"
                     /locus_tag="ANA_C10218"
     CDS             240719..241069
                     /gene="sui1"
                     /locus_tag="ANA_C10218"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor SUI1"
                     /protein_id="AFW93025.1"
                     /translation="MANPKSDKGFVYQEFGNGSSPALERAVERGIQDLPPNQQNVRIQ
                     ATRAGRKGKTVTVITGFQTKPETLATLLKQLKAQCGTGGTVKDNEIEVQGEHKQKILE
                     ILVKLGYKAKISGG"
     gene            241202..241852
                     /locus_tag="ANA_C10219"
     CDS             241202..241852
                     /locus_tag="ANA_C10219"
                     /EC_number="1.3.99.5"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxo-5-alpha-steroid 4-dehydrogenase
                     domain-containig protein"
                     /protein_id="AFW93026.1"
                     /translation="MKIKYPINFHKGLTFLIILGLMVLYHNFTIGAWVYLSLHGTYGF
                     LWLLKDRIFPDKQWEQEIPASQGILTFVLLCLYWVAPFILISSGTVPPLPLVAVAISL
                     NIAGVFLHFASDAQKYYTLKYKTGLITEGFFAKCRNPNYLGEVLIYLAFSLLTQHWLP
                     FVIQGLFIAMIFVPNMRKKDQSLSRYPEFAEYKENSGLFFPKLFNSRSSQKEETTA"
     gene            241919..242308
                     /locus_tag="ANA_C10220"
     CDS             241919..242308
                     /locus_tag="ANA_C10220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93027.1"
                     /translation="MNYKAIILSAILGISTPAIIDMAIPSQAMAVQKFNYPAGEFSDK
                     EWKVTLSFDNNVYYYNGENLKSNNNINLSGAVASGTKQRQVYTWNNNGMKYQVTWKPS
                     DPNFIRVQVTQPNGKLILNRLLKAVKK"
     gene            complement(242501..245065)
                     /locus_tag="ANA_C10221"
     CDS             complement(242501..245065)
                     /locus_tag="ANA_C10221"
                     /EC_number="2.4.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-glucan phosphorylase"
                     /protein_id="AFW93028.1"
                     /translation="MQPIRTFNVSPSLPSRLEPLRKLAYNLHFDWNVESKDLFRRLDP
                     DLWESTHHNPVLMLGTISQSRLLEVVEDEGFLAQVDRAARQLEDYLQEYTWYKKQRNQ
                     HQKECYAYFSAEFGLVDCLPVYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQ
                     YLNADGWQQERYLINDFYNMPLHLERNPDGTELRIAVDYPGRKVYARVWRVQVGTVAL
                     YMLDTNIEPNKAYDHDITDQLYGGDIDMRIHQEIMLGIGGVQMLKALGYEVTAYHMNE
                     GHAAFSALERIRTLIQEKGLNYREARQVVSSSNIFTTHTPVPAGIDLFAPDKILHYLG
                     YYADIFGLPKEQFLGLGRENTGDLSSPFSMAVLALKMATFSNGVAQLHGVVSRQMFQG
                     LWQKVPVEDVPIAAITNGVHARSCVSKSTQELYDRYLGPNWSSAPPDNQLWERMDAIP
                     DEELWRNHERCRLDMVLYVREHLVKHLRDRGASASDIAQAQEVLDPNVLTIGFARRFA
                     TYKRATLWMRDLERIKQILLANKHRKVQFVIAGKAHPKDIPGKELIRDINHFIREHHL
                     EKQVVFVPNYDIHIARLMVAGCDIWLNTPRRPREASGTSGMKAAMNGLPNLSVLDGWW
                     DEADYVRTGWAIGHGENYDDPNYQDEIEANALYELLEKEVIPLFYDHRDGDGLPRPWV
                     AKMKDAIRLNCPFFNTARMVREYAMRAYFPASDRYHTLTVDNYAPAKELAAWRAKLGE
                     HWFSIKIKDIDVSAASDIEVNQTVAVKAKVDLATLSNDDVQVELYQGSIDANGDIVNA
                     VPVVMDYQGQDTDNSSVYTANITYTTSGLQGLSLRVLPRNQYLSSPYEPRLIAWAE"
     gene            245574..246173
                     /locus_tag="ANA_C10222"
     CDS             245574..246173
                     /locus_tag="ANA_C10222"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93029.1"
                     /translation="MKLSQILPLVIVGGALATSLVAWEKPAQAIQVFNFSFDNTVGPV
                     NGTVSGTLDLPNGNGTFAATSVKINSAPAALGYTQPVDVLSYFPFPSLNSFTVFNDTI
                     TSSNFLAYNTAEMLALNVVPGSLGSLLSPVGTGQAFSGVVDIYSTTLTYTPATPVPFD
                     TTPGAMLSTIPVLALMYRWKQSRSRIALRTTEKPAVTVS"
     gene            246553..247500
                     /locus_tag="ANA_C10223"
     CDS             246553..247500
                     /locus_tag="ANA_C10223"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93030.1"
                     /translation="MTRFIHDQFAKDYLEELLKPYGKVEAPSHVSGEVREIDVLFTPF
                     LEQKADIASLGLLGKLATTLAIFEPFRNPASTEEICDCLLKSLEVRGALKREAKRNAT
                     KIAQSNFPKLWILTPTASKKLLSGFHGTLESDSLPGIYYLPESFRAAIIVIHQLPPIP
                     ETLWLRLLGRGTVQKRAIDELAALPSNQPYVKITLELLYNLQQNLRINQSPEIETEDR
                     ELIMRLAPLYQQERELARQEGLQEGLQRGEQRGEQRGLQQGEQLLIIRQLNRRIGTMD
                     SSLIQQVQKLPVEQLEELGEALLDFTSVTDLQTWLQSVS"
     gene            247911..248465
                     /locus_tag="ANA_C10224"
     CDS             247911..248465
                     /locus_tag="ANA_C10224"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93031.1"
                     /translation="MQRYIMMKLSQILPLVVVGGALATSLVAWEKPAQAITFNWDASG
                     LNVSGSGQIELGDTADQNGFYTITNIWGIINFNDGSAGQIIGLTDPVPKIKLNPPVFP
                     PINFQYQKTPVGDFPDPNKYENYAFNEPFTVTPVPFDISPGAILPTIPILALMYLWKQ
                     SRNRMALKTINNPDVTVSTYRQVG"
     gene            248909..249058
                     /gene="psbI"
                     /locus_tag="ANA_C10225"
     CDS             248909..249058
                     /gene="psbI"
                     /locus_tag="ANA_C10225"
                     /codon_start=1
                     /transl_table=11
                     /product="photosystem II reaction centre protein"
                     /protein_id="AFW93032.1"
                     /translation="MLFTKPLGVSSMLSLKIAVYIVVGFFVSLFIFGFLSNDPARNPG
                     RRDAE"
     gene            249157..251547
                     /locus_tag="ANA_C10226"
     CDS             249157..251547
                     /locus_tag="ANA_C10226"
                     /codon_start=1
                     /transl_table=11
                     /product="OstA family protein"
                     /protein_id="AFW93033.1"
                     /translation="MFHPVLSPQLPPSLESLKPVDHLASATVVKIKTDRRKLIIVGKN
                     QDNKYQLNISLVKKDVVTKASSSSPENLAPQSLPTYPQVNGEVSHKNQLFLDKSVVLA
                     ATPIPPTESGNVNLQESGGKFDLSVGDKKPAAAPVQNLIEFKLRNPENRESTPTTVEF
                     PPSPQLPQVEKIPAGKGRVVEVIADRQEYDEQRRIVTADGNVVVRFDGAVIDADSLHI
                     NLDNLIAVGEGNVALTRGNQVLQGKRFTYNFIQDNGELENGKGELYIPTTGTDFAFSP
                     SLPTDITAGGVPSQPLSNRIRANQPIAGVNSPGGIQFNASGQSDVRNVPAQESGGVVK
                     RLRFEAQRIEFYPRGFQAQDVRITNDPFSPPELEVRAEQVTVTREAPLIDRIVTQRQQ
                     LVFDQKVVIPIPVNRRTIDRRPRQVNPTIVSPGFDNGKRGGVYVERSFEPINTDQKRW
                     TIIPQFYVQRAFKDSGNVASLFGVKSKLNAVFGPKTILEGTGELTSFDFDQVENSLRG
                     SLRLRQILGNVNPYTLSLESSYRDRLYNGSLGYQTVQSSIGGIISSPVIPLGKSGINL
                     SYQGGAQYIDANTDRQDLLSPVRKNDRISLSRLQGSVALSGGINLWQGKPLAATATEG
                     LKYTSNPVVPYLQAIAGITGTTSYYGSSDNQSTLTGTMGLVGQIGNFSRPYLDYTAFN
                     LTYSQGTNSGLSPFLFDRLVDNKVLNAGLSQQLYGPFRLGLQTSINLDTGKATSTDYI
                     MEYSRRTYGISLRYNPVLQLGGFSIRISDFNWTGGTDPFSNGEVKPVVGGVVRQDN"
     gene            complement(251641..253173)
                     /locus_tag="ANA_C10227"
     CDS             complement(251641..253173)
                     /locus_tag="ANA_C10227"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative nitroreductase"
                     /protein_id="AFW93034.1"
                     /translation="MPEIEQSISQHYHDRTKYHPETLAGKGRNLDWNKQPVPFKEYKI
                     GSDIDLKPYLQETAATVANKQDTKWWWRLSQLLFHSYGLTAKMPSLGNTVYLRSAPSA
                     GGLYPAEVYLVSRGTPLLPPGLYNYQCRTHSLMHFWESDVWQTLQAACFWHPSLENTQ
                     LAIITTAVFYRSAWRYEDRAYRRIFLDTGHLLSNIQLACNIADYRSHLIGGFADEAVN
                     ELLYIDHEQEGTTAILALADLLDVSQNLPLGRTALPSTTATNYPSIPDGELLKYFHLN
                     TQIPASNGGKLNLPTVQSEKSLEDKYNFPFCEKFSTRTTPIFWGENLSELSNTIYKRR
                     STRAYTGDDLSFDELKALLDFTYQPQNYIDQNLDPQPDYFDLNLIETFVVVSGVQGLD
                     PGCYYYAPKAQELRQIRFKNCRRELYFLCLEQELGRDAGAVLFHTADLKNAIAQYGDR
                     VYRYLHLDAGIFGQRLNLAAIRLNLGVSGIAGFFDDQVNEVLGIPTDEAVIYITTLGK
                     PR"
     gene            253334..254173
                     /locus_tag="ANA_C10228"
     CDS             253334..254173
                     /locus_tag="ANA_C10228"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase domain-containing protein"
                     /protein_id="AFW93035.1"
                     /translation="MMPVRQTLSTSDIQLSYLEWSQGQEPLLLLHGMADHALVWSSLG
                     DYLAADYHIVAPDMRGHGESSKPEQDYTFASAISDLEALMDKLGWSAAHIVSHSWTGK
                     LAAIWARENPARLKSITLVDPIFIWKMPSFLKITFPLLYRVLPFLKSMGPFASYEEAE
                     QKIKQLSQYQNWSSLQQQVFQAAIEEKPNGTWGSKFTIAARDGIFDAVMEIPGFIHPV
                     DTPALFIQPEKGVNRQNWQIQPYKTNLKNLNLCQVPGNHWPFLTNPTEFNQTVATFLA
                     AQT"
     gene            254311..256017
                     /locus_tag="ANA_C10229"
     CDS             254311..256017
                     /locus_tag="ANA_C10229"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="AFW93036.1"
                     /translation="MSLCINPVCSQPNHPDNDENRFCQSCGSQLELIGRYRVLRLLSD
                     KTGFGKIYEAYQQDTPKILKVLKEELTNDSKALALFQQEAKVLQQLNHPGIPQTEGYF
                     PYQTRNNLILHCLVMEKIVGPNLEQWLKQQQNRPISEAQAIVWLKQLLEILDLVHNQQ
                     YLHRDIKPSNIMIRPDGQLVLIDFGTAREITRTYLANSGGMTAISSSGYSPPEQMRGQ
                     SIPSSDFFALGRTFVFLLTGFPPEQLYDPHLDILQWRQHGNHVSPLLLDFIDWLISTE
                     VTKRPSNAEEISRRLAAIEHQLTENTSATVNIGGLGKTEIINKPTTNNTVIPPQRQPE
                     KLPLLSWFAALIVSLLLLWWVSLAFRNTKFAALPPDYGQAPVKQGKVDYFPYEEGKDS
                     QGRVAEFNIAVLSVEYKWQLGSTYQIKYNDQTITLDSLKSNLEQEGIQKIMENPSEII
                     SVGTASCEGNITAEQSRALERSQQIQLLGKKIFSSTPSVKGYRLLNLGQFQRKDCQAN
                     QDSTAYQRSIIIIGVKKQAQGVILDEALRDRLEKKPFADFKLEDYSLGSPDKFKTIPS
                     NL"
     gene            complement(256273..257061)
                     /locus_tag="ANA_C10230"
     CDS             complement(256273..257061)
                     /locus_tag="ANA_C10230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93037.1"
                     /translation="MKKIVKKALTLLSVNYAKMLEYRSELIFWVLAGSLPIIMMGIWI
                     QAADSGKFAFKSVDFARYFFAVFLARQISVVWVIYDFEKEVLEGKLSPKLLQPIDPVW
                     HHVANHLGERVARMPFVLFLSIFFFVLYPQAFWLPSITNLLLFILAAIMAFALRFIIQ
                     YTFAIFAFWTEKAAALENLWLLFFVFLSGLIAPLDVFPENVRNIVMWTPFPYMINFPA
                     SILVGLPVDLTRGFLSIAGWFLLFLGANRFLWRRGLKQYSGMGA"
     gene            complement(257067..258050)
                     /locus_tag="ANA_C10231"
     CDS             complement(257067..258050)
                     /locus_tag="ANA_C10231"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter family protein"
                     /protein_id="AFW93038.1"
                     /translation="MSIIIAENLSKSYPVAIKDPGIGGTISHFFRRTYRNINAVQDVS
                     FSIEPGEIVGFLGPNGAGKTTTLKMLTGLIHPSQGTVKVGGFIPFNRQEAFLQKITLV
                     MGQKQQLIWDLPALDSLRINAAVYNISDKEFQRRVGELTEMLALAGKLTQPVRKLSLG
                     ERMKAELLAALLHRPQVLFLDEPTLGLDVNAQAGVRNFLKEYNQLYQATILLTSHYMA
                     DITALCERVLLIHEGKLMYDGRLDGLLASFAPYREIYVELVQPLSLEQLMPYGDVQML
                     EGRAVRFIVPQAAMTRTVSQILADLEVVDLTVTEPPVEEVIGRVFQKGFNH"
     gene            complement(258099..261629)
                     /locus_tag="ANA_C10232"
     CDS             complement(258099..261629)
                     /locus_tag="ANA_C10232"
                     /codon_start=1
                     /transl_table=11
                     /product="WD-40 repeat-containing protein"
                     /protein_id="AFW93039.1"
                     /translation="MNTYPYQVGGSLINNAPSYVERQTDIEIYNALKKSEFCYVLNCR
                     QMGKSSLLVRTKHHLEQEGFKCTSIDITNIGSENITASQWYKGIIADLCRGFKLLGKF
                     NLKSWWQTGDDISLVHKLSQFIAELLTQFPEERLIIFIDEIDSILSLDFPVDDFFALI
                     RYCYNQRAIDPEYQRLTFAIFGVATPSDLIQDAKRTPFNIGQAIDLKGFKIAEVDSLI
                     RGLELVIPNPYPVMKQILDWTGGQPFLTQKLCNLITNFQVSGDYLDFAKGYEEFWLDN
                     VVNEYIIKNWESQDEPEHLRTIRDRLLYNQQLVSRLLGIYQQILQGVEVKSDDSREQV
                     ELLLSGLVVKQVGLLIVKNRIYAEVFNLDWVEKQLANLRPYSQTFDAWVTSQQADESR
                     LLRGQALADAQAWAWDKSLTNLDNQFLAKSAELERREQQLVLVAEKSKNMEIQLLEQQ
                     KNARLQKLILGVISTALLTAVSLGGISFWLYRQSLQSERLAKISEIKALISSSNGNFK
                     SHQELEAVRDAIKAKRKLKKLNINNPELDHLTDNVVRQASYGAQERNRLSGHNLGLVW
                     DLAWSPDSQMVALASQNEVWLWQQNGKLIRKFKGHNSTVWTVAFSPTEKIIASGSADK
                     TIKLWSLNGQKLATITVGEEVKSIAFSPDGRLLTIGMNNGTLGIWQLADKKFRMIKAH
                     ESAISKVLFTPDGQKLVTGSFDGKATLWSLDGKKLVNFNHGQDAVRGLAISADGKLLA
                     TGGNNKKIELWSLDGKKLKNIEAEYSIIAMAFSPDNKTLAAASWDKVVKLYSLDGKDL
                     ATLSGHKEGVWAIAWSPDSKILATASMDNSVKLWQLQNPLVTVLRYHQSNLAKVAISP
                     NGKIIATTGWDSMINLWKSDGTLFRSLQADGNGVTSVVFSPNSQYLAIGSTDKTIKIW
                     KIDGTLIDTLPGHTGVILDIALSPDSKILASVGYDQALWLWQRDDKKPFSFRLYKTIK
                     AHSEPINSVEFSPDGQVLATGSYDKTIRLWSREGKLLKTLQRHNLAVFDATFSPDGQL
                     IASISDDRTIKLWQRDGKFLRTLVNSKFTFHTVTFSPDGKTIAAGSGDGENAIHLVNL
                     EGKPIITLFRHLGAVSSLTFSADGKTLVSASRDRTAIIWNLPQIFATNELDYACNWVK
                     DYLQNNQELENSEENNSSGDKLSTRHLCDH"
     gene            complement(261644..263278)
                     /locus_tag="ANA_C10233"
     CDS             complement(261644..263278)
                     /locus_tag="ANA_C10233"
                     /EC_number="2.7.7.65"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="AFW93040.1"
                     /translation="MKKNITLPGDPLPFNSCFYIERTPIESDAYAELLKPGSLIRIKA
                     PRHMGKSSLMLQLIHQAQIHEYSVVTIDFKLVDRQTFLSLNNFLRWFCMNVARQLSLA
                     SDLDDYWDEEIGSKVSASIYFESYLLEQIKSPLVLILNEVDYAFQYQQIAQDFLLLLR
                     NWHEQAQQTPIWQKVRLVLFHSTEVYIPLNINQSPFNVGLSLKLPEFTVEQVTELARR
                     YELDWCDSQAVKNLMYWVGGQPYLIHQALYDLYQQKISLPELLDNCTKGKYIYSGYLR
                     NLLNILLQDAELSQAYNQVVNSTGNNIFLSDNLVYKLDSLGLIKLSGYNYEPFCELYR
                     LFFQKSLLIESNAIPWDKLKKENEKLQLLVNIDKLTQVANRKCFDETLEIEWERMTYI
                     QEPLSLILADLDNFKFHNDTYGHQSGDNCLHKIAQAINSVIKNPDHLVARYGGEEFVL
                     ILPQVDAEAAIFIAEEIRETVKSLRIKIPELTKKNQLTNMISLTISLGIACIIPSGDF
                     SLREFFEAADQAMYQAKKLGRDRSILSSKFKFGYDE"
     gene            complement(263617..264681)
                     /locus_tag="ANA_C10234"
     CDS             complement(263617..264681)
                     /locus_tag="ANA_C10234"
                     /EC_number="6.3.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-1-phosphate guanylyltransferase"
                     /protein_id="AFW93041.1"
                     /translation="MNNLFFPVILAGGKGERFWPLSRLDRPKQFLSLDGSSRSLLQAT
                     ADRLLTLAGGWENLWVITSSPIAQGVREQLPDLPVANLLIESEGRDTAAAVAWTSLEI
                     KKRYGEDAIIGFFPADHWIADQEIFAETLAAAMDLAAKKAAIVTLGIKPNFPSTGYGY
                     IEQGEKIGSFNNLPAYHVHRFTEKPDRETAETFLSTGRFSWNSGMFVFRAGVVLEELR
                     THAPEIIKPLEQHGPDIYPQLPKKSIDYALMEKTSLAYVLPVAFGWDDLGDWNAIERL
                     LKQSDNPNVELATHVGLDTQGAIVYASNPDDVIVTIGLEDVVIVRDRNVTLVVKKDRT
                     QEIKQILKILQTDSRFTGLL"
     gene            265090..266613
                     /locus_tag="ANA_C10235"
     CDS             265090..266613
                     /locus_tag="ANA_C10235"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator protein"
                     /protein_id="AFW93042.1"
                     /translation="MSGEKIVIKQVQWSENQVAPQQVPTSEPEVLQPPVQWSENQVTP
                     QQVPTSEPEVKPKQSINSSRHVVESVGAIPNELYDRLGLSVPRWLLWVLTIVLGVILS
                     GLLASSLALWTPLWSNLDQAKDDEFGANKQDQIKVPGDLWTKLSQYKLSKPMNILIMG
                     IEPVPGTVDGSPESFAGKSDTMMLVRLNPSDKSIRLLSIPRGTMIAIPEQGLTKVSEA
                     NAKGGPVLAARVVSRSLNNAPIDRYIRISTSGFRELVEQLGGVDVFVPQTMNYQDQAG
                     GFAVNLISGWQSLNGEQAEQFARFREEGMGDLPRVQRQQALITALMQRLNSPTVLPRL
                     PQLTRLMRKYFDTNLKMEEMMALANFSVNVERDHFQMAMLPGTFSKLSQDPNSYWLNM
                     TGQQSLLNDFVGVNVTGIKSDTRPVSIQRIAVQNTTNQPQLTEKVITYLKQKGFTNVY
                     PVPDWPDSQRQTQIIVQKGNRQPGIDLRQVLGLGQIEVSGNGDLESDLTIRIGKDWK"
     gene            266709..267215
                     /locus_tag="ANA_C10236"
     CDS             266709..267215
                     /locus_tag="ANA_C10236"
                     /codon_start=1
                     /transl_table=11
                     /product="pentapeptide repeat-containing protein"
                     /protein_id="AFW93043.1"
                     /translation="MNKILLRFLSLIFIFILVGFSVIMNPEPVFAQVNTINYNNANLE
                     NRDFSHTNLVGGTFVAAEMRGTNFQDANLTNAIFTKGVLLKANLESANLTGALVDRVT
                     FDSANLRNAIFAEATLTRSRFYDADITGADFTDALIDRYQVSLLCQRADGVNPVTGIS
                     TRDSLGCK"
     gene            267427..269031
                     /gene="mviN"
                     /locus_tag="ANA_C10237"
     CDS             267427..269031
                     /gene="mviN"
                     /locus_tag="ANA_C10237"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein"
                     /protein_id="AFW93044.1"
                     /translation="MTQQDQKPSRSFAGIAGIVAAATLISKVFGLIRQQIIAAAFGVG
                     AAATAYSYAYIIPGFLLILLGGVNGPLHSAIVSVLAKHKKEEAAPIVETITTLVGGLL
                     ILVTFAQIFCAEYIVDLVGHGLEATTRAIAIRQIQIMAPLALFAGLIGIGFGTLNAAN
                     QYWLLSISPLLSSITVIIGIAILAGQYGKEIINPEYALIGGMVLAWGTLAGGILQWLV
                     QSIVQWRLGLGKLRLRFDFKSPGVQEVIKIMTPATISSGMMPINVATDLYFASPIVGA
                     AAGFNYANLLVQTPLGIISNIILLPLLPTFAKLSHPDNWGELKLRIRQGLLLTAVTML
                     PLGALMVSLSVPIVQIVYQRGAFKQEATQLVSSLLIAYGIGMFVYLGRDVLVRVFYAL
                     GDGQTPFKISIFNIVLNAVLDLILVERFGAPGLVLATVGVNCSSMLMLLFLLNRKLNG
                     LPWQEWCVPILGLTVGSIISGLASFGTLMTSQQILGKQDLISLLIELSISAFVGIGVF
                     AIIASRMNIPEVNTFVMKMQQKFLKK"
     gene            269416..270765
                     /gene="mtgE"
                     /locus_tag="ANA_C10238"
     CDS             269416..270765
                     /gene="mtgE"
                     /locus_tag="ANA_C10238"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transport protein"
                     /protein_id="AFW93045.1"
                     /translation="MLTQEIRNSLDIADLNQLKCDLNCLQPVDVGEYITQLPEKQRAI
                     AFRLLNKDQAIDVFEYLPTEVQEDLINSLHDAQVVDLVEEMSPDERAYLFDELPAGVV
                     KRLLQQLSPEQRQATATILGYPEGTAGRVMTTEYVRLRRGLTVGEALSKIRLQDQDKE
                     TIYYAYVTDDNRKLVSVVSLRQLLFTFPDVLIKDIASAHVVKVRTETSQEEVARIMQR
                     YDLIAMPVVDREDRLVGIITIDDVVDILEEEATEDIQKLAGVSGDEEALSPAQVTIRK
                     RLPWLLGIMGLYIGAASAIAPFQEVIAAVPVLAVIMPIFSNTGGTVGIQALTVTIRGL
                     GVGEVTPADTGKILRKELLAGLGTAVALGLTMVALSLIWAKPQERWVALIAGVVMATN
                     TMVAVTLGTLLPMGLKHLKLDPALMSGPLVTTMLDTIGFLTFLSIISVALKVFHLQS"
     gene            271038..272030
                     /locus_tag="ANA_C10239"
     CDS             271038..272030
                     /locus_tag="ANA_C10239"
                     /EC_number="2.1.3.2"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase"
                     /protein_id="AFW93046.1"
                     /translation="MPTTWNRHHILTLADFTTAEYNAVLQTAASFQEVLSRRTKKVPT
                     LQGQVVANLFFEPSTRTRSSFEIAAKRLSADTLNFAAATSSMTKGETILDTAKTYLAM
                     GTDIMVVRHKDAGVPQAIAQEMDRLGVKVSVLNAGDGQHEHPSQGLLDLFTICSLIDP
                     AQPKIESLQGKKIAIVGDILHSRVARSNIWSLIASGAEVHLSAPPTLLPKFFAEYLGC
                     TENSNRLFTHWQLEPALENADFVMTLRLQKERMTAHLFPSLREYHQLFGITRAKLKLC
                     KPQVKVLHPGPVNRGVEISSDLMDDPEFSLIQSQVTSGVAVRMALLYFIGSGRA"
     gene            272608..273513
                     /locus_tag="ANA_C10240"
     CDS             272608..273513
                     /locus_tag="ANA_C10240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93047.1"
                     /translation="MALSSLNEVAKYLEQHENSQQIKKLIFFACKNEWENNQDTLNRF
                     KLPELIQELSSLNPTIDCLTSSLSIAVGNLSKPKQYSMIASIIIKEIQKLYLTPDQET
                     ELIFKQPHQEQETGLILNQPSQNIPKFYSSEKKSSTPPAKTPSSSKKSQYNQFDLRQN
                     LMRFSNPLRIKIILFSALYNKFTFNEQDWLRLKSEELDSLLRKLFNSCATIGELESKI
                     NNTVISLGTPDKNNQASGVIIRVMRGLYGDIPAKTNSDKLPNSYPSAKTKPPANPNYQ
                     PAPTQVNDFYDDDDNNTCQITVPPT"
     gene            273594..274586
                     /locus_tag="ANA_C10241"
     CDS             273594..274586
                     /locus_tag="ANA_C10241"
                     /codon_start=1
                     /transl_table=11
                     /product="pentapeptide repeat-containing protein"
                     /protein_id="AFW93048.1"
                     /translation="MDAKELLRRYANGETNFSNAKLNGVNLFDADLIGIGLDQANLSN
                     AILTFSYLNQALLNNANLSFTNLRGANLTQAKLQNANLHDADLHGATLQGADLRNANL
                     TLAHLLDANLMSSDLRGANLTGANLTGACLRGANLREEKRTYSACLRGANLHKVDLRG
                     ANLTGADLAKANLSGANLSETMLRGVDLSGANLSGAILENATLTETNLQGANLNGANL
                     INAKLSKSNLTEAELIGANLHDAMMFQATLIKAKLNRANLSFARLSKVNLSRANLCEA
                     DLTEAELVDACLAMTDFTDANLTKVNLFRAEISTTNLTGANLFEAVMPDGTIGY"
     gene            274690..275475
                     /locus_tag="ANA_C10242"
     CDS             274690..275475
                     /locus_tag="ANA_C10242"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93049.1"
                     /translation="MPTLRVNCFTSLPIFSLLISGSWVFVCEYSPVQAQTSNNMPIFA
                     QATLPYLQEIAINQQPLPQLQPEKFYQSQGTQYSQYNQNFDRYFVYVDSNNYEILQRV
                     RQIEPNAYIRNYKGRKVIQSGVFNGQSNAQKRVRELEFNGISGAKIVNSENIELTPNY
                     SVQPVMSYNAPGYNDQNYPNNYQQEKRNSYYVVIPGNANSLHSLGTEIRQKVSININV
                     FRRTQPLGTHIAVGPFSDRLEAEQWNSYLKNSGYGNARVYYGK"
     gene            275663..277210
                     /gene="yjeF"
                     /locus_tag="ANA_C10243"
     CDS             275663..277210
                     /gene="yjeF"
                     /locus_tag="ANA_C10243"
                     /codon_start=1
                     /transl_table=11
                     /product="putative carbohydrate kinase"
                     /protein_id="AFW93050.1"
                     /translation="MTKEQFVVTAAQMRDIEARIFTAGMPVAALMEKVAGLISHRLQA
                     IISPGQCVGILVGPGHNGGDGLVVARELHFRGYQVWIYQPFSKLKELTSQHFQYAQNL
                     GIPCYQEIAELPSYDFLIDGLFGFGLERKITDSIATAINYFNSKNQPIISIDIPSGLH
                     TDTGEVLGTAIQANYTFCLGLWKQGLLQEQALPYIGKAELIDFDIPLADIHAVIGNIP
                     QIKRITKTTALSTLPLPRPLITHKYKQGHLLLICGSQRYVGGAILTGLGARASGIGML
                     SIAVPESLKMLLVSHLPEALIIGCPETKTGTIANLPLVGCVSDSVTHLIDLNSFTTIA
                     CGPGLTKDNISIIPEIIKCECPLILDADALNILAQLGTIPTLKSRKSATVITPHTGEF
                     KRLFPHIDYTNRIKAVQTAAQESGAVVLLKGARTAISNSQGSSVWINPESTPALARGG
                     SGDVLTGLLGGLLAQIMNKEIFIEDIVATAAWWHSQAGILAAQARTELGVDAFTLTQY
                     LLPVLKR"
     gene            complement(277276..277662)
                     /gene="rplL"
                     /locus_tag="ANA_C10244"
     CDS             complement(277276..277662)
                     /gene="rplL"
                     /locus_tag="ANA_C10244"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L7/L12"
                     /protein_id="AFW93051.1"
                     /translation="MSAATEQILDQLKSLTLLEASELVKQIEEAFGVSAAPTGGGMMM
                     MAAPGAVAEVVEEKTEFDAILDSVPADKKIAVLKIVREITGLGLKEAKDLVEAAPKAV
                     KEAVTKEAAEDIKKRIEEAGGKVTVK"
     gene            complement(277722..278291)
                     /gene="rplJ"
                     /locus_tag="ANA_C10245"
     CDS             complement(277722..278291)
                     /gene="rplJ"
                     /locus_tag="ANA_C10245"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L10"
                     /protein_id="AFW93052.1"
                     /translation="MGRTLENKKEIVADLKVSLSESTLALVIDYQGLTVAEITDLRRQ
                     LRPSGAICKVTKNTFMGIAIKDQEQWQPMSELLNGSSAFLLVKEDLSAIKAYQAFQKA
                     TKKTEIRGGVMEGRVLSEADVKALGDLPSKEQLMAQIAGAINGVATKLAVGINEVPSS
                     LARALQAVAEKENSDSSESAAELAVVSED"
     gene            complement(278688..279404)
                     /gene="rplA"
                     /locus_tag="ANA_C10246"
     CDS             complement(278688..279404)
                     /gene="rplA"
                     /locus_tag="ANA_C10246"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L1"
                     /protein_id="AFW93053.1"
                     /translation="MAKKVSRRLQALLEKVEDRDYTPLEALALLKETATAKFAEAAEA
                     HIRLGIDPKYTDQQLRTTVALPKGTGQIIRVAVIARGEKVTEATNAGADIAGSEELIE
                     DIQKGMMDFDKLIATPDVMPQVAKLGKLLGPRGLMPSPKGGTVTFDVASAIAEFKAGK
                     LEYRADRTGIVHVMFGKTAFSPEDLLINLKALQESIDRNRPSGAKGRYWRSVYISSTM
                     GPSIAIDISALRELKITDAA"
     gene            complement(279555..279980)
                     /gene="rplK"
                     /locus_tag="ANA_C10247"
     CDS             complement(279555..279980)
                     /gene="rplK"
                     /locus_tag="ANA_C10247"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L11"
                     /protein_id="AFW93054.1"
                     /translation="MAKKVVAVIKLALNAGKANPAPPVGPALGQHGVNIMMFCKEYNA
                     KTADQAGMVIPVEISVYEDRSFTFVLKTPPASVLIRKAAKIERGSSEPNKTKVGSISR
                     TQLREIAQTKLPDLNANDIDAAMNIVEGTAKNMGVTITD"
     gene            complement(279987..280619)
                     /gene="nusG"
                     /locus_tag="ANA_C10248"
     CDS             complement(279987..280619)
                     /gene="nusG"
                     /locus_tag="ANA_C10248"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination protein"
                     /protein_id="AFW93055.1"
                     /translation="MTSATDEPRNSELQSDDTLLTGIKEVRWYAVQVASGCEKRVKTN
                     LEQRIQTFDVADRIVQVEIPHTPTVKIRKDGKRLPSEEKVFPGYVLVRMAMSDDTWQV
                     VRNTSHVINFVGAEQKRGSGRGRGHVKPVPLNPSEVERIFKQALEQEPVVIIDMATGD
                     KIVVLSGPFKDFEGEVIEVSPERSKLKALLSIFGRDTPVELEFNQVKKQS"
     gene            complement(280619..280840)
                     /gene="sceE"
                     /locus_tag="ANA_C10249"
     CDS             complement(280619..280840)
                     /gene="sceE"
                     /locus_tag="ANA_C10249"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase"
                     /protein_id="AFW93056.1"
                     /translation="MAKKNEAEMPETENGFNLNNFFQGTKEELEKVIWPSRKQLVSES
                     AAVLLMVTLSASLIYLVDGLFAWAAKQVF"
     gene            complement(281022..281097)
                     /locus_tag="ANA_C1R001"
     tRNA            complement(281022..281097)
                     /locus_tag="ANA_C1R001"
                     /product="tRNA-Trp"
                     /note="tRNA-tRNA"
     gene            complement(281248..281610)
                     /gene="rplS"
                     /locus_tag="ANA_C10250"
     CDS             complement(281248..281610)
                     /gene="rplS"
                     /locus_tag="ANA_C10250"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L19"
                     /protein_id="AFW93057.1"
                     /translation="MNAQEIIRSIEAEQMKSDLPDIYVGDTVKVGIKIQEGTKFRVQP
                     YEGVVIARRNGGINETITVRKVFQGVGVERVFLLHSPLVESIKVLRRGKVRRAKLYYL
                     RALVGKATRIKQRFDRPL"
     gene            282021..283757
                     /gene="hflX"
                     /locus_tag="ANA_C10251"
     CDS             282021..283757
                     /gene="hflX"
                     /locus_tag="ANA_C10251"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="AFW93058.1"
                     /translation="METIFGNVQGLKSSQLKQLQRLYHQRISGDRITTTDFAQRLAAI
                     STEINQPICTYINRRGQVIRVGVGTPRQTQIPPLELPRYGAERLSGIRCLSTNLKSEQ
                     PSESALTAMALQRLDALVVFNITGGGFTKRGGGSTGYVKEAYLAHLVANNRQLVVTQS
                     AGISIGDAGTYSHISPPLSLDALADQDFLDLVASLEEEFSREYVAQEVDADHDRVVIV
                     GVLTENITPQQFQDIIVELTRLVDTAGGVVLQTLQQKRSRIHPQTVIGEGKVQEVAIA
                     VQTLGANLVVFDRDLSRSQVRNLEAQIGVRVVDRTEVILDIFAQRAQSGAGKLQVELA
                     QLGYMLPRLTGKGEGMSRLGGGIGTRGPGETKLETERRAIQKRISRLQHEVNQLQAHR
                     CRLRQRRQHREVPSVALVGYTNAGKSTLLNALTNSEVYTADQLFATLDPTTRRLIIPH
                     AETGAPQETLMTDTVGFIHELPASLMDAFRATLEEVTEADALLHLVDLSHPAWLNHIR
                     AVRDILAQMPITPGPALVAFNKIDQVSSETLALAREEFPLAVFISASQRLGLETLRQR
                     LSLLIQYAVGDD"
     gene            complement(283830..284045)
                     /locus_tag="ANA_C10252"
     CDS             complement(283830..284045)
                     /locus_tag="ANA_C10252"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93059.1"
                     /translation="MTYLELHQKIEQQISQLPPEQLSLVSDFLDSIQEKSTVNQRPLR
                     RISPIKRGKKAGDLLHYAGTWHCLCYH"
     gene            complement(284181..284525)
                     /locus_tag="ANA_C10253"
     CDS             complement(284181..284525)
                     /locus_tag="ANA_C10253"
                     /codon_start=1
                     /transl_table=11
                     /product="PemK family protein"
                     /protein_id="AFW93060.1"
                     /translation="MSSPKRSEVWLVDLGYVAKVRPCLVISIPVLDQDRALVTLVPHT
                     TSSRSSRFEVQVKTNFLREGVFDVQNIITIPHAKLLRKLGNITPEQMLKLEQVLLFWL
                     GFDEENVQDDDE"
     gene            complement(284518..284868)
                     /locus_tag="ANA_C10254"
     CDS             complement(284518..284868)
                     /locus_tag="ANA_C10254"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93061.1"
                     /translation="MINAIAKLTEGIACGVILERAIAKRTEGIAYSVILEIVISSPCY
                     DISIYRKKAMTALVQELLNTFDRLTDSERLDLVLEILKRTVDLDFSPLSDEDLVMNAE
                     GLFLDLDEEEATYE"
     gene            complement(284896..285132)
                     /locus_tag="ANA_C10255"
     CDS             complement(284896..285132)
                     /locus_tag="ANA_C10255"
                     /codon_start=1
                     /transl_table=11
                     /product="translationally controlled tumor protein"
                     /protein_id="AFW93062.1"
                     /translation="MYIFNCIFTGKKVFSDDYSAKIEDDGFVWVVDGKYEELSDQKFD
                     DSLFGGNKSAEGEDVTEYVTEYKPVVNTLLKAFR"
     gene            complement(285216..286115)
                     /locus_tag="ANA_C10256"
     CDS             complement(285216..286115)
                     /locus_tag="ANA_C10256"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93063.1"
                     /translation="MTRQSHDQFAKEYLEELLTPLGTIKKSEKVKSEVQEIDVWFEPF
                     SDQTQENLPLGLLGKMAKTQCLFEPFRNPPSEIEIRSCLLKLYAVHGDVVRKAKRENR
                     NIAESDLPILWILTPTFSSRMITGLGATEIVEDWVKGVYFLPNILKTAIVVIHQLPEN
                     EDTLWLRVLGKGGTQKRAVEELTELPENHPFRENLLEILADWRKNLELRDNLSREEEE
                     VIMNLSPAYLQQIEDWKQEGKQEGQLLLITSLLEGRFGSLDAELSGVVAKIAKFPISE
                     RTQLLLSLGNLSREELLQRLQDQ"
     gene            complement(286122..286301)
                     /gene="bchB"
                     /locus_tag="ANA_C10257"
     CDS             complement(286122..286301)
                     /gene="bchB"
                     /locus_tag="ANA_C10257"
                     /codon_start=1
                     /transl_table=11
                     /product="protochlorophyllide reductase"
                     /protein_id="AFW93064.1"
                     /translation="MSEQIKWTAEAEVKLKEIPFFVRPFARKKIETYAQENSISLITL
                     EIYEQVKQQFNKKFG"
     gene            complement(286403..287776)
                     /gene="thiC"
                     /locus_tag="ANA_C10258"
     CDS             complement(286403..287776)
                     /gene="thiC"
                     /locus_tag="ANA_C10258"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein"
                     /protein_id="AFW93065.1"
                     /translation="MRTEWVAKRRGQANVSQMHYARQGVITEEMDYVAKREKLPAELI
                     RAEVARGRMIIPANINHTNLEPMAIGIASSCKVNANIGASPNSSNLQEEVDKLNLAVK
                     YGADTVMDLSTGGGNLDEIRTAIINASPVPIGTVPVYQALESVHGTIENLTADDFLHI
                     IEKHAQQGVDYQTIHAGILIEHLPLVRNRLTGIVSRGGGILARWMLHHHKQNPLYTHF
                     NDIIEIFKRYDVSFSLGDSLRPGCTHDASDEAQLAELKTLGNLTRKAWEHDVQVMVEG
                     PGHVPMDQIEFNVRKQMEECSEAPFYVLGPLVTDIAPGYDHITSAIGAAMAGWYGTAM
                     LCYVTPKEHLGLPDAEDVRNGLIAYKIAAHAADIARHRPGARDRDDELSKARYNFDWN
                     RQFELSLDPERAKEYHDETLPADIYKTAEFCSMCGPKFCPMQTKVDADALTELEKFLA
                     KEPVAQG"
     gene            complement(288108..288581)
                     /locus_tag="ANA_C10259"
     CDS             complement(288108..288581)
                     /locus_tag="ANA_C10259"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93066.1"
                     /translation="MSVKPKRLVNPYEERMLEFLQTCIDKNYKIHTQVSLCQFCELGS
                     SLDIKLRNFFFSSSVDALITNKDYKPCLVVEFQSTYHDSHEARERDNKKLHLLTLAGV
                     PLIYSRIKDFGLLHLYSQQEEVIFNLFTGEKRENAKALIRNYCEPSNFSNLLAIA"
     gene            complement(288581..289330)
                     /locus_tag="ANA_C10260"
     CDS             complement(288581..289330)
                     /locus_tag="ANA_C10260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93067.1"
                     /translation="MNLKEDFWKKAMSKIIYDVIQRFEVENGVPRLVSTNIQVIEGGE
                     DLLSLAISMLTKLGFYEKFDENRTSQYIGYRLKNPGKGAKRYQLVLSQRKEGLCISIS
                     QDVLKSEILELTCFTEYNVPADDLGNDYVFTTHILGRFWILPSKEDIFLEVMQSHYPN
                     ILNGEVRGNFSLNPYVIYPDITDLNGEPFGETISMESEEFNLKSLGESSSYLILYEDK
                     LFPYMTQVCITSIEVLEEFINHFVKILMEKN"
     gene            289575..290000
                     /locus_tag="ANA_C10261"
     CDS             289575..290000
                     /locus_tag="ANA_C10261"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93068.1"
                     /translation="MKTNRRGAEDAEGRELGEEMSWLTGEVIGAAIEVHRVLGPGFLE
                     EVYKEALVVEFMIRGIHHEVEKSISLTYKGHDVGRGRLDFLVADCLVVELKAVQTLAP
                     IHEAQLLSYLKITKRTLGLLINFNVPLLKDGIKRIALSL"
     gene            290380..290583
                     /gene="psbH"
                     /locus_tag="ANA_C10262"
     CDS             290380..290583
                     /gene="psbH"
                     /locus_tag="ANA_C10262"
                     /codon_start=1
                     /transl_table=11
                     /product="photosystem II phosphoprotein"
                     /protein_id="AFW93069.1"
                     /translation="MAQRTKLGDILRPLNAEYGKVSPGWGTTPLMGVFMGLFLVFLLI
                     ILQVYNKSLLIQDVLVDWRSLGG"
     gene            290886..291146
                     /gene="tatAE"
                     /locus_tag="ANA_C10263"
     CDS             290886..291146
                     /gene="tatAE"
                     /locus_tag="ANA_C10263"
                     /EC_number="3.5.1.87"
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocation protein"
                     /protein_id="AFW93070.1"
                     /translation="MNIFGIGLPEMGVIMVVALLIFGPKKLPEIGRSLGKTIRSFQEA
                     SNEFQSEFKKESEQLKETVQTTAELEHKHIEAGKTQSENVQG"
     gene            291143..291784
                     /gene="pth"
                     /locus_tag="ANA_C10264"
     CDS             291143..291784
                     /gene="pth"
                     /locus_tag="ANA_C10264"
                     /EC_number="3.1.1.29"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="AFW93071.1"
                     /translation="MKDEEVKPTAVVIPQLIVGLGNPEPKYDQTRHNIGFAAIDTLAR
                     AWQISLAENRKFQGEFGEGNAAGKGKIRLLKPLTYMNLSGQAIQAVTNWYKIPPESIL
                     IIYDDLDLPLGKTRLRLSGSAGGHNGMKSIISHLNTQNFPRLRIGIGKPKNAIDGDNS
                     HTVSHVLGRFSATENKVMSQVLNFVVECVEFSFKQGIEKSMNLCNQSLTQDGT"
     gene            complement(291866..292501)
                     /gene="trmB"
                     /locus_tag="ANA_C10265"
     CDS             complement(291866..292501)
                     /gene="trmB"
                     /locus_tag="ANA_C10265"
                     /EC_number="2.1.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N(7))-methyltransferase"
                     /protein_id="AFW93072.1"
                     /translation="MSPVRVRQHVNPLASKFQTPAASPEWEKIYIQQNLPLHLDIGCA
                     RGRFVLKMAQVEPNWNFLGLEIREPLVVEANRIRDEMELTNLHYLFANVNNSLVSLLS
                     TLPVGRLQKVTIQFPDPWFKNRHAKRRVVQPELVTELAKYLTVGGIVFLQSDIEFVAV
                     EMCDRFDEHPAFEKLGTTTWLTENPLPVPTEREIATQNKGEPVYRALFRKL"
     gene            292653..293753
                     /locus_tag="ANA_C10266"
     CDS             292653..293753
                     /locus_tag="ANA_C10266"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="AFW93073.1"
                     /translation="MKLNFRFAIVSDLHIALPETIWDHPSRFHLVEVSIPAFDSVLAH
                     LTQLDLDFLLIPGDLTQHGEPANHNWLQNRLSQLPFPSYVIPGNHDLPVLMANEQSIG
                     FADFPYYYQQFGYENPQQHYYNRQIFPGVRLIGLNSNSFNDQGEQIGRLDSQQFQWLE
                     RELASIKDELVLVMIHHNVVEHLPNQSNHPMANRYMLENAAELRTLLQRYGVKLVFTG
                     HLHVQDIAYAEGIYDITTGSLVSYPHPYRVLEFNRDELGNESLQVVSHRVESVPDFPN
                     LQTLSRQWMGDRSYPFVLKLLTLPPLSLPLAQAQILAPGLRDFWATIADGDAMLEYPH
                     FPIHVRRYIEEYSAVNDGNTALIDNHSTLLIG"
     gene            complement(293830..295053)
                     /locus_tag="ANA_C10267"
     CDS             complement(293830..295053)
                     /locus_tag="ANA_C10267"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93074.1"
                     /translation="MADQMQWTNALSTRPSLEAAINDVVEQAVASLTAPAHLGLVFIS
                     SAFMSEYSRLLPLLAEKLSVPVLIGCSAGGVIGKKQAGETEEIEAEPALSLTLAHLPG
                     VEIRPFHIVAEELPDSDSSPMAWIDLLGVPPSVVPQFILLSSPFASGTNDLLQGLDFA
                     YPGSVVVGGQASSGFMNGRVGLFCNDKLYREGTVGIALSGNIVLDTIVAQGCRPIGEP
                     LQVTKAKRNIIVELDEKVPLVVLRNLISSLSEEDRTLAQHSLFVGLAMDEFRLNLHSG
                     DFLIRNILGVDPNAGAIAIGDRIRAGQRLQFHLRDAEASAQDLEILLQEYQSQNASEP
                     SPVGALMFTCLGRGTGLYGKPNFDSQLFSRYLHDLPMGGFFCGGEIGPVSGRTFLHGY
                     TSVFAICRSLISDNS"
     gene            295196..297112
                     /locus_tag="ANA_C10268"
     CDS             295196..297112
                     /locus_tag="ANA_C10268"
                     /EC_number="2.1.1.72"
                     /codon_start=1
                     /transl_table=11
                     /product="type III modification methylase"
                     /protein_id="AFW93075.1"
                     /translation="MNKRDIDKVEITSGDIKAEQLEQLKAIFPEVFTEGEIDFDKLKA
                     TLVKATLGKNTDDRPERYSFTWAGKREAIQMLQTPSKATLKPDRNESVDFDNTQNLFI
                     EGDNLEVLKLLRKSYSGQVKMIYIDPPYNTGNDFIYPDNYTDPLDNYLELTGQKDSEG
                     NLQTSNPETSGRYHSAWLSMMYPRLFLARQLLREDGVIFVSIDDHEVHNLRLLMNEVF
                     GEENFVACVCWQKKYAPANDTVDFSATHDFILVYSKQRQFLDSGKAIALIGRMERTEE
                     QNKLYKNPDNDPRGLWKASDYLCNKSAEQRPNLYYPIIHPKTAEEIWPSRTAVWRYSK
                     ARHQQNVQDNRVWWGLNQENKVPAYKRFLSEVGGIISDTWWQHKDVGHNDEAKKQIKS
                     LFPEASQSFDTPKPTRLIKRIVELSTNTDSTDIILDFFAGSATTAQAVLELNHEDTGD
                     RRFILVQLPQKTDNPQFPTIVDLSKERIRRSIQKIKNSDNGKLPLQNRETPEDLGFKV
                     LKLSKSNYRQSEELPSDTEPEAYIEQLELFNDPLVDGWKPENVRYEVMLKQGYSLTSR
                     IEEVTEIESATIYKITDEDKRQHFYISLDNQFHFETARTLKLTKNDLLICLDMAIDDT
                     TAANLVLQCRLKTI"
     gene            297125..297441
                     /locus_tag="ANA_C10269"
                     /note="type III restriction enzyme;
                     disrupted"
                     /pseudo
     gene            297973..298875
                     /locus_tag="ANA_C10270"
     CDS             297973..298875
                     /locus_tag="ANA_C10270"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="cation transport protein"
                     /protein_id="AFW93076.1"
                     /translation="MIYDNRTEVRKVLIITLLLNVFVMGLKVLVGHWTGSLSLLADAL
                     HSVTDSANNVLGLVAIKFSSPLPDREHPYGHNKFEALGALGIAAFLGIACFEIVQGAL
                     ERILKGGEPVKVSPPELWLLLIVLGINIFVAFYERNVGKRVGSSILIADATHTMSDVW
                     VTISVIGGLIGVWLGYQWLDVALAFPVALLVFWSGWSVLTENLPWLVDQMAIAPETIH
                     TIAVSVPGVINCHDIASRGVIGRQVFIEMHLIVDAPDVETAHNITEEVEKQLEQRFHP
                     VRILIHVEPPAYQSERITFEAEQT"
     gene            complement(298893..299153)
                     /locus_tag="ANA_C10271"
     CDS             complement(298893..299153)
                     /locus_tag="ANA_C10271"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93077.1"
                     /translation="MPNQLMYQQDDFVVLETNQPEQFLTVAELLIKLEKTLSQIAFAD
                     LPLDVQKFESVSEQAQYLLDTSCNLDVGPGEYLQWYAVRLEK"
     gene            complement(299505..300710)
                     /locus_tag="ANA_C10272"
     CDS             complement(299505..300710)
                     /locus_tag="ANA_C10272"
                     /EC_number="2.7.13.3"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="adaptive-response sensory kinase"
                     /protein_id="AFW93078.1"
                     /translation="MLKQDVMQVSQDQPIYAEAPLQLLLFVDGRPQSRQEVQQIRVYL
                     KELEAGYSFELQIIDVGQQPYLAEHFKLVATPALVKIHPEPQQTIAGTNIIPQLKIWW
                     PRWQHAVGTFLKLQADKQECLDEKSQVISPKSTIHSVATSAEAIQLGDEIFRLKQEKE
                     RLQEQLLFKDRVIAILAHDLRNPLTAAAIAIETLQSNYNPDTGGFQRLKSGLAIHLLK
                     QARTQTKIIDRMIADLLQAGRGDDTELPIVPQKLQLGEICLQVLEELSDRYIAKSQTV
                     ETDIPQDLPYVYADPERIRQVLVNLLDNAIKYTPAGGIITVAGLHRTSQKVQFTIGDT
                     GPGIPEENRDRIFENLFRLQRDQSTDGYGIGLCLCQRIIRAHYGQIWVDSSPHGGAWF
                     HFTMPVYPS"
     gene            complement(301100..301207)
                     /locus_tag="ANA_C10273"
     CDS             complement(301100..301207)
                     /locus_tag="ANA_C10273"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93079.1"
                     /translation="MWLIKYCFATPKAATIGFEELIESFRQWFEVVSWE"
     gene            complement(301347..303167)
                     /locus_tag="ANA_C10274"
     CDS             complement(301347..303167)
                     /locus_tag="ANA_C10274"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93080.1"
                     /translation="MVFSFLGKLFGKTPQPKPTEITGLIKISGCENLQRKGDIIFVHG
                     LGGHARSTWHPQELANDDNFWLMWLAQERPDLGIWSFGYNAAPFEWKGATMPLFDRAS
                     NLLEYLTINDIGKYPIIFVTHSMGGLLVKEMLRNAQTFNRQSVIEQTKGIVFLSTPHT
                     GSHLANLINNIGTLARTTVSVDELKSHLPQLRQLNEWYRQNVDAMAITTKVYYETKPT
                     KIVLVVDPDSANPGIKDVQPTATDDDHISITKPKSPDNLVYKGVSRFIKEQLLTIPKP
                     PENNPINISSFYIQRPEIENNCYQNIVQPGALIRIKSPRKMGKTYLISRIFHHIKQKG
                     YRTVSINLWSQENLTDLKTFLQRFCAILSLELGIEDQVEKSWSSRLGNQDNCTNYLKK
                     YILPAIDSPLVLGLDNIDEIFPYPEITQQFSALLRAWHEKAKTEEIWQNLRLVIAHSQ
                     EVDTSINLNQSPFNVGLSVEIGEFNTTQIKELVKQYSLSFSDTEINQLKEMIDGHPYL
                     LTTALGEIAKGNFTLSKFLEIAPTNQSPYGKFLNFYLSELEKDDLLKTAMQQVINSDI
                     PIQIDSTQALKLRSLGLIEFKGNEVQCLCDLYRLYFQERL"
     gene            complement(303485..303802)
                     /locus_tag="ANA_C10275"
     CDS             complement(303485..303802)
                     /locus_tag="ANA_C10275"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93081.1"
                     /translation="MNYQVIIQPTAFQEIETSYRWMCDNLSPEMANNWYYEFQDTIAS
                     LQNFPNRCSKAPESKVIGCEVRQIWIGKKRKYRVLFVVMEDVVAILHVRHSRQSYRGE
                     ESE"
     gene            complement(303799..304065)
                     /locus_tag="ANA_C10276"
     CDS             complement(303799..304065)
                     /locus_tag="ANA_C10276"
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death family protein"
                     /protein_id="AFW93082.1"
                     /translation="MTIKELLLQEIDNTPNEILEDLFSFLQSLKTDSKHPSSIYQELL
                     ERIDYLEAIVGIRKGLDEFEQGQGIPVEEALATLKDKFNIPPRS"
     gene            complement(304174..304281)
                     /locus_tag="ANA_C10277"
                     /note="plasmid stabilization system protein;
                     partial ORF"
                     /pseudo
     gene            complement(304278..304508)
                     /locus_tag="ANA_C10278"
     CDS             complement(304278..304508)
                     /locus_tag="ANA_C10278"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93083.1"
                     /translation="MLSVEELIQEALSLPNATRVFLVERLMESLESDIDENTQNLWNI
                     EAKKRRDEIRNHTVELIPGELALTQVRRILEK"
     gene            304648..304941
                     /locus_tag="ANA_C10279"
     CDS             304648..304941
                     /locus_tag="ANA_C10279"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93084.1"
                     /translation="MNQPIPTINTRLLDSLSQIILALSQEEYQILVEKIQHSRLTEHQ
                     KTQNIESLKQDIAAGIQQLQNGEYTEYDENNLSTLITSIKERGRERLQGEISE"
     gene            304938..305240
                     /locus_tag="ANA_C10280"
     CDS             304938..305240
                     /locus_tag="ANA_C10280"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization system protein"
                     /protein_id="AFW93085.1"
                     /translation="MNHFRISKLAEKDLEDIWIYLGQQNEILADQKIAQIFDKFPMLA
                     QFPNMGTKRDELQTGIRSFPVKPYIIFYTQDSASLEIVRIFHQSRDIKNQFSEHDI"
     gene            complement(305355..307769)
                     /locus_tag="ANA_C10281"
     CDS             complement(305355..307769)
                     /locus_tag="ANA_C10281"
                     /codon_start=1
                     /transl_table=11
                     /product="GUN4 domain-containing protein"
                     /protein_id="AFW93086.1"
                     /translation="MTFQNYQYQFGGSLPPNAPTYVTRKADEDLYQAVKAGEFCFVLN
                     SRQMGKSSLRVRTMQRLQLEEIACVAIDLTAIGTSGLNSEQWYNGIINNISESLKLEN
                     KFDLDALWEENKRLSNVQVFGKFIDKVLKLVSTQIVIFIDEIDSILSLDFPVDDFFAL
                     IRAFFNQRVDNSEYNRITFVLLGVATPSELIQDKKRTPFNIGKGIELTGFEFTEALPL
                     IDGFSHQTKNPETVLKVILDWTGGQPFLTQKVCNFICESKDEIPTGEEASFVENLVKN
                     RVIKNWEAQDEPEHFRTIRDRILKRDENKAAYLLDLYQQIWHSQGIDTDNSIEQSDLQ
                     LAGIVVKKNGKLKVYNQIYQTIFDGLWIEKTLASLRPYAENFRQWLLSGKQDKSRLLR
                     GEALAEAEVWVKDKSLGFEDKEFLAASRTQEQEEKAIKIEAEAKQEADRQLEIVRKEI
                     AKIRELAAVASQLQQDNKVNEANQFLNVAGLVLQEKIKNQNMKSAVLNGCIVLGYQYL
                     LDNSQDKFSSQEQKYKKLKEDFDKSFEKLPKENKLNHNESSYLATLIYIYYIKGNLEE
                     DQNKSSDYYKIALEKYEILKYHIRFDIDLFKLDLNILYNVNVDIVANLCFKLKELNNS
                     NTGYYELLKKHLLNELDYLMQEKRWQEADQKNWQFILVLAKREKEGYLELNDIKNFNC
                     NDLKQLDYLWVKNSQGHFGYSVQRRIYLETRNSLDYDCEEEELKWDEFIIGETWHNFA
                     DKLGWTDKTHYRKYEELGWLEMKDLDTFRLYGTIPWWHSGGESMNSSNILNDFYVTFL
                     FFVDYL"
     gene            307963..309291
                     /locus_tag="ANA_C10282"
     CDS             307963..309291
                     /locus_tag="ANA_C10282"
                     /codon_start=1
                     /transl_table=11
                     /product="S-layer domain-containing protein"
                     /protein_id="AFW93087.1"
                     /translation="MFSRNYPAVFLSFAVLLSLTACANSQSAKNLEQSLAADPQLQNN
                     PVPFGKPQSQQVTPNPNTSTIKLPADFPADIPIYPNAKLEEVTPANSENKISIRWQSG
                     DPSNIITSFYRQQFQAKNWQIVQQPQDDVDGTFSAKRNDLLINVTIKPQTVTKAEPNQ
                     PQTATKLVIEYSSNSKDTSTNPVIPSDNSEFIGPVLPNSNNSNVVTQPTLQPTTQPET
                     LTTQEFSDIQKAPPEWRSHIQDLATLGILSIEPKTTEFLPDKIITRREYARWLVAANN
                     AMYANNPAKQIRLASSSTQPAFRDILTKDPDFPVIQGLAEAGLIPSALSGDATAVLFR
                     PDAPLTREQLILWKVPLDTRQALPAASLEAVKQTWGFQDAGGIEPKALKAVLADFQNA
                     EQSNIRRVFGYTTLFQPKKPVTRAEASAALWYFGTQGEGISATEALKLRS"
     gene            complement(309363..310097)
                     /locus_tag="ANA_C10283"
     CDS             complement(309363..310097)
                     /locus_tag="ANA_C10283"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding domain-containing protein"
                     /protein_id="AFW93088.1"
                     /translation="MWCSFDKSRVTIALTCMVVASVVASDIAFAARQRNYTPDEFRSV
                     LRGLGYNVKVTKDPLTDEETKKAINQFQTGYKLKVDGKVGPKTQDQAAKIVEILQANL
                     NTVLKPKTLLPRDQFYSPQLEELVKEYQKKHQLSETGIADLRLRQKLNEEVKNIIDKP
                     TPTATPTAKPTAKPTAKPTAKPTAKPTAKPTAKPTAKPTATPTVKPTAKPTVKPTVKP
                     TATPTVKPTATPTTKPTATPTTKPEK"
     gene            310533..311951
                     /locus_tag="ANA_C10284"
     CDS             310533..311951
                     /locus_tag="ANA_C10284"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93089.1"
                     /translation="MSKLKNYQRKNLWFERVMAITATANLVLVFFDLSYVPWRDFYFR
                     RLPELTRLYDSIKGIEPHRDTKKYLEAVARLEVQVTQTGLISPQVKAKLADLRFLSKE
                     MIETNPFAGAGKSGTLEKIKNRMRERVSKESAKGAFNTFWSQEYLSKHGWNQEIDFFN
                     QKIRPGIAKNYYRKIGENGEFLNNFWIIDLPFVVLFAIELLGRTFFIKRRYSHLSWLE
                     AILWRWYDLLLLIPIWQWLRVIPVTIRLDQAKLVDFYVIRRQIHQGILANFAEEITEI
                     VVVQVINQFQGSIQRGEITRWLLESENVRSYIDINNINEVEAITGLLIKTLVNQVLPK
                     IQPEVNAILCHSIEIACQQLPGYSNIRIIPGLGKAQTQISEQLATQITNNIYAALAST
                     IKDPVAAKLSTQLIEKFTTSFTSEIQKKQVLVEIQSLLNDFLEEVKINYIQRLSQEDI
                     DKILEETRKMRTESSSSLSIRQ"
     gene            312175..312471
                     /locus_tag="ANA_C10285"
     CDS             312175..312471
                     /locus_tag="ANA_C10285"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93090.1"
                     /translation="MNKIIDGDINQIDIKLFLEEIIPAQAETLCGGYCQSSQDDRDAY
                     MNDIAEIINNAKKQTQGVDDKRSNQKINTIDKSKKTYLNGIEIPRKGKTVVISF"
     gene            312741..313745
                     /gene="moaA"
                     /locus_tag="ANA_C10286"
     CDS             312741..313745
                     /gene="moaA"
                     /locus_tag="ANA_C10286"
                     /EC_number="1.97.1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein A"
                     /protein_id="AFW93091.1"
                     /translation="MTTSATINKVDYLRISLIDRCNFRCQYCMPEGAELDYIVKQQLL
                     TDEELLTLIQEVFIPVGFTRFRLTGGEPLLRPHIVDLVAKIAHLPQTEDLSMTTNGFL
                     LAPIAQNLYNAGLRRINISLDSLDPHIFAEIIGNHGRGRWQQVWQGIQIAYNVGFDPL
                     KLNVVVIPGVNDHEILDLAALTIDKQWHVRFIEFMPIGNGDLFSDRGWVSSADLRQSI
                     RGRWGLTESQVRGNGPADVFQIPGAKGTIGFISQMSECFCDRCNRMRLSADGWLRPCL
                     LNETGQIDLKTALRAGISTTDLQAQVRQILNIKSEINFKQRDPGTVGTYTRTMSQIGG
                     "
     gene            complement(313813..314421)
                     /gene="rpsD"
                     /locus_tag="ANA_C10287"
     CDS             complement(313813..314421)
                     /gene="rpsD"
                     /locus_tag="ANA_C10287"
                     /EC_number="3.6.1.27"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S4"
                     /protein_id="AFW93092.1"
                     /translation="MSRYRGPRLRIVRRLGELPGLTRKSARRAYPPGQHGQNRKKRSE
                     YAIRLEEKQKLRMNYGLTEKQMLRYVRKARRVAGSTGQVLLQLLEMRLDNTVFRMGMA
                     PTIPAARQLVNHGHVTVNGKPVDIASYQCRPGEEVAVRNREASKKLVEANLQYPGLAN
                     LPSHLEFDKTKLSGKVNSVIEREWVALQVNELLVVEYYSRQA"
     gene            314686..315237
                     /locus_tag="ANA_C10288"
     CDS             314686..315237
                     /locus_tag="ANA_C10288"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93093.1"
                     /translation="MSNFGNKQTNYFFRGFTASLITIGGLLASSLPTMAVTDSYENDY
                     RVCAAQLLSVGITAKPASQSCAATLQPRELSSCVAKIHKLTQITPVDALSSCRQARIP
                     QDLATCVVSISKSYQGSENSATLTSCGRSLLPVTFADCVVGLRREIDLSPTQALNTCI
                     DASEGSSGFGAVSTKPLGSNSQQ"
     gene            complement(315334..316233)
                     /gene="hetR"
                     /locus_tag="ANA_C10289"
     CDS             complement(315334..316233)
                     /gene="hetR"
                     /locus_tag="ANA_C10289"
                     /EC_number="3.4.21.-"
                     /codon_start=1
                     /transl_table=11
                     /product="heterocyst differentiation protein"
                     /protein_id="AFW93094.1"
                     /translation="MTNDIDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAAT
                     AAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKIIVEEVRLALTEGKLLKMLGSQEPRY
                     LIQLPYVWMEKYPWIPGRSRVPGTNLTGEEKKQIEQKLPDNLPDAKLVTSFEFMELID
                     FLHKRSQEELPANHQMPLSEALAEHIKRRLLYSGTVTRIDCPWGMPFYALTRPFYAPA
                     DDQERTYTMVEDTARYFRMMKYWAERKPNTMRAVEELDIPPDWIEPAMEELDEIIRSW
                     GDKYHQEGGIPMILQMVVGNKDE"
     gene            complement(316907..319162)
                     /gene="sepJ"
                     /locus_tag="ANA_C10290"
     CDS             complement(316907..319162)
                     /gene="sepJ"
                     /locus_tag="ANA_C10290"
                     /codon_start=1
                     /transl_table=11
                     /product="cell adhesion protein"
                     /protein_id="AFW93095.1"
                     /translation="MGRFEKRPENPRIRGELSRAAENALWDVVEDLENLQQNLLRSLQ
                     EDVKRLEIEKTRLSTDIQKLIEEKEQLQQSRQITEQQVLIRQLAEVLAKHISSQLQSS
                     LKTLATQAVEYNPSDLVTLQNAQINNNTVNEIGQNVTNMLDSLDDNVTIAFNSLLQEL
                     KNYQGDLSQQLSRMYSQQQQGEAILAEFVNRLRSEVEKNRDANSLKVITGGPPTVLQL
                     ADSLRGEAITHQNGNGEKSSQKIIVEPVTLIPHQSPQGDSTSAANAVILSSPTEKSPE
                     PSSFVNPDLPAIPENQSPELSSFVNPDLPAIPENQSPELSSFVNPDTSLEDKNSELSA
                     VLTSKVLTAPTLGETKPEPVSVLTPNLSTGRPPTPKLRRETTSKQKTTPKQPATPQQP
                     ATPRQPETPRQQRSRTSPNWSQLQIGFLLICLSTVVSSLYNVAIKAIFFTASNPLGGL
                     PTQQLIFPTLGNIFLILMLRLLVVVPLMLLLSPILHPPIWQELENLFASLRANATPVQ
                     NKTKQSLFLSVISGCLLFLSQVFIYIAIGEVTTGIAIALFFIYPVMSVFLSWVLFQER
                     PSLMVTGAMAAIFCGELLVLGSQSVGVNNTSLGSTTAILSGIAFAIYVILTRICATKL
                     KLHPVSLTSINFTTMLLLSFICLIIPLPSNLGLAISSSNILELVLSAFILGVLTLCGY
                     LFNNFGIRNLGTPVSSLIGATVPILTVIFAGVMLQESLNIAQVIGVILVTVGAASISL
                     KKTPNQLQPSE"
     gene            complement(319538..320794)
                     /locus_tag="ANA_C10291"
     CDS             complement(319538..320794)
                     /locus_tag="ANA_C10291"
                     /EC_number="3.6.3.27"
                     /EC_number="3.6.3.28"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transport protein"
                     /protein_id="AFW93096.1"
                     /translation="MVYFMDIQTTTVALLAFYVAWNLGANDVANAMGTSVGSGAITLK
                     QAIIIAGVLEFLGAVLFGQEVTSTLGTKIANPALFVTTPQTLVMGMIAVLLTAGIWLQ
                     IATARGLPVSSSHAIVGAIAGFSWVALGIEAIDWSSIGLITIGWILTPIISGAIAAGF
                     YSLIQHWIFNQPQPLSQLQEWIPWLSTLLLSVFGIIVLPTITQPLSQFLLTEGKFNIP
                     AHDITLFTGGIAVLSLTLISWRQLANSQIDNKIQGLFAKFQVLSACFVAFAHGSNDVG
                     NAIAPLAVISYINQQGKVPSDQLTIPLWILVLGAMGIVAGLAVWGKKVIATIGENIIS
                     LEPSNGFCAELATAITILIASRLGLPVSTSHALVGGVVGIGLVQNIKSIKFATIQNIA
                     AAWLITVPISAALSATIFTLMAIFWQ"
     gene            320912..321973
                     /locus_tag="ANA_C10292"
     CDS             320912..321973
                     /locus_tag="ANA_C10292"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase domain-containing protein"
                     /protein_id="AFW93097.1"
                     /translation="MFDIFTKLSYQALQSGKNYFAFAHKTVSSQIKNLIYPSLQPNIS
                     PLSPKLLTQLQDNMNQLLARDWEDSQAGVYPQNLLFDNSWDDFFRYYPLICLDLPNIW
                     ERIKNRKYQEFSQEIATDNYPSYYLQNFHYQTDGYLSELSANLYDLQVEILFGGSTDA
                     MRRRILCPLKSQLTAFDHIPQEQLRVIDIACGTGRTLKLIRAALPDVSLFGIDLSSAY
                     LRKANELLSQIPGELPQLVQGNVEELPYRDNYFHGTTCVFLFHELPAAVRQTVIEECF
                     RVTKPGGVFIICDSIQENDLPEMELVVKNFSETFHEPYYNHYVTDNLVERLEKAGFEQ
                     IETQVHFVSKYWIAHKPSH"
     gene            complement(322490..322726)
                     /locus_tag="ANA_C10293"
     CDS             complement(322490..322726)
                     /locus_tag="ANA_C10293"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93098.1"
                     /translation="MRAAISLLVSSLVLGSLAFNCEAVQTRFSALSMAKSDYQLSPLV
                     LNQSFNLADNSKPSPNQPEKPNPHRGSGRRGLDG"
     gene            complement(322834..324576)
                     /locus_tag="ANA_C10294"
     CDS             complement(322834..324576)
                     /locus_tag="ANA_C10294"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="AFW93099.1"
                     /translation="MMNQTYTTDVLVVGGGTGGTAAAIQAARRGVKTILVSEFPWLGG
                     MLTSAGVSAPDGNELQALQTGLWGAFLQELQRRQPGGLDHSWVSFFSYDPRIGAEIFA
                     DWVRELPNLQWISGQVPLAVLRTQDCITGVRFADFTVNAKIILDGTELGDLLALGEIP
                     YRWGWELQSEWREPSAPTNFNSLTQTYPVQAPTWVVVMEDFGENTAPAILPAPNYDPS
                     QFTGAWDNYSPEKFLNYGRLPADRFMINWPIAGNDYCQNANRLLDSVKKREFVQECYW
                     HSQNFAHFIQTQFGRRYGLAENLFPHPNSAFALHPYYRESRRLVGLTTVCEQDILPLA
                     NSNTALPFSDAIAVGNYANDHHYPGVEFSLQPKSIRWGGRWTGTPFTIPYRALVPATT
                     DGLLVCEKNISVSHIANGTTRLQPIVMGIGQAAGMAASLCIVLECQPRDLPVKSLQAA
                     LLTDDDAPSPIVPLFNLLTNHPDWLYWQTYYLDHPEAYPADGNCPCILVDEDNKLDLD
                     CFTGRFRRLGEQNYQFNITNDTNLTTTNWQLVTLKSDIDQQLQALTPEKILKIWGRPN
                     FSGNWLLVEHLEEV"
     gene            324695..326017
                     /locus_tag="ANA_C10295"
     CDS             324695..326017
                     /locus_tag="ANA_C10295"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="AFW93100.1"
                     /translation="MNNILRIGTLLRERYKIIDLLSHHTGFGITYKVKDSNHPNQPIR
                     ILKQLKKPTASKLDIENLSILQQQEILNQYWQEYLRLFRIETQALGKLGEKHEQIPTI
                     YERFSEGGEEFYVQEYIEGNSLSQDVRQNQRLSEEKTISLLIEILEVFEYIQNNPGYA
                     IIHRDIKPDNIIRRSSDNKLVIIDFGLAKEVTVPGIKVGSVMGGTKGYIAPEILLGIV
                     SFASDIYSIGMIGVFAITGEDPSYTPLLAENWQKKASVSHEFADILNKMICEDYTKRF
                     QNAEEGLQALMGNQAPPPPAPPIPWKLILGTISGIILIISVVMAVMSILPKSNDQLIA
                     DGKAKSGQLTSSDQKELSNNKTYDVYTFKSDQRQYLTVQIISNDFQPQLTMMKPDDKY
                     FNPVSNVGTKDNDFTASIMVETGTYQFKITSTKAASGNYVIKAWVTDR"
     gene            326119..326643
                     /locus_tag="ANA_C10296"
     CDS             326119..326643
                     /locus_tag="ANA_C10296"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93101.1"
                     /translation="MKSYQWLLFPSILILNLTFTACQKSEKVVFSCETDGNGEPVAKV
                     KYQDKTRDLIEWKRTNFVKAGFPPQRRCQEVTPKLQTAYDNGSLKDLTWGYSEAENDP
                     RKLLKSLCTSTGKDCHTLILTLLDTDDADVELKSFTAVLNGDASKAYLTSSCAVKPRS
                     NLTCTVDIFKVFNK"
     gene            complement(327074..327502)
                     /locus_tag="ANA_C10297"
     CDS             complement(327074..327502)
                     /locus_tag="ANA_C10297"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93102.1"
                     /translation="MCGGAIAERGRCFLVFIMFYQAPEIQGSIRNLRQYYRESMRQDV
                     WAYEIYIDDVLVISEDCHWWSNTRAEVITAVKEIGEQLKQKELVKRELATVGNNLYVK
                     WCTDITRAGKAQGITGYYSIFVKGKPYSVYQYLSQITRVR"
     gene            complement(327554..328081)
                     /locus_tag="ANA_C10298"
     CDS             complement(327554..328081)
                     /locus_tag="ANA_C10298"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93103.1"
                     /translation="MNPNPSDLKLVSKVKSETLADLRSFCRESVNLMTSDVSSYAQGR
                     YRLWLFHECDLRTPSTITKAYHNDRLGNFCQRVYPGTNIGLLTFGGKIGNIQSTGLII
                     PHRDHSYSRAIARTVNLGSCIFHYNGKDYQLNDGDIIEFNCKKLHGVTKILSAERFSI
                     NLWQLNQEKGYFPIV"
     gene            complement(328191..328490)
                     /locus_tag="ANA_C10299"
     CDS             complement(328191..328490)
                     /locus_tag="ANA_C10299"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93104.1"
                     /translation="MAINIPSKFGSRLPEPNKKKGIDFDKLTEKLRFERDNIQPYLTN
                     HQLLFYHHNCDLFVGNYYHGKNHFLNVNFTGDESEEYPPHRNDEYDEVGKILAHI"
     gene            complement(328580..328936)
                     /locus_tag="ANA_C10300"
     CDS             complement(328580..328936)
                     /locus_tag="ANA_C10300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93105.1"
                     /translation="MAINILSKADKKLSQLKDGIRVLAWEQYKIDNRVKGEEGYKIFE
                     AEWLTHDIHKMDQAKFDKFIAGLGYTVDDLLAERNRYYQKRNRATGIGNEPASFDNKP
                     ASVDYVEGNQPDNIPY"
     gene            329267..330265
                     /locus_tag="ANA_C10301"
     CDS             329267..330265
                     /locus_tag="ANA_C10301"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93106.1"
                     /translation="MGIYYKSQKPGANMTEATANYDQTWKEAIGQYFESFLQFFYPKI
                     YEQIDWSKPPISLDKELEQITASSQTKKRYADKLFQVWLLNNEIIWILIHIEVQSQYD
                     KQFPQRMFIYNYRSFDLFNKPVISLAILGDENKSWRPNSYEYGLGDSEVKIKFSTVKL
                     LDYQWEELAASNNLFAIIVMAHLKTKVTTKDLTQREQWKWNLVRPLYQKGLTKFDIIN
                     LVKFIDKMMTLPPPLQLEFNHKLEQHEKELNMPFLSTIEELAEERGQVKGAKETCQQN
                     IFDLLENRFGTLPEKLMETLKEINDLMALKNLHLKTISVNSLDEFQTLINAVLQPK"
     gene            complement(330392..330760)
                     /locus_tag="ANA_C10302"
     CDS             complement(330392..330760)
                     /locus_tag="ANA_C10302"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93107.1"
                     /translation="MFNNIGDCIMIGQLFTTGIGIYQMYPGDDNKWIAQVDFEDESHA
                     QLWGVQGTLATKYGDDLLESVRTVKQDAENLGMRMLSLPDTKLRLYVKRLFVDNAEVW
                     KQIESVGKELDLEVISCLPE"
     gene            complement(330867..331253)
                     /locus_tag="ANA_C10303"
     CDS             complement(330867..331253)
                     /locus_tag="ANA_C10303"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93108.1"
                     /translation="MMNKINFAGIEGKVLQVSPHGNYQVVELSDSEALRRNRITIVGT
                     YSNKFHWPESSDESSGFTSFITYIGLKQVDFPRFRDWVIANNGYFEGDDGTPRQSKRV
                     RRFPLEIKVRGLLAESVVELIHGEIG"
     gene            complement(331563..331811)
                     /locus_tag="ANA_C10304"
     CDS             complement(331563..331811)
                     /locus_tag="ANA_C10304"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93109.1"
                     /translation="MVLLLVNIMTTAFFKRTGINPLKSIEITVEQLNLLFNEPRITGV
                     VDISGSGKLIVSCEDGLARMIGFSDSEIIWFDSYSEQD"
     gene            332016..333230
                     /locus_tag="ANA_C10305"
     CDS             332016..333230
                     /locus_tag="ANA_C10305"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93110.1"
                     /translation="MTPEEVLSQITNGIWVNKGGLRVPTEVVQALSTKEDWFDSIQPV
                     VYLQNNLPDLKAIINYFSEPELDDEVGYASAEILQSCYGVNKVFNSKVHGNPNIVGQQ
                     KLDVIGQRPANIETYKASVEVNNILINWKNINNSGYNNNESIYDRIKNVEQANKSWFS
                     QQIEDLKTLMLNAYDNLLSQFEQQQEPVPQEVINHFIEIREKTDKKFSSAIADFPKDN
                     LNIINIFQGLLDKLKKQLEDALQSIKELISDKNEYKMAKAEARQKYKAKSGVLKFLKS
                     KLVKPTIGGIKKLFRKAGKLLSNKNQSNYKKDSLKSQFGDISSAYGAIVPVDVPTTIN
                     AIEVLKKITESILTTFILKGVKLPGVLVEALKNTTVSIILKRLDIPGGEAIRYITGGL
                     LRTVKHLLPAIL"
     mobile_element  333220..334671
                     /mobile_element_type="insertion sequence:ISAsp3"
     gene            333315..334655
                     /locus_tag="ANA_C10306"
     CDS             333315..334655
                     /locus_tag="ANA_C10306"
                     /codon_start=1
                     /transl_table=11
                     /product="IS4 family transposase"
                     /protein_id="AFW93111.1"
                     /translation="MFDILTLLQCLLPEIKVTTMRQLSQIIMAMLAMSGRVTMLGISR
                     WTLSGGSYRTVIRFFRTVIPWATVFWVFFRRHLFCPNDVYLLAGDEVVISKAGKKTYG
                     LDRFFSSLTSKPISGLSFFTLSLVSVQQRHSFPIQIEQVIKSDVEKSIVSPIPEVKPQ
                     EKPGRGRPKGSKNKNKQEVIFTSELLRIQKMINELFKLIANFIPLTYLVVDGHFGNNN
                     ALQMARQVKLHIISKLRHDSALYIPYQHPDPNHRSRRKYGDKLDWRNIAGEYLRQSSI
                     DEDIKTDIYQMTLLHKEFAQSLNVVILVKTNIKTNAVSHVILFSSDLDLSYEKIIDYY
                     RLRFQIEFNFRDAKQFWGLEDFMNRGQTAVTNAANLSFFMVNLSHYLLAQFRQDNPGA
                     GIIDLKAYCRGFRYVREMLKMLPEQPEPILLAQIFAKLTSLGRVHNAPTAVEPS"
     gene            334804..336849
                     /locus_tag="ANA_C10307"
     CDS             334804..336849
                     /locus_tag="ANA_C10307"
                     /codon_start=1
                     /transl_table=11
                     /product="TPR domain-containing protein"
                     /protein_id="AFW93112.1"
                     /translation="MKLHKLSHLLLFFVLLFPASPIIITGCNSSLFARKPGTLSESEL
                     KDVLKEITVKVLVDDKEAASGTIIKKQNGFYTVLTNYHVIENAKSVKVVTPDNQIYPV
                     EFSKVDRQDNKKDDLYDLAKLTFSSETTYLVAGLGEENIKPGEKVFAGGYVKGNLQTT
                     KGTAKLFLNQPLIKGQQIAYDNDIQQGMSGGAIINEKGYLVGINSKLANPVLQTDFRY
                     LQGEQPDEKTLKEWGNYSWGIAVNLVDEAAPDLALFPERVIRKIGGIPAKVLDIAKQS
                     SVQIKQANGGIGSGVIIAKDNDIYYVLTAAHVVENKQEYQVVAPDKQVYKVDNQTIRT
                     RQGLDMAVLQFRSSQVYQVATLGDYKLSDKAQYVFLYGWKGEELNHPSLFSVGTIETN
                     TDFWAKPRGYELAYSNQGYPGMSGGGIWDTEGRLVGIHNFAEKDVLGYSLGLSIESFL
                     FYQKDGLWQLPQAKLTVAKIEPKSSDFNSINLAFFPNISAPDPVNGSGKDWLNYGIQL
                     WRIADIDNVIAAMENAIGKDPNSWQAFYNVAWIWRGQKKYDQAIADFTQAITINPQFA
                     AAYYNRGVAYSKQGKTELAIADYTQAIIINSKYENAYYNRGNAYSKQGNLDQAIQDYT
                     QAITINPLNRKAYYGRILTYILKGNKQEAIKDLETAKQLFQQQGNTQNAQKTQELLN"
     gene            337127..337543
                     /locus_tag="ANA_C10308"
                     /note="XisH protein;
                     with internal stop codon"
                     /pseudo
     gene            337531..337884
                     /gene="xisI"
                     /locus_tag="ANA_C10309"
     CDS             337531..337884
                     /gene="xisI"
                     /locus_tag="ANA_C10309"
                     /codon_start=1
                     /transl_table=11
                     /product="XisI protein"
                     /protein_id="AFW93113.1"
                     /translation="MDKLEQYRNIIKKILTEYYEMSNTQISKKYEFEVSERLAIDENR
                     DQYIWFRFGWDDKKQIQHIIIYLTIKNGKVWVEEDATDLCIVDDLLSAGIPQNDIVLG
                     FHHPSKRVFTEFATA"
     gene            337972..338181
                     /locus_tag="ANA_C10310"
     CDS             337972..338181
                     /locus_tag="ANA_C10310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93114.1"
                     /translation="MKSRSFTVIIYKEDDMYIAECPEVGTVDQGETIEQAITGLKEAT
                     RLYLEEFPLPETSPRYVTSIEVTYA"
     gene            338174..338401
                     /locus_tag="ANA_C10311"
     CDS             338174..338401
                     /locus_tag="ANA_C10311"
                     /codon_start=1
                     /transl_table=11
                     /product="YcfA family protein"
                     /protein_id="AFW93115.1"
                     /translation="MPKLPRISSKEAIRTLERMGFYQIRQTGSHVIMKKQTINGEVGC
                     VVPLHPELKVGTLSGVLKQAQITPEEFIENL"
     gene            338432..338584
                     /locus_tag="ANA_C10312"
                     /note="hypothetical protein;
                     partial ORF"
                     /pseudo
     gene            complement(338722..339054)
                     /locus_tag="ANA_C10313"
     CDS             complement(338722..339054)
                     /locus_tag="ANA_C10313"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93116.1"
                     /translation="MKDERLYLSNIKECIERIEEYTKGGKEEFMQNKMIQDAVIRNFE
                     IIGEATKRLSPELRSQYSDVPWQQMAGLRDVLIHDYLKVNLNLVWQIIEQNLSNLKRQ
                     VTAILQNP"
     gene            complement(339051..339341)
                     /locus_tag="ANA_C10314"
     CDS             complement(339051..339341)
                     /locus_tag="ANA_C10314"
                     /EC_number="2.7.7.-"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase domain-containing
                     protein"
                     /protein_id="AFW93117.1"
                     /translation="MGIEELLLPFREQILKIATKYGAYNLRVFGSVARGEATPDSDID
                     FLVELKPQSSLFDYIGLMQDLAALLGRKVDIAEPGNLHELIRDKVLSEAVPL"
     gene            complement(339465..342620)
                     /locus_tag="ANA_C10315"
     CDS             complement(339465..342620)
                     /locus_tag="ANA_C10315"
                     /EC_number="3.2.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase family 38 protein"
                     /protein_id="AFW93118.1"
                     /translation="MNLPVSSLNTKSISTAIENLRSCCQVDIQSTWRYQETDEVVTDF
                     IPFSLTDWQPVELNEKDHIFWKGGKQVLWLGQKFSVPENLHNFPLTGLSLRVALVWWA
                     DLAEVYVNDKLVLTGDLFDSSPRVLLSSSVTPGEEFTIALRLVSPGHCDGALMRSLAI
                     YESTDYNHPDAGFIADELAVTEILIQNFAPEKIPNLAREVEKVTNLKDAENQDWKTYL
                     VNLRETYVGLAEFINAQKYKINLLGHAHLDLAWLWPVAETWKAAQNTFESVLQLQKDF
                     PELIFCHTTPALYAWVEENRPDLFREIQNQVKAGKWEVLGGFWVEPDLNLIAGESIVR
                     QLLYGQRYFLQKFGKTSSVVWVPDTFGFCATLPQFLANAGIEFFVTQKLRWNDTTKFD
                     YDLFWWRSLDGSQTLSFMSAPIGETIEPVKMAKYACEWKTQTGLQDSLWLPGVGDHGG
                     GPTRDMLETGRRWEHSPIFPKLEFTTSEKYLQFIKSESQNLPVWENELYLEFHRGCYT
                     THADQKRWNRKSEHLLYSAELFATLANILCGAKFPQTEIETAWKKVLFNQFHDILPGS
                     SITQVYEDAIPEWEAVEKMGTKILEESLIGITSKINIPQPPNSESIPVIIFNSLNWER
                     AEVVTVDLSKIITPNYPTWKVADIQGKEILCQNCENSTLLFFATIPSIGYSIFWISPS
                     SPQPKIFPKNWILENEYLQIQVNPETGDLTSVFDKIKQREILTGAGNQLQAFTDSGQY
                     WDAWNIDPNYNTKPLPPTELKSIQWQEYGEIHQRLRVVRQLGKSEFCQDYILELGSPI
                     LKITNTVNWQENQVLVKTAFPLNLQAEFATYEIPCGAIRRPTNPQTPAQKAKWEVPAL
                     HWADLTTDTEVGKYGVSLLNDCKYGYDAQPSQLRLTLLRSSHWPDSQADRGIHEFTYS
                     LYPHLGSWEEAETVKRGYELNVPFEVLVNPDNYQCNSDGCQSQSFLYLSADNLILMAL
                     KPSEDDSEKFILRFYECHGKTANLSLQSQILSLGEPVDLLENCLKLEENIQPWKIVTF
                     QATLINCSQDLAKDKCLPFSL"
     gene            342721..344025
                     /locus_tag="ANA_C10316"
     CDS             342721..344025
                     /locus_tag="ANA_C10316"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93119.1"
                     /translation="MSSDSSNRYQSKLFNFVYQHSRRLTQKWENTVKNLQVATGLGVG
                     SLLYPLYQLWQQNGTAKQLHSSTPPSSDAPIQIILDVVKNLPPGDADLPTSPKTNPFT
                     FLGSLWEKIFPKPNFPTSENTLQQHIPTVQGIAIELQTRNLVLVSADNRIFDVLTPQQ
                     NVKLADRINSEISEYRYSLQLIAYQQKELLPKIDHLLNKLTDEDSIIARKSLLNPIKL
                     FGFLDQLIANLETTALVPVQKHSQEIVNHFQNQVNGLAVNHDDLKSPQLQISDLIAAA
                     INYFFGGRNNYQIDSNSSPEKLQNKSDFKKVLSSNNQLDSRDSLGDNWLTWNDLFGET
                     NTKLEESVQQPQAKREFSKIHRKIGQQATEPKNEEFPEIDSQTSQGFNFKPDWIDISA
                     TSLGYEKHPLEQILEWLDQSILWIEQIFTNMIYFFRGLLLGR"
     gene            complement(344093..344875)
                     /gene="xth"
                     /locus_tag="ANA_C10317"
     CDS             complement(344093..344875)
                     /gene="xth"
                     /locus_tag="ANA_C10317"
                     /EC_number="3.1.11.2"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease 3"
                     /protein_id="AFW93120.1"
                     /translation="MKIATWNVNSVRTRLEQVINWLTENPVDVLCLQETKVIDKDFPN
                     LAFENLGYYPYISGQKSYNGVALISRQPLTDVNVGFGAILPEIASAWDEQKRVISGVI
                     EGVRIVNLYVPNGSAIGSDKYEYKLGWLKILKEYLQTLLLSNPAISMCGDFNIALEDI
                     DINDKVKIDNHIMASALERQALRDVLSLGFGDAFRKFNNAGENYSWWDYRTAAFKRNL
                     GWRIDHHYLTPTLYERAQSCTIDIEPRKLVQPSDHTPVIVEF"
     gene            345251..345448
                     /locus_tag="ANA_C10318"
     CDS             345251..345448
                     /locus_tag="ANA_C10318"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93121.1"
                     /translation="MSIIVNTCPCCGGSILRHVRHHEVYWFCLSCRQEVPVLNTSSGS
                     NLLSKLETHNQEVLPQTALSS"
     gene            345622..346644
                     /locus_tag="ANA_C10319"
     CDS             345622..346644
                     /locus_tag="ANA_C10319"
                     /EC_number="1.1.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="AFW93122.1"
                     /translation="MLAALLYGQEDLRLEQVPDPTPEAGEVVIQVEAATTCGTDLKVW
                     RRGGHAKMLTPPTLFGHEGAGRIVAVGAGVTNWRVGDRVVANNSAPCMKCFFCQRQEY
                     SLCPHLTWNNGTFAEYLKIPAPIVWHNLLPVPKHLPLVLAAMTEPLACVLHGISRSGV
                     KPHDKVVVLGDGAIGLMFVAVLAKYTEVILWGGNNQRLEIGERFGAAKTFNYHQVTAI
                     ANTVRELTAGWGADVVIEATGVPSVWETAIACGRPGATINLFGGCPRDTTISVNTEQL
                     HYSELTLKGVFHNTPEYVKAALSLIASGTIPFDLLISEHRPLQDLEQVFMDMKARKVI
                     KVAMYN"
     gene            346832..347029
                     /locus_tag="ANA_C10320"
     CDS             346832..347029
                     /locus_tag="ANA_C10320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93123.1"
                     /translation="MIITLLVAWIVFIILWKLIKTTIKTAMISAAVVMLLYFGFGITP
                     QDIWQQISQFAQTFSQTPVKK"
     gene            347116..347958
                     /locus_tag="ANA_C10321"
     CDS             347116..347958
                     /locus_tag="ANA_C10321"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93124.1"
                     /translation="MSFDNVCKILAEKYPLDFANWLLPETVEKIKVLKTELSIEPIRA
                     DSVILLQTNNRILHLEFQTNTKSETPIPLRMLDYFVRLVRQYNLPVTQVVIFLQETSN
                     EIAFTEAYLDEMTNHRYRVIRMWEQDSDLFLNNPALLPLAPLTKTNSAPGLLSQVATE
                     IAKITNVAARQNTAAYTEILAGLRFEKNLIRQLLSEDIMQESVIYQDILQKGELKGEK
                     IGEQKEAFRFLNRQLNRRFGEISLPIIEKMRLLSTEQLEILGEEFLDFSAISDLVTWL
                     DRQK"
     gene            complement(348022..348522)
                     /locus_tag="ANA_C10322"
     CDS             complement(348022..348522)
                     /locus_tag="ANA_C10322"
                     /codon_start=1
                     /transl_table=11
                     /product="putative thioesterase"
                     /protein_id="AFW93125.1"
                     /translation="MSKDTNQPQLPPTSAIESVTNVAFENWFEYPVRAQPHHTDYAGI
                     VWHGTYLTWMEEARVECLRSIGIEFADLVALGCDLPVVELSIRYHRSVQLGMSVLVKT
                     RMAEVTGVRMNWDYTLVSPDGQDLYITAQVTLVALDREKGKIMRQLPPAFQDALAKIS
                     GSRKIG"
     gene            348682..350154
                     /locus_tag="ANA_C10323"
     CDS             348682..350154
                     /locus_tag="ANA_C10323"
                     /EC_number="3.4.11.1"
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl aminopeptidase"
                     /protein_id="AFW93126.1"
                     /translation="MTIQPTNTALLDWTGDTLAIGLFEDAVELTGDLASLNDKCAGIV
                     QEVIAEEEFTGKANSIIVIRLGATHAVRKLILVGLGKPDALKLENLRRVAATVARTAK
                     KQKTKTLGISLPLWNNDSAATAQALTEGIELALYQDIRFKSEPEDKNPQIETIDLLGL
                     AGQEAAIARANQIVSGVILARQLVAAPANAVTSITMAETAQAIAHEYGLELEILEQEE
                     CENLGMGAFLGVAQASDLPPKFIHLIYKPATTPRRKLAIIGKGVTFDSGGLNIKGVGS
                     GIETMKMDMGGAAATLGAAKAIGQLKPDVEVHFISAVTENMISGKAMHPGDILTASNG
                     KTIEVNNTDAEGRLTLADALVYADKLGVDAIVDLATLTGACVVALGEDIAGLFTPDDA
                     VASQLQTAADSAGEKIWRMPMEDKYFDGLKSGIADMKNTGPRYGGSITAALFLKQFVK
                     DTPWAHLDIAGPVWADKEHGYNGAGATGFGVRTLVSWVLS"
     gene            complement(350235..351596)
                     /gene="matE"
                     /locus_tag="ANA_C10324"
     CDS             complement(350235..351596)
                     /gene="matE"
                     /locus_tag="ANA_C10324"
                     /codon_start=1
                     /transl_table=11
                     /product="multi antimicrobial extrusion protein"
                     /protein_id="AFW93127.1"
                     /translation="MRFTFTVPSNYNFLGRFYRLASISVLANMMVPLAGLVDIAFLGH
                     LTDIRHLAGVILATILFDYLYRVLKFMRSSTNAITAQAVGQNDDKAVVLAGLRSGLIA
                     LLVGLIIVLLQYPLQKIGFFILSGSSDIESAGVDYFYARIWGAPAVLLNFVLFGWFLG
                     REMNWVMLLMSIVGNGSNVLLDYLMISKWGWASVGAGLATALSQYLALIVGLIWMFFT
                     IPWQAVPAAIQELFDWVALKETFALKGNILIRFLVLVSVYSIFTNLSATMGTTVLAQN
                     GLLLQIALLSQFTIQGVGVTMQTLTANFKSKDNTQQIIPLLIVSLVTSVVIALGFAGT
                     SIFFPDQVFGLLTNHTEVNQEINQYTIWLVPILVITAITLMLEGYFIGLKEGATLRNT
                     VLLSFVVGFIPLLIAAWYFHNNHLLWSTLLSYMTSNMILLGVSVPQTFKDKSLENQPL
                     ISR"
     gene            351913..352938
                     /gene="plsX"
                     /locus_tag="ANA_C10325"
     CDS             351913..352938
                     /gene="plsX"
                     /locus_tag="ANA_C10325"
                     /EC_number="1.14.21.3"
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid/phospholipid synthesis protein"
                     /protein_id="AFW93128.1"
                     /translation="MGSTGVRIAIDAMGGDHAPAEIVAGALRAREELGVKILLVGDPQ
                     QIEAVMPPKTTMADLEIVPAEEMIAMDEDPLNAVRRKRKSSINIAMDLVKNQQADAVF
                     SAGHSGAAMASALLRLGRLPGIDRPAIGTVFPTIKAGKPVMILDVGANVDCRPKFLEQ
                     FAVMGSIYSQYVLGTENPKIGLLNIGEEDTKGNEVVLRAHQLLRENTQINFTGNAEGR
                     DVLSGEFDVIVCDGFVGNILLKFAEAVGGVILQILREELPQGIHGQIGTAILKPNLKR
                     VKQRMDHAEHGGALLLGVSGICFIGHGSSQAPSIFSAIRMAKEAVDNQVLERLQSQYQ
                     ILQNESS"
     gene            353158..354159
                     /gene="fabH"
                     /locus_tag="ANA_C10326"
     CDS             353158..354159
                     /gene="fabH"
                     /locus_tag="ANA_C10326"
                     /EC_number="2.3.1.41"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-[acyl-carrier-protein] synthase 3"
                     /protein_id="AFW93129.1"
                     /translation="MQNFFNGGIAITGSGSAVPATCLHNQELTQLVETSDEWIASRTG
                     IRQRRLALPPDSLASLATAASQQAIAAAGITAADIDLILLATSTPDDLFGTACRVQGE
                     LGATKAVAFDLTAACSGFVFGLVTAAQYIRTGVYQNVLLIGADILSRWVDWQDRRSCV
                     LFGDGAGAVVLQANKSDRLLGFCLKSDGSQNNCLNLSYNASTTELTPDIHVSTGKYHP
                     ITMNGKEVYRFAVQKVPEVIDKALFAANLKVENIDWLVLHQANQRIINSVAERLEIPE
                     HKVISNVSDYGNTSAASIPLALDEAVRAGKIKPNDIIAASGFGAGLSWGAAIFKWGR"
     gene            354326..355207
                     /gene="fabD"
                     /locus_tag="ANA_C10327"
     CDS             354326..355207
                     /gene="fabD"
                     /locus_tag="ANA_C10327"
                     /EC_number="2.3.1.39"
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl CoA-acyl carrier protein transacylase"
                     /protein_id="AFW93130.1"
                     /translation="MTKTAWVFPGQGSQSLGMGIDLLNLPSAKEKFIQAEEILGWSVT
                     DICQSDIETLSRTLYTQPSLYVIESIIADILREKGQQPDLVAGHSLGEYIALYVAGVF
                     EWSAGLHLVKRRAELMDSAVGGMMAALMNFDREELEKVISETPNVVLANDNSPAQVVI
                     SGTPEAVQAVMSQVKAKRAIPLKVSGAFHSHLMKTAATEFQEVLDSVIFQSATVPVLS
                     NVDPIPAVAAETLKQRLSQQMTGPVRWREISLQLPENGIEKVVEIGPGNVLTGLIKRT
                     ATGLILENIRNAGELPE"
     gene            355780..356682
                     /locus_tag="ANA_C10328"
     CDS             355780..356682
                     /locus_tag="ANA_C10328"
                     /EC_number="1.14.19.-"
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid desaturase 1"
                     /protein_id="AFW93131.1"
                     /translation="MKKYPRLLAFGYMVGPFLIIVTHLGSFLPLFTGLSWRSILWAVA
                     LYVIRMMSITAIYHRLIIHKSYQAPMIIKWIGSIIACSSGQMGPNWWKGHHIQGHHNN
                     SDKPDDSHSPHAPFTGFKGFLWSQCGWLLSRNFFPPSLPADLEADWVLKTIDRLHFIP
                     LILLGVISFWIGGLEFLGAFFLSTMILFHCVAFVNSLSHIFGEKPFVSNDYSRNNWFV
                     ALLTFGEGWHNMHHAFQWSARHGFSVKEGKVIYLIDPTYEFIRLLERLHLSSHLKLPS
                     EVELLEAAYSVSTEPEMMVGIVKK"
     gene            356779..357492
                     /locus_tag="ANA_C10329"
     CDS             356779..357492
                     /locus_tag="ANA_C10329"
                     /codon_start=1
                     /transl_table=11
                     /product="PspA/IM30 family protein"
                     /protein_id="AFW93132.1"
                     /translation="MKKAVYWIMGERAGRTIVGTWNWLWGMPVESGGKVAVAVAEESL
                     QSMQEAVQKLAGAVAAQEGAYKTAKRKYEAKITESKTLEQQAMIAQRSGNEEAARMAM
                     SKAIQTEQILPKLEEMVKQAETAVKASKDKLNRERMKLESYKADMQNMKDMSEVNEAL
                     AMIAKVNNEFDIGSAKSDFEKAKGAVERRNLQTEALVELSENPTEKLQAEIETMTLDD
                     EVARRLHRLQDSQSKQLPE"
     gene            357503..358402
                     /locus_tag="ANA_C10330"
     CDS             357503..358402
                     /locus_tag="ANA_C10330"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type phosphate transport system protein"
                     /protein_id="AFW93133.1"
                     /translation="MSQRSGPPPIVFILLFLGLLGGGYWWFFMRNPAPNPTATQPESN
                     SPAGATSGAFPLPKTVASGTTVKIDGSTSMVTINQNLKNGFEKQFSGTKVDAVANGTD
                     KGIQDLLAGKVDIAAASRPLTAQEQSQGLKAVTVTQDAIALIVGKANPFNRGLTSSQV
                     ADIFQGKINNWSAVGGSAATIRVINRPAISGTHQTFKELVLKGANFGTTPNITTLPQD
                     ATTPLVQALKKDGIGYATFAQVANQQTVRVVAIEGLTPEAASYPFKRSLYYIYKDPAS
                     AGVQAFLGYASSPQGQQALTVGN"
     gene            358474..359142
                     /locus_tag="ANA_C10331"
     CDS             358474..359142
                     /locus_tag="ANA_C10331"
                     /EC_number="2.3.1.51"
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="AFW93134.1"
                     /translation="MDSILFILSSVTRTREPLISLALYHAFKWSVISPLLHTYFRGKI
                     YGAENVPQSGAVIVVSNHASYFDPPIVSTSVRRPVAYMAKEELFKVPVLSQAIKLYGA
                     YPVSRGSADRNAIRSALEYLDNGWAVGVFLEGTRTPDGRIHDPKRGAALLAAKAKAPF
                     LPVCLWGSEKILQPGSPVPHSVPLTLRIGKLIDAPSSTKKEELERVTQMCADAINAMH
                     DLGR"
     gene            359392..360345
                     /locus_tag="ANA_C10332"
     CDS             359392..360345
                     /locus_tag="ANA_C10332"
                     /EC_number="2.1.1.37"
                     /codon_start=1
                     /transl_table=11
                     /product="type II modification methylase"
                     /protein_id="AFW93135.1"
                     /translation="MKSSSLKVIDLFSGCGGLSVGFQNSGFEIVAAFENWKSAINVYQ
                     QNFHHPIFEYDLSQVNNNYSIFKQFLPDVIIGGPPCQDFSSAGKRNEDLGRGDLSITF
                     AEIVANVSSQWFVLENVELFRKSHKYQEFKQILKSAGYGLTEKVLDASLCGVPQKRKR
                     FFCIGELGGQDDNLKTYLEANLSKKPTTIRDYLGNSLGIEYYYRHPRSYQRRAIFSID
                     EPSPTIRGVNRPIPKTYQQHPGDVAPLTPDLRPLTTRERSYLQTFPDNFIFAGSKTDL
                     EQMIGNAVPVKLAEYVAKCLLMYIEDYNKYHISNVMMPLTV"
     gene            360355..360504
                     /locus_tag="ANA_C10333"
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /note="C terminal partial ORF"
                     /pseudo
     gene            361010..361306
                     /locus_tag="ANA_C10334"
     CDS             361010..361306
                     /locus_tag="ANA_C10334"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93136.1"
                     /translation="MSELREKLQQNLDEAEWEWLIPHVQKDAVILVAENLDLLDVGEA
                     IASDNILSVQHWIDEQLLAKPTIDQVGEWNLNREKRFNALIVEPYVIIKEIITV"
     gene            complement(361357..362751)
                     /gene="trmE"
                     /locus_tag="ANA_C10335"
     CDS             complement(361357..362751)
                     /gene="trmE"
                     /locus_tag="ANA_C10335"
                     /EC_number="3.6.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA modification GTPase"
                     /protein_id="AFW93137.1"
                     /translation="MSELLANTGTIAAIATAVVPQQGSVGIVRVSGDQAMAIAHTLFY
                     APGRQVWSSHRIIYGYIRQPQTKQIVDEALLLIMKAPRSFTREDVVEFHCHGGIMAVQ
                     QVLQLCLENGARLAQPGEFTLRAFLNGRLDLTQAESIADLVGAKSPQAAQTALAGLQG
                     KLAQPIRKLRANCLDILAEIEARIDFEEDLPPLDQQRIIADIEQVTAEISKLLATKDK
                     GELLRTGLKVAIVGRPNVGKSSLLNAWSQSDRAIVTDLPGTTRDVVESQLVVGGIPVQ
                     VLDTAGIRETVDQVEKIGVERSHRAANDADLVLFTIDAASGWTSADQEIYQQVKHRPV
                     ILVINKIDLISSAEQENLQSKIQNPKSKILTAAAINQGIDNLETAILEIVQQGKVQAA
                     DLDLAINQRQAAALTKAKIDLAQVQMTITDKLPLDFWTIDLRGAIQALGEITGEEVTE
                     SVLDRIFSRFCIGK"
     gene            362885..363085
                     /locus_tag="ANA_C10336"
     CDS             362885..363085
                     /locus_tag="ANA_C10336"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93138.1"
                     /translation="MEQKINCAEACVNGCVLGDKCPNIEFRESTSKFIEETSLDKMLE
                     IAEERLRKKITEPPTWVFPEDS"
     gene            complement(363399..363839)
                     /locus_tag="ANA_C10337"
     CDS             complement(363399..363839)
                     /locus_tag="ANA_C10337"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase/DNA gyrase/HSP90 family ATPase"
                     /protein_id="AFW93139.1"
                     /translation="MKSELHVPSDLSFINIVENWLLGCLQLHLGESVDWTKQSSLLRL
                     VLIEAYSNAVRHAHKEKLNLPILLRLELKGRDLSIEIWDHGEGFDLSTYFPPNPLDRQ
                     EGGYGWLIMNRLMDKVEYKLQVNGANCLKLETTLTELLPDVLRD"
     gene            complement(363843..365495)
                     /locus_tag="ANA_C10338"
     CDS             complement(363843..365495)
                     /locus_tag="ANA_C10338"
                     /EC_number="3.1.3.3"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator"
                     /protein_id="AFW93140.1"
                     /translation="MTDKKLDKLKLMVVDDELDNLDLLYRTFWKDFKVYRANNASEAL
                     AILEKEGEMAVIISDQRMPDINGSELLSLTVERFPDTIRILLTGFTDVEDLVDAINSG
                     RVFKYITKPWNPNQLQLLVKQASDTYRLVKKRVAELSRALRRESLFNAMTKAIRESLD
                     YNNMLQKVVATMGETFAAHNCLLKPVEDDLLIQQPFCYQNPQSEICNLLPEPSELIAE
                     VFQTQHYQITENFYKDIPYQYLVIPLIYQQHLLAIVAICKLGSDQIWHQEDIQLITDV
                     SEQAALAISQAKLYQSLQEKQQQIHLELEVARQIQHNILRQTLPEITGVKIQACCYPA
                     KEVGGDFFEVFVHANGDLWLAVGDVSGKGVPAALFMASTISLLRRELSQEVPVEPNVM
                     MQNLNYALSDDLISSNYFITMVLARYHPSTRELVYANSGHIYPFMWSQKTIFNDSPHY
                     LKVRSIPLGILPKWQGESGRLILAPGDTLLLASDGITEATGWENLDNSRTTNRSMLNQ
                     AGLWQLIKKQTQSLNLDNLLAVIQANNDLQEDDQTILCLEIL"
     gene            complement(365550..366230)
                     /locus_tag="ANA_C10339"
     CDS             complement(365550..366230)
                     /locus_tag="ANA_C10339"
                     /EC_number="4.2.1.3"
                     /EC_number="3.1.1.61"
                     /EC_number="2.3.1.129"
                     /codon_start=1
                     /transl_table=11
                     /product="two component luxR family transcription
                     regulator protein"
                     /protein_id="AFW93141.1"
                     /translation="MSKIRIVVIEDHYLTRFSICKALQQKNEIEVVGEAGNARHGLIM
                     LKKLQPDVAIVDIGLPDQDGIELTKEIKAIANHRQLSNTKVLILTSSDNKASVLAAFS
                     AGADSYCMKDIRFDNLLEAIRVTADGNPWIDPMIARIILEKAQQKTHFVQSNDNKPPV
                     NSSILSDRELEVLKLITKGCSNDDIAKRLYIVTGTVKTHISNIMNKLCANDRTEAAVI
                     ALRSGLVT"
     gene            complement(366330..367505)
                     /locus_tag="ANA_C10340"
     CDS             complement(366330..367505)
                     /locus_tag="ANA_C10340"
                     /codon_start=1
                     /transl_table=11
                     /product="YjgP/YjgQ family permease"
                     /protein_id="AFW93142.1"
                     /translation="MIYKQFKPFSNFISLFSFSIMDRYLAMQLISPFLFGVGAFTSVV
                     LAIDSLFELLRKVVESGLPLNIALEIFLLKLPYVMVYSFPMSTLLATLMTYSRLSSES
                     ELIALRGCGVSVYRMVFTAVVLSFAVTIMTYIFNEQIAPAANYKATITLAQALKSDQP
                     SFKQQNIYYPEYREFKEADGSKNKILSRLFYADQFDGKQMKGLTIIDRSRGGVDQIVV
                     SESAKWNGQKQVWDFYNGTIYLVATDRSYRNILRFEHQQLQLPRTPLTLAENSRDYGE
                     MNISQALEQLEIERLGGNDQKIRKLRVRIQQKIAFPFVCVIFGLVGSVMGSIPQRTGR
                     GTSFGISVIVIFSYYLLLSVSGALAQAGILSPIIGAWLPNLFGLVTGLFLLIRVAQR"
     gene            complement(367551..368279)
                     /locus_tag="ANA_C10341"
     CDS             complement(367551..368279)
                     /locus_tag="ANA_C10341"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter family protein"
                     /protein_id="AFW93143.1"
                     /translation="MKIVLENIHKSYGKRLIVNRVNLSVSQGEIVGLLGPNGAGKTTT
                     FYIATGLEKPNHGKVWLDNFDITNFPMHKRARLGIGYLAQEPSVFRHLSVQDNILLVF
                     EQTQVPRREWRQRLHTLLQEFRLEKVALSKGIQLSGGERRRTELARALAAGKEGPKFL
                     FLDEPFAGVDPIAVSEIQEIVSQLRDRGMGILITDHNVRETLAITDRAYIMREGQILA
                     FGNADELYNNPLVRQYYLGDNFAV"
     gene            complement(368307..368846)
                     /locus_tag="ANA_C10342"
     CDS             complement(368307..368846)
                     /locus_tag="ANA_C10342"
                     /codon_start=1
                     /transl_table=11
                     /product="OstA family protein"
                     /protein_id="AFW93144.1"
                     /translation="MIFISPFPVPRSLITMIPPYQLLKSQIRRLGLALVLPISLLGVA
                     GLPTQLPPATAQSGGNRPLTIRSDTQEYDAKTQVITARGNVQMVYPARQIQATSAQAQ
                     YFSKEKRIDFSGNVYILQQGSNSIRAEKVTYLIDEGKFIALPQSNRQVESTYMVEDVN
                     PSRQTTKPAPKTPALKRSN"
     gene            complement(369246..369638)
                     /locus_tag="ANA_C10343"
     CDS             complement(369246..369638)
                     /locus_tag="ANA_C10343"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93145.1"
                     /translation="MNETMSEEFWQGVEQFNAGQFYACHDILEALWIDSIEPDKTFYQ
                     GILQIAVGLYHLGNHNLRGAMILLGEGSNRLRRYLPSYGGINVEELFTESVDLLKTLQ
                     QESLQPMANNKLAENQARLLPSISLSKL"
     gene            complement(369635..370000)
                     /locus_tag="ANA_C10344"
     CDS             complement(369635..370000)
                     /locus_tag="ANA_C10344"
                     /EC_number="1.18.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin thioredoxin reductase beta subunit
                     protein"
                     /protein_id="AFW93146.1"
                     /translation="MVTSEVNSQSSDKSLEAMRHFSEQYAKRTGTYFCSEPSVTAVVI
                     EGLAKHKDELGAPLCPCRHYEDKEAEVNAAFWNCPCVPMRERKECHCMLFLTSDNEFS
                     CDKQEISMETIKEVRDTMG"
     gene            complement(370051..371226)
                     /locus_tag="ANA_C10345"
     CDS             complement(370051..371226)
                     /locus_tag="ANA_C10345"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93147.1"
                     /translation="MKITKKINNWLETHAAAPAYGGWVLAGISVCYLGAGINTMAGWL
                     YVISGVSFALLGVSGFVAPRSLAGIIVKRRPIEPVTAGDDLKIEIEIHNQREQSATLL
                     QVRDILPFIFGQPVQQSIESIPPQDSYRWVYYHPTQQRGLYRWHTVELATGAPWGLFW
                     CRRPRQCEARAIVYPTVLPLTTCPLIDEIGQDDSQRGDPRGKPLQMATTGLVRSLRPY
                     RIGDPTRLIHWRTSARYGELRVRELEVITGGQEIIIAIDSSFQWQQELFEQAVITAAS
                     LYFYAQQQQLQVQLWTSATGLITGNIAVLETLAATNPIEKNSLPPDNCPLIWLTQNSF
                     TTSTLPLGSRWVLWQNSDSAAETVINREYPGIIIQNEQELQPQLQKALNLFSGDFSH"
     gene            complement(371241..371417)
                     /locus_tag="ANA_C10346"
     CDS             complement(371241..371417)
                     /locus_tag="ANA_C10346"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93148.1"
                     /translation="MQDKLSVIAKNSSPNASPVQLSVVMDERELLDIVIINHYSTNSC
                     SFACSLFPVPSFPN"
     gene            371718..372755
                     /gene="mtnA"
                     /locus_tag="ANA_C10347"
     CDS             371718..372755
                     /gene="mtnA"
                     /locus_tag="ANA_C10347"
                     /EC_number="5.3.1.23"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-5-thioribose-1-phosphate isomerase"
                     /protein_id="AFW93149.1"
                     /translation="MVYPVIWRNNSVSLIDQTRLPNEYTVVEIHRSEDMAQAITTMIV
                     RGAPAIGVAAAYGMYLGAREIETSEIQEFLTKLETVANLLRSTRPTAVNLFWAIGRMM
                     KTAYETVGTVAEIKQVLLETAQKINAEDLQTCQAIGDHGLAALPQTPDQLIILTHCNA
                     GALATAGYGTALGVVRSAWKEGRLARVFADETRPRLQGAKLTAWECVQEGIPVTVITD
                     NMAAHCMKQGLIDAVVVGADRIAANGDTANKIGTYSLAIVAKAHNIPFFVAAPLSTVD
                     FELIDGSQIPIEERHPAEIYQIGETILTPPGVEFYNPAFDVTPADLITAIITENGAFL
                     PGDLLKAKKML"
     gene            372963..373703
                     /locus_tag="ANA_C10348"
     CDS             372963..373703
                     /locus_tag="ANA_C10348"
                     /codon_start=1
                     /transl_table=11
                     /product="IS630 family transposase"
                     /protein_id="AFW93150.1"
                     /translation="MYTYQWTSSNKAGSNSSSNLLTDFQRQMLLKSLQEHRSQSQRQR
                     IQIMLLADQGITQAEICQILGCCPATARHWIHIARQGMAHQWQDCPIGRPKLVSNEYL
                     QRLKELFYSNPRDYGHVSQHWTLNWLQKHLCEEFGFEVSDRHFKRLLKQMGLSTRPKP
                     SHDGQNSPKSATEPKISIADLKKANTTDSSEIIPINFHKAVKDSDIYGAQYIRSISIS
                     ATNQQYIGVFTNRRRILSLSSRTSVYQP"
     mobile_element  372963..373703
                     /mobile_element_type="insertion sequence"
     gene            373582..376290
                     /locus_tag="ANA_C10349"
     CDS             373582..376290
                     /locus_tag="ANA_C10349"
                     /EC_number="3.6.3.27"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic nucleotide-regulated ABC
                     bacteriocin/lantibiotic exporter protein"
                     /protein_id="AFW93151.1"
                     /translation="MAHNISAQLVSLQQINNTLGYSLTAEEFYHYLPELQSINPKVGK
                     FWTGKNVEPGIYIIIRGKVRLLDDKDELIATLETGASFGEFTLFPQSKFEPYAARASA
                     NLQLCFLPEKLLLPLIAKYPQIREHLWEKAYSLLRNTDYTPIKPSSPENDNSDSTPYL
                     TSESKINKAYFPSPRQRVGHLWQKVMGRYPFFAQQSGSDCGAACLVMVSRYWGKRFSV
                     NRLRDIANVDRNGASLRGLLTAAESLGFATRPVKASLKQLAKQKLPAIVHWEGKHYIV
                     VYEITPKYVIVADPAIGQRTLTHEEFNSDWTGYTLLLQPTAMLKETKETSTPFWQFFE
                     LIKPHSVVMLEVFIASIFIQIFGLITPLFTQLILDRVVVQRSELTLTAVGIGLLIFSL
                     FRVAMTGLRQYLLDHIANRIDLALIVGFIRHTLRLPLSFFETRYVGDIISRVQENRKI
                     QRFLSGEALSILLDLFTVFIYLGLMFWYSWKMALLALIIVPPFALLALIATPFLQRIS
                     REIFNAVAKESSYLIEALTGVRTVKATAVEQTVRWHWEELLNKEIKTNFSGQVIGNNL
                     QIFSNTIEAVATTALLWFGAYLVIHNQLTVGQLVAFNMLLGNIIRPFQRLIVLWNELQ
                     EVVIAVERINDVLDTEPEEDLQNQSRQNLPPIQGHIRFENVTFRYHPESDINILENLS
                     FEIKPGQMVALVGRSGSGKTTISKLVIGLYPPTDGKVLIDGQDITSLSLRSFRQQIGV
                     VDQDTFLFGGTIRENISLGHPGIPLSEVIAAAEMAGADEFIKKLPMGYESQIGEGGGL
                     LSGGQRQRIAIARALLGNPKLLVLDEATSHLDTESERIIQQNFNTILKGKTTLVIAHR
                     LSTVRNADLILVLDRGVLIESGSHEELMAKKGHYFYLNQQQLQTLT"
     gene            376563..378065
                     /locus_tag="ANA_C10350"
     CDS             376563..378065
                     /locus_tag="ANA_C10350"
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="AFW93152.1"
                     /translation="MTSTLNGNITKSDEILSPELPEITNEDWSEITKESLDSLPQVWT
                     RGLLYLLVFIVSIVLPWSLLSKVDETGTGRGRIEPKDKTVKLDAAVGGTVAEIQVKEG
                     ETVKAGQTLLLLESALVKSELRQVQDKLEGQLNRISQLKSSKNQLIVSLATQQQQNQS
                     QQLEKQAQIDQAQQNINTLKNAYQFQKEERLSQLNQARQTLTNSQTTNQLAESSLLSS
                     QREVKRYSQLRQQGVIPEINLVDKQDIAKEKQKLYAQSQSDIQQAKLRLAEQQSSYGR
                     NLRQAHADIEQAKLRLGEQQGSYQTLTLSGQSAVLKIAEQQKSLDTDISSLKSDISQT
                     KRQIDALKFQLGQREIKASVNGILFQLPIQKPGSVVQVGTMVAEIAQDNSPLIIRAQM
                     ATTDSGFLRLGLPVKLKFDAYPFQDYGIISGELIKISPNTIEIDTANGKVAAYNLEIS
                     LKKSCIPTANKCIPLRPGDTATAEVIVRQRRIIDFLLDPFKKLQQGGVKL"
     gene            378523..379260
                     /locus_tag="ANA_C10351"
     CDS             378523..379260
                     /locus_tag="ANA_C10351"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /transl_table=11
                     /product="putative parvulin peptidyl-prolyl isomerase"
                     /protein_id="AFW93153.1"
                     /translation="MSEPITITQSDILQQIKLSCKIPELVEQIVNRKVIITAAEEAGI
                     KVEVEELQKAADFLRLTNDLTSANDTWKWLEKYGLSIDDFEDIVYTGVVTAKLSQHLF
                     SDQIEPFFFENQLNYAGVVMYEVVFNDEDLAIELFYAVKEGEMSFYDVAHQYIQDIEL
                     RRKGGYLGILNRRDLKPEISAAVFGAKPPQVIKPIITSKGVHLIFVEEIIQPELNDKL
                     RQQIVSDLLLSWIKKQVNQTEINVNFE"
     gene            complement(379436..379687)
                     /locus_tag="ANA_C10352"
     CDS             complement(379436..379687)
                     /locus_tag="ANA_C10352"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93154.1"
                     /translation="MEWKLIKSCLFVLQKSIVISVEKINIMKGRISILDINSDYLQEL
                     TEDSFINSIFGGKPTTETSFAYDVAWVVTKGVKWVVDLF"
     gene            complement(379672..379860)
                     /locus_tag="ANA_C10353"
     CDS             complement(379672..379860)
                     /locus_tag="ANA_C10353"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93155.1"
                     /translation="MAKIQIADLHSENFVELTAEEQYLIQGGIWWRVAAGAVAVACYI
                     IENWSDIKKGVSDAWNGN"
     gene            complement(380055..380186)
                     /locus_tag="ANA_C10354"
     CDS             complement(380055..380186)
                     /locus_tag="ANA_C10354"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93156.1"
                     /translation="MKMAKIKILDLEVKKIVQLTSDEQYLIQGGCCCCPWWWPRCWW"
     gene            complement(380619..381035)
                     /locus_tag="ANA_C10355"
     CDS             complement(380619..381035)
                     /locus_tag="ANA_C10355"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93157.1"
                     /translation="MIVQKRKIWKFSLIRRLYDLGLQEQDIRNLYRFIDWVMILPKPL
                     ENQLWSEYKKFEQERTMRYITTGERIGYERGIEEGRQEGERLVILKLLKRRLGELSPE
                     TTQRIQSLSVNQLENLSEALLDFSSMADLLNWLQLN"
     gene            complement(381326..381529)
                     /locus_tag="ANA_C10356"
     CDS             complement(381326..381529)
                     /locus_tag="ANA_C10356"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93158.1"
                     /translation="MNNISPDSITLEDSNTFVKSETDSDILQPLLPRLSWDNQITYLR
                     LIFRAKRALDRIEKEAGIVRSEN"
     gene            complement(381546..382805)
                     /locus_tag="ANA_C10357"
     CDS             complement(381546..382805)
                     /locus_tag="ANA_C10357"
                     /EC_number="1.3.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM domain-containing protein"
                     /protein_id="AFW93159.1"
                     /translation="MTYRRISYAVWEITLKCNLACQHCGSRAGHTRTNELSTAEALNL
                     VQQMAEVGITEVTIIGGEAFLRPDWLEIAQAITKAGMICGMTTGGYGITLETAHRMKA
                     AGIQVVSVSVDGLEATHDRIRGKQGSWKWAFQTMSNLKEAGIPFGCNTQINRLSAPEF
                     PQIYEHLRDAGIFAWQIQLTVPMGNAADNSEILLQPYELLDVYPMIARVAKRAKQEGV
                     QVQPGNNIGYYGPYERLLRGGDAWSFWQGCSAGLSALGIEADGAIKGCPSLPTTAYTG
                     GNIRDHSLRTIIEETEELRFNLGAGTPKGTEHLWGFCKTCEFAELCRGGCSWTAHVFF
                     DKRGNNPYCHHRALTQEKNGIRERVFLQREANGNPFDNGEFALIEESINTPWIENDPL
                     HFTAELIQWPKEWEKEAELGKSLVNSH"
     gene            complement(382907..383254)
                     /locus_tag="ANA_C10358"
     CDS             complement(382907..383254)
                     /locus_tag="ANA_C10358"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93160.1"
                     /translation="MSLENVKSFYEYLEDNEAFRDQIKAAENKEECSQIVKEAGFDFT
                     LEEYEEYTYQLLESTNSEDEIQDLGEKELAAVFGGITGRTSIIRPLYGVVWPRQKWPP
                     VQLMYGVVTGDTF"
     gene            complement(383414..383848)
                     /locus_tag="ANA_C10359"
     CDS             complement(383414..383848)
                     /locus_tag="ANA_C10359"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen fixation protein"
                     /protein_id="AFW93161.1"
                     /translation="MKEIAEKTTLCPSARPEPGESFVFGIIGGTVAEPRVAYLKQPQP
                     ITDELIAKVSPVTPAEVFRTASTCATNGCQHFDGKNCGLATRIVENLPTVGEELPPCS
                     IRRDCRWWQQEGKAACMRCPQVITDNYNASELSIQVATPTAC"
     gene            complement(383888..384139)
                     /locus_tag="ANA_C10360"
     CDS             complement(383888..384139)
                     /locus_tag="ANA_C10360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93162.1"
                     /translation="MRQVNMNNHRLEINDLIDSAVNNAVARREEALASVSNEEAKNVS
                     GGIAITTTVGRLIRPPILLGIMVKPPIITGIITGKIALR"
     gene            complement(384220..384411)
                     /locus_tag="ANA_C10361"
     CDS             complement(384220..384411)
                     /locus_tag="ANA_C10361"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93163.1"
                     /translation="MTKLQQLCPFFWLFLIRNCLFFSDILNLKGQIYGYLCGKCCYHQ
                     AIEGDKTETIMSLLFCLSL"
     gene            complement(384546..385505)
                     /locus_tag="ANA_C10362"
     CDS             complement(384546..385505)
                     /locus_tag="ANA_C10362"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93164.1"
                     /translation="MTNIIHKRADFDSPWKEILTAYFPQAMQFFFPETYALINWERPY
                     EFLDKEFQQITREAEQGKRYADQLVKVWQIQGEQLWLLIHVEIQGKKEDNFGQRIFTY
                     NYRIFDSFGQPAISLAILCDTNREWRPSNYGYNYPQTKLNFEFGSIKLLDYEQRWQEL
                     ENSKNPFATVVMAHLKTQQTRSYPQKRKIWKFSLIRRLYDLGLQEQDIRNLYRFIDWV
                     MILPKPLENQLWSEYKKFEQERTMRYITTGERIGYERGIEEGRQEGERLVILKLLKRR
                     LGELSPETTQRIQSLSVNQLENLSEALLDFISMADLLNWLQLN"
     gene            complement(385890..386876)
                     /locus_tag="ANA_C10363"
     CDS             complement(385890..386876)
                     /locus_tag="ANA_C10363"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-grasp domain-containing protein"
                     /protein_id="AFW93165.1"
                     /translation="MSITSIIQKVALQIGAVVLLEPEYKLVGHITFKNGKRSVFSYAK
                     LNINGLASAELVKDKAYSNFFLKQLGYRVTEGKTFFTDQLCAKIAHPRNIHDGFNYAQ
                     SIGFPVIVKPLNLSQGILVTKVYNQAEYYDVAHKIFEIKSGLIVEKFYSGNDYRIVVL
                     DDEVITAYQRIPLFVVGDGISNVLELLQQKQEKFLNMGRKNVIKFDDFRISQKLKTQN
                     IDWNSVIPHNNIIYLLDSANLSSGGEAVDFSERIHPDFQKLAINITKDMGLRLTGVDI
                     LTHDITMPMVDYTLIEVNGSPGLNHYAASGEVAAKRVEEFYLKILQVLENDS"
     gene            387155..387412
                     /locus_tag="ANA_C10364"
     CDS             387155..387412
                     /locus_tag="ANA_C10364"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93166.1"
                     /translation="MPQNTDYKNSTSEDLTIPAAREDNAYKKRLNGWAVARIVSEREK
                     VIVSRFRSRSDAEGYIQHIRQMIPDTVFELFFDCQREEVVV"
     gene            complement(387556..389682)
                     /locus_tag="ANA_C10365"
     CDS             complement(387556..389682)
                     /locus_tag="ANA_C10365"
                     /EC_number="3.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M3 domain-containing protein"
                     /protein_id="AFW93167.1"
                     /translation="MRATATIYQNPLLQSSGLPAFAAIKSEQVEPAFSYLLGELEKQL
                     TDLEANIEPTWSGLVEPLEKLTERLNWSWGILNHLMGVKNSPELRIAYEKVQPQVVQF
                     MNILGQSKPIYNAFKAIRHSPTWETLNSAQQRIIKAAIRDAELSGVGLEGKDRERFNN
                     IQMELAELATRFANHVLDATKGFILILTTHNDIDGLPSSLLSLAAQAARAAGEENATP
                     EHGPWHITLDFPSYFPFMQHSTRRDLREKIYKAYITRASSGELDNNPLIIRILELRKE
                     LAQLIGFETFAELSLASKMAKDVASVEKLLEELRQASYHAAVKDLEKLKAFAKAKGAA
                     EAENLQHWDIGFWAERQREEKFAFTAEELLPYFPLPQVLDGLFGLVKRLFGVTVTPAD
                     GQAPIWHEDVRYFQIADKYGEPIAYFYLDAYSRPAEKRGGAWMDACIHRRKVTENDLT
                     TIRLPVAYLICNQTPPVDGNPSLMAFDEVETLFHEFGHGLHHMLTKVDYLGAAGINNV
                     EWDAVELPSQFMENWCYDRQTLFGMAKHYQTGESLPEHYYQKLLAARNYMSGSTMLRQ
                     LDFSSVDLELHYRYSPNSQETVTDLRHRIAKLTTVLPPLPEDAFLCAFGHIFEGGYAA
                     GYYSYKWAEVLSADVFAAFEEAGLEDEAAIHAIGRRYRDTVLALGGSQHPMDVFKTFR
                     GREPSTKALLKHNGLLTQCCSDKQGW"
     gene            390105..390257
                     /locus_tag="ANA_C10366"
                     /note="dienelactone hydrolase;
                     N terminal partial ORF"
                     /pseudo
     gene            390364..390741
                     /locus_tag="ANA_C10367"
     CDS             390364..390741
                     /locus_tag="ANA_C10367"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93168.1"
                     /translation="MSHLPPLNTETIWAIINDKIDDDTVKKLLWYHLGYRYNPITDTW
                     TNSEVAPTWRDEYPQPPDFIDSRPAIMKLTRSIPPENKQALKEKLGFKGYKIGEFGPR
                     QTRRATSANWLLSYMLITTGKIE"
     gene            391054..392097
                     /locus_tag="ANA_C10368"
     CDS             391054..392097
                     /locus_tag="ANA_C10368"
                     /EC_number="2.5.1.54"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /protein_id="AFW93169.1"
                     /translation="MIHKLINTNIKSSHVLPTPNEVKAKLPLTKTAENTILKFRQEIE
                     HILDFQDRRKFIVVGPCSIHDPKAAIEYGENLLGLAEKVQDKLLLIMRVYFEKPRTTV
                     GWKGLINDPKMDDSFHVEEGISIARNLLLKLTELGLPTATEALDPIIPQYISELVSWS
                     AIGARTTESQTHREMASGLSMPVGFKNGTDGNIQVAVNALKSANTPHHFLGINQKGQV
                     SVFQTKGNAHGHVILRGGTQPNFDAENIKLVEEQLKAANLSPRIVVDCSHGNTNKDYR
                     LQSIVFENIIQQIIDGNNSIVGMMLESNLYEGSQPITGKREDLQYGVSVTDKCINWQE
                     TERIILAAHAKLA"
     gene            complement(392570..392643)
                     /locus_tag="ANA_C1R002"
     tRNA            complement(392570..392643)
                     /locus_tag="ANA_C1R002"
                     /product="tRNA-Arg"
                     /note="tRNA-tRNA"
     gene            complement(392677..393774)
                     /locus_tag="ANA_C10369"
     CDS             complement(392677..393774)
                     /locus_tag="ANA_C10369"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93170.1"
                     /translation="MPSIPKNLLDFTQTPHSGYHWDCSHRRFFEGWYYRVTLPEIKQT
                     IAFMYSIEDPSGNQPYSGGAAQILGINDEYLCRTFPDVNKFWASRDVLGLGHWGKTNL
                     QVSPLYLIPSEFTHHIQEGYQATATLNQGIITDPATGNYCRWEYEIKPVYAWGNQNSL
                     QQSTAGWLSFSQIFEPGWQILMAHGLASGWIDWHGKIYEFTNAPAYAEKNWGGAFPQK
                     WFWLNCNSFINQPDLALTAGGGKRGVLWWMESVAMIGIHHQGKFYEFVPWNSEVKWQI
                     QPWGRWQMQAKNLNYEIELTGTTQLPGTSLRAPTSNGLKFCCRDTMQGELNLELRELN
                     GSKSQVILNASSNLCGLEVGGDDWDNYWQSH"
     gene            complement(393826..393957)
                     /locus_tag="ANA_C10370"
     CDS             complement(393826..393957)
                     /locus_tag="ANA_C10370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93171.1"
                     /translation="MFDFIFGGAFFRVIMDSNSEITECDIRLNSVIALIWRSHPESS"
     gene            394663..395880
                     /locus_tag="ANA_C10371"
     CDS             394663..395880
                     /locus_tag="ANA_C10371"
                     /EC_number="2.7.8.6"
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide biosynthesis polyprenyl
                     glycosylphosphotransferase"
                     /protein_id="AFW93172.1"
                     /translation="MYLSDTYHPEKEIAGLQAPNRILISSGIITLITSLVIYLSESWE
                     QDSGGMRGILLVNLGIFTIWAIILRLLAFNWWRSKSHQGRWLMLGSGNHAIKFAQMFL
                     TRNPLGRLVILTENGQQLPELAEIEPQLSHEGCLSDLSDWSQQPLLGVVVGTKISLSD
                     VQVQSLMQLRLKGIPVYQLPDIWETLCYKLPSSLLEDEWFAFSSGFNLVFCGFSLKIK
                     RFTDIMLTGVLSVLLLPLMVIVGLIIKLDSPGPIFYSQLRTGLYGKPFRVYKFRSMSQ
                     DAEKKGAQWAIQRDPRITRVGYWLRVLRIDELPQIWNVLSGEMSLIGPRPERPEFDVK
                     LKEAIPYYEMRYLVKPGITGWAQVLYPYGASLEDAYEKLAYDLYYIKNYSLWLDIVIV
                     LKTIRVVLLGKGR"
     gene            395877..396854
                     /gene="galE"
                     /locus_tag="ANA_C10372"
     CDS             395877..396854
                     /gene="galE"
                     /locus_tag="ANA_C10372"
                     /EC_number="5.1.3.2"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="AFW93173.1"
                     /translation="MNQKVLVTGGAGYIGSHVVRQLGEAGYNIVVYDNCSTGLPQSVL
                     HGELIIGDLGDIDRLYQVFGKHQFSAVLHFAASLVVPESVAYPLDYYANNTRNTLNLL
                     RCCSVMGVNQLIFSSTAAVYGEPQENPVTESTPTLPINPYGRSKLISEFMIQDYGLAS
                     CLRYVILRYFNVAGADPGGRIGQNSSNATHLIANACNAALKRQSELKIFGTDFPTPDG
                     TGIRDYIHVEDLAAAHVDALRYLERDGESQVLNCGYGEGYSVRQVVERVKAISGVDFP
                     VIEVARRPGDPACVTADAEKIKQVLNWQPKYNNLDNIIYSFLSWEKGKT"
     gene            397113..399302
                     /locus_tag="ANA_C10373"
     CDS             397113..399302
                     /locus_tag="ANA_C10373"
                     /EC_number="2.7.10.-"
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide synthesis protein"
                     /protein_id="AFW93174.1"
                     /translation="MSINQEDQDSSFDIQQYWLTFKRHWLVTSIVFASVLGVTALLTY
                     SAKPIYESEGKLVFTKKSGASSLAGLSQSLGELGGLTNLSNPVDTESEIIRSYPIVIK
                     TITTLNLTNDQGKQISLENFLKKLKLKTIRGTDVIQLSYRSTNPQEAADVVNSLMKYY
                     LESNIRTNRTEARSAREFLDKQLPEVEKRVTKAEMTLRRFKENNRVVALDVEAKTGLE
                     SLGKLDEAITRSQGELAAAYTRSVALQYEMKSTTQEAVDLSALSQSRGVQQVLTEYQK
                     TQYDLATARTLYTSDNPKVVNLVLKEASLKKLLEERVTQTIGSSKSLPQQNLQVGELK
                     QALTQDLVKSEVERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQLSVAQIT
                     YQEFLKQSQLVQVLENQNVGNSRIISEALVPERPVSPKIPLNLALGGFLGILLGAGTA
                     LLLESMNQSLKNVEEANRLLGFPLLGAIPQYGEKNPKHRQEGRQELPLLDNPYSPVST
                     SFEMLQTNLGFTLSDKELRVILLTSSTPGEGKSFVAANLALAAAHVGRRVLLVDADMR
                     RPRQHRVWEIPNLLGLSNILAGQMQLKNAVQEVSPQVNMLPAGKIPPNPVALLDSQRM
                     ADLIAEARNDYDFVIIDTPPLTAVTDPLIVGKYVDGLLLVVRPGKVEYSAVKSSKLLL
                     NHGKVPILGMVVNGISEESSYGGYYYQRGYYGQKVDSKGKFSQANLR"
     gene            399731..400291
                     /locus_tag="ANA_C10374"
     CDS             399731..400291
                     /locus_tag="ANA_C10374"
                     /codon_start=1
                     /transl_table=11
                     /product="putative restriction endonuclease"
                     /protein_id="AFW93175.1"
                     /translation="MTISAIKYLTLQEFLMLPETKPASEFLGREIIQKPTPKGRHSRL
                     QGKLSGEINLVSESEKIAYAFPELRCSFGNRSIVPDIAVFTWEHIPFLSSGEVPDRFE
                     VAPDWVIEILSPEQKSNKVIGNILYCMEHGCKLGWFLDPDDLSILVFLCDRQPILMEK
                     TDILPVLAGIELKLTVDDVFGWLRMA"
     gene            400588..402051
                     /locus_tag="ANA_C10375"
     CDS             400588..402051
                     /locus_tag="ANA_C10375"
                     /EC_number="2.7.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="AFW93176.1"
                     /translation="MKNSFLKNGFYNTAGGIIRIGLAILTIPLLIRLIGVEEYGLWTL
                     ASSVIAIVGLAEAGLATATTVFVSQDLGKEDSDGLSQTLTVTVGAMLILATIAAFALW
                     FGAEGIVSIFTKLDNTQQLTGVKALQIGGLVLWSRLLQQVLVGVEQAYQRYGLMNLLN
                     TIQSALITLGMLVIAYRGGRTIALMQWQAVAAVAVLLSHAWVVQSLLKTVNLHLAWSK
                     DKGLAVGRYSVMIWLSSLGSALFARGDRIIVGSLLGTQSLGVYAAITDITTQINVLSS
                     LPVQPLVPAVSHLIQNLNNEQTKQNIKQAIQLNGLVALGLGGILITLSPLICSLIFTN
                     VIDIKYIFLFCISTVIYSLYSLNAVGYYILLGIGAANICAIVVAASGFLSLIMIALGA
                     YNFGLIGAICGNFPYLLTNLLLLMGVKHFCIPQNTLIKWLKFPLLFFCIVVYLHYFIP
                     YSNVLRLGSAILQSCILFIWFTANNKGFFAKKILNFK"
     gene            402061..402909
                     /locus_tag="ANA_C10376"
     CDS             402061..402909
                     /locus_tag="ANA_C10376"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase domain-containing protein"
                     /protein_id="AFW93177.1"
                     /translation="MHCVYCNGYLKEFSVRNTKSMKQHMLNSDLRNMLPSMTHGKCVS
                     CGSIIATDNRMKSEEFLLSIYNNLPKDYWQELQSEKSNSFFVELGNLLNPNQNSDMSI
                     CDVGCGDGKFLDCISECWQKFGVELGKANEHMINHKKITYFNGTLDRSPFRKHSMDII
                     TYIDVFEHLADPRKEIKIAKEFLSPNGKIVIYTGNANSIYSKMSGKNWTYLNVVGHIA
                     VASEKGLINALNSCGFTKIDVLNVNHHSSVSFPKWLFYLLASKLLGNRGNIPLFNDHM
                     IMIASI"
     gene            403058..404005
                     /locus_tag="ANA_C10377"
     CDS             403058..404005
                     /locus_tag="ANA_C10377"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2 protein"
                     /protein_id="AFW93178.1"
                     /translation="MEISSIPEYLKKKSYPERIEGGSRKINSNRKDENHQHNQPLVTI
                     ITVVFNGEEYIESTIKSVINQTHENIEYLVIDGGSNDGTLEILKKYSAHIDYWLSEPD
                     NGIYDAMNKGIALSSGDIIGLLNAGDTYLPNALSLLVEQFVPSDNLSIYYGDIYLDYI
                     DANITIKTPASIDRLKYSMTICHQAMFITKHTYLNQGLYNLNYKYASDYAYVLSLLLI
                     GAEFHYIGGVVAYFQTGGVSDNKIFNSRLECIKIHRNLKSPFFYRALILYIKQLFSYY
                     FYKIVGYFFGKQKGAEFRKQRLINKYQTHILQNQEVKSK"
     gene            404002..404949
                     /locus_tag="ANA_C10378"
     CDS             404002..404949
                     /locus_tag="ANA_C10378"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2 protein"
                     /protein_id="AFW93179.1"
                     /translation="MNKLINTPILLSLIVPVVKPELFLEKLFISLSNLKHEQIELVLI
                     NQSGKEIDILRKILNIELVEYVRNSVIPAAEARNLGASLASGEYLFFLDDDAFIYSNI
                     ISLEELIISLSNGPNLLVPQRGEVIDGCYISHWPQNTSKITYRNFSRFIIEWNLIIKK
                     ELFLQLGGFNDMGPGSHHACQCGEAFVLTSKIIVTGQSIKLCPNIKVAHPGLFEKAKN
                     TKNALGYAYATGFAIGIGLNYFNFIAKIYWINRGIFSAFYELLRHSKNQIKLVENVNL
                     FIYRLAILKCKILGLIDAVTKSKPRSLIWLDAEAKKIIN"
     gene            404962..406305
                     /locus_tag="ANA_C10379"
     CDS             404962..406305
                     /locus_tag="ANA_C10379"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93180.1"
                     /translation="MNDFIFDWIWLYTQILLLIILIIRELVQNHNRNLYVVFISATML
                     TLVQGQAWWLLSQFQNGDSDIVHLYQLLSLESTRLANLYAGLCTISLFITYTWMARHK
                     FKNKGFLNSEVVVFSIKNTNSLVSYIVIALWVTVFGGILILLLGGLQAAIDNPGNSVG
                     GQTFLLIGVSLGKMPLLYKLSLKQRLNRVDILTFGFTFLLTLINSRFLATFMLVQVLL
                     IFNYCWKQIPRRWIIASSFVFIFIFIIYGLYRDNSAINYNLSLFERLEEISSRLNQQD
                     SPIEWFYRTNVEVFAGLAGILTYENNVGGINSDFGLSNLSLFTQFIPNMIRNDPYLVG
                     PLTDFLKSLYPYPEGSVVPSGLETFYAHFGVFGLILLGILLGYLSYFLHMKMLYQNDD
                     TLKVSLLSVQLINIVRTMLSNVLFFGLADWTMLFAYRLILNFGKKQDKRADYKSY"
     gene            406617..407774
                     /locus_tag="ANA_C10380"
     CDS             406617..407774
                     /locus_tag="ANA_C10380"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1 protein"
                     /protein_id="AFW93181.1"
                     /translation="MIIGIDTRFALKKRRGIGNYTLNLLQSLAKIDQENQYFLYTDQP
                     DSENILPKAANFEVRILVPANYLLWEQLVLPRQAIKDGIDVLHCTANTSPVFLKKSTK
                     LIVTIHDVMYLKDSVLLPKSNVAYQRLGRIYRSAIVSKTIRNATKVITVSNFSKSDIL
                     HHFPSLQTSSIITTYEAPDAAFRILDRGNASKIIKNSFNLSGKYLLTLGGTDPRKNTK
                     LVIRAFSKLKQTKNIDEKLVIVGIPNWKQSEFYDLVCLLEYGNDVIFTDYVTQEELVC
                     LYNCATLFIYPSLYEGFGIPPLESMVCGTPVITSNTTSIPEIVGDAALQVDPTNQEEL
                     ETAVYKLLIDSSLRNNLIQRGLARAKQFSWQRMAEETLDIYKSIIAYDNNS"
     gene            407771..408952
                     /locus_tag="ANA_C10381"
     CDS             407771..408952
                     /locus_tag="ANA_C10381"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1 protein"
                     /protein_id="AFW93182.1"
                     /translation="MKILFVTPRFPYPLLQGDQLILYHRLRILSQRHEITLLTLYHSS
                     WELENIDQIRPYCKAIYTVPLPKWQSLINVGKGLFTSQLPLQACYYSSSRFQQQLDSI
                     LAANNFDIVHAFMMRIAPYFHHIHTPKIIELIDSMQLNLERRVVLESFPRRWIFQEEL
                     QRVIRYERDLPNLFNKLVVVSEKDAQLIPSDRVKVIPNGIDTDFFSLQQQSPIDPTLI
                     FSGNMSYAPNIHAVKWFVELCLPIIQQTVPNVSLIIAGAKPSREVRSLARKEGVIVTG
                     FVESMPETLKQAKVAIAPMQSGSGMQNKILEAMASGLPVVTTTLGLGSLSAKPDKEIL
                     IADSPEDFAKATITLLQNSDLAREIRNLARQFVVNKYSWEFSANQVENLYNQIIIDRG
                     R"
     gene            408970..409569
                     /locus_tag="ANA_C10382"
     CDS             408970..409569
                     /locus_tag="ANA_C10382"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93183.1"
                     /translation="MKKTTAAQVPKRQVEELAQTIARDFNEFYEYQQSQSQQLEQTGE
                     IIVISADGKGVIMGREDLRPSTQKRAIASQRKLEKRLTKGEKRNSKRMATVAAVYTIK
                     PFIRTAEQIINPKEFPQSQRPRPEVKRVWASLVKEPETVISEAFDEALHRDPNQQKHW
                     VALVDGNKTQLRLLKQLSRKHNIKLTIVLDIIRKNAENP"
     gene            complement(409884..410372)
                     /locus_tag="ANA_C10383"
     CDS             complement(409884..410372)
                     /locus_tag="ANA_C10383"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93184.1"
                     /translation="MSINKNKPHLLILPEDDANRQIVNGFIQNLNVNNRAIQILPIAD
                     GWKKAVDKFTNDHIKAMRQYPQRNILLIIDFDECEDRLNFVESYIPDDIKNRVFVLGV
                     QSNPESLKRDIQKNFETIGESLATDCAENNHKLWEHCLLIHNKPELERMILSIKPFLF
                     PN"
     gene            complement(410369..411478)
                     /locus_tag="ANA_C10384"
     CDS             complement(410369..411478)
                     /locus_tag="ANA_C10384"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATPase"
                     /protein_id="AFW93185.1"
                     /translation="MLQRLYVHNFRCLENFELTMKEMSSALLIGKNGTGKSTIATALE
                     VFQSIGRGINRVGQLVKSKDFTRGRYDVPIRLEIEVLLEEKLYKYVLALELPEKFKEL
                     RVFEEQLLVAGNPIYSRKEAQVTIYSSSQNRESQFLVDWHLVALPVIQEQSETDPLHT
                     FKNWLAHIIILAPIPSLMTGDSHGETLQPNRDGANIGEWFSGLLGRYPAAYRDVDKYL
                     REVMPDFQDFLNELIGKEFKSLIVRFAENNATLNVNFQDLSDGEKCFFLCAVVLAANK
                     FYGSVFCFWDEPDNYLSISEVGHFITSLRRSFKDSGQILVTSHNPEAIRKFSNENTFI
                     LDRKSHLEPTLIRLLSDIPVTGDLINSLICGDIEL"
     gene            complement(411863..412423)
                     /locus_tag="ANA_C10385"
     CDS             complement(411863..412423)
                     /locus_tag="ANA_C10385"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93186.1"
                     /translation="MSQSDIPNIQELSTEISQLRQDLQLRDQLVQQLSQELFRLVKGN
                     TNFTPPKSEPEIDLSQLQALRDQIQAVEQQLTFYQEQITNRDTEIYQLRQSLQELTDR
                     SRMLEQVVQELPQIYRRKFEERMTPVRDKVTILQRENRQLQAELQSVSYRLALKNRYT
                     NHGGIDLPTFPRSEVATDSLPAAQNV"
     gene            complement(412786..413109)
                     /gene="rpsF"
                     /locus_tag="ANA_C10386"
     CDS             complement(412786..413109)
                     /gene="rpsF"
                     /locus_tag="ANA_C10386"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S6"
                     /protein_id="AFW93187.1"
                     /translation="MTTVYETMYILRPDLGDEQVVQQIAKYENLIREHGAENIEIQNR
                     GKRRLAYEIQKHRDGVYVQLNYTGPGTVIAIMERAMRLSEEVIRYMTVKQEVHKEKPE
                     EVVAA"
     gene            413399..414172
                     /locus_tag="ANA_C10387"
     CDS             413399..414172
                     /locus_tag="ANA_C10387"
                     /EC_number="3.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetate hydrolase family protein"
                     /protein_id="AFW93188.1"
                     /translation="MAQRYVRVQSQEGKIYYGLLQLSQNVEVLDAPPWLDGQPTDLIL
                     PSNSYKILAPCAPSKIVGVGKNYADHAAEMGTPVPAEPLIFFKPPTSVIASEREIKYP
                     HQSQRVDYEGELALVIGDRTSDCTPAQAQSKIWGYTIANDVTARDLQKKDPQWTRAKG
                     FDTFCPLGPWIVRELNPGARLQTFLNDNPHPVQSTCIDQMVFSPDFLVSYISQVMTLL
                     PGDIILTGTPMGVGALQIGDRIRVEIEGIGRLENTVVER"
     gene            complement(414176..414652)
                     /locus_tag="ANA_C10388"
     CDS             complement(414176..414652)
                     /locus_tag="ANA_C10388"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93189.1"
                     /translation="MSWRGSTTFPDRIFACLPYLLPLIEVFAFGQFLMNDFPLLGLIF
                     LPLLPLLRIYYGVRYAGMIIFFALWLLVVRNEKINHFIRFNTMQAIILDIVIFLCSIL
                     TDIVKLVPGSGFAMQTLYTTIFMGIVAAVVYSVAQSLMGKYAEIPAISDAVHMQVR"
     gene            complement(415116..415313)
                     /locus_tag="ANA_C10389"
     CDS             complement(415116..415313)
                     /locus_tag="ANA_C10389"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93190.1"
                     /translation="MLVIVMDNQILSSEKVCQSCLLANGSGQPRWGGGKLRCGQAISK
                     FTEQQPDQYECVMGFRVANVE"
     gene            415666..416949
                     /locus_tag="ANA_C10390"
     CDS             415666..416949
                     /locus_tag="ANA_C10390"
                     /EC_number="2.1.2.1"
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase"
                     /protein_id="AFW93191.1"
                     /translation="MTKTNSDLLKNSDPAINELINQELQRQRDHLELIASENFTSAAV
                     LAAQGSVLTNKYAEGLPGKRYYGGCEFVDEIEQIAIDRAKQLFGAAHANVQPHSGAQA
                     NFAVFLTLLQPGDTIMGMDLSHGGHLTHGSPVNVSGKWFQVRHYGVSKETEQLDYDQI
                     RDLAIKERPKLLICGYSAYPRIIDFQKFRSIADEVGAYLLADIAHIAGLVATGHHPNP
                     LPYCDVVTTTTHKTLRGPRGGLILTRDAELGKKLDKSVFPGTQGGPLEHVIAGKAVAF
                     GEALKPEFTTYSGQVIENARALATQLQNRGFKLVSNGTDNHLMLVDLRSIAMTGKKGD
                     QLVSTVNITANKNTVPFDTESPFVTSGLRLGSPAMTTRGLGVAEFTEVGNIIADRLLS
                     PDADTVTKDCLMRVAALCDRFPLYPHLEIPVPALA"
     gene            complement(417174..418706)
                     /locus_tag="ANA_C10391"
     CDS             complement(417174..418706)
                     /locus_tag="ANA_C10391"
                     /EC_number="6.6.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium chelatase ChlI domain-containing
                     protein"
                     /protein_id="AFW93192.1"
                     /translation="MLARVWSASIIGIDAVKVGVEVDVSGGLPGIVILGLPDSAIQES
                     KERVKATLKNAGFAFPIRKIVINLTPADLRKEGPAFDLPISVGILAASEQVNADLLGD
                     FLFLGEVSLDGSLRPVAGVLPIAATAKKMGITGLVVPVDNAQEAAVVEGLTVYGCKDI
                     ADVVDLLNNPKKYQPVQLNKAVETTQETSLNLADLQDVKGQAHARRALEIAAAGGHNL
                     IFVGPPGSGKTMLARRLSGILPPLSFPESLEVTRIHSVAGLLKNRGSLVRERPFRSPH
                     HSASGPSLVGGGTFPRPGEISLSHRGVLFLDELTEFKRDVLEFLRQPLEDGFVTISRT
                     KQSVTFPAQFTLVASTNPCPCGYYGDTIQGCTCSPRQREQYWAKLSGPLMDRIDLQVA
                     VNRLKPEEITQQPTGEASKSVAERVKKARELAMIRFQKEEDLQCNAQMQSRHLQKWCN
                     LDDASRTLLEAAIRKLGLSARASDRILKVARTIADLAADENLKPQHVAEAIQYRTIDR
                     MQ"
     gene            418827..419432
                     /locus_tag="ANA_C10392"
     CDS             418827..419432
                     /locus_tag="ANA_C10392"
                     /codon_start=1
                     /transl_table=11
                     /product="putative restriction endonuclease"
                     /protein_id="AFW93193.1"
                     /translation="MVQALTKLLTFAQFILEYGNNPRYELADAELIDMEPTGPHEAVG
                     GKLATKLGIAITHAELPWFIPRTCLIRPFAETATARRPDIVVLDETVLYDEPFWEHEP
                     VIALGKSIKLVVEVVSSNWETDYARKVEEYALLGIPEYWIVDYRGLGGVVFIGKPKQP
                     TFTVCQLIGEDYSQQKYRLGEFIKSPLLPSLQLRLDDVMPR"
     gene            419473..420036
                     /locus_tag="ANA_C10393"
     CDS             419473..420036
                     /locus_tag="ANA_C10393"
                     /codon_start=1
                     /transl_table=11
                     /product="putative restriction endonuclease"
                     /protein_id="AFW93194.1"
                     /translation="MVQTPTKLLTLDEFLKQPETKPASEFIDGKIIQKPMPQGKHSTV
                     QLDLGADINIALKPQHIARAYSELRCTFGSKSIVPDIAVFTWERIPRDENGKVSNTFA
                     LAPDWTIEILSPDQSQTKVVRNILHCLTHGTEMGWLIDPEEELVFVYFSNRTIEVFEV
                     ASDRLPVPHFAESFKLTIGQLFSWLSE"
     gene            complement(420101..420982)
                     /locus_tag="ANA_C10394"
     CDS             complement(420101..420982)
                     /locus_tag="ANA_C10394"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93195.1"
                     /translation="MAKPADVSTKRLISLAPNNWVKWVTQIPDVVAGEILNSEFQWIS
                     RESDVLIRAESKEYGKFMVLNELQLRYKPEMPRRMRAYAGLAEEKYKLPTYPVLINIL
                     KTGDAEIPTRYESNLAGLEVRQDYRVINLWEVDVKIALEQPLPSLLPFVPILKGGEDE
                     SIIREALRLLQADEQLNQLETVLAFFATFVLDSSLVQEIMRWDMTVLRESPWYQEILQ
                     QGMQQGMQQGEQQGERKDRLSSIELCLEVKFGNEGLKFVQKISEISDLETLKTIQRSI
                     LTVESLEELKHILQSFS"
     gene            421079..421429
                     /locus_tag="ANA_C10395"
     CDS             421079..421429
                     /locus_tag="ANA_C10395"
                     /EC_number="3.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine triad protein"
                     /protein_id="AFW93196.1"
                     /translation="MSQNTETIFSKIIRKEIPANIVYEDDLALAFTDVNPQAPVHILI
                     IPKKPIVSLATAEPEDQALLGHLLLTVQKVAAQAGLENGYRVVMNTGVDGGQTVYHLH
                     IHILGGRSMSWPPG"
     gene            421653..422735
                     /gene="psbA"
                     /locus_tag="ANA_C10396"
     CDS             421653..422735
                     /gene="psbA"
                     /locus_tag="ANA_C10396"
                     /codon_start=1
                     /transl_table=11
                     /product="photosystem II reaction centre protein"
                     /protein_id="AFW93197.1"
                     /translation="MTTTLQQRESANVWNRFCEWITSTDNRLYIGWFGVLMIPTLLAA
                     ITCFVIAFIAAPPVDIDGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWESASL
                     DEWLYNGGPYQLVVFHFLIGVFCYLGREWELSYRLGMRPWICLAFSAPVAAATAVFLI
                     YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSL
                     VTSSLVKETTENESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRQLHFLLA
                     AWPVIGIWFTALGVSTMAFNLNGFNFNQSVMDSQGRVIATWADVINRANLGMEVMHER
                     NAHNFPLDLAAADVAPVALSAPAING"
     gene            complement(422790..423236)
                     /locus_tag="ANA_C10397"
     CDS             complement(422790..423236)
                     /locus_tag="ANA_C10397"
                     /codon_start=1
                     /transl_table=11
                     /product="polyketide cyclase/dehydrase family protein"
                     /protein_id="AFW93198.1"
                     /translation="MLHFKHSSIINAPIEVVWKFHERPDILQILTPPWQPVQIVRREG
                     GLSAGAITEFRLFLGILPLTWLARHTDYEEYRLFTDEQISGPFESWVHRHEFTEENGK
                     TKLTDNITYSMPGGDGIEFISGWLVQTQLEAMFRYRHYVTKRECEK"
     gene            423582..423914
                     /locus_tag="ANA_C10398"
     CDS             423582..423914
                     /locus_tag="ANA_C10398"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="AFW93199.1"
                     /translation="MSIYVGNLSYEVTQEGLSEIFKEYGKVKRVQLPTDRETGKVRGF
                     GFVEMESDEEEEKAIEALDGAEWMGRDLKVNKAKPREERSSFGGGNRSGGGGRSGGYG
                     GGGGGNRY"
     gene            424113..425027
                     /locus_tag="ANA_C10399"
     CDS             424113..425027
                     /locus_tag="ANA_C10399"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="3'-5' exonuclease"
                     /protein_id="AFW93200.1"
                     /translation="MPYLTAAREIRSLITEYTTAKTLWIDTEVADYKTRNPRLSLIQV
                     LANPEDMTGNSVYLLDVLDKSDVIADFVERIMVNDAIEKVFHNAGYDVKYLGAKKAKN
                     ITCTLEMAKKIPVYLLPLPNYQLKTLATKLCNFHDINKQEQTSDWGKRPLTEEQIEYA
                     YLDCIYLAQVHLRLLELEANLKIDPIREDLSLLTARYIEIEQQQKILKSEFEHLQERV
                     KQAMLVQNISETSSCKLTSYERKTIKTQFQELVDLVENQGVDLDFTITLTEDIRKNLG
                     VNLEKLTVNVDINTYWKITPKNQEGEEY"
     gene            425333..426175
                     /locus_tag="ANA_C10400"
     CDS             425333..426175
                     /locus_tag="ANA_C10400"
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat-containing protein"
                     /protein_id="AFW93201.1"
                     /translation="MKWQLLRHKHREVNRAFTIAMVTIFSGIICVSCSNNQDVLVTER
                     GASPPNPQIGRTSKAGEFYVQGQTQHLKGNYQAAIAAYSKSISLNPQYAPAFKGRGLV
                     YFDTGNKEGAIADYNQALGLNSQDAEAYNNRANAFVSIGDYRRAIADYNQAISIAPKY
                     AEVYNNRGNARANQGDKNAALEDYTQAIRINKEYAVAYNNRGNAYASRGEPQKAISDY
                     NEAVRINPNFGAAFNNRGNAYAAIGDKRGALKDLQRAAAIFDKEGNKDLYQQAMKNIE
                     ELGK"
     gene            complement(426396..427190)
                     /locus_tag="ANA_C10401"
     CDS             complement(426396..427190)
                     /locus_tag="ANA_C10401"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93202.1"
                     /translation="MYDNICKFIAENYKDDIATWLLGSPIKLTELSPTELSNDPIRAD
                     SLILLQSDQLVLHTEFQTDTDEDMPFRMLDYRVRIYRRFPQKEMRQVVIYLRKTSSDL
                     VSENSFKLNNTYHQFEIIRLWEQPTAQFMTVPGLLPFAVLSQTKDPKMVLSQVGEAVA
                     AITDQKIQGNIAAASAVLAGLVLKKDVIRKIFRSEIMRESVIYQEILEEGEAKGKAEG
                     IAEATKKLALNLLRIGMSLQQISEVTELSLEQVQALEKEIKNPTSN"
     gene            complement(427285..428652)
                     /locus_tag="ANA_C10402"
     CDS             complement(427285..428652)
                     /locus_tag="ANA_C10402"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93203.1"
                     /translation="MSKLNHQISLLELIQILSAYRQNIILNLHKLKEDYHRTGIKRVR
                     GVRDINGDLITPWLETEDVYAGDFVQMGVFAINRNTATINMLISRKVKLVKSEDNIHI
                     TEVAGLLAHDLDNFNKYTIVKDGKVHVSALNIKISNKKVFDLLQAKGVIIADKFDFNS
                     EYIIQLDNLPLVPVNIKFASIDGLFTQLAEIKVVMSILSAYLRHQSDVFVSNQVEELK
                     QHYLSKNLYLNFPKTQEYPDTIDSHISYKIEFGNQDILNLSKLYAANQFLARRYEVYD
                     QETGEIFPKPTLEMGLNQNIAFRQKAISARMKLTKVDDLMKPIFDDFLGININGKVGE
                     ILHKVGNHRLALLLYAQHAGKSVNGEDLITAMTTAYQKLAAYVEQTYQENISPMVFYI
                     GATGLLPNKISAKAMTADELAAKYPHLQFSKHEQAGTFFEVGNTIISVYPQTEYYSKN
                     SLAVS"
     gene            429052..430560
                     /locus_tag="ANA_C10403"
     CDS             429052..430560
                     /locus_tag="ANA_C10403"
                     /EC_number="4.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="UbiD family decarboxylase"
                     /protein_id="AFW93204.1"
                     /translation="MARDLRGFIKILEEKGQLKRISALVDPDMEIAEISNRMLQKGGP
                     GLIFENVKGASFPVAVNLMGTVERICWAMNMEKPEELETLGKKLSMLQQPKPPKKISQ
                     AIDFGKVLFDVIKAKPGRDFFPPCQQVVIEGNDLDLNKLPLIRPYPGDAGKIITLGLV
                     ITKDCETGIPNVGVYRLQLQSNNTMTVHWLSVRGGARHLRKAAERGKKLEIAIALGVD
                     PLIIMAAATPIPVDLSEWLFAGLYGGSGVNLAKCKTVDLEVPADSEFVLEGTITPGEV
                     LPDGPFGDHMGYYGGVEDSPLVRFQCMTHRRDPIYLTTFSGLPPKEEAMMAIALNRIY
                     TPILRQQVSEIVDFFLPMEALSYKAAIISIDKAYPGQARRAALAFWSALPQFTYTKFV
                     IVVDKDINVRDPRQVVWAISSKVDPTRDVFILPNTPFDTLDFASEKLGLGGRMGIDAT
                     TKIPPETEHEWGEPLKSDIDIAAMVERRWQEYGLADLQLGEVDPNLFGYDMK"
     gene            complement(430734..431153)
                     /gene="petE"
                     /locus_tag="ANA_C10404"
     CDS             complement(430734..431153)
                     /gene="petE"
                     /locus_tag="ANA_C10404"
                     /EC_number="1.10.9.1"
                     /codon_start=1
                     /transl_table=11
                     /product="plastocyanin"
                     /protein_id="AFW93205.1"
                     /translation="MKSIAATLRRLSLAVLTVIVIFGSFAVFTPTASAETYTVKLGSD
                     KGLLAFQPKQLTVKPGDTIEWINNKVPPHNVVFDSAKNPAHDKALATALSHTKLLLNP
                     GQKQTTTFPADAPAGDYTFYCQPHRGAGMVGKITVEG"
     gene            complement(431454..432047)
                     /locus_tag="ANA_C10405"
     CDS             complement(431454..432047)
                     /locus_tag="ANA_C10405"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin domain-containing protein"
                     /protein_id="AFW93206.1"
                     /translation="MNSIKWLFLQTQIITNGRQLVSKCLLLLVCLFVISMQPALAGIK
                     DDRYDGNIFVIYAGNGSLVPSKETLAQTLAEHKPAIVTFYTDDSSDCKKYAPVVSEMQ
                     AFYGRATEIIPISVDTLLADKTYQPTEPGYYYGGSVPQVVVFDQSGKVVFNKKGQVPF
                     EEIDDKLREVFDLLPRTESVELKRRSPREFSSQLEDQ"
     gene            432360..433703
                     /locus_tag="ANA_C10406"
     CDS             432360..433703
                     /locus_tag="ANA_C10406"
                     /EC_number="6.3.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="mur ligase domain-containing protein"
                     /protein_id="AFW93207.1"
                     /translation="MTVGKKIKVIDRLRLGFAVSMAKSVTFLVRSLRLGAASVLPGSI
                     ARRIEPRILELLSQQVKNGIILIAGTNGKTTTALLLCTILERKGFRIAHNSTGANLEN
                     GLATALIDNANLLGNLNVDYAILEVDENIVPKVLKPLQPRIILCLNLFRDQLDRYGEV
                     DSISKRWTKVIATLPTTTVVIPNADDPTLSYLGQQLPQKVLFFGLNEPENYLEAIPHA
                     VDSIYCPSCGHALDYQGVYLSHLGDFTCPSCGFTKSQPALLSQEWSQILVGLYNKYNT
                     LAAATAAKELGVDEVSIRDGINNFQAAFGRAEDLVIDGKRVRILLSKNPVGTNETIRV
                     VTESTDKTTLLVLNDRTPDGTDVSWIWDVDTEKLVARGGTLIVSGDRVYDMALRLRYS
                     QESLDSDINLIVESNLQQAIATALEHTPVNETLHILPTYSAMLEVREVLTGRKIL"
     gene            433819..434091
                     /locus_tag="ANA_C10407"
     CDS             433819..434091
                     /locus_tag="ANA_C10407"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93208.1"
                     /translation="MKIVKLILLAFPMFLASLLLVVNPAHASKFKAAPAVQMIVVTSN
                     QANFDIATPQINSITHSVIQQIGCNCTNCVQANLQKLQGKLPMAGI"
     gene            434198..435196
                     /locus_tag="ANA_C10408"
     CDS             434198..435196
                     /locus_tag="ANA_C10408"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic solute binding protein"
                     /protein_id="AFW93209.1"
                     /translation="MSAKKLSTHLLKTTILGLMVGLSGCGNKPINTTYNTTNKNINNN
                     LPFVVATNSVICDLTKQVAGDTINLICLIPPGINPINYKPIPEDNQAIKNANLVLYHG
                     DNFEPGLIKIIEEIKKPKLKIAVAKTMGVNSIQIRKNGKQIIEPHVWHNPINTIKMVE
                     IINSSLVKLAPENKNIYNRNTKKVTKEINQINSWIKSRLASIPDKNRKLVTTNSAMIY
                     YVKAYDIPYSVNLGNVKNTGKLTDPKVMNLVRDIQKAQVPTIFADTNTNSNLLAPVAT
                     AAKVKVSQRPLYIDGLGEAGSDGETYQKMMTANTRIIVEGLGGTYLKFEPKNSRNK"
     gene            complement(435950..437392)
                     /locus_tag="ANA_C10409"
     CDS             complement(435950..437392)
                     /locus_tag="ANA_C10409"
                     /EC_number="5.4.2.2"
                     /EC_number="5.4.2.8"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucomutase/phosphomannomutase"
                     /protein_id="AFW93210.1"
                     /translation="MSVVTNPIKFGTDGWRGVIGEEFTFERLALVATVAAKVLHNTYF
                     SEVGSRTIIVGYDRRFMAEEFARVVANAVTAVGFDVLFSETFAPTPAYSWAAKELKAL
                     GALVVTASHNPGAYLGLKVKSAFGGSVPPEVTQEIEALLSEEVAPAAISGKEETFDPW
                     PSYCQALAAKVDIDKIKEAIATGKLTIFVDVMHGAAAGGLARLLGEQVKEINSDRDPL
                     FEGGAPEPLPKYLSRLFTVMKTHRQTHKTGLTVGLVFDGDCDRIAAVDQDANFLSSQV
                     LIPILIDHLTLRRNFQGEIVKTVSGSDLMPRVAALHNLSIHETAVGYKYIADRMLATQ
                     VLLGGEESGGIGYGSHIPERDALLSALYVLEAVVESGLDLGEYYRYLQQQTNFSSSYD
                     RIDLPLANMEVRGRLLKQLQSQPLTEIAGKEVIGCQTIDGYKFRLADQSWLMIRFSGT
                     EPVLRLYCEAATLEEVHKTLAWAKNWAESN"
     gene            complement(437638..438288)
                     /gene="purN"
                     /locus_tag="ANA_C10410"
     CDS             complement(437638..438288)
                     /gene="purN"
                     /locus_tag="ANA_C10410"
                     /EC_number="2.1.2.-"
                     /EC_number="2.1.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylglycinamide formyltransferase"
                     /protein_id="AFW93211.1"
                     /translation="MIYDSPLNTTDSLIYPDIYHHQVSSNQPLKLGIMASGNGSNFEV
                     IAQAIADGKINAQIQVLIYNNPGAKAAIRAENWGVESVLLNHRDYKNREKFDHKVAQT
                     LQQYDVEFVIMAGWMRLVTQVLIDAFPNRMINIHPSLLPSFKGVQAVEQALVAKVKIT
                     GCTVHLVSLEVDSGEILIQAAVPVLPDDTSETLHARIQIQEHRILPMAISLLSQRK"
     gene            complement(438372..439151)
                     /locus_tag="ANA_C10411"
     CDS             complement(438372..439151)
                     /locus_tag="ANA_C10411"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC-type transport protein"
                     /protein_id="AFW93212.1"
                     /translation="MNVMRTVVMAKNVFQEVIRDRILYIIGFYAIILGIAFRAIPEFT
                     VTAFDKIFLDFGLATMNVIGLIVAIFIGTGLVNKEIEKRTILVLIAKPISRSEFIASK
                     YLGLSAVIAVLITAMTIIYLGFLQLGQVSYPVTSIFLATLFIFFQLCLITAVAITLGI
                     FTSSLIATALTFAVYLMGNITQDLVALGKLSQNPAMERITQSLYLILPDLSRLDLKND
                     AVYGLQALPDPITLITNAGYGLLYSFMLLAIAIIIFLRREF"
     gene            complement(439172..440182)
                     /locus_tag="ANA_C10412"
     CDS             complement(439172..440182)
                     /locus_tag="ANA_C10412"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93213.1"
                     /translation="MNFLLKEIRGIFKYIQDLFAGVQKFLTPAKAYSWQTLIYLSIFS
                     WGISYFALGYIKDIIAFCGWLFLLAGTAWYTTDDPLRVPGTFMPVGAVTTGFLVSIFA
                     FGHKEGVLTPNTIVIWPTIAAIVTAIPNFFEGTGGKLAKAKLPKLQDRQKVVVLLAWC
                     MLISCWLQFYFVIDKWLKEYPSLRADNFQKSAFVIRLEPPAKKPKTGDLILNKLQPLV
                     NQQIANKPWSEVEKWLLEAKPRLGNLGRRTINSNLGQSQERLLWRVEPRVVNIKSGYR
                     LDILTIWGGPGANSQGYYWKKSCLIEPSNSGKQTDNKNTIARLTCDRTSKFIMGSPPA
                     QQ"
     gene            complement(440219..440764)
                     /gene="fraC"
                     /locus_tag="ANA_C10413"
     CDS             complement(440219..440764)
                     /gene="fraC"
                     /locus_tag="ANA_C10413"
                     /codon_start=1
                     /transl_table=11
                     /product="filament integrity protein"
                     /protein_id="AFW93214.1"
                     /translation="MSDELSLPIILPIGAIFFEILFLLIAIPLEAYILNRWLKFDKRT
                     SIFYAIALNVFSSVIGWIVFFTVEPILSIAIKKELINYVFFNKLQDPSIGTMIVLLSF
                     TIFIATFLVKFLLMKILIIFMGEGGKKTETEIISSQQRASYMNMAKLQNTNLITATLI
                     ANSLSYTAITFIILIRSLSIK"
     gene            441039..442175
                     /locus_tag="ANA_C10414"
     CDS             441039..442175
                     /locus_tag="ANA_C10414"
                     /EC_number="2.5.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="cob(I)alamin adenosyltransferase"
                     /protein_id="AFW93215.1"
                     /translation="MTRNGIGIRTAQVRSERLTGQIHVYDGIGKGKSQAALGVVLRSI
                     GLGINTPSDSSRVLLLRFLKGPERDYDEDGAITALQRGFPHLIDQVRTGRAEFFGHDQ
                     ITPFDRTEAARGWDVAKGAIASGLYSVVVLDEINPVLDLGLLSVEEVVNTLKSKPQEL
                     EIITTGRAAPQALLDIADLHSEMKPHHHPTAAELFIEGIEIYTGAGKGKSTSALGKAL
                     QAIGRGINHPGSTRVLIMQWLKGGSGYTEDAAIAALQQSYPEVVDHQRCGRDAIVWRN
                     SRQDLDYIEAERGWEIAKIAIASGVYKTIILDELNPTVDLELLPVDPIVQALLRKPRD
                     TEVIITGRCQNQPAYFDLASIHSEVYCHKHYANQGVELKRGVDF"
     gene            complement(442265..443101)
                     /locus_tag="ANA_C10415"
     CDS             complement(442265..443101)
                     /locus_tag="ANA_C10415"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93216.1"
                     /translation="MSFDNVCKLLAEKYPFDFAKWLLPQEPKTIKVLKTELSIEPIRA
                     DFVTFLQTENRILHIEFQTNPQSKPPIPFRELDYSVRLIRTYQVPVTQVVIFLQETDD
                     PIVFTEEYVNETTRHRYRVIRMWEEEPELFLHNLALLPLAPLTRTNSPQGLLSQIANN
                     VAKIADRETKQDIAAYTEILAGLRFEKDFIRQLLSEDIMQESVIYQDILQKGEGKGEQ
                     KEAVKFCLMLLNQRFGQLDSEILERVKVLSVEHLENLGAALFNISEIADLVTWLNQED
                     HH"
     gene            complement(443288..443869)
                     /locus_tag="ANA_C10416"
     CDS             complement(443288..443869)
                     /locus_tag="ANA_C10416"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93217.1"
                     /translation="MQNGGNRENISHLLPYILGDSQENCVFYYYPDRTFTTTNDSFKI
                     LHQLFIKGSSTEKIIYGYVELFSTFKFLVLLSNDYIGNDFCKEYSFDVMERDKIESNI
                     NIDLCKNSISEIKESQQKNINKFKNALDELRFFIDQKQSEEHISNIVQTSIENVFKGI
                     EEGSTINEDDYIRLIDNFLEKFAHFLNFKNRNF"
     gene            complement(444128..444844)
                     /locus_tag="ANA_C10417"
     CDS             complement(444128..444844)
                     /locus_tag="ANA_C10417"
                     /codon_start=1
                     /transl_table=11
                     /product="putative restriction endonuclease"
                     /protein_id="AFW93218.1"
                     /translation="MYQTDPPRSPQEVLPTMYDLKSEDPEEKGLPDQFHLLQPRLLDE
                     TFNSPTYPSNKIFTASDLNLYYDPHHPTWYKRPDWFVSVDVSPLYKNGDLRLSYVIWQ
                     EGITPFIIVELLSPGTEKEDLGQTLRNVEKPPTKWEVYEQILRIPYYAIFDRYKYEFR
                     MFKLDGGRYAEIDLSSSNSRFWIPEIELGLGVWEGTYNNIQQPWLRWYDISGNWVLTP
                     IEQKERLIEQLRKLGVEPDI"
     gene            complement(445091..446020)
                     /gene="cbiQ"
                     /locus_tag="ANA_C10418"
     CDS             complement(445091..446020)
                     /gene="cbiQ"
                     /locus_tag="ANA_C10418"
                     /EC_number="3.6.3.-"
                     /EC_number="3.6.3.30"
                     /codon_start=1
                     /transl_table=11
                     /product="cobyric acid synthase"
                     /protein_id="AFW93219.1"
                     /translation="MDLLRSLPLGLYLEEPQTWLHKLDPRVKLIWLLSFLSSYIVANN
                     YWRVLLVLLLITFTVFAKIPLRVWRQQMGWLLILSFMVLVIASISPDGLGVSYQSRLP
                     ANEQILTQPISEKKTQVTPVIADSHKKYSYVLFNKGFVKVNRRSLDLAISLSTIVFTL
                     IYSTNLYLLTTAPEEITSGMESLMQPLRRFNIPVTEITLTLTLSLRFIPLVLEEIQNL
                     VRSVMTRAINWKKLGLKGGAKVWLIVTERLLENLLLRAEQMANAMMVRGFTSPNEHRV
                     KWQELKLITGDWLAIATLMIFWVIRIAFGADVS"
     gene            complement(446450..447814)
                     /gene="engA"
                     /locus_tag="ANA_C10419"
     CDS             complement(446450..447814)
                     /gene="engA"
                     /locus_tag="ANA_C10419"
                     /EC_number="3.6.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="small GTP-binding protein"
                     /protein_id="AFW93220.1"
                     /translation="MPLPIVAIIGRPNVGKSTFVNRLAGDQTAIVHDEPGVTRDRTYR
                     PAFWNDREFVVVDTGGLVFNDDTEFLPMIRQQALTALSEACAAIFVVDGQAGLMPADE
                     EISEWLRQQPVPVLLAVNKCESPDQGVIQAAEFWELGLGEPFPISAIHGSGTGEILDE
                     LMNHIPLIVEEEENKEIKVAIIGRPNVGKSSLLNAFVGEYRAIVSPISGTTRDTIDTV
                     VERGDQTYRLIDTAGIRKKKHIEYGTEFFSINRAFKAIRRSDVVLLVIDAVDGVTEQD
                     QKLAGRVLEEGRACVIVVNKWDAVEKDSYTIYDHAKELESRLHFTEWADTIYVSAVTG
                     QRVEKILELVNTAAEAHKRRVSTSVINEVLEDAISWHSPPTSRGGRQGKIYYGTQVSS
                     QPPSIALFVNDNTRFNDNYRRYIERQFRKQLGFQGTPIRLFWRSKKVRDVEIGGPNRA
                     TRVK"
     gene            448265..448885
                     /locus_tag="ANA_C10420"
     CDS             448265..448885
                     /locus_tag="ANA_C10420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93221.1"
                     /translation="MLTILFLNTMFINQKVCIAIAGATLAGMIASASPAGAVVFTYNG
                     SKYDVTTHSFNGNDAFSGTNALNSPLNALWGNKSLANGLASVVGCQLGGCYVNPTDIN
                     GNDWAGAYFAYATQTEHVPGKTNTILSLASIQPNNSTQLPYIDEVQHSYNIGNWNNPN
                     RWFATAVAVPVPWDISGSGTILGSITGIGLGVGLKRLKSKKTLTIS"
     gene            complement(449389..450132)
                     /locus_tag="ANA_C10421"
     CDS             complement(449389..450132)
                     /locus_tag="ANA_C10421"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator protein"
                     /protein_id="AFW93222.1"
                     /translation="MPRILVIDDDPAISELVAVNLEMAGYDVSQAEDGIKGQALALQL
                     QPDLIMLDLMLPRVDGFTVCQRLRRDERTSEIPVLMLTALSQTQNKVEGFNAGADDYL
                     TKPFELEELLARVRALLRRTDRIPQAAKHSEILNYGPITLVPERFEAIWFKTTVKLTH
                     LEFELLHCLLQRHGQTVSPSEILREVWGYDPDDDIETIRVHIRHLRTKLEPDPRHPRY
                     IKTVYGAGYCLELPSVSSGIDEAIATIVE"
     gene            450352..451425
                     /locus_tag="ANA_C10422"
     CDS             450352..451425
                     /locus_tag="ANA_C10422"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase domain-containing protein"
                     /protein_id="AFW93223.1"
                     /translation="MYKYEYLPPYFLQNGVTMTTYTALWANRDWESKTTHPEPKYQEV
                     IFTGGQGVPIFGKVAIPPNAHGTIVGTYGITGELDQQWFLRILGRKAYAQGYAVVLFD
                     WRAHGKTAELSPTLTSDGLYEGEDFVRIAETAAKMGCPSPFWFTGYSLGGQLALWGVK
                     AAADLAPKDIDIAGGAVICPSLDSFRSLTYLVTHPFGKYIESRIAKELKKLAWKIHAV
                     YPESMQPEAIARANSIWGFDEELVIERLGFATVADYYQASSGLELLPKLSKPTLILYA
                     ADDPLFDPAIIPDLEAAATKNPDIDLLLTRYGGHVGYVSSKKCQNQYEDPDQWWAWNR
                     VLEWIETSRSQKIENGSMQKSKV"
     gene            451438..452154
                     /locus_tag="ANA_C10423"
     CDS             451438..452154
                     /locus_tag="ANA_C10423"
                     /EC_number="2.7.8.7"
                     /codon_start=1
                     /transl_table=11
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="AFW93224.1"
                     /translation="MFNFNWLPAPKKLDLLLNDVHIWRINLNSSESQLQFFRETLSSD
                     EIARAQRFYFPEHRQRFIAGRGTLRAILGQYLGIDPKQVEFEYQPRGKPLLAAKFADQ
                     GLLFNLSHSQDLALCGVSYQNQIGVDLEYIRTMSDLESLAKRFFSFKEYEHLRLISPQ
                     EQQQIFFRYWTCKEAYLKATGDGLVQLEEIEISLTPNQPSQLLVSGDWNLRELTPAEN
                     FAAAVVVAGSNINLHCWEYY"
     gene            complement(452235..452456)
                     /locus_tag="ANA_C10424"
     CDS             complement(452235..452456)
                     /locus_tag="ANA_C10424"
                     /EC_number="1.18.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-thioredoxin reductase
                     domain-containing protein"
                     /protein_id="AFW93225.1"
                     /translation="MKVGDRVQVKESVVVYHHPEHRGQAFDIKGTEGEIVAIVTQWQG
                     RPVSANFPFLVQFGKKFKAHLRDFEIESI"
     gene            complement(452755..454683)
                     /locus_tag="ANA_C10425"
     CDS             complement(452755..454683)
                     /locus_tag="ANA_C10425"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /transl_table=11
                     /product="protein serine/threonine phosphatase 2C
                     domain-containing protein"
                     /protein_id="AFW93226.1"
                     /translation="MLSTQRIINCPNSECDQPINSVGDTICDRCHTPLIYRYLRATGN
                     QVAEIPPGTKVADRYEVINPQIWLDTKPATLPHIPAPLPNIVIPYLSLYSQRLHIPQA
                     YGFTSLAEIYGDILLLENAPIDETGCIYPKITDSWEQASPVRQVYWLWQILQLWTHLS
                     KLGVAQSLLLADNLCVQGWCIRLLELHQSTEPPTLQDLGNSWRNWVTIAKTTIAEKLN
                     IIVELMCQPEIDLQIINTQLNELLLTTAADLPLYLTIAGATDPGTVIKHNEDACYPSH
                     PRDIDDQLQPRLAIICDGIGGHEGGEVASQLALQSLKLQMRALLTEIGQQTELLTPDL
                     LYQQIESCLRVVNNVIWSRNDEEKRQGKERMATTLIMSLQIPQRGEQLENSHELYLAH
                     IGDSRVYWITQNYCQLLTVDDDMVKRKVGLGKTLYRQALQIPEAKALTQALGTKEAEF
                     LNFSIQRFIIEEDGILLLCSDGLSDRNLVEQSWQDYAIPVLTGDLDIADATQELIKLA
                     NEKNGQDNISVVLTLCRVAKPSSMAIIPAPPAEIIPPQPLAVPDSEALIITASIETDL
                     AASSQALLDLSLTEAQTAPIKPSRSKGLGLFARLLVLLLGSTTVGLFAWWQLSPQSFS
                     QVCRQLPQKVREFCPGRE"
     gene            complement(454997..455434)
                     /locus_tag="ANA_C10426"
     CDS             complement(454997..455434)
                     /locus_tag="ANA_C10426"
                     /codon_start=1
                     /transl_table=11
                     /product="ferric uptake regulator family protein"
                     /protein_id="AFW93227.1"
                     /translation="MRAIHTRSQERILNLLQNLKQGISAQDIYVELRNLKQSMGLATV
                     YRSLDALKLEGLVQVRTLANGEALYSLTQQDKHHLTCLQCGISIPIHQCPVHELENQL
                     QTSHQFKVFYHTLEFFGLCTKCRVKESPSQESGVRMKEGRKKE"
     gene            455591..455839
                     /gene="purS"
                     /locus_tag="ANA_C10427"
     CDS             455591..455839
                     /gene="purS"
                     /locus_tag="ANA_C10427"
                     /EC_number="6.3.5.3"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="AFW93228.1"
                     /translation="MTLRTSVLDPAGVAVQSGLKQMGYDNVEQVRIGKYIELTIVAPD
                     EMKARRDLNQICDQMLSNPVIENYRFDLIEVESQTGVF"
     gene            456114..456785
                     /gene="purQ"
                     /locus_tag="ANA_C10428"
     CDS             456114..456785
                     /gene="purQ"
                     /locus_tag="ANA_C10428"
                     /EC_number="6.3.5.3"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase I"
                     /protein_id="AFW93229.1"
                     /translation="MKFGILVFPGSNCDRDVAYVTRDLLGQPTRMVWHQETDISDIDV
                     VIVPGGFSYGDYLRCGAIARFSPVMQQVIDHAQQGKFVLGICNGFQVLTEAGLLPGAL
                     ARNQDLHFICDRSPLKVERNNLPWTQGYLEGEIITLPIAHGEGRFYSDETTLAEIEAN
                     GQVLFRYQTNPNGSLNNIAGICNLQGNVLGMMPHPERAADSALGNSDGLRLFEGLLGK
                     VAALV"
     gene            complement(456879..457304)
                     /locus_tag="ANA_C10429"
     CDS             complement(456879..457304)
                     /locus_tag="ANA_C10429"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH domain-containing protein"
                     /protein_id="AFW93230.1"
                     /translation="MTNKIGNKTLGTPKTYVELITAFPPRKITSEEELAITQNIIDSL
                     LDQERLTPDERDYLHLLGLVVSEYEEENYPVADIYGVELLKVLMTELNLQPKDLMPIF
                     ADETIISDILSGEQPLTIEQIEKLSNFFHVSPSVFLKNV"
     gene            complement(457264..457566)
                     /locus_tag="ANA_C10430"
     CDS             complement(457264..457566)
                     /locus_tag="ANA_C10430"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93231.1"
                     /translation="MHIISKKRLKEFSQQHPKSESNLETWYKIVNKAKWENFVQLRQV
                     FPSADLVGNFTVFNVSGNNYRLIALVDYQYQEVYIRHILTHAEYDKQNWKQDPWYT"
     gene            complement(457576..458031)
                     /locus_tag="ANA_C10431"
     CDS             complement(457576..458031)
                     /locus_tag="ANA_C10431"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93232.1"
                     /translation="MNNLQKSAFTLVIQPEEKIENRVYIIVNYLAKTYLESQWLITEI
                     DATGLLGNRLTSILNNQENTTISSSDFLQLLQEEGQILDLEATLVKSSQEIITVFIRD
                     GYSVDILGVTELLPVNVLNNCIRVDANLFDTQETEISQPKINVVYQKIA"
     gene            complement(458028..458354)
                     /locus_tag="ANA_C10432"
     CDS             complement(458028..458354)
                     /locus_tag="ANA_C10432"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93233.1"
                     /translation="MSDKIHSRYADGTPVYQSQRPPRFGEPVADPLAQAAHSRLRWDQ
                     YHQRVYQAREFDTNGQPVRDIDFTSPTYPNGTLRPDHLPPPHQHLWLANITGGTPTRS
                     KQPQIL"
     gene            458530..458835
                     /locus_tag="ANA_C10433"
     CDS             458530..458835
                     /locus_tag="ANA_C10433"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93234.1"
                     /translation="MTNDTIRTVIWVNSAKEELLEFPEDVIDEVGYILYRVQTNQTHP
                     NRVFEKSNLLLARATRSRGTTQTKPTYSFGTLRERGFKSLDFSLVHAGGLCLCSSDF"
     gene            complement(458988..459215)
                     /locus_tag="ANA_C10434"
     CDS             complement(458988..459215)
                     /locus_tag="ANA_C10434"
                     /codon_start=1
                     /transl_table=11
                     /product="KW Leptospira repeat-containing protein"
                     /protein_id="AFW93235.1"
                     /translation="MFWCKSIASTHKTRKIIIHLRYSTFPSSRVFKMNGKWGFINNSG
                     QLLIPCKFDDALSFSEGLAAVTINGKEHLGM"
     gene            complement(459245..460645)
                     /locus_tag="ANA_C10435"
     CDS             complement(459245..460645)
                     /locus_tag="ANA_C10435"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase modulator U62 peptidase"
                     /protein_id="AFW93236.1"
                     /translation="MKTKLTDVQNLLSDLISRYSSRVDYLMIRLEEAEGTDIVLRGDK
                     VETLSEGISIGGHVRTCYKGGWGLSSFNKLTTIEDRIEEAIAAARIVGDEETILAAID
                     PVQAVCRLPLLGTDPRQVSLKQKKQLCDRYTDLLKTVDHRITTTSVHYSDSTQRVIIV
                     TSEGTFIDQSWVDMEMRFAATARNGDTVQTGRETTGSRKAYEDLTNLDKQVKGAAERA
                     VTSLSLPSVKGNTYTVVIDPILSGLFVHEAFGHLSEADMAYENPDILEVMTLGRRFGP
                     KELQIFDGAAPQGHRGSYFYDDEGTPATTTQLIEDGVLVGRLHSRETAGKLDEKPTGN
                     ARCLNYHYSPIVRMTNTWIERGKTPVADLFTGIKEGVFAQNWLGGMTNGEMFTFSAGE
                     AWMIRNGKIAEPVKDVTLSGNVFQTLADIEAIGDDFYWDESGGCGKGGQNGLPVGCGG
                     PSLRIRDVVVGGESGE"
     gene            461338..461601
                     /locus_tag="ANA_C10436"
     CDS             461338..461601
                     /locus_tag="ANA_C10436"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93237.1"
                     /translation="MVRQMCWLSKSNGDDQKILYLQTAPGQPWRPYTAFPQFSVPDYR
                     VPRGSKGWATYQKLFKAGWTLVPSARGSEFGDSCYAESTVQSS"
     gene            461742..461999
                     /locus_tag="ANA_C10437"
     CDS             461742..461999
                     /locus_tag="ANA_C10437"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93238.1"
                     /translation="MPPRWPRKPDRKDPDFRKLDDRMNFAVHVGICATVTSGLWFFHI
                     LKTTAWEWLPGVTIGWVGVLLLHLIYIGAIANYDPTPPKST"
     gene            462118..462426
                     /locus_tag="ANA_C10438"
     CDS             462118..462426
                     /locus_tag="ANA_C10438"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93239.1"
                     /translation="MAKTNTTELLETLAAEIGESVYIDIAKWHLYLSDAKLHNVVAEK
                     LYPLITSKSVNEDKVIAVLESITVKVGGGRKELSLIDLLPLQCQVTLVDIVEKYQREI
                     "
     gene            462484..462708
                     /locus_tag="ANA_C10439"
     CDS             462484..462708
                     /locus_tag="ANA_C10439"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93240.1"
                     /translation="MFLQIKDSRDLVKIVDVQELLDPTSKIVHAQDQEGQEEQETDIY
                     QKEELVFPSGEKLPRCWLDAKFREREAVAA"
     gene            complement(462762..463220)
                     /locus_tag="ANA_C10440"
     CDS             complement(462762..463220)
                     /locus_tag="ANA_C10440"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93241.1"
                     /translation="MNITDLFNVANLFVLPFWALMILLPNWKITRKVMESYLPFVVLA
                     GAYLYLFVTSITPENAAALSNPQLADIARFFSNETAAATGWIHFLVMDLFVGRWIYWE
                     GQKTGIWTIHSIALCLFAGPLGVLSHIFTYWITKAFSKGSEGVTEKAAVN"
     gene            complement(463222..464271)
                     /gene="cobW"
                     /locus_tag="ANA_C10441"
     CDS             complement(463222..464271)
                     /gene="cobW"
                     /locus_tag="ANA_C10441"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin biosynthesis protein"
                     /protein_id="AFW93242.1"
                     /translation="MATKIPVTVITGFLGSGKTSIIRHLLQNNQGRRIAVLVNEFGEL
                     GIDGELLKSCQICPEDETAENPETNIFELTNGCLCCTVQEEFYPTMRELIKRRDSIDY
                     IIIETSGLALPKPLIKAFRWQEIRNAATVDAVITVVDCAAVAAGTFASDLDAIAAQRQ
                     EDDSLEHETPLQELFEDQLACADLVILNKTDLVDSETQAQVLELVKHELPRVVKIVSS
                     DYGKLDPSILLGFAAAVEDNLDSRPSHHDTEEDHDHDDEINSTHVILNRTFDPEKLQA
                     ILEKLAQEQEIYRIKGFVAVENKLMRLVMQGVGNRFDKFYDRPWKPEEAKQTSLVFIG
                     RNLQSSTIESQLVAL"
     gene            complement(464391..464834)
                     /locus_tag="ANA_C10442"
     CDS             complement(464391..464834)
                     /locus_tag="ANA_C10442"
                     /EC_number="3.6.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="PIN domain-containing protein"
                     /protein_id="AFW93243.1"
                     /translation="MNNYLICVDASFTINLINSKSLDSPFIKLWENWQQNSATIIAPT
                     LFYYEITNALHRMNQANLLTIEDTEKALQDALNLGIVLYGSSQFPQLHEMALTLAKTL
                     KLSAAYDAHYLALSKLLNAEFYTADKRLYNSIKLSLNWVHFISHT"
     gene            complement(464827..465081)
                     /locus_tag="ANA_C10443"
     CDS             complement(464827..465081)
                     /locus_tag="ANA_C10443"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93244.1"
                     /translation="MNRELVKKLVEIIHCLSPEEKQLLETELQIKPDWNIIKKSIIQR
                     GEILNQRLNNQSLQDTITNIISEMREERCEELINSLKVHE"
     gene            complement(465252..465701)
                     /locus_tag="ANA_C10444"
     CDS             complement(465252..465701)
                     /locus_tag="ANA_C10444"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93245.1"
                     /translation="MIENTDLILRKTPENDNTFNNQGVKFSSDSTIHTWENLRFRSKT
                     EIKIAEALDRTGVLFVPNSLARLTTPKGRENKEADFLICYNGKWGVLEVDGPFHTAER
                     RVEEQERERIFKKNGIKVVERFDAERCYNNPDEVVQEFFKMIEIGYS"
     gene            complement(465830..466231)
                     /locus_tag="ANA_C10445"
     CDS             complement(465830..466231)
                     /locus_tag="ANA_C10445"
                     /codon_start=1
                     /transl_table=11
                     /product="HicB family protein"
                     /protein_id="AFW93246.1"
                     /translation="MSKKNKTERESLEFYLNLKYPVTLYPDPDGGYVAEIKDLPGCMT
                     QGETTDETLFNIEEARSLWIETAYEYGDEIPLPSTQVQYSGKVLLRIPRSLHERLTEN
                     AEKEGVSLNQYLVFLLSERNAIKSLSMANVK"
     gene            complement(466420..467103)
                     /gene="exsB"
                     /locus_tag="ANA_C10446"
     CDS             complement(466420..467103)
                     /gene="exsB"
                     /locus_tag="ANA_C10446"
                     /codon_start=1
                     /transl_table=11
                     /product="exsB protein"
                     /protein_id="AFW93247.1"
                     /translation="MKAVILLSGGLDSSTVLYKAKADGCECYAISFDYQQRHRKELNS
                     ALMIAKAAGVIQHQVVNFDLGQWGGSALTDQKIDLPTGRSLAEMADNIPVTYVPARNT
                     IFLSFALSYAEAIAAERVYIGVNILDYSGYPDCRPDYIEAMQEVFRLGTKQGREGEAM
                     KIIAPLIDLKKTEIIQLGNQLGVPWDLTWSCYAGGESACGVCDSCQLRLAAFAELGLK
                     DPIDYSEVG"
     gene            467656..468762
                     /locus_tag="ANA_C10447"
     CDS             467656..468762
                     /locus_tag="ANA_C10447"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="AFW93248.1"
                     /translation="MVVEERTIVQDSISVSEPNLYSQRSQPHHIRIGVIGVGNMGQHH
                     TRVLSSMKDVELVGVSDINVERGLETASKYKVRFFEDYCDLLPHVDAICVAVPTRLHY
                     AVGINCLLAGIHVLIEKPIAASISEAESLVNAAAESQCILQVGHIERFNPAFRELTQV
                     LKTEEVLALESHRMSPYSARANDVSVVLDLMIHDIDLLLELAASPVVKLTASGTRSLD
                     SGYLDYVTATLGFANGVVATLTASKVTHRKIRRLVAHCKNSFTEADFLTNEILVHRQT
                     PINPLIDHQKVLYRQDGLIEKVYTSNVQPLSAELEHFVNCVRGGNQPSVGGEQALKAL
                     RLASLIEQMALEERVWNPLEWSSESRVQSLTSSI"
     gene            469126..470277
                     /locus_tag="ANA_C10448"
     CDS             469126..470277
                     /locus_tag="ANA_C10448"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93249.1"
                     /translation="MTDQPPVANPMNAAAISMNRQPAAATPMNSVNPGRPSNITGKTI
                     LSVDLGRTSTKTCVSREPANVAFIPANVKQTSIEQIRGGVFEAKATDPLMDLWLEYQG
                     SGYAVGQLAADFGANLGVGQSKVEDALVKVLSSAGYFKLRDEIFVVLGLPFLSLEQFE
                     KEKAQLTSLVTGPHVLNFRGESITLNISKVWVMPEGYGSLLWSETQPNKGTAVPDFTK
                     ISVGIVDIGHQTIDMIMVDNFRFARAASKSEDFGMSKFYELVAAEVQGADSQSLALIS
                     AVNKPKGDRFYRPKGASKPTNLDDFLPNLKEQFSREICSRVLAWLPERVTDVIITGGG
                     GEFFWEDVQRLLKEAQINAYLAAPSRQANALGQYIYGEAQLSAAVRARS"
     gene            470283..470744
                     /locus_tag="ANA_C10449"
     CDS             470283..470744
                     /locus_tag="ANA_C10449"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93250.1"
                     /translation="MFQWSKKVVKSVTFNPEIADESLLAQVENYLETQPDKTFSDLCK
                     EALWNFLCVPEPVQLTSKIANVTTVEQKIGEIQNQIAGFEERFFAKESHRLESMESQM
                     LQLTQQVAKLTIILNQEPLTCIPSDSVSVAPAIPQEVDPVISRIGQFLDDF"
     gene            471506..472837
                     /gene="fbt"
                     /locus_tag="ANA_C10450"
     CDS             471506..472837
                     /gene="fbt"
                     /locus_tag="ANA_C10450"
                     /codon_start=1
                     /transl_table=11
                     /product="folate/biopterin transporter"
                     /protein_id="AFW93251.1"
                     /translation="MLNDSPTLPKFKDLLTQKIFLGNKPSAELIAILTIYFVQGILAL
                     SRLAVSFFLKDELLLSPVQMSAIVGISTIPWMTKPLYGFISDSLPLFGYHRKPYIVLS
                     GILGSAALVCLGTTVHTSTTATIMIVLSSLSVAISDVIVDSIVVERARSESEAKIGSL
                     QSLCWGSSAIGGLCTAYLSGLLLEYFTNRTVFLITALFPLIISSVAWLISEKPINKDD
                     KKSNNTKYQLGQIRQAITQKAIWLPTAFIFVWHATPNAESAFFYFTTNELQFQPEFLG
                     RVRLVTSLASLIGVWAFQRYLKTIPFRIMFSWGIFLSTALGMTTLLLVTHTNRLLGID
                     DHWFSLGDSLIITVIGQVLFMPILVLSTKLCPPGIEATFFALIMSVFNLGGTVSYALG
                     SIMMKWLGITEHQFDSLWLLIIITNCSSLIPIFFINWLPDAKIEIDHSQSI"
     gene            472861..474342
                     /locus_tag="ANA_C10451"
     CDS             472861..474342
                     /locus_tag="ANA_C10451"
                     /codon_start=1
                     /transl_table=11
                     /product="carotenoid oxygenase"
                     /protein_id="AFW93252.1"
                     /translation="MQILEPQNSQVLEKSYTLKDWQGGYESLTEEYDYWIDDIEGEIP
                     PELAGTLFRNGAGLLDINKQRLHHPFDGDGMISRITFTNGRAHFRNRFVQTAGYLAEQ
                     KAGKILYRGVFGTQKPGGWLANIFDLKIKNIANTNVIYWGKKLLALWEAAEPYSLNPQ
                     TLETLGNEYFNGVLSKGEAFSAHPRIDPNGTLVNFAIKPGLSTTITIFELNTNGEITS
                     KQNHSVPGFCFIHDFVITENYCIFFQNPVDFNPIPFALGISSAAQCIKFQKNQPTRII
                     IIPRKTQTKNVKVLETQAGFIFHHVNAFELRNEIIIDSICYESLTEVEPNSDYRKTDF
                     DTNSPPQLWRFNLNLSENKVQNQLIDPRPTEFPTIHPNYVGKSYRYLYSAAAHQSTVN
                     APLQAIFKVDLESGRKQLWSAAPRGFIGEPIFIPRPNSQTEDDGWLIALVYDAEHHRF
                     DVVILDAENLEKEKPVAKLHLKHHIPYGLHGSFTQETFIENLG"
     gene            474526..475815
                     /locus_tag="ANA_C10452"
     CDS             474526..475815
                     /locus_tag="ANA_C10452"
                     /EC_number="1.4.1.2"
                     /EC_number="1.4.1.3"
                     /EC_number="1.4.1.4"
                     /EC_number="1.4.1.8"
                     /EC_number="1.4.1.9"
                     /EC_number="1.4.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate/phenylalanine/leucine/valine
                     dehydrogenase"
                     /protein_id="AFW93253.1"
                     /translation="MVTTSLPLMETQSSAYICPYDQACSYLEWAAKELKLDQGIVEIL
                     SHPRKVVTVSIPIKMDNGEIRVFPGHRVQHSDILGPYKGGIRYHEAVTLREVSALAML
                     MTWKCALLGIPYGGGKGGIPIDPKKFSVGELERISRRYISELIKDIGPSVDIPAPDMG
                     TSAREMAWMMDTYSVNVGHSVPGVVTGKPLSIGGSLGREMATGRGVMIIVREALADHG
                     KSLVGVRVAIQGFGNVGGAAAELLHQEGAKIIAVSSASGGIFAENGLDISAVKAYAAA
                     NHRSVVGFPQGTPISNADLLTLPCDVLIPAALENQITAENVHQIKAQFVAEAANGPVT
                     LEANRVLESQGVNVLPDILANAGGVVVSYLEWVQGLSYLFWDEERVNREMEHLMVQAY
                     RKVIHESQARGVNLRLAAYTLGVGRVAQALNDRGLYP"
     gene            475936..477039
                     /locus_tag="ANA_C10453"
     CDS             475936..477039
                     /locus_tag="ANA_C10453"
                     /EC_number="3.6.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="RecF/RecN/SMC domain-containing ATPase"
                     /protein_id="AFW93254.1"
                     /translation="MLQRVIIKGFKSIKTMDLELRPLNILIGANGAGKSNLISFFKML
                     NEMMAGRLQQYIGISGYAQSLLHFGPKITPQIEAQLEFKIDNGSLDIIYTMCLGHAAG
                     DTLIFAEETATRNGLHLPQPSTTYSLGAGHQETKINKAAQEGTPTIANAIKHLLNGCC
                     VYHFHDTSSTARVRQSCYIDDNRSLVSDAGNLAALLLRFREYHNTAYQRIIKTIRLIA
                     PFFDDFVLEPRANNVILNWQGKDSDQVFGPHQFSDGTLRAICLTTLLLQPEDELPKLI
                     VVDEPELGLHPYALNVVAAMFAKASYHTQILISTQSTSFLDNFNPEDVITVDRVGKES
                     QFKRLNSEELEAWLEEYSLGEIWEKNIIGGGPH"
     gene            477039..477728
                     /locus_tag="ANA_C10454"
     CDS             477039..477728
                     /locus_tag="ANA_C10454"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93255.1"
                     /translation="MVRLYLFAEGQTEQTFASIILQPYLTQYQVFMHHPRLIAHGRKK
                     GKTNRGGSGYGDYQPMKNDILRSLAEDKNTDVFFTTMIDLYAIHHNFPGLDEAEIMRQ
                     NPTKRVEFLEKSFADDINDPRFIPYIQLHEYEAYLFSDPTCFESCYDNCSDRVAILKT
                     IADKHETPELINDSRATAPSKRIIAQFPDYERAKSTYGPLLAESIGLEVIRNKCPHFN
                     SWLLRLELLGK"
     gene            complement(477915..479165)
                     /locus_tag="ANA_C10455"
     CDS             complement(477915..479165)
                     /locus_tag="ANA_C10455"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93256.1"
                     /translation="MLKPLLVSGWFRVKPFLKYIAIVIVISPFLGMSIHATLAKQSEV
                     ANSRAKNSKSQIKLAESAATRQLNLQFAQVNSHTGKILVGEGIQSLPKDIVISGAERE
                     NSQLGDDVVSKTVPSVNVAQLQSKTSINQANLIQKLKDAKEETDLNSPVSGNSQSQEL
                     AISTVTPKNGEIPVSERPNESEMAQTDPIGSPHPIPWQWILATQEAIGAKGGSGVRYY
                     RSIPVISPDGKYAIYSRVQMEVKPEMHNSRVNSVLFVEDRQTKRLRVMTSTSVVIDPL
                     LKRQAILSAQGDNDGKIGVLVPVSWSEKGDRFLARKFVAIFNTADATDQAVIWNRQQD
                     HLNVVSPVQSQDDHEKIAILLGWSKKQPNNVLFRAGELGEENWPLLQVANDGRTVDIS
                     AEGDQAVTFGEKGSIWADPQVASR"
     gene            480047..481048
                     /gene="fmt"
                     /locus_tag="ANA_C10456"
     CDS             480047..481048
                     /gene="fmt"
                     /locus_tag="ANA_C10456"
                     /EC_number="2.1.2.9"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="AFW93257.1"
                     /translation="MKIVFFGTPDFAVPTLEKLLENKDFHVMSVVTQPDKRRERGNKL
                     TPSPVKVFATDHHIPVWQPERVKKDVETLTQLKQIEADIFVVIAYGQILSKKILDMPK
                     LGCINVHGSILPQYRGAAPIQWSIYNGEKETGITTMLMDRGMDTGDMLLKATIPIQLL
                     DNAQVLAEKLAITGADLLIETLYKLERQEVTPIPQDHTAATYASLIQKPDYNLDWGQS
                     AIQLHNQIRGFYPNCTATFRNQALKITATVPLYPAYIHELPEPLLEKVHKIPNLSTIS
                     GQPGEVVNITKGLGAIVQTGVGLLLLREVQLTGKRPQSGWDFVNGTRLTVGEVMGNG"
     gene            complement(481383..481733)
                     /locus_tag="ANA_C10457"
     CDS             complement(481383..481733)
                     /locus_tag="ANA_C10457"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93258.1"
                     /translation="MELNSLPTEVILTHPRQSLGKLQLDWTPQPGNYLDFAEKTYVVL
                     ERCHRYQLKGGRYSLHNIAIYVQKAQRPEQKSLVEGRWVIGDATCNYNALSEIMRCAV
                     NPEGPCKSCRFYES"
     gene            481939..482823
                     /locus_tag="ANA_C10458"
     CDS             481939..482823
                     /locus_tag="ANA_C10458"
                     /EC_number="2.4.2.-"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-2 type tarsporter protein"
                     /protein_id="AFW93259.1"
                     /translation="MSNDKVAVNWQQLTSSPVVADTTSNFFAEIVQETFALTRRLFIQ
                     LQRRPSSLIAGIIQPVMWLVLFGALFQNAPTGLFGSTTNYGKFLAAGVIVFTAFAGAL
                     NAGLPVMFDREFGFLNRLLVAPLASRFSIVFASAIFIISQSLLQAAVIVAAAAFLGAG
                     LPDFTGLCAIALIVFLLALGVTAISLGLAFALPGHIELIAVIFVTNLPLLFASTALAP
                     LSFMPGWLQVIATLNPLSYAIEPIRYLYLHSSWGLNDIVMHAFWGDVTFGGALLVLLG
                     FALVALLSIQPQLRRSLA"
     gene            482845..483249
                     /locus_tag="ANA_C10459"
     CDS             482845..483249
                     /locus_tag="ANA_C10459"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93260.1"
                     /translation="MKRSFLPVHKIIVATIAGVSFASILVGEPTLADTNQPFGSLESD
                     TLGQQGYRSSNPLSGNGSGFDMMNMIHQANFGTIQWNADEQNQQLDLAAATFKAAQQK
                     LLQPQLKQNPGSSAIIPGQNLLPLQILPSSGK"
     gene            complement(483425..483862)
                     /locus_tag="ANA_C10460"
     CDS             complement(483425..483862)
                     /locus_tag="ANA_C10460"
                     /EC_number="1.1.1.-"
                     /EC_number="1.11.1.15"
                     /codon_start=1
                     /transl_table=11
                     /product="AhpC/TSA family protein"
                     /protein_id="AFW93261.1"
                     /translation="MPLSVGTDAPAFTAKDTNGNTISLSDFAGKTVVLYFYPKDDTPG
                     CTKQACSFRDSQAEYKDKDVVVLGVSADDEVSHQAFTNKYNLNFPLLADTQKSIITAY
                     DVDGGGYAKRVTYIIDGNGKIIDVDAAVNTTTQASDVLAKLGL"
     gene            484011..484415
                     /locus_tag="ANA_C10461"
     CDS             484011..484415
                     /locus_tag="ANA_C10461"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93262.1"
                     /translation="MSTVDSPNLKPLVYTSEALERAERSLICSPFNLNLFIAMTSQSI
                     QLGAIAMEKGNQQSYTKQPLSELTCENALAWLIDVGVLRREVDGQGITDSFRLTPLGH
                     QLIVKLKDQKLRHPSLSDRYNDFMTRWLRLPF"
     gene            484612..486084
                     /gene="cobQ"
                     /locus_tag="ANA_C10462"
     CDS             484612..486084
                     /gene="cobQ"
                     /locus_tag="ANA_C10462"
                     /EC_number="6.3.5.10"
                     /codon_start=1
                     /transl_table=11
                     /product="cobyric acid synthase"
                     /protein_id="AFW93263.1"
                     /translation="MKAIMVVGTTSHAGKSLITTAICRILSRRGLRVSPFKGQNMALN
                     AYVTASGGEIGYAQAVQAWAAGVVPLVEMNPILLKPQGDMTSQIILKGKAIGKVSATD
                     YYEQYFELGWQTIKECLQYLSTEFEALVCEGAGSPAEINLKHRDLTNMRVAKHLNAPT
                     LLVVDIDRGGAFAHVVGTLELLDPDERALIKGVVINKFRGQRSILEPGIKWLEERTGI
                     PVVGVIPYLEQVFPAEDSLDLLERKPAKANSELNIAVIRLPRIANFTDFDPLESEPSV
                     TVKYLHPKQELGHPDAVIIPGTKTTIADLIALQKSGMAEAIQNYAASGGTVLGICGGF
                     QMLGQSIADPEGMEGQSGKYPGLNLLPIKTVITGQKVARQRQVTSNYPQAGLPVTGFE
                     IHQGRSRIENPADQKSCQPLFDDANLGLVDSCQSVWGTYLHGIFDNGPWRRAWVNRLR
                     QQRGLKSLPTGVANYKEQREQMLDSLATQIEEHLDLIPFI"
     gene            486717..487703
                     /locus_tag="ANA_C10463"
     CDS             486717..487703
                     /locus_tag="ANA_C10463"
                     /codon_start=1
                     /transl_table=11
                     /product="pentapeptide repeat-containing protein"
                     /protein_id="AFW93264.1"
                     /translation="MANPEHLAILKQGVGVWNKWIDENRRDVIPDLYKADMRGHNLRG
                     AELVGANLSEADLRKADLIGADLIGAELVGADLRWANLIKTDLRWANLSNADLTNADL
                     TNADLLQSQVISTNFNQAILTGSCIKDWQINSETNLDGVICEYIYLEDIFYFGEYESK
                     RRPINGNFAPGEFASLYKKILENTDLILRKTPENDNNINNQGIQFYSNSTIHTWERLR
                     FRSKTEIKIAEALDRTEVLFVPNSLARLTTPKGRENKEADFLICYKGKWGVLEVDGPF
                     HIAERRVEEQERERIFKINGIKVVERFGAKECYETPDKVVQKFFYLMEIAYS"
     gene            487810..489882
                     /locus_tag="ANA_C10464"
     CDS             487810..489882
                     /locus_tag="ANA_C10464"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan-rich domain-containing protein"
                     /protein_id="AFW93265.1"
                     /translation="MNSKPHTKHGYKNPRYGNYNTSGYAFGVQVVGNYAYVADSISGL
                     QIIDISNPTTPTLKGNYDTSGNTLDVQVVGNYAYVADDNGGLKIIDVSEFINLYTAIE
                     SAGNTKLVKDSTNKYFTQIGTNTPIAIKNGGQQIYQDIYGSGWQTIAAETVNGDNQVL
                     WKNVSGNYLHIWHLDSNWNWVSSEGNWGLNSADAFTQETKFGIDANGDGVIGNPYTAI
                     EAVGNTKLVKDSTYKYFTQIGTNTPIAIKNGGQQIYQNIYAGWQTIAAETVNGDNQVL
                     WKNVSGNYLHIWHLDNNWNWVSSEGNWGLNSADAFTQETVFGIDANGDGVIGNPYTAI
                     EAVGNTKLVKDSTNKYFTQIGTNTPIAIKNSGQQISQDIYAGWQTIAAETVNGDNQVL
                     WKNVSGNYLHIWHLDNNWNWVSSEGNWGLNSAEALTQETNFSIDANGDGVIGYTSIES
                     AGNTKLVKDSTNKYFTQIGTNTPIAIKNGGQQIYQNIYAGWQTIAAETVNGDNQVLWK
                     NVSGNYLHIWHLDNNWNWVSSEGNWGLNSAEALTQETVFGIDANGDGKIGSPSSLTLT
                     GTSGNHILIGGANSDTFNGGLGNDTLYLGLNDNAVDNVNYASGDGTDTVYQFVRGDGG
                     DKLNFTGIANLDVVTLGANTEVRIGDGIAANTGFGTGQLLITLSSTTGLNNADVNVNL
                     FGSNFLFN"
     gene            complement(490467..492227)
                     /gene="hflB"
                     /locus_tag="ANA_C10465"
     CDS             complement(490467..492227)
                     /gene="hflB"
                     /locus_tag="ANA_C10465"
                     /EC_number="3.4.24.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent metallopeptidase"
                     /protein_id="AFW93266.1"
                     /translation="MTYGRFLEYLDADRVTNVDLYDGGRTAIIEANDQDIENRTQRWR
                     VDLPVNAPELIQKLKEKQVSFDAHPIRNDGAIWGLLGNLIFPVLLITGLFFLFRRSNN
                     LPGGPGQAMNFGKSRARFQMEAKTGVKFDDVAGIEEAKEELQEVVTFLKQPEKFTAVG
                     ARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKK
                     AKDNAPCIIFIDEIDAVGRQRGAGIGGGNDEREQTLNQLLTEMDGFEGNTGIIIIAAT
                     NRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEVLQVHARNKKLDPSVSLEAIARRTPG
                     FTGADLANLLNEAAILTARRRKEGITLLEIDDAVDRVVAGMEGTPLVDSKSKRLIAYH
                     EIGHALVGTLLKDHDPVQKVTLIPRGQAQGLTWFMPNEEQGLISRSQLKARITGALGG
                     RAAEEVIFGRAEVTTGAGGDLQQLSGMARQMVTRFGMSDLGPLSLESQQGEVFLGRDW
                     TTRSEYSEAIACRIDAQVRMIVEECYSNAKNIMRDHRSLADRLVDLLIEKETINGDEL
                     RQIVAEYAEVPDKSQFAPML"
     gene            492821..493039
                     /locus_tag="ANA_C10466"
     CDS             492821..493039
                     /locus_tag="ANA_C10466"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93267.1"
                     /translation="MKAELTAIIERATEGGYWAICPEISGANGQGETIEEAKENLKLA
                     IQLIIEDPMAHIRRGITEDAIEETILIP"
     gene            493036..493215
                     /locus_tag="ANA_C10467"
                     /note="YcfA family protein;
                     with internal stop codon"
                     /pseudo
     gene            complement(493403..493915)
                     /locus_tag="ANA_C10468"
     CDS             complement(493403..493915)
                     /locus_tag="ANA_C10468"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93268.1"
                     /translation="MDELNKQLSAFGISPEEISKQLSSMGISFDEIAKKTASIGVPSI
                     ILAVAFTSFGGTGLTVTLATALAGSIGVIGDNLTGYGIEMILTTVYVERRKTEAEEAL
                     YREIDILPLTDALKIKLKSQLAQVKVTDNTTDNISTENSANGSTNQNSDRCQVEETQR
                     EPQQVMAVAK"
     gene            complement(494570..495169)
                     /locus_tag="ANA_C10469"
     CDS             complement(494570..495169)
                     /locus_tag="ANA_C10469"
                     /codon_start=1
                     /transl_table=11
                     /product="putative restriction endonuclease"
                     /protein_id="AFW93269.1"
                     /translation="MTQAAITNLELIQPLANHQALTDEQFMLLQENDNLYEYVNGELI
                     IVANSGVEHGYLALTLGYFLTGFVRDHKLGITCDSSTAFKMKTGNKRSPDLAFVSKER
                     LPGLKRLPKGFFDGAPDLAVEIISPNNTFEEIHNKLVEYFENGTRLAWVILPDEECVL
                     VYRKPKPSQLLQLEDSLDGEDVIPNFNLPLIELFQELSF"
     gene            complement(495456..495626)
                     /locus_tag="ANA_C10470"
     CDS             complement(495456..495626)
                     /locus_tag="ANA_C10470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93270.1"
                     /translation="MFTNTLLKLMFPVCIPALCLNNYSNPKRLFEKYYMKPIISKNLT
                     PLPPFRTREWGF"
     gene            complement(495770..496252)
                     /locus_tag="ANA_C10471"
     CDS             complement(495770..496252)
                     /locus_tag="ANA_C10471"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93271.1"
                     /translation="MSKTAFPTGIIVVLCVTAGFNPVAHAQTAAPIFGDATIQHPLSS
                     DPLILRGMSGGAIPGSKIAGKAETPPTGPCKGFMDEAPDHTVKLTSKFDYLKLVVQSP
                     ADTTMIVKGPGGTWCNDDFDGKNPGIVGEWLPGTYQIWIGSYKENESLPYTLKITEGK
                     "
     gene            complement(496392..497837)
                     /gene="gltX"
                     /locus_tag="ANA_C10472"
     CDS             complement(496392..497837)
                     /gene="gltX"
                     /locus_tag="ANA_C10472"
                     /EC_number="6.1.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA synthetase"
                     /protein_id="AFW93272.1"
                     /translation="MTVRVRIAPSPTGNLHIGTARTAVFNYLFARHHDGNFILRIEDT
                     DLERSRPEYTDNILAGLRWLGLNWDEGPFFQSQRLHLYKEAVQKLLDQGLAYRCYTTS
                     EELDALREGQKARGEAPRYDNRHRHLTPEQRAEFEAQGRSSVIRFQIADSREIVWNDL
                     VRGKMSWRGSDLGGDMVIARAASDGTGQPLYNFVVVVDDIDMQITHVIRGEDHIANTA
                     KQILLYEALGAKIPEFAHTPLILNQEGRKLSKRDGVTSICDFQEMGFTAEGLVNYMTL
                     LGWSPADSTQEIFDLESAAKDFCFERVNKAGAKFDWDKLDWLNSQYLHNMPIDKLTDL
                     VIPYWEKAGCQFTGGRERTWLEQLVGLIAASLTRLVDAVEMTKVFFTDGVELTEEGSQ
                     QLQQEGVKTVLQAIITALESQPELSADIAQSIIKQVVKSENVKKGLVMRSLRAGLTGD
                     VHGPDLIQSWLLLNQIGLDKARLNQAISSKP"
     gene            complement(497936..498009)
                     /locus_tag="ANA_C1R003"
     tRNA            complement(497936..498009)
                     /locus_tag="ANA_C1R003"
                     /product="tRNA-Asp"
                     /note="tRNA-tRNA"
     gene            complement(498235..499416)
                     /locus_tag="ANA_C10473"
     CDS             complement(498235..499416)
                     /locus_tag="ANA_C10473"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93273.1"
                     /translation="MPRLPKPRKLSLILIFIIPLILIGFLFNNFASASSIIESIEFIG
                     QATLPTGLIFQKTEVGGLSGITYDVRNNLYYAISDDRGQKATPRFYTFTIDLSKGKLT
                     NNDVIPVGVTNLLNTSNQPFPPNTTDTEGIAITNQDTIFVSSEGDVDKLINPFIKEFA
                     LASGKTISTLPIPDKFLPDSQKQKGIRNNLAFESLTITPNQKFLFTATENALIQDGPA
                     AKSGVGTSSRILEYNLLTKQPEREFLYQTEPVTSLFNPTGKFASGLPDLLALNNQGNF
                     LSIERSFTGLGFTVFVFEISLENATDIHNFDSIAKIDPDKIKPVEKKLLLDLRTLDVS
                     LDNIEGLTLGAKLPDGQPSLILISDNNFNGLQQTQILAFKLKIESPLTRLLRRLKIPN
                     F"
     gene            complement(499439..500899)
                     /locus_tag="ANA_C10474"
     CDS             complement(499439..500899)
                     /locus_tag="ANA_C10474"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93274.1"
                     /translation="MLINAQLLLQFQRCERRPFLDVHGDYLQREIPNELVLKVQQDKI
                     AHHQRIVKKLSYYEPDYLSRDWEAGAASTLELMQQGVSYIRRGVILTSYREKYTLLSR
                     PDLLVKQPGKSRFGNWNYVPVNIELGKRPKQEYQVVIAFHAQVLATVQDVILSKAGLI
                     LRDKDKTYVVDLDKWTPQMLNILEEYIQVIESVEAPEIFISRQKCSLCPWYNYCHAKA
                     RYQEHLSLLPGVTPIRYTQLQNLAITTLEALAQTHPSTLENLTGFDSNVAAKLVIQAQ
                     SVFTKQPLIIANSFSLEYLTFTAPIELYFDIEAQPDLNLNYLLGVLVVDRVANTEQFY
                     AFLAEQPEQEPLIWQQFLNLVNQYPQAPIYHFCAYEVDTVKRLGKLYRTPYAQIHPIL
                     NRFIDIYEQLIQSVALPIDSYALKTIARWLGFEWREQQANGAKCIYWYDKWLETGDRT
                     LLAIIQDYNEDDCRATRTVKDWLVSFFEAESGNITL"
     gene            501507..502583
                     /gene="acsF"
                     /locus_tag="ANA_C10475"
     CDS             501507..502583
                     /gene="acsF"
                     /locus_tag="ANA_C10475"
                     /EC_number="1.14.13.81"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium-protoporphyrin IX monomethyl ester
                     aerobic oxidative cyclase"
                     /protein_id="AFW93275.1"
                     /translation="MVESLRKPGFDEIRSGIKSPAKETLLTPRFYTTDFDEMARMDLS
                     VNEEELEAIIAEFRIDYNRHHFVRDAQFEKSWDSIDGETRKLFVEFLERSCTAEFSGF
                     LLYKELGRRLKDKSPLLAEGFNLMSRDEARHAGFLNKAMSDFNLSLDLGFLTKSRSYT
                     FFKPKFIFYATYLSEKIGYWRYITIYRHLEAHPEDQIYPIFNFFENWCQDENRHGDFF
                     DAVMRAQPQMLNDWRAKLWSRFFLLSVFATMYLNDIQRKDFYASLGLNAREYDIHVIK
                     KTNETAGRVFPVMLDVENPVFYERLDVCVQNNEKLAAISSSNTPKFLQFFQKLPIYLS
                     HGWQLLQLYLMKPIDAASAHGQAR"
     gene            502618..502821
                     /locus_tag="ANA_C10476"
     CDS             502618..502821
                     /locus_tag="ANA_C10476"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93276.1"
                     /translation="MDRTTFFVSILFRAKTLRSKDAKGRVLSLSKDLFVSLQQFNLSK
                     NKWQIRQGAKSLLAIGSLIADEY"
     gene            complement(502955..503533)
                     /locus_tag="ANA_C10477"
     CDS             complement(502955..503533)
                     /locus_tag="ANA_C10477"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93277.1"
                     /translation="MSLFDDLSRFLESRLEEFLRNNPHLELEALLEQLREQEEDTLKL
                     IAELQLQEKRSQDEILSTAQEIQKWHIRIQKAQAAGRQDLATPAQEREAALLREGNQM
                     WGQMQGLKERINQSQELLRKIQQRRQEVQTKAAEAQTARTKAQTQQRLKTETPGWNTA
                     ANSHSNFDDLENTFRNWETQDELEKLKRKMGK"
     gene            complement(503642..503857)
                     /locus_tag="ANA_C10478"
     CDS             complement(503642..503857)
                     /locus_tag="ANA_C10478"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93278.1"
                     /translation="MLVGAKHLEDKLSVIAKNSSPNASPVQLLVGAKHLEDKLSVIAK
                     NSSPNASPVQLLVGAKHLEEIIGHCQK"
     gene            complement(503866..504747)
                     /locus_tag="ANA_C10479"
     CDS             complement(503866..504747)
                     /locus_tag="ANA_C10479"
                     /EC_number="3.4.16.4"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine carboxypeptidase
                     domain-containing protein"
                     /protein_id="AFW93279.1"
                     /translation="MGYDEIEIFKISNIFMKPILQIAAFVTIIIFVSVTLVSVHKVFR
                     DQLIITPQIAKECLTNSSLPCDNSKSSINIPFIPDQKLDDQQRFLATIAQKIPTIPQD
                     DTFEYTLLRSYGTVFINQESGINLPQKVILDNESETKSFQKTMSIALVDGTQECYLQK
                     TAAAALNKAKSLENIPLKSGYAGDCLRNFATNLRFWNKYANSETLARVKAGKETKILG
                     LVAPPGTSQHLWGLAIDLQVSTSTQRQALNENGWFQTVVSDLPHWTYLSQSEDDLPKF
                     GLQQKTIQGIKYWVTPI"
     gene            504938..505771
                     /locus_tag="ANA_C10480"
     CDS             504938..505771
                     /locus_tag="ANA_C10480"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="AFW93280.1"
                     /translation="MKLKNSRIQTLIIYSILSAIAIVMLFPLLWLISTALKSPTENIW
                     QSPPQLLPSQPTLENFSKVWQFLPFATYLYNSILVSVLTVGLNLLFCSLAAYPLSRLS
                     FVGRNGIFIAIVSTIMIPFQIVMIPLYILTVQLGLRNSYLGIIFPSLASAFGIFLLRQ
                     ALIGVPKEIEEAARLDGSSELGLWWHIMLPAIRPALITLAIFVFIGAWSDFLWPLIVI
                     QDESLYTLPLGVAKLAGTFSLDWRLVAAGSVISITPVLLLFLFLQKYIVPTDTGSGVK
                     G"
     gene            505882..507219
                     /locus_tag="ANA_C10481"
     CDS             505882..507219
                     /locus_tag="ANA_C10481"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93281.1"
                     /translation="MTNSRLQLLVLSNGHGEDIIAVRIIQALQQLSSPPDIFALPIVG
                     EGRAYQQIDISMIGKVQTMPSGGFIYMDSRELMRDLRGGLVQLTLNQIQSIRSWVSSQ
                     TKLGNPKAILAVGDIVPLLFAAVSGANYAFVGTAKSEYYVRDEAGLLPRKSKSAWWEN
                     FSGSIYHPWERWLMSRGRCRAVFPRDALTTEILKKWRIPAVDVGNPMMDGLQKIFTAQ
                     QFYRPDAELEEVIRPLIVTLLPGSRAPEAYNNWEIIMIAVSALTASLRQPDSIFRAAG
                     TMIFLGAIAPGLDCSILSQTLHIQGWRRCDQSPLAISDPDSLTFNQKNAYFILTQQAY
                     NECLHLGDLAIAMAGTATEQFIGLGKPAIAISGHGPQYNPAFAEAQSRLLGISLTLVN
                     QPSQVLPAIQSLLKNPDLLHEIAENGLQRMGRAGAAQRIAECLQEKLNYQPRT"
     gene            complement(507196..507918)
                     /locus_tag="ANA_C10482"
     CDS             complement(507196..507918)
                     /locus_tag="ANA_C10482"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator protein"
                     /protein_id="AFW93282.1"
                     /translation="MSEISILLIEDHDLTRMGLKTELQSHSGFKVIGEAANATQGLKL
                     LETIKPNVAVIDIGLPDMSGIELTRKFRRYQTETGQFQTKILILTMNNTEDAVLAAFA
                     AGADSYYMKETSINKFTEAVEATFHGNSWIDPAIASVVLRKMRQGVPGDHQSLDKPKT
                     VKIEALEIEYEQVLETYPLTQRELEILELIVGGCSNGQIAEKLYITVGTVKTHVRNIL
                     NKLCADDRTQAAVRALRSGLVV"
     gene            509280..510587
                     /locus_tag="ANA_C10483"
     CDS             509280..510587
                     /locus_tag="ANA_C10483"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="AFW93283.1"
                     /translation="MEEPLKILVVENDQVDGLIVSLALTKTGIKMEIDEVKDGSQAFF
                     ALIHNHYDCIFLDYHLPNQDSLTLIHKLQSSGIKVPLVILIDSGDEKIAQEWIKLGAT
                     EYFIKSKLSPETIAQMLRSAIRIHHTEMQLNLANQQLKESREQLILQQKEFTAQQQHI
                     QEQNLNILEASSLKSLFLATISHELRTPMNAIIGFSQILLRPKFGELTNQQLVMVEKI
                     LNNGKELLIKINEILDFSQLESGKLALKPEILDLSAVVSNVVTEIRPLAEAKKLSLLV
                     KTDLKNTSVFNDAVRLRQILTNLLTNAVKFTESGNIWVEIRETPKNQVTITVKDTGIG
                     IAAQDFQNIFAAFHQIDQGISRKYSGTGLGLAIIDSLVGIMGGKICVESQLGVGSTFK
                     IELPRRINLAADLGNVVFSSHQHHFHSVYSPNKALMNYPHIRL"
     gene            510606..511463
                     /locus_tag="ANA_C10484"
     CDS             510606..511463
                     /locus_tag="ANA_C10484"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator protein"
                     /protein_id="AFW93284.1"
                     /translation="MSNLKKDRILSVDDVQDNLDVVRTLLESEGYHVDSATNGQAALD
                     KVAELPPDLIILDVMMPGIDGYEVTLRIRNNPEINYIPILLLTAYNESSVVKGLDVGA
                     DDFICKPFETEELLARVRSLLRLKHSIDEQRKMTLQREDFVSRLTHDLRTPLVAADRM
                     LNLFLQEVFGQIPSEMKQPIHVMIRSNQNLLEMVNTLLEVYRFEAGKKTLNFESCNLT
                     TIAAEVVSELTPLAQEKNLILKLDTHELSPTGNNGGIVNGDRLELRRVFNNLIGNAIK
                     FTDTGSIEI"
     gene            511469..512512
                     /locus_tag="ANA_C10485"
     CDS             511469..512512
                     /locus_tag="ANA_C10485"
                     /EC_number="3.6.3.21"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan/tyrosine permease"
                     /protein_id="AFW93285.1"
                     /translation="MRVEGISHIGLLAIIAKILGKPGARIAGIAYIFNHYALLVAYMT
                     EGGKILITTVDQVWELEHISPQWVGTVSFFLVFGSLMYWGKDRLVEKINGIFIIILLI
                     AFFGLLILGGMQFQNSQLLVQNWQSIGNAVAVIYVAMFFHSIVPLVVTQLEGDIPKIR
                     QSMIIGSVIPLFMFLAWNAVILGCMTPDILSHNLENEKVFDPLEILRTGQSGEWFAVL
                     LSIFSEFAIVTSFIGITYGLTDFFQDISIITKSEISRLPLYSLVLLPPLSLGTFNPTI
                     FFHALEYTGAFSASILGGIMPALMSWKQSQTPEFTNGNYQTLVPGGKITLILIMVGAL
                     FLICRQILVIYQF"
     gene            513193..513759
                     /locus_tag="ANA_C10486"
     CDS             513193..513759
                     /locus_tag="ANA_C10486"
                     /codon_start=1
                     /transl_table=11
                     /product="putative restriction endonuclease"
                     /protein_id="AFW93286.1"
                     /translation="MLQVKHQFQSFEEYLSYDDGTEKLYELFNGELIEMPPESGINVQ
                     IATFLLIQFVSLLGHKRVRGHGLELEVRGEPRNRYPDLTIIREEHIQQLANRNTIRLS
                     MLPPLLVVEVVSPGELQRDRDFIAKRLQYQDCGIPEYWIIDPQTQSILVLELINEIYH
                     EIGIFSGDDLVLSPQFNSLNLKVSQIFA"
     gene            514266..515486
                     /locus_tag="ANA_C10487"
     CDS             514266..515486
                     /locus_tag="ANA_C10487"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93287.1"
                     /translation="MEQQEKTLRASSDGIEKIKAAMKKEGYTQNSAKTPIYKVTKQEL
                     KRYIIEKIIITPNTTQLNNPNLTELSEKHLHIFSTHSDINKSSRDIVRIYIDQVSAPI
                     QLDKFLRDLEDKQVTAFQLTDANWRTFCTGKDARKSKQKGQEKLLPESVFNAFCKILG
                     LNPDEIAYKPDNTIELEDKLKLFNHERQINLLIEKVQDGKNTFLISNDCLYSRSWMLH
                     RLEKAIESCFLQTKTKINKYSIITLNSSSENIHTQLSTSITNFKSIFHKNDIYNKLKQ
                     QHIILVINIDHYCYDIENINKIYDFHQTMYQAKSPDNDGHLLMFLLATDKNLQNQLQN
                     QSYIHENIIELPNADYRPYHLINLLNMEELMANEIINKCQNNAQELLVELYKYLNIDR
                     NLTTLKIWSNYPWN"
     gene            515477..516448
                     /locus_tag="ANA_C10488"
     CDS             515477..516448
                     /locus_tag="ANA_C10488"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="AFW93288.1"
                     /translation="MELKYTGKIHPPSGGIWNEQVNRKLYPYYPDNGLKEAVKLAIQL
                     NRPLLLEGEPGCGKSELARAVFYEFSQREGENWHFRLWNIQSTSKAQDGFYTYDYIGR
                     LQAAQIAKLEKLKSTNPEDYLEYGPLGHAFLEHGKTDNVKSRNIVLIDEIDKADIDFP
                     NDLLLALEDQCFEIKDVRPRRWLTANKDAPPIIFITSNQEKELPNAFLRRCLYHYVEF
                     PKKDDLIEIINGRFSAPPETLINAAIGRFLALREDMNDNKEETDKKVSTSELIDWFQV
                     LNLHIRNEENEIDDKKLNDIIKELKNKKLPYNGTLLKNRQDKQEYGK"
     gene            516706..519393
                     /locus_tag="ANA_C10489"
     CDS             516706..519393
                     /locus_tag="ANA_C10489"
                     /codon_start=1
                     /transl_table=11
                     /product="von Willebrand factor A domain-containing
                     protein"
                     /protein_id="AFW93289.1"
                     /translation="MKNPLLLNLFLELRATGLPLTIDQYDLALMALSKSVDIVLNDNK
                     PAIKGVLQTVWVKSRKQQALFNQCWDEFNQKSIYKNARIESQSDASTLKRERQKPEIE
                     KIPQPALINDEPELPQPAAEIAQFNPDLPDDHGVGTSVKTKLKEVYYLPISRQELQRS
                     WQLLIQKSTGNIRQIDIPNTVIDITKHGFFTQAVFTYPKTKYREVVLLIDQGGSMTPF
                     HPFCRQLQQIYQTAKVYYFHNSPTDELYHDPQCWQGQSITSILSKFSPQHTLVIIISD
                     AGAARGRTVPDRWEETYDFITQLIPKTKKIAWLNPLPPSRWVDNTAEEIAKINPSVPM
                     FALETGEFQRMVKWLSSRNLTPHPPSLPEKEEEERGSSDDLWNYGFDAKGRIAVFEKL
                     LGNSHLKFASYAAFPLVLTPDLLYCLYRKFFYQTSNLLWYAVADLLLSDLCQQVDFEL
                     YEMEREVRNELLKRLPRRNRKQILKELSDFLIQYISRQVSNQNQNNDLNQVQQWAALS
                     YVEKGSQAAKELARKLQQAYLSNNKGELVRLSSVIETLAEPLKENYQPLLKIAQGYRA
                     VVRGDDKGVEASRKIFESETIEVEGVKLKRPEINFGKVRLQSFDFDVITVNRRGEETK
                     RETQQNYYFQESLPGNITLDMVAIPRGKFLMGSPEDEPGRYDDESPQHEVTVQPFFMG
                     KYPVTQAQWKAVATNCPQVNRELEPNPSKFKENKQENNLPVEQITWYDAVEFCKRLSQ
                     LTGRKYRLPSEAEWEYACRAGTTTPFHFGETITGKLANYSATTIYGEEPKGEYRERTT
                     PVGSFTANAFGLYDMHGNVWEWCDDHWHDDYDNAPTDGSAWIESNNVEEGAERLLRGG
                     SWYNYPSFCRSAYRYDYYPDSRNHYTVGFRLVVSGARTL"
     gene            complement(520235..520831)
                     /gene="coxC"
                     /locus_tag="ANA_C10490"
     CDS             complement(520235..520831)
                     /gene="coxC"
                     /locus_tag="ANA_C10490"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit III protein"
                     /protein_id="AFW93290.1"
                     /translation="MTAITPIEHHSDGHEEHPDLRVWGLITFLASESLMFGGFFATYL
                     FFKGTTAVWPPAGTEVELFIPAINTIILVSSSFVIHFGDMAIKRNSVGWMRFWYFITA
                     IMGAVFLAGQVYEYMNLGYGFTTNVFSNCFYLMTGFHGLHVFIGLLLILGVLWRSFRR
                     GHYSATKHTGIEMAEIYWHFVDIIWIILFTLVYLLNIL"
     gene            complement(521011..522684)
                     /gene="coxA"
                     /locus_tag="ANA_C10491"
     CDS             complement(521011..522684)
                     /gene="coxA"
                     /locus_tag="ANA_C10491"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit I protein"
                     /protein_id="AFW93291.1"
                     /translation="MTQVNFPVNPPPDASESTTRLITHSSHPPAWKVRDYFTFNTDHK
                     VIGIQYLVTAFAFYLIGGLMAIAIRAELATPDSDFLDPNLYNAFMTNHGTIMIFLWIV
                     PSAIGGFGNYLVPLMMGARDMAFPKLNAIAFWLNPPAGLLLLGSFIFGGSQSGWTAYP
                     PLSLVTANNAQTMWILAIVLVGTSSILGSLNFVITILMMKVPSMKWDQVPLFCWAILA
                     TSILALFSTPVLAAGLVLLLFDINFGTSFFKPDAGGNVVIYQHLFWFYSHPAVYLMIL
                     PIFGIMSEIIPTHARKPIFGYKAIAFSTVAICVVGLFVWVHHMFTSGTPGWMRMFFTI
                     STLIVAVPTGVKIFGWVATLWGGKIRFTSAMLFAIGLLSMFVMGGLSGVTMGTAPFDV
                     HVHDTYYVVGHFHYVLFGGSVFGIYAGIYHWFPKITGRMMNETWGRVHFVLTFIGTNL
                     TFLPMHKLGLQGMPRRVAMYDPQFTSLNQLCTIGAILLGISVIPFALNAIFSWKNGEL
                     AGDNPWESLTLEWTTSSPPIIENWEVLPVVTHGPYDYGHDKSSLTEPVS"
     gene            complement(522734..523669)
                     /gene="coxB"
                     /locus_tag="ANA_C10492"
     CDS             complement(522734..523669)
                     /gene="coxB"
                     /locus_tag="ANA_C10492"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit II protein"
                     /protein_id="AFW93292.1"
                     /translation="MQKVPVSLWTLLAGMIIAPISIWVGQNHHLLPEAASQQAPLVDG
                     FFNLMLTIAVALFLIVEGTILLFLVIYRRRKGDNSDGTPVEGNLSLEIFWTAIPTVIV
                     IVLGIYSVDIYNQMGGFGVGSHPHHESAGAMNVSQIANIGIGENPQTKNKPADLVVDV
                     KGIQFAWLFNYPVSGISAGELHVPVGADVQLNLSADDVIHSFWVPQFRLKQDAIPGVP
                     TQLRFTATKTGTYPVVCAELCGGYHGSMRTEVIVHEQQDFDAWMNENQIAENQDINHI
                     IAVNLENLSPSEFLDPYIQNLEVTPTNLQSLVMSH"
     gene            complement(524101..524394)
                     /gene="fdxB"
                     /locus_tag="ANA_C10493"
     CDS             complement(524101..524394)
                     /gene="fdxB"
                     /locus_tag="ANA_C10493"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="AFW93293.1"
                     /translation="MATLTGLTYGGNAWTPKFAQEIDKEKCIGCGRCMKICGHKVLAL
                     MALNEEGEFVVDEDEEEVERKVMVIANPENCIGCEACARICSKNCYSHDTLDK"
     gene            525216..526802
                     /gene="patB"
                     /locus_tag="ANA_C10494"
     CDS             525216..526802
                     /gene="patB"
                     /locus_tag="ANA_C10494"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin iron-sulfur binding
                     domain-containing protein"
                     /protein_id="AFW93294.1"
                     /translation="MPHIIPNNSCVGCDNCRPLCPTGAIKIEDDEYWVDPALCNNCEG
                     YYLQPQCVIACPTNAPIPTHAKKGRCKVEPRDATSPDLFSNGKNNPFASAIVIWEACN
                     LLAQRTSLQWEKNEEGNLHYSRSVNQGRGTISFQIQDLFPANNRADNLQAIDYLDIRA
                     ACIHLIFAAQITALDQPWEEEFTIDERQIEQYLGLEKRKDLSKSTKLGLIKNIVYQTC
                     SLMVSIDWPQQGRVPSFSIKDSYLWNLTDTQHHFQEDDQGCKYLVGLTFTVKAGIWTQ
                     HFFNRQGCKERTTFYQYGSLPKTLLTTVMSLWQQHEGAVRLMLWLLFKTKMGREQRIT
                     IPTLLRVAYGEEKVTQASRHREERKRLLKAYENDLEVLNHYGVKPLFDPVTYPPEIQP
                     LWAKLVDIPEDPEEALEFWINDGSGENRLTDSGPRGKWNLLLNARILSFELPPDWENR
                     SESDKKQRRTTKPKSNHQQTGNLLGEQVTEGRKKMNLSQRELAKLMEKSQSWIRDVEK
                     GRLKAKLDDQMLLRQLLDIS"
     gene            527117..527845
                     /locus_tag="ANA_C10495"
     CDS             527117..527845
                     /locus_tag="ANA_C10495"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93295.1"
                     /translation="MNVSNIIFRKSFLTLPSLAALVILGSGLSVNAQTVEPETIILPT
                     HQTSIFTVATEEIASGTITPIPGTVETSSVMLNSGSTEASEKTQPSNRIAQSPIGIGR
                     ATRGGSSYIGVGLNVGASGGFSDLSDGNFTVISKIGVTKTLSVRPSVILGSNTTFLVP
                     ITYDLSFKSPDPFTEALPIAPYLGLGAVIKTGDKSETALLVTGGIDVPLNSRLTATAA
                     VNAGFFSKTDVGVLLGVGYNFRGF"
     gene            528291..529400
                     /gene="proB"
                     /locus_tag="ANA_C10496"
     CDS             528291..529400
                     /gene="proB"
                     /locus_tag="ANA_C10496"
                     /EC_number="2.7.2.11"
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyl kinase"
                     /protein_id="AFW93296.1"
                     /translation="MTKTIVVKIGTSSLTQPETGQLALSSIATLAETLCDLRRQGHRV
                     ILVSSGAVGVGCARLGLTERPKTIALKQAVAAVGQGRLMRIYDDLFSILQQPIAQVLL
                     TRADLVQRSRYLNANNTFQELLALGVIPIVNENDTVAVEELKFGDNDTLSALVASLVE
                     ADWLFLLTDVDRLYSADPRSVPDAKPISLVSSMQELTDLQIQTGGQGSQWGTGGMMTK
                     ISAARIAIAAGIRTVITQGQFPRNIEKIIQGELIGTHFAPQPEPTSARKRWIAYGLIP
                     GGKLHLDAGAIAAVVKAGKSLLAAGIRAVEGEFDNQEAVQLCDSNGQEIARGLVNYNS
                     EELQKICGRQSREIPAILGYEKADTVIHRDNLVLI"
     gene            529443..530690
                     /locus_tag="ANA_C10497"
     CDS             529443..530690
                     /locus_tag="ANA_C10497"
                     /codon_start=1
                     /transl_table=11
                     /product="cell cycle protein"
                     /protein_id="AFW93297.1"
                     /translation="MTNYQLPITNYQLPITNYQIVNLLRLIPIFDNSVSTWGLEARLL
                     RWLTLTWMFIGLIILFSASYPVADERQGDGLYYFKRQILWAIASLIIFNIIVNLPLRK
                     ILGVSHWFLIFFLMLIFLTLVPGLGKKAFDAARWISVGPIPIQPSELIKPFLVLQSAT
                     LFGKWEKLRWGIRLSWLGVFGLVLLGILAQPNLSTTALCGMTIWFIALAAGIPYKYLG
                     GTAFGGVMLAIISISIKEYQRKRIMSFMNPWADATGDGYQLVQSLLAVGSGQTSGVGF
                     GLSQQKLFYLPIQDTDFIFAIFSEEFGFIGGILLLLMLAIFATLGLIIALKSKNLTSQ
                     LVAIGVVVVMVGQSLLHIGVTTGALPTTGLPLPMFSYGGNSMVASLISSALLIRVARE
                     SSEADVVPLRKTLSENQTRRRFF"
     gene            531039..532055
                     /locus_tag="ANA_C10498"
     CDS             531039..532055
                     /locus_tag="ANA_C10498"
                     /EC_number="3.6.3.25"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transport system permease protein 1"
                     /protein_id="AFW93298.1"
                     /translation="MGIVVENVSKQFGSFQAVEQVNLEIQSGSLVALLGPSGSGKSTL
                     LRLISGLETPDTGKIFLTGKDATDQSVQERNIGFVFQHYALFKHLTVRKNIAFGLEIR
                     KAPKKKIQGKVEQLLELVQLSGLGDRYPSQLSGGQRQRVALARALAVEPNVLLLDEPF
                     GALDAKVRKDLRAWLRRLHDEVHVTTVFVTHDQEEAMEVSDEIVVMNKGKVEQVGTPA
                     QIYDHPASAFVMSFIGPVNVLPSSAKIFQSSGFESAHPETFLRPQDIIIENVANGTTV
                     PAIVSRIIHLGWEIQVELTLDDGQAMTAHLTRERFDELKLEPQEKVYVKPKDAKSFPL
                     YYSI"
     gene            complement(532134..533129)
                     /gene="por"
                     /locus_tag="ANA_C10499"
     CDS             complement(532134..533129)
                     /gene="por"
                     /locus_tag="ANA_C10499"
                     /EC_number="1.3.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="light-dependent protochlorophyllide
                     oxidoreductase"
                     /protein_id="AFW93299.1"
                     /translation="MEQNRKSTAIITGASSGVGLQAAKALVDKGNWHVIMACRDLIKA
                     EKAAQSVGMPANSYTLMQIDLGSLESVRQFVNNFRATGKTVEALVCNAAIYMPLIKEP
                     LFSPEGFELTVTTNHLGHFLMCNLMLADLQKSPAADKRLVILGTVTHNPDELGGKIPP
                     RPDLGNFEGFAAGFQNPITMIDGKQFEPVKAYKDSKVCNVLTMRELHNRFHESTGITF
                     SSLYPGCVATTALFRNHYPLFQKIFPLFQRYITGGFVTEELSGERVAMVVADPEYKQS
                     GIYWSWGNRQKKDRASFGQKVSPQARDEEKGKRMWDLSYQLVGLGKASEKSKSLI"
     gene            complement(533341..534345)
                     /locus_tag="ANA_C10500"
     CDS             complement(533341..534345)
                     /locus_tag="ANA_C10500"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93300.1"
                     /translation="MTRFIHDQFAKQYLTELLTPYGQVETSKDITAEVRQIDVLFIPS
                     PQPTQSLERLGLLGRMATKYAIFEPFRNAVSKSEIRSCMGKLFDIHADLERQSNRNNT
                     RINEAELPRLWIFTPTASIELLASFNGTTDEENWGKGIYFFGEGFKTIIIAIHQLPIT
                     PETLFLRVLGKGKVQRQAVEELETLANDSPFLADIIQLVHNLIAVLSARQRQEQDIDK
                     DDQELIMKLSEIYQQQLEELKKQGRQEGRQEGRQEGRQEGLQEGIHVGLQEGRQEGLQ
                     AGVERERRAMIESILQVRFGQIDSQLQRIINPLIAMSREEFTPLLLQLSREELLAKFA
                     "
     gene            complement(534455..535915)
                     /gene="gatA"
                     /locus_tag="ANA_C10501"
     CDS             complement(534455..535915)
                     /gene="gatA"
                     /locus_tag="ANA_C10501"
                     /EC_number="6.3.5.7"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit A
                     protein"
                     /protein_id="AFW93301.1"
                     /translation="MASIRELHEQIISKERSAVEITQEALNRIQELEPKLHSFLTVTT
                     EQALKQAQAVDAKVAAGEEIGILAGIPIGIKDNLCTKGIVTTCASRILENFIPPYEST
                     VTQKLADAGGVMVGKTNLDEFAMGSSTENSAYQVTANPWDLSRVPGGSSGGSAAAVAA
                     DECVVSLGSDTGGSIRQPASFCGVVGMKPTYGLVSRYGLVAYASSLDQIGPFGRSVED
                     AAILLSAIAGYDPQDSTSLKVAIPNYAASLKPDLKVRKKLRIGVITETFGEGLDPEVE
                     AAVTKAIEQLQELGAEIHPISCPSFRYGLPTYYIIAPSEASANLARYDGVKYGLRSPD
                     ADNLLSMYTKTRSQGFGAEVKRRIMIGTYALSAGYYDAYYLKAQKVRTLIKQDFEKAF
                     KTVDVLISPTAPTTAFRAGEKTTDPLSMYLNDLMTIPANLAGLPGISLPCGFDSKGLP
                     IGLQIVGKVLGEEQLFQVAYAYEQSTNWHLQKPKMA"
     gene            536103..536540
                     /gene="xisH"
                     /locus_tag="ANA_C10502"
     CDS             536103..536540
                     /gene="xisH"
                     /locus_tag="ANA_C10502"
                     /codon_start=1
                     /transl_table=11
                     /product="XisH protein"
                     /protein_id="AFW93302.1"
                     /translation="MGKANFNMPAKDIYHNAVKNALIQEGWIITNDPLHLKWGQKDMY
                     VYLGAKQLLAAEQGTRKIAVEIKSFVSPSEMADLKDAIGGFVLYRAVMNRLEPDRILY
                     LGVRDTVFTDLFEEPIGKLLRESENLNLLVFNSDTERITQWIP"
     gene            536528..536863
                     /gene="xisI"
                     /locus_tag="ANA_C10503"
     CDS             536528..536863
                     /gene="xisI"
                     /locus_tag="ANA_C10503"
                     /codon_start=1
                     /transl_table=11
                     /product="XisI protein"
                     /protein_id="AFW93303.1"
                     /translation="MDTLDNYRRVIKEVLIPYTQIPYSYGVIECKTVFDDENDSYLLI
                     TLGWHDHKRIHGCLVHLDIIDGKIWVQRDDTEDGVTYELEAAGIPKDKIVLGFHPQNV
                     RQHTGYAVR"
     gene            536918..537121
                     /locus_tag="ANA_C10504"
     CDS             536918..537121
                     /locus_tag="ANA_C10504"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93304.1"
                     /translation="MRFDDNMNPPPWTKNLFTEADAISLLNGKKVTAMRFIKLKEKIK
                     TTFELGNQIASALSMSISTSGEG"
     gene            537243..537488
                     /locus_tag="ANA_C10505"
     CDS             537243..537488
                     /locus_tag="ANA_C10505"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93305.1"
                     /translation="MFYKIPLLLTPQPEGGFTVTSPLLPELITEGDSMDEVLANVRDA
                     FEAVLETYQDLGKELPLNLQSVDQNSPALIETIISIR"
     gene            537485..537697
                     /locus_tag="ANA_C10506"
     CDS             537485..537697
                     /locus_tag="ANA_C10506"
                     /codon_start=1
                     /transl_table=11
                     /product="YcfA family protein"
                     /protein_id="AFW93306.1"
                     /translation="MNYREVAKKLSKLGCEEIPRRGGGSHRKWFNAITQKATVIPDWS
                     GRDLKLGTLRAAIKQLGIEWADFEEV"
     gene            537728..537892
                     /locus_tag="ANA_C10507"
     CDS             537728..537892
                     /locus_tag="ANA_C10507"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93307.1"
                     /translation="MNDKLQTEKDKLQTSTNIVINQETEKEEVLCPHCLRTATNGIKC
                     KGICVADNDY"
     gene            537928..539289
                     /gene="dnaE"
                     /locus_tag="ANA_C10508"
     CDS             537928..539289
                     /gene="dnaE"
                     /locus_tag="ANA_C10508"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit alpha"
                     /protein_id="AFW93308.1"
                     /translation="MVKIVSRTYVGQANVYDIGVESDHNFVIKNGFIASNCFNKSHST
                     AYAYVTYQTSYLKANYPLEYMAALLTANSGDTDKVRKYLDNCSNMGIVIDAPDVNRSG
                     LDFTPAGEKILFGFSAVRNVGQNAIASILEAREESGELVPFKSLADFCDRVDLRAMNR
                     RTLESLINCGAFDKIQANRNQLIHDLELVYEWAQSRARDKASGQGNIFDLLGGGFAGN
                     NNQPQKNAYESAPKAPPVNDLPPQEKLRMEKELLGFYLSDHPLKSIRQSSSVLAPINL
                     AQLGEQKDDAILCAVVMLNNVKKVVTKKGDSMAILQVEDLSGSSEAVVFPKTYERISS
                     VLEVDARLIIWGKIDRRDDQVQFILEDAETVETVKMILVELSPKQAGTIEEQHRLNTI
                     LKSQAGDKDKSRIPVIGIVQAGSHREIVRFGRQFWVQDSGTAVQALQNGKFRADIKQL
                     TSG"
     gene            complement(539739..541334)
                     /locus_tag="ANA_C10509"
     CDS             complement(539739..541334)
                     /locus_tag="ANA_C10509"
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family protein"
                     /protein_id="AFW93309.1"
                     /translation="MTQINGNYTNGNGNGKGNGNGRASHRDAQVLTSPKPTPKQPKPD
                     FNFDNFEQSVVLRQSPIWSRTIMITLMGLACFGIIWACLAKIEQVVPATGQLKPEGTV
                     KDVQAPVNGVVKSLYVKDGQQVKTGDLLLTFDSIATLAELNSLNKIRVALIQENNIYR
                     RLMGASTGIDAEIAFLRSKLPGESAFLLKSRASLVAENELLRSQLRNLPGAAGTGIDE
                     QQLLAVAKTELASRSKAAELEVEKTRKQLSQTEFKLQDTKNGLAIQSQILVSLKTLAE
                     EGGISKLQYLNQQQQVQTLKAEISQLQEEEKRLKFDIDKGKEQSTNTVASSDKTILEK
                     IGSNKQRIAEIDSQFMKIILDNEQRLADVNSKISQTQLNVKYQELRAPVGGVVFDLQA
                     KNPGFVANSTQKLLQIVPKDSLIAEVFITNKDIGFVRKGMNVDVRIDSFPFSEFGDIK
                     GKVIDIGSDALPPDQNHQFYRFPAKIKLDKQQLSLTNQERKISLQSGMSITANIKVRE
                     ERTVMSLFTEMFTKQIESLNEVR"
     gene            complement(541475..544468)
                     /locus_tag="ANA_C10510"
     CDS             complement(541475..544468)
                     /locus_tag="ANA_C10510"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="C39 peptidase domain-containing ABC transporter"
                     /protein_id="AFW93310.1"
                     /translation="MTYIQSNFEEFIASIEGFDQLSKEEINNLLSSQILQPLRYRVGQ
                     KIIGKEQLPERIAILHQGNVRLLGYNPQNQLPITLKLLQPGATIGEISWLRELPCETA
                     IASTEVICLTWKAADYLQFINRNPAFAKARQNQSHLIEIFDILSSQVAQKALVNHNLK
                     NITQQAQLEAKIHYLSPGKTALRELDSDRIWFVSGRSSLPNFPPGSRLETDVIEVKGN
                     ILVRLLGINPQDLSLLDGISIESETLETISDSRVDSEIPYAQEPEFVPPTTSNQPLKN
                     QNYPFFRGQGELDSSLACFQMLSKHLEMPFRKEVVRRILTDQIKRQGSISFQVCAYLS
                     ELIGLKSQLVDVPAVSINRIPTPALIRYRDSFAVLYAVDGKTVVLGLPSQGIINCQIS
                     QLVEELETDDANLQPQVRVLLLSATKETPKERFGLSWFVPYLSRYRRVLIEVFIASFF
                     VQLAALANPLVIQLIIDKVIVQNSISTLNILGVLLLAVGVFEAVLTTLRTYLFVDTTN
                     RIDMSLGSQIIDHLLRLPLRYFDKRPVGELSTRINELENIRQFLTGTALTVVLDALFS
                     VVYIVVMLFYSWQLTLVGLGTIPLFVVVTLIAAPTVSRQLRTKAERNAETQSYLVEVM
                     SGIQTVKAQNIELRSRFSWQKKYAKFVAAGFKTVITSTLANSTSQFLSKLSSLLVLWV
                     GAYLVLKGELTLGELIAFRIISSYVTTPILRLAQIWQNFQETGLSLERLSDIVDTPQE
                     GEIDKNNIPLPAVTGAVKFENVSFRFAASGPLQLSNVSVEFAAGEFVGIVGQSGSGKS
                     TMMKLLLRLYDAESGRILVDGYDIAKVELYSLRRQIGVVPQDTLLFDGTVKENIALTN
                     PDATDEEIIEAAQIAVAHEFIMTLPNGYNTRVGERGSALSGGQRQRIAIARSVLQRPK
                     ILVLDEATSALDYPTEKQIGLNLARAFKGNTVFFITHRLNTVSNADTIVVMDNSRVIE
                     QGSHQELMAAKGHYFYLYQQQEVNL"
     gene            complement(544525..545256)
                     /locus_tag="ANA_C10511"
     CDS             complement(544525..545256)
                     /locus_tag="ANA_C10511"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /transl_table=11
                     /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="AFW93311.1"
                     /translation="MTTNLITSNMNQVLQLGDRIFQPTEVLSLLSEYQLLPLLMKEIF
                     IDQAIAEIVCTPEEEQLACEQLAQQYQGLEPQSESFQKLKIMAVRQLKLEKFKEETWG
                     GDLNSYFFQRKSQLDRVIYSLITTSEIGIAQEIYFRIQEGEQSFAQLAREYAQGPESQ
                     TDGLVGPIDLQSLHPTLVNILAKSQPQQLSPPTQINNVIVIIRLEKILPAQLDRSTRQ
                     RLLNERFNQWLQTQMTEQKFQIQTV"
     gene            complement(545896..546663)
                     /locus_tag="ANA_C10512"
     CDS             complement(545896..546663)
                     /locus_tag="ANA_C10512"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93312.1"
                     /translation="MSLQSLRFLLLSSLGCSVFFGNTVAFAQVVVPTVPSGSSTTVPS
                     GSSTTIPTSTTVDSSKRFSCQYKNGQPTVMYQPQSQPGQYFAWAAPQTLGGNWDAQRR
                     CETIASRLELYRPDGLQELQIAVENNENIICVTTESQPNCRIVLTVPRGKDPYTIRNS
                     VFQNLTTADSGQQTNAVNTYTNRNRGNGDSLYSLGQTLLGGKNQVSSAKQGINLKPYL
                     DPKDGGTGGKLRNGVEIRRNTNTTRQAPSRLNPSKFR"
     gene            547410..548225
                     /locus_tag="ANA_C10513"
     CDS             547410..548225
                     /locus_tag="ANA_C10513"
                     /EC_number="6.3.5.9"
                     /EC_number="6.3.5.10"
                     /codon_start=1
                     /transl_table=11
                     /product="CobB/CobQ glutamine amidotransferase
                     domain-containing protein"
                     /protein_id="AFW93313.1"
                     /translation="MSSAPMEIIIGWLYPKLMSTYGDRGNVITIQRRAQWRGYNVIVL
                     PLDQDSTAEDIKSVDVIVGGGAQDRQQEIVMRDLQGAKAEAMRDKIEHGTPGVFTCGS
                     PQLLGNYYEPAFGQRIEGLGILDLVSIHPGENTKRCIGNLVIEVTASRLAQEIEAMTG
                     TKPYLVGFENHGGRTTLGQVEALGRVVYGLGNNGEDGTEGAFYQNAIATYSHGPLLPK
                     NPFVADWLIQTALRLKYQQEIKLSPLDDTLAIQGREAMFKRLKVNSPSVAGVS"
     gene            548389..548952
                     /locus_tag="ANA_C10514"
     CDS             548389..548952
                     /locus_tag="ANA_C10514"
                     /codon_start=1
                     /transl_table=11
                     /product="GAF domain-containing protein"
                     /protein_id="AFW93314.1"
                     /translation="MQLPFDSAQGKPSFPEFENRSSYHPNQGLRKLLNRLVIKMQRDE
                     LIRQTTNHLRESLQANRVVLYYFYEQWQGQVTFESLSADEYSILGFTGPSDCFNHEYA
                     ALYLEGRVRAIADIELEAIQDCHRDFLRSMQVRANLVVPILIPRGLWGLLVAHHCQSS
                     RDWTLTDIELMQTAARTLATDSNILKS"
     gene            complement(548980..551166)
                     /gene="topA"
                     /locus_tag="ANA_C10515"
     CDS             complement(548980..551166)
                     /gene="topA"
                     /locus_tag="ANA_C10515"
                     /EC_number="5.99.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase I"
                     /protein_id="AFW93315.1"
                     /translation="MPKRLLVVESPGKVKKLSQILGADWIVRASCGHIRELSNEGDDS
                     LGFTMDGNTVRCNYIPRDQRAKETIQQLKAAVRQVDEVVLATDPDREGETIAWHLKET
                     LGLKDPKRVVYTEITPSAVRNAIAHPRKLDTNLIGAGLCRDCLDKLVGYKGSPLVWAL
                     NNGAKSVGRVQSATLHLICQREREILAFVPQDYWSVWVDYQEGFRAFYKGTDNTEKET
                     SEPETETHDDAASNNPEKPESQRVLSEAEANRLVEEAKRHLHQIIHLEGKLVYRQPPP
                     PFTTSTLQQAAGSKLKFSPDKTMQVAQKLYEAGLITYMRTDSVMLSPEFCASARQWLE
                     QNDPENVPQQVAKQRSSKTAQEAHEAIRPTDVFRPSVQLRAELPEDEFNLYVMIWKRA
                     IASQCRPAQLRKTLVITKSGNILWQARGQVIEFYGYAKYWLNLSKDAVLPLLQQGQIL
                     TLAKAGHDQKQTQPPPRYSEPKLVQLMERKGIGRPSTYAPTIATLKKRNYVELKKDNL
                     QPTALGLEVDEFLQKALPDLLEAEFTAKMEDALDAISEGKNSWQHYLTTWNQSYFIPA
                     LSKAKTVVVNSSTTAKSNNFLERKYETSKTRCPDCKNCLAKIPSSKVKKKYFLKCVSG
                     CENIVLFWSDFHKKWEAPKTKTSADENAPKPSAKITAYPCPVCKKPLEEYSYLKDGQN
                     KTMLRCSGQDSWKDTKHKDVAYFHTAKGWWSPKFGNLNDLNADERR"
     gene            complement(551254..551751)
                     /locus_tag="ANA_C10516"
     CDS             complement(551254..551751)
                     /locus_tag="ANA_C10516"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93316.1"
                     /translation="MKMTQELIDLRNSILQGNYTDALAIVDELEGMSKQAILRNIESY
                     LKILLIHLIKNKIEQRLTNSWMASIRNSIREIQKINLKENKRSYYVNEDEWENLIEEE
                     VIEDAIADASLETMNGKYTRSQLSEILDRKEIITKAITFLSLTYTCSAKELPAIMDDY
                     LNDCK"
     gene            complement(551927..555223)
                     /locus_tag="ANA_C10517"
     CDS             complement(551927..555223)
                     /locus_tag="ANA_C10517"
                     /EC_number="2.1.1.72"
                     /codon_start=1
                     /transl_table=11
                     /product="type II restriction enzyme and modification
                     methylase"
                     /protein_id="AFW93317.1"
                     /translation="MNQQFSKTLFQKKTLKNALVNFKFPSDLEERHKIIKKWIEALNS
                     GTLNQVKEVSLHGDFLKDIFQDVLGYSSIIAGGGKLWEIHAEQTIADGGGSADAAVGF
                     FTATENNKGKVKLQGKVVAPIELKGTKDDLDRPAPGRKESAVDQGWRYANYTPDCHWI
                     IISNYRELRLYHTNKTPAYYEKFLLVDLANLEEFKRFYFLLCRENFLPIKDVSKIDTL
                     LVTSEEAQEDITKKLYEEYKQVRLNIVKDFRFRFGSKLNIPNRDQVLIEKAQKTLDRI
                     LFIAFCEDRGLLPEKTIAKAHDSKDAYNPRRIWENYKAVFRWVDQGNEDPPIPGYNGG
                     LFQYDPILDAQLDIPDPLCTKLKKLTRFDFDSEVSVDILGRIFEQSITDLEELKADVA
                     KQEFDRKQGKRKKLGVFYTPAYITQYIVEVAIGGYLQNREDELREKFKLGEFTDTAEN
                     QKREIEFWQSYRDEVLVKTRVIDPACGSGAFLIAAFDYFASQYQRVNDNLQFLKHQTT
                     ENMELDKTILSNNLFGVDLSPESVEITKLSLWLKTATQGKTLTYLDDNIKIGNSIIND
                     AKITDLPFIWESEFPQIFAEGGFDVVIGNPPYIRQELLSPFKPYLQENYQTYDGVADI
                     YIYFYEKGLNLLKPAGIISYIVTNKWLRSGYGEPLRRFFSQESVFEQIIDFGHAPIFE
                     DADTFPCIIAARKSEVSNTENEEKSVLICAVPRGELKNINLIQYVQNPENSFTIPWSR
                     FTANAWSLEPPAVDDLMRKIQRVGVPLKEFAGVKPICGIKTGFNEAFFIDDATKNKLV
                     QADPKCAEIIKPLLRGQDIKRWIPEWDKVWIIFAHKDIDIEQYPVIKEHLEIYRNKLE
                     ARAGKQLWWQLQASPSSYHLFEEPKIIWQDLAFHSRFCLDKQNVFIDMTCFALPCSDL
                     WLLAVLNSPLMWSWLWRNTIHGKDEVLRLKNIYTENIPIAQPTEKIRAEVEAIVTRLI
                     EITKLNGQVYKDVLDWLQIEYKIEKLGNKLEDFATLEFPDFVEEVRKRMVRKTTAKKI
                     IPPLDISAFTALRKAHNDYVPEINSRKNEALKLEQRLSDLINQAYQLTPEEIDLMWKT
                     APPRMPQLLE"
     gene            555495..556064
                     /locus_tag="ANA_C10518"
     CDS             555495..556064
                     /locus_tag="ANA_C10518"
                     /codon_start=1
                     /transl_table=11
                     /product="putative restriction endonuclease"
                     /protein_id="AFW93318.1"
                     /translation="MVMLQTPIKTLTLDEFLKLPETKPAREFINGEIIQKHKPQGKHS
                     TVQSDFVSAANTVLKPQRIARAYSELRCTFGGRSIVPDIAVFTWKRIPRDENGEVANT
                     FAIPPDWTIEILSPEQSQTKVVRNILHCLSHGTQMGWLIDPAEKLVFVYFNDQRILLF
                     ELETDSLPVPSFAESFNLTVGQLFGWLNE"
     gene            556126..557361
                     /locus_tag="ANA_C10519"
     CDS             556126..557361
                     /locus_tag="ANA_C10519"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93319.1"
                     /translation="MDSHSPLCQIIAHRIITSPQKRITFAEYMDMVLYHPEYGYYSSD
                     AIKIGFRGSDFFTSASLGADFGELLAKQFYQMWEILDQPIHFDLVEMGAGQGILASHI
                     LNYIQQQYPDFLAAVKYIIVEKSQSLKQEQQQRLQDFSVDWCNLEEIPSKSINGCFFS
                     NELVDAFPVHQFTLAAGELREIYVTIGQQSEEENSALPFDSAQGKPLFMEIIGEPSTP
                     QLGEYFKLVEIDLSQNTYENGYRSEINLAALNWLGIVADCLERGYVLTIDYGYPAHRY
                     YNPRRSQGTLQCYYQHRHHDNPYINIGQQDITAHVDFTALSSWGERCGLKNMGWTQQG
                     LFLMALGIGERFSLSEVERLAALSSQQQPISQLLQHREGLHQLINPGGLGNFGVLVQS
                     QGLTEQEASQPLQGLVVPE"
     gene            557761..558639
                     /locus_tag="ANA_C10520"
     CDS             557761..558639
                     /locus_tag="ANA_C10520"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="AFW93320.1"
                     /translation="MKVAFLGTGLMGLPMAQRLLATDIELIAYNRTPEKLEPLRKAGA
                     QIVTKPREAIRAADCIVLMLSNAAAIYHVLLTDTSWHTLSGRSIIQMGTINPLESQEI
                     RDTVVAAGGEYIEAPVLGSIPEAQTGKLIVMVGGEEEQYQRHLKLLQHFGENPVYIGA
                     VGSASNLTLALNQLIASLTTSFALSLAYIQLQGIDVDLFMQVLRESKLYAPTFDQNLR
                     RMLDGNYNNANLPTKQLIKEIDLFISEAKSLGLNLNSIEGVRQILHATMKMSYPEDDY
                     SSVFPAIREWGEVSGG"
     gene            complement(558687..559214)
                     /locus_tag="ANA_C10521"
     CDS             complement(558687..559214)
                     /locus_tag="ANA_C10521"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93321.1"
                     /translation="MNSCILMAEIYDNPQLRHTPDGLEVTEMIVHVAGAKPEDPTHPL
                     KVVGWGNLAKEIHQSYHQGDRVIIEGRLGMNTIDRPEGFKEKRAELTVQRIHAIGQGT
                     YTNSPPAATRTTPVNETPVAPPTYSQTNYESNYPTSAPMPQVAPSQPTYQPAPVQSPS
                     PVGVTPEPDPDDIPF"
     gene            559938..560369
                     /locus_tag="ANA_C10522"
     CDS             559938..560369
                     /locus_tag="ANA_C10522"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93322.1"
                     /translation="MSLIFDQNGNLLPGIHLATWNEIEEHLAHNTRRRNLLSGLKQGC
                     EILKQCGCQRIYIGGSFVTTKRLPNDFDVCWEDDQVDFKLLQKLDSVLHPSSRRSAQK
                     NKYGGEFLIANINIEDPFTTCLEFFQQDRNGNIKGIVAVDL"
     gene            560518..560955
                     /locus_tag="ANA_C10523"
     CDS             560518..560955
                     /locus_tag="ANA_C10523"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93323.1"
                     /translation="MIFNEWQYSITKAQMKKFELAMTQYASKPVPEDENQKLRHEARI
                     DSLQSQIEEFTEEIEEYENLKNNQGKIERLQYDSLEKLPEALIKARIIRGHTQESFAK
                     LLGVKPQQVQRDEANGYASASLTKLLKIQHTLNLEIREEIIFK"
     gene            complement(560963..561712)
                     /gene="devA"
                     /locus_tag="ANA_C10524"
     CDS             complement(560963..561712)
                     /gene="devA"
                     /locus_tag="ANA_C10524"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein DevA"
                     /protein_id="AFW93324.1"
                     /translation="MSLEVTTIPSEVISTSETVISVGNLNHYFGKGALQKQVLFDINL
                     EINAGEIVIMTGPSGSGKTTLLSLMGGLRSSQNGSLQILGQEIFGAKKGQLTKLRRQI
                     GYIFQAHNLMSFLTAKENVRMSLELHENHLNGDINATATAMLEHVGLGEHINSYPENL
                     SGGQKQRVAIARALVSHPKIVLADEPTASLDKQSGRDVVELMQVLAKEQNCTILLVTH
                     DNRILDIADRIIYMEDGQLKSDGVDMGVKLN"
     gene            complement(561751..562932)
                     /gene="devC"
                     /locus_tag="ANA_C10525"
     CDS             complement(561751..562932)
                     /gene="devC"
                     /locus_tag="ANA_C10525"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease protein DevC"
                     /protein_id="AFW93325.1"
                     /translation="MINKIFRKTPLAWRQLMKEKTRLVVAVAGITFADMLIFIQMGFE
                     SALFDAAIQPHRNLQADLVLINPQFQTLLSVKSFSRERLYQTLSYNGVKSVSSIYIST
                     GQWRNPETKMNRSILVWGVDPATPGLKFPELQAKKDNLKQLNQVLFDEASRPEYGEIG
                     KIFRETGKFNAELSGKNVSVKGLFQNGASFAADGNVVTSDSTFLQLFPTRKADQIEVG
                     LITLQPGADIEKVRKQLQIGLNPDPQKPFVEVGTPETFAQKEKTYWAEGTGIGFIFSL
                     GVIVGFIVGIVIVYQVLYSDVSDHLPEYATLKAMGYTDNYLLRVLLQEALFLAALGYL
                     PAFFLSFGLYQVTFAATLLPIYMKVDRAINVFFLTVIMCTVSGAIAMRKLRSADPADI
                     F"
     gene            complement(562965..564254)
                     /locus_tag="ANA_C10526"
     CDS             complement(562965..564254)
                     /locus_tag="ANA_C10526"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter membrane fusion protein DevB"
                     /protein_id="AFW93326.1"
                     /translation="MSYKLSFKSPSPGLIGLMVAATTIPVGIIIYGVSNFGQMGKTSV
                     TESKPIVPIAEIVTALGRLEPETEIIKLSAPLALDGDRISQLLVKEGDNVKVGQVIAI
                     LQSRDLLKNAVIQSMKQVEVAKAKLAQIKAGAKSGEIQEQSAIVERIKAQYAGDKQSQ
                     QENIARISAQWEGDRIAQTATINKLTAELKNAESEYQRYQQLFSEGAISNSVIDSKRL
                     NVETAKQTLSESQAILNRINTTANKQLAEAKVALNRINNTSNQQISETQGKLNSIAEI
                     RPVDVQLARTEVESAIANLQRAKTELEAAYIRAPMTGQIIKIHARVGEKIDNPGVADF
                     AQTNTMMAVAEVYQTDISKIKLGQKAIITSQGFTGELKGVVQQIGLQVKRQNVFSDQP
                     GENLDSRIIEVKIRLNPEDSKKVSGLTNLQVQTAIKL"
     gene            complement(564301..564894)
                     /locus_tag="ANA_C10527"
     CDS             complement(564301..564894)
                     /locus_tag="ANA_C10527"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR-like transcriptional regulator"
                     /protein_id="AFW93327.1"
                     /translation="MPKIVNHEQYRKELLGKCFDLFATKGYSAITMRQISASLKVSTG
                     TLYHYFPNKQALFEQLVEEISQQDIITALTEFGGKNNLLELMETLGQYLVKNEDYLIK
                     WTYVWVDFCQHQDSKIMLTNSTVFKRANQRCQQVACDLLGVRDVVLASFVLSFVNGVV
                     LEKLWGNENIDFPQQCQLLGEMITAYLQQKAEVKINN"
     gene            complement(565014..566633)
                     /locus_tag="ANA_C10528"
     CDS             complement(565014..566633)
                     /locus_tag="ANA_C10528"
                     /EC_number="4.2.1.70"
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridylate synthase"
                     /protein_id="AFW93328.1"
                     /translation="MILLHPLSDFIESNFIIYSAQPNYYYEGKCPQTGEILRLPRTPL
                     AEAIADSLMQQLEQNHLYSHEGKMYGILLVELPNGEQRVIKAFSGLLNGNSMVTGWVL
                     PIPGREEVALLETQILAKLAAIKQEIITLEQIPERAEYKTLSVEYTQQLQTMSLHHDH
                     SKQQRHKQRQEFYQTLTDKSLTTALEKLEAESRQQGIDRRNLKRHQNEILQPLQQIIT
                     SADRKITELKQQRKQLSRQLQTEMHAAYSLTNFQGQSLSLQQLLPAGTPTGTGECCAP
                     KLLHYAATHGLKPLAMAEFWWGNSSIENKVSGEFYGACLERCQPLMGFLLSGLKPNQV
                     EIIYEDEWLIAVNKSSGLLSVPGRYFHNQDSVISRLRHLYNQEIIAVHRLDQDTSGIL
                     LIAKDPITHSQLSQQFQQRQIHKVYEALLTGSLAINEGEINLPLWGNPDHRPYQEVDL
                     SRGKPSLTHFRVMNRAGDYTRIEFVPLTGRTHQLRVHAADTRGLGMAILGDKLYGYHS
                     DTDRLYLHARELRFQHPHVEKILHLQVKTPF"
     gene            complement(567046..567255)
                     /locus_tag="ANA_C10529"
     CDS             complement(567046..567255)
                     /locus_tag="ANA_C10529"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93329.1"
                     /translation="MRKQITLSLWLFSVNGNNQFLILRIANYPKKPASNSGNSIKADP
                     IKTRVAGSILMWFFCGSRIWYNSEK"
     gene            complement(567259..567447)
                     /locus_tag="ANA_C10530"
     CDS             complement(567259..567447)
                     /locus_tag="ANA_C10530"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93330.1"
                     /translation="MKEYMSALEGLVEQLTLAAILEMLERICHKKAENLRTHWNDEET
                     AKLWEKAARQIENINVDI"
     gene            567943..568845
                     /locus_tag="ANA_C10531"
     CDS             567943..568845
                     /locus_tag="ANA_C10531"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93331.1"
                     /translation="MTRFIHDQFAKDYLEELLKNYGEVQAPSRVAGEVREIDVYFSPY
                     PQANPNLQLLGLLGKFASTPAIFEPYRNPASSDEICDCLLKLLEVKGVLKREAKRNKT
                     NLQESEIPKLWILTPTASPEILSGFNTTLKTDSLPGIYYLGAALRTAIVVIHQLPRTE
                     ETLWIRMLGRGNVQKQAIEELAELTVNHPFRRITLELLYNLQKHLGVNQETEDREIIM
                     RLAPLYQQDRDLAVQEGKIEGKIEGETLLIIRQLNRRIGEINSELIAKIQKLSLEKLE
                     MLGEELLDFTKLDDLESWLNQNQE"
     gene            complement(568902..570053)
                     /locus_tag="ANA_C10532"
     CDS             complement(568902..570053)
                     /locus_tag="ANA_C10532"
                     /EC_number="4.4.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="AFW93332.1"
                     /translation="MTSTISINDSQRLGLEPLDVPHRLLLGPGPSNAHPEVLQAMNTT
                     PVGHLDPAFLTLMDEIQSLLRYTWQTENPHTIAVSGTGTAAMEATLANSVEPGEVVLI
                     GVAGYFGNRLVDMAGRYGADVRTITKPWGQVFNLEEISAAVATHKPAILALVHAETST
                     GARQPLEGVGELCRQHGTLLLVDTVTSLGGVPIFLDEWGVDLAYSCSQKGLGCSPGAS
                     PFTMSGRAMEKLQKRQSKVANWYLDMTLLGKYWGTERTYHHTAPINLYYGLREALRLV
                     AEEGLASCWQRHQKNVEYLWEGLEDMGLKMHVEKEYRLPTLTTVCIPEGVNGKSVARQ
                     LLVEHNIEIGGGLGELAGKVWRVGLMGFNSRPESVDKLIAALGTMISNN"
     gene            complement(570224..571507)
                     /locus_tag="ANA_C10533"
     CDS             complement(570224..571507)
                     /locus_tag="ANA_C10533"
                     /codon_start=1
                     /transl_table=11
                     /product="NACHT domain-containing protein"
                     /protein_id="AFW93333.1"
                     /translation="MDLPRKRKRGTILTIQGLNKLENAIKTKEYAENNGKRFTLDNLS
                     NQTELDSHTLCKIFNCNVRVDKKSLVKCFKAFNLVLEADDYQSPLQPPIQPDGDYSLA
                     PDVSVFYGRTAELVTLKQWIQVNRCQLIMVLGMGGMGKTSLIAKLMSGFTNSEFKYVI
                     WRSLYHAPTVEETLTDLIHIVSHQQAVDLPKFPDQLISKLMQYLHQTRCLLVLDNLES
                     ILQWGGGGYYRPGFEGYGQLIRTIGESTHKSCLIIISREPPIAFSVLEKKANSVRLLI
                     LRGLLPEDGLKIFQSEGIDKTQAEWQILHNHYGGNPLILKIVITIIHFLFSSKIDLFL
                     AQGITVFGDIYDLLDQQFQRLSDLEKTVIYSLAIHRQPLFMPELVRKIISPVTSQNLL
                     ATLANLKLRSLIECNSDGFTVQNNLREYVTSQFES"
     gene            571911..572159
                     /locus_tag="ANA_C10534"
     CDS             571911..572159
                     /locus_tag="ANA_C10534"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93334.1"
                     /translation="MTSKTPRPRRKVLGAAFTGALVTLTVFVLNTYVISGQDKRITSE
                     ASAAATTVLSSLIAYLIPPDPNETTVDEDGNTKSALKQ"
     gene            572305..572829
                     /locus_tag="ANA_C10535"
     CDS             572305..572829
                     /locus_tag="ANA_C10535"
                     /EC_number="3.5.1.28"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="AFW93335.1"
                     /translation="MKVCIDPGHGGTDPGAIGKDPFVLNEKDVNLSISLLLKKELEAN
                     GHTVFLTRDTDISVSLGSRASFANQKNVDIFISIHCNSYSNNSAEGIETWIFSGSNAG
                     KNLAEPVQQSLISTFSTHRNRGVKEANFQVLRETEMPAILVECEFISNPTQLQFLSNN
                     NNQKKIAQAIALGI"
     gene            573256..573960
                     /locus_tag="ANA_C10536"
     CDS             573256..573960
                     /locus_tag="ANA_C10536"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding domain-containing protein"
                     /protein_id="AFW93336.1"
                     /translation="MATELKTFTGSQFIGKPVLADIEFIPHLETINDFAATNGLKIFV
                     TSSNRVLGIPVVNPNFPPSRMSNHFIGHAIDMNIQIGSTLYNSNALGNFSSLPAAIKA
                     FITAIRNHPVLRWGGDFGDPVHIDDNLNNTNPSLWKQKLPIIQSELTGLTQPGIRTGS
                     GPRLLFLTTPLMEGDDIKAVQKKLISKGFDLGKNGADGLFGQATVNAVLKFQDQEDLE
                     PVDGIVGDKTREALGL"
     gene            574037..574525
                     /locus_tag="ANA_C10537"
     CDS             574037..574525
                     /locus_tag="ANA_C10537"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93337.1"
                     /translation="MNRNFIACKAQVFNRIVTPDSFLNELIDWANQAPDEVFEKNDKK
                     DIYSSVAPELGPGNTLLHRKAVMLEVLRVLGGFESSWDWNEGRDITNINSNTACTEEA
                     GIFQCSGNSMNFDPSLKKLLKNVSGQTDCDTFIKVSKSNHKFAIEYCARLLRFTINHH
                     DH"
     gene            complement(574506..574877)
                     /locus_tag="ANA_C10538"
     CDS             complement(574506..574877)
                     /locus_tag="ANA_C10538"
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="AFW93338.1"
                     /translation="MERPYLNLELRRLVAQRADNLCEYCLIAEHDTILGCAIDHIISI
                     KHGGSSNIDNLAYCCVYCNRFKGSDIGSIIIDKKEFVRFYHPRWDNWGEHFKLNNSTI
                     ESLTNIGQVTARILGFNDHDG"
     gene            complement(574887..575144)
                     /locus_tag="ANA_C10539"
     CDS             complement(574887..575144)
                     /locus_tag="ANA_C10539"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93339.1"
                     /translation="METSISINPAYEEIINFLAAGITSQSLVEFQVSETVKERVSDLI
                     FREKTDGISSEEKSELDHYLILEHLLRLAKARAYDFIHEKA"
     gene            complement(575321..575554)
                     /locus_tag="ANA_C10540"
     CDS             complement(575321..575554)
                     /locus_tag="ANA_C10540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93340.1"
                     /translation="MDLLNIRTKVITEINLIPEDKLEELYNFIHYWRLNGESSPAGKM
                     PALQEFHNSSLYLIRAKSAVTLASLLIMKFSVA"
     gene            complement(575697..576866)
                     /locus_tag="ANA_C10541"
     CDS             complement(575697..576866)
                     /locus_tag="ANA_C10541"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="AFW93341.1"
                     /translation="MLNIIPLLLLLIQVPATAILLSRLLKGPGRYPALEPQQPTPELL
                     GTVSVVVPTLNEALRISPLLEGLSRQSYEVREIIVVDSRSQDGTPDLVKTAQITDPRF
                     WVITDDPLPPGWVGRPWALHNGFLFTSEGSEWFLGMDADIQPHPGLVASLVKTAIAQG
                     YDLVSLSPQFILKYPGECWLQPALLMTLLYRFDPTGIYTEQPERVMANGQCFLCRRSV
                     LRAVDGYSSAKGSFCDDVTLARNIASQGFKVGFLDGAKVLRVRMYEGALETWNEWGRS
                     LDLKDAASPAQIWGDLWLLSAVQGLPLLILLGYLLLPSLVLSLPAMLLLGLNIFLVVI
                     RFALLLAIAPSYDRQDATGGWLFWLSPLADPLAVLRIFLSAFHTPKEWRGRKYGD"
     gene            complement(577238..578146)
                     /locus_tag="ANA_C10542"
     CDS             complement(577238..578146)
                     /locus_tag="ANA_C10542"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="AFW93342.1"
                     /translation="MRQIVIVERVCLIGHIVSMVFGLLGILIVIPNAELIVSLSEVGQ
                     SVMQWSMAGGGVVYMILGALGVFLYAYRTLGLARALGFLIPSLSISLTSELLGTSTGF
                     PFGYYSYLSGLGYKISGLVPFTIPLSWFYVGLVSYVLARAGLEVDKKPSLFRHVGAIG
                     LGALLLTSWDFVLDPAMSQTSLPFWYWHQPGAFFGMPYQNFAGWMGTGSLFMTVAALL
                     WSKNPVKLDHYQLNVPLLVYLGNFGFATVMSLAAGFPIPVLLGVALGVAPAVLLWSKG
                     SSTPATVNIEAATQEVAVANVKVAFK"
     gene            578425..578850
                     /locus_tag="ANA_C10543"
     CDS             578425..578850
                     /locus_tag="ANA_C10543"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93343.1"
                     /translation="MSILKKIPWFSLTLILLSYSTLGWLIFEEKAPWYVRLITAVTIL
                     LSLILLTNPWLKLDDYSHIFFKSNARTFLVAILAAFLFFLMIAWFRVFLDTLLILSAT
                     ILAKIDFQTVGLKPALAFGCISFCSLLGLGIGALINHYI"
     gene            complement(578907..579191)
                     /gene="rpmA"
                     /locus_tag="ANA_C10544"
     CDS             complement(578907..579191)
                     /gene="rpmA"
                     /locus_tag="ANA_C10544"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L27"
                     /protein_id="AFW93344.1"
                     /translation="MAHKKGTGSTRNGRDSNAQRLGVKRYGGQTVRAGNILVRQRGTK
                     VHPGNNVGIGSDDTLFALIDGVVTFERRGKSQKKVSVYAVAAELVEAVAG"
     gene            complement(579330..579749)
                     /gene="rplU"
                     /locus_tag="ANA_C10545"
     CDS             complement(579330..579749)
                     /gene="rplU"
                     /locus_tag="ANA_C10545"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L21"
                     /protein_id="AFW93345.1"
                     /translation="MTYAIIETGGKQMKVEAGRFYDIELLTAEPDEKVTINAVLLVHH
                     EGAVSIGQPLVEGATVEGTIMRHFRGRKVLVYKMKPKKKTRKKRGHRQEITRFLINSI
                     NLNGEVLAYEEAPTSPELPVLDTDFVEETADESSEES"
     gene            580220..581308
                     /locus_tag="ANA_C10546"
     CDS             580220..581308
                     /locus_tag="ANA_C10546"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase-like protein"
                     /protein_id="AFW93346.1"
                     /translation="MKRIEVEQRTIFVGLAGSHGYGLNRPESDYDYRGVFIAPKRYYL
                     GFDSIEQKDSGWDEPGIFPFIDGNEDTVIYELRKVIHLLAGANPNVLELLWLTNYPFL
                     TNVGQHLINHRHLFLSKKVKHTYSGYAFAQIKKMETHRKWLLNPPTKKPLPSDFDITD
                     EVPLSKDELNAFLEYLYLLIRGKIEFLEESEQLYKLLTGDIDFKGVLKQYTLADETLA
                     YTQNLTHSRKDFIRLLQKSQSYQIALREWKAYISWQENRNPARAEMEKKSGYDLKHGM
                     HCIRLLRSGLEILQRGEVTVDRNLAGDIDDLKAILRGDYSYEQLMKMAEDLVAQMDVF
                     YDQSSLPHRPNLEQINDLCMELVEMQGW"
     gene            581647..582861
                     /locus_tag="ANA_C10547"
     CDS             581647..582861
                     /locus_tag="ANA_C10547"
                     /codon_start=1
                     /transl_table=11
                     /product="TPR repeat-containing protein"
                     /protein_id="AFW93347.1"
                     /translation="MSQSDDYTPGEQAGGKPKFASDIYAVGMIGIQAVTGLVPGQFQE
                     DSNTGEIIWRNYAQVSDEFAEVLTKMVRDHFSQRYKNATEALQALIPPDKTIVIPPPP
                     PKKFPTKIMLGLGMAVAISFAGGYIVNQVLSYQAALTATTKKAEEFLKQGNDKLDKRD
                     SQGAINTLTEAIRLDPKFAEAYSRRGVAYSNIENNQKAIDDLQKSVKLFATQGNNSAS
                     KHDQGRIRDYLKDYQGAIALYNESINLDPHDARTYQNRGIAHYSLGDKQAAIADFNQA
                     IKINPNFAIAYHQRGNSRSDLGDKQAAIADFNQAIKINPNFAIAYKNRGYIHYELGDK
                     QAAIADYTQAIKINPKYSKAYHVLGYIHYDLGDKQAAIADFQQAVKLYQQQKGNEELL
                     KIAQDRIRELQK"
     gene            582955..583224
                     /locus_tag="ANA_C10548"
     CDS             582955..583224
                     /locus_tag="ANA_C10548"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93348.1"
                     /translation="MPKLNIGRKIKQQMSKRGWTEEMLELVYLNPGKTEKTRDKRYNM
                     DGTRKDDPATVYYRSDGAYIVCNDITGDVVQVSDINDPNWIEKQY"
     gene            583289..583576
                     /locus_tag="ANA_C10549"
     CDS             583289..583576
                     /locus_tag="ANA_C10549"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93349.1"
                     /translation="MKLIDKYQKTGFIKAGELLLTPANALEFINEIAEGNISVLGVDL
                     WYYINNQISEDPGSLDLSEIDDPQQSVSIAKQFITHNLPKGTAFVSLVLSD"
     gene            complement(583747..584208)
                     /locus_tag="ANA_C10550"
     CDS             complement(583747..584208)
                     /locus_tag="ANA_C10550"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane anti-sigma factor"
                     /protein_id="AFW93350.1"
                     /translation="MEKRDCFELLSAYLDGEVTATERRQVEEWLSNDTSIKCLYKRLL
                     NLRKGLHDIPVPATAQSSEVTINQVLTRVNRRYRLNWMLGGAAAAACILGTISGLFPG
                     NSRMVEIATTQPTELTPTATDSPLMVALNNPVIEIPKTAVATGQKPVNNLN"
     gene            complement(584325..584981)
                     /gene="sigG"
                     /locus_tag="ANA_C10551"
     CDS             complement(584325..584981)
                     /gene="sigG"
                     /locus_tag="ANA_C10551"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor SigG"
                     /protein_id="AFW93351.1"
                     /translation="MSQSISVSWSTVDATYPAASVQVDKLSNHDLILRCQVGLRPDRA
                     AFSELLRRYQTQVDRVLYHLAPDWSDRADLAQEVWIRVYRNINRLQEPAKFRGWLSRI
                     ATNLFYDELRKRKRVASPLSLDAPRLLADGEMDWEIAGDTPSPDEEMTTREFYEQLRE
                     AIADLPEVFRTTIVLREIEGLAYEEIAEITGVSLGTVKSRIARARSRLQTQLQTYLDT
                     "
     gene            585317..586018
                     /locus_tag="ANA_C10552"
     CDS             585317..586018
                     /locus_tag="ANA_C10552"
                     /codon_start=1
                     /transl_table=11
                     /product="ErfK family protein"
                     /protein_id="AFW93352.1"
                     /translation="MAMARNESVASMVMFLCFGTAILSLAVHWQTMRTTGQLNQSAST
                     EVYPQGSPVEIGSSAIAASVPTSPQKAAVINLDSPWKTQKSSLDAVTDPVNNPKPSVP
                     DLNATKVVVDLSDRRVYVSRYDEVIASYPIAIGKKGWETPTGDFKIIHKEHHPIWRHP
                     ITGAIFDGGTDSPLGDRWIGFWSDGRNEIGFHGTPNVDLVGAAVSHGCLRMRNSDVRM
                     LYSQVNIGTQVSVRE"
     gene            complement(586060..586596)
                     /locus_tag="ANA_C10553"
     CDS             complement(586060..586596)
                     /locus_tag="ANA_C10553"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93353.1"
                     /translation="MSIEKIVEQALQDGHLTPAMEAEVGRICGNASELLIEEYMALDR
                     LMGALLTGEVVAVPRKQFINVMEELVLSNVIAKVAEIEVTSEISLDVGDITAYALNRL
                     PPLYATTEEGAKYQRERANTELDALISQQVSEAICKYLDTPDFFPERQSLNKTTGNEV
                     LTQVSTLLQTHAANFEPQ"
     gene            complement(586901..587839)
                     /locus_tag="ANA_C10554"
     CDS             complement(586901..587839)
                     /locus_tag="ANA_C10554"
                     /codon_start=1
                     /transl_table=11
                     /product="metalloendopeptidase"
                     /protein_id="AFW93354.1"
                     /translation="MTIFNANLLTMTNTIHPQHKLRNFSIINPTKILIGIIATVPIAL
                     GLPAKALEIQVLPKNPQLGDTISVVIEADSQEKISNPTVTVGETTYPAFKIAPRQYRS
                     FIPTTPLEKAGVRTIRISQDGQEQNLSIKVRDRKFPVQRITLPPGKAGVNATEYELKR
                     VKELKALQTPKKYWHGLFLTPNAGRTSTKYGVRRYYNGEFANDYYHRGQDYAGATGSS
                     VVTPAAGKVALVGTVSQGFRVHGNVVGIDHGQGVISIFMHLSRIDVKEGDFVQAGQKI
                     GAVGSTGASTGPHLHWGLYVNGQSVDPIPWKSQQID"
     gene            complement(588075..589766)
                     /locus_tag="ANA_C10555"
     CDS             complement(588075..589766)
                     /locus_tag="ANA_C10555"
                     /EC_number="6.3.5.1"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(+) synthase"
                     /protein_id="AFW93355.1"
                     /translation="MKIAIAQINPIIGDLPGNAQKILEMSQQAASENVRLLLTPELSI
                     CGYPPRDLLVNPSFIEVIDNTLQKLAEDLPANLAVLVGTVVKNSQAHISGGKNLFNST
                     ALLENGKIQQFFHKRLLPTYDVFDEKRYFEPGLEANYFILDHLKIGVTICEDLWNDEE
                     FWGKRSYAVNPIADLANLGVDLIVNLSASPYTVGKQHLREAMLKHSVVNFQQPIIYTN
                     QVGGNDDLVFDGRSFALNKQGEIVCRAKGFVSDFLTVEFNSNKQDLDFGDISPVDESE
                     DEEIWNALVLGVKDYVGKCRFSKVLLGLSGGVDSALVAAIATAALGKENVIGVLMPSP
                     YSSEHSISDALKLAANLDIQTQLLPIGELMASFDNSLDELFAGTEFGIAEENLQSRIR
                     GNLLMAISNKFGYLLLSTGNKSEVAVGYCTLYGDMNGGLSVIADVPKTRVYSICKWLN
                     SHQQKEVIPENILTKAPSAELKPGQVDQDSLPPYEILDDILDRLIHQHQSATEIISAG
                     HEPAIVDRVLQLLSRAEFKRRQAAPGLKITDRAFGTGWRMPIASSWSALRNTSSP"
     gene            complement(589814..590560)
                     /locus_tag="ANA_C10556"
     CDS             complement(589814..590560)
                     /locus_tag="ANA_C10556"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="AFW93356.1"
                     /translation="MPIRNQKKILNPINQQPLADFKVGVDNVIFSVDTAQNRLLVLLV
                     MRQQEPFLNDWSLPGTLVRQGESLEDAAYRIMAEKIKVNNLYLAQLYTFGGPNRDPRE
                     KIDSYGVRYLSVSYFALVRFEEAELIADKVAGIAWYPVKQLPQLAFDHNEIITYGHGR
                     LKNKLEYSPVAFEVLPETFTLNDLYQLYTTVLGENFADYSNFRARLLKLGFLSDTGIK
                     VSRGAGRPASLYKFDKEAFAPFKDKPLVFI"
     gene            complement(590530..591120)
                     /gene="nadD"
                     /locus_tag="ANA_C10557"
     CDS             complement(590530..591120)
                     /gene="nadD"
                     /locus_tag="ANA_C10557"
                     /EC_number="2.7.7.18"
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide adenylyltransferase"
                     /protein_id="AFW93357.1"
                     /translation="MKIALFGTSADPPTAGHLIILKWLSERYDWVGVWAADNPMKSQQ
                     TPLPHRAAMLELLIKDINVANQNIALEQDLSSWKTLETVGKAKLKWGENIEYTLVIGA
                     DLVNQLPRWYHVEDLLKQVQLLVIPRPGYIIDDSGLDKVKQIGGKIAIANLIGLDVSS
                     TAFREQGDINTLTPPVIAYIHQQHLYECQYVTKKRF"
     gene            591705..591992
                     /locus_tag="ANA_C10558"
     CDS             591705..591992
                     /locus_tag="ANA_C10558"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93358.1"
                     /translation="MDSVSLTHEQLSQAINELPLAALPELADFIESLLFKLNLTPAAI
                     NNEPEESNFLLSISGIGESSEPNLSDKDTENGEMEIDPTRGIKEFNHEVNK"
     gene            591995..592411
                     /locus_tag="ANA_C10559"
     CDS             591995..592411
                     /locus_tag="ANA_C10559"
                     /codon_start=1
                     /transl_table=11
                     /product="PIN domain-containing protein"
                     /protein_id="AFW93359.1"
                     /translation="MTAILDISFLVATVDIKDENYGRILDVIVDSKEVLVLPTTVLPE
                     VCHLLASRLGYPTTKQVLTELAHSNVIIEGIDKTDLKRVTEILDQYTDSKLNFVDATI
                     VAIAERMNITKIFTLNKPIFSIISPQHCAGFEIFPE"
     gene            complement(592467..593876)
                     /gene="aspA"
                     /locus_tag="ANA_C10560"
     CDS             complement(592467..593876)
                     /gene="aspA"
                     /locus_tag="ANA_C10560"
                     /EC_number="4.3.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate ammonia-lyase"
                     /protein_id="AFW93360.1"
                     /translation="MTNNSDFRIEKDSMGDRQIANNVYYGIQTQRAIENFPISGIKPL
                     PTYINACLYIKKATAIVNGELDCIPADISKAIIQATDEILAGELRDQFVVDVYQAGAG
                     TSHHMNINEVLANRALEILGDQKGNYKLVSPNDHVNYGQSTNDVIPTAIRIGGLLALS
                     RTLQPALEQAISALEAKAIEFQDIVKSGRTHLQDAVPVRLGDNFGAWAQILSEHQNRL
                     YIAAGDLMVLGLGGSAAGTGMNTHPEYRQRVVDILSQLLEFPLEAAPHLMAAMQSMGA
                     FVNVSGALRNLAQDLVKISHDLRLMDSGPKTGFKEIQLPPVQPGSSIMPGKYNPVMAE
                     MTSMVCFQVMGYDNAIAFAAQAGQLELNVMMPLIAYNLIHSIEILGNTISALTTSCIQ
                     GITANKERCLAYAEGSLALVTALNTHIGYLNAAAVAKESLETGKSLRQIVLEKGLMTE
                     TELATVLDLDQMSAIVPLK"
     gene            complement(594006..595919)
                     /locus_tag="ANA_C10561"
     CDS             complement(594006..595919)
                     /locus_tag="ANA_C10561"
                     /EC_number="3.4.24.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent metalloprotease"
                     /protein_id="AFW93361.1"
                     /translation="MKNLHKNALMKQRLSSSSQRHVLTGVIAAGLMMLPGLVGSSPVL
                     AQQKPERNSLTYGQLIQKADKGEIRKVELDQTEQIAKVYLAGQKPDTIPLQVRLLDQN
                     PELINKLKEKNVEFGEVSSAGNRAAVGLLINLMWILPLVALMLLFLRRSANASNQAMS
                     FGKSRARFQMEAKTGVTFNDVAGVKEAKEELEEVVTFLKLPEKFTAVGAKIPKGVLLV
                     GPPGTGKTLLAKAIAGEAGVPFFSMSGSEFVEMFVGVGASRVRDLFKKAKDNAPCLIF
                     IDEIDAVGRQRGAGIGGGNDEREQTLNQLLTEMDGFEGNTGIIIIAATNRPDVLDSAL
                     LRPGRFDRQVIVDVPDLKGRQEILTVHAQNKKIDPSVSLEAIARRTPGFTGADLANLL
                     NEAAILTARRRKEAVTDLEVDNAIDRVVAGMEGTALVDSKNKRLIAYHEVGHALVGTL
                     VKGHDPVQKVTLIPRGQALGLTWFTPNEEQGLISRSQILARIAATLGGRAAEEIVFGK
                     AEVTTGAGNDLQQVTSLARQMVTKFGMSDLGPVSLENQNNDVFLGRDWGNKSEYSEDI
                     AARIDAAVREIVNRCYIQAKEIIQENRLILERAVDLLIEQETIEGDLFRTMVANHTQV
                     KVTNEQVSVPILF"
     mobile_element  595990..597787
                     /mobile_element_type="insertion sequence:ISAsp14"
     gene            complement(596136..596351)
                     /locus_tag="ANA_C10562"
     CDS             complement(596136..596351)
                     /locus_tag="ANA_C10562"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93362.1"
                     /translation="MKMIDKKHQEWQQRNADKTRAYTAKYEASRVKVSVTLKKEIAEQ
                     IDKIKPPSQTYGGWIRELVEKYIDNLE"
     gene            596418..597782
                     /locus_tag="ANA_C10563"
     CDS             596418..597782
                     /locus_tag="ANA_C10563"
                     /codon_start=1
                     /transl_table=11
                     /product="IS200/IS605 family transposase"
                     /protein_id="AFW93363.1"
                     /translation="MALRRATFRLYPNKQVSEMLHYHRKLHKDLYNAAVSNRITSYKK
                     FGKTVSYFEQQNCLPDFKEVWIEYKVINSQALQATLKRVDFAFGRFFKGLGKYPRFKP
                     IRHYSGWTYPSFTGWKVHSTGDNGYLELSKIGQIQMRGKARLWGHPKALDIVNRNGQW
                     YASIVLEIDDTLLKNSRKTDNGVMAIDLGCNDAIAWTNGEENGLVAAPRFFRKAEQKN
                     QELGKSKRRKRSPNFKKKVKASRRWKKVQKLVSKLSRKVANQRQNFVHQETTRIISGN
                     STVVTEKLEVKKMSAKAKKGDALSLSKGKRKKQKAGLNKSILDVGMGMIRDALKAKLS
                     DIGGLFVEVPTKKVKPSQTCPKCGNQEKKSLAARTHVCHNCGYTQQRDIAAAEVMLLW
                     YSNNLQGLGTSLLDVDDSSSTSNTSERKNAGSMKQLGRAKRQKSQAPLGDVETPGSNE
                     VSKG"
     gene            597932..599020
                     /gene="aroC"
                     /locus_tag="ANA_C10564"
     CDS             597932..599020
                     /gene="aroC"
                     /locus_tag="ANA_C10564"
                     /EC_number="4.2.3.5"
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate synthase"
                     /protein_id="AFW93364.1"
                     /translation="MGSTFGHLFRITTFGESHGGGVGVIIDGCPPQLEISAEEIQFEL
                     DRRRPGQSKITTPRKEADTCEILSGVFEGKTLGTPIAILVRNKNTRPQDYDEMAQKYR
                     PSHADATYDAKYGFRNWQGGGRSSARETIGRVAAGAIAKKILHQVANVEVIAYVKRIK
                     DLEGVVDPNTVSLADVESNIVRCPDGETANTMISLIEQTGRDGNSIGGVVECVVRNVP
                     KGLGEPVFDKLEADLAKAVMSLPASKGFEIGSGFDGTLLTGFEHNDEFYIDESGEIRT
                     VTNRSGGIQGGISNGENIIIRVAFKPTATIRKEQKTVTKEGEETLLSGKGRHDPCVLP
                     RAVPMVDAMVALVLCDHLLRHYGQCKVL"
     gene            complement(599166..600068)
                     /locus_tag="ANA_C10565"
     CDS             complement(599166..600068)
                     /locus_tag="ANA_C10565"
                     /codon_start=1
                     /transl_table=11
                     /product="HemK family methyltransferase"
                     /protein_id="AFW93365.1"
                     /translation="MVEQQLQVVSGLELWQWRKTAIQTAIASDISPMEVDWLLLTIAN
                     LDRLALRLESFKTWQQIPIKLSLTELEQLWQRRLDDRLPVQYIAGTTAWRKFQLTVSP
                     AVLIPRPETEILIDLAVTAANGEAKAGQWVDLGTGSGAIALGLAEAFTTATIHAVDVS
                     PAALAIAQTNAEDLGFRERIQFYQGSWWQPLESLKGQFSGMISNPPYIPSNTVLTLQP
                     EVVNHEPHLALDGGADGLDYIRHLIDISPNYLRPGGLWLIEMMAGQAEMVRELLENNG
                     NYINISIHADLAGIKRFAVACNCK"
     gene            complement(600078..600878)
                     /locus_tag="ANA_C10566"
     CDS             complement(600078..600878)
                     /locus_tag="ANA_C10566"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93366.1"
                     /translation="MKLLVRWSLTLGLAGSTFLGVVLVPHIPALALPEQEIKAKLDGV
                     PVYLVTNGKGIPLSRSLSNNQNGQKDGDLLTRVYMSRQEAQEFIKKLQQVKDKNPKLD
                     EVVKTLQVTAVPLGSIYQQIRETKNQPNRLIFDFKPVDRDIQGALDLLRQSGQKVDKF
                     SGLPVFAVRFGADKGYVPIQTAAEKQQLIPLFLSKQDAQGLLTQVKPKYRTADIQVIA
                     VDEVIKTLQSKNDDWLKQVLLVPSPESREYMMSREYIKTLPNNKPSQK"
     gene            complement(601311..604811)
                     /locus_tag="ANA_C10567"
     CDS             complement(601311..604811)
                     /locus_tag="ANA_C10567"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93367.1"
                     /translation="MTSHIDEIHQLIADIDHLLSHTAKGISKFLSNQGQQEKDVLQRV
                     HNFLVRLSEEEVSKDDVLPETTNPLPTPKFSSLLTQFNQEVNVPSVFESGSHQPELSS
                     IETGQIKQELMVLIQPLQAELSRLLAERADLIQEIRQLEQKRLQNHSLSQQLANQDEM
                     ISEFLEVLMGRLVPHLKSNSAVIINPDLQNLEAITSAIQPILESAERVEQLANLARNL
                     DQHLLSLDGTVNTIFEALERNINAYYQSLSQALAKMHNEGMQGEQLMAKFLNNLTQYL
                     QQQVLINESSISDVNTEIVSASPLLTESSVVEQLTPSENVSTELPTAASPLLAESTVV
                     EQLTPSEDVLVELPAAEILPIDLDTELLQEPTQSAKDLQLTNTDEVAELYASFFNTEI
                     SSPLSFSFSPDILLKEDESLSIASEVVNHDLSALEINSSIVSSLADSTTLAEPNSVDT
                     ITVLTDLLVDTTHEQVPITVINQSDNSHIEPENQDVALDNCQEVDLSLTTQTYIEAEK
                     EDFSQALITSEQTPITSPQPSIPNDENNHLVPEDNLNTTWYLGIDIGTTGISAALLNH
                     SKLVVYPIYWSAENQSGDASFQQSFRLPAEVYLPTNSTSHQVKNGQSESSPHLYSAQL
                     KPYLQIAVPYQQERQKWEPMLQLNEFSAGPLIWVVRSLSKLLSTLRASQTSTTPALIA
                     NAVGMNIPTFSKVIKNIAGVICTCPSSWTEQYRFNVREAIVTSELISHPQQVFFVEEA
                     IASLLPELDSANGQSIQISEKQGLRALKTSNYLLVGNTLAINIGATLVEMTLVDIPAN
                     LEELVHKNFMLHNFAYSGKGIEQDIICQLLLPPKSRQLRQPGQFHHEEANANPWHWQP
                     SIPGLDQMQFSNLGLEGLVLPKVGEPDTQARIRLQQRLESSLLGQALLDAALALKLIL
                     QHQETFTLEFADQRWVLQRRDLESQVFVPFVRRLNRELNKLLVARGIPTEAINQAVLS
                     GGVASVGTINRWLRQKLPNAKIIQDLYLGENGAPNCSRVALGLTMLPLHPQVLDIPKQ
                     QYTDYFLFSELLKLLPNRSLTFGEVLQLFESRGINTRICQQRLLAFLEGELPPGLIPA
                     ASDYLWLTHHSQENLDYKAIDSLKAGINSPPLFEKQGNLSYRPNLQQVQLLLRYLDAI
                     KSSTVQSLEEPYSYLLHSQV"
     gene            605121..605372
                     /locus_tag="ANA_C10568"
     CDS             605121..605372
                     /locus_tag="ANA_C10568"
                     /codon_start=1
                     /transl_table=11
                     /product="Crp family bacterial regulator"
                     /protein_id="AFW93368.1"
                     /translation="MRQVNRKLQLRESDSQSRVADTLLFLAEGQSKQENTGTEIPNLP
                     HRELSSLSGLARETVTRVLRKLEKKGLIVRDYTQNGLIV"
     gene            605477..606241
                     /locus_tag="ANA_C10569"
     CDS             605477..606241
                     /locus_tag="ANA_C10569"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93369.1"
                     /translation="MFPIGQLWKKPSFNLVACMSIVDLLPEEPEKDSSPESLPQIQLQ
                     YQPLKVESTLRMVETAFLASTASLIWFINFYFPLGPVLRVFFPIPIALVYLRWGKRAA
                     WMAAVTSGLLLSVLMGPFRSLLFVMPFGLMGVLLGVTWYRRVPWIVSMTLGTLLGTMG
                     VFFRLWFLSVLSGEDLWVYVINQVTEIIEWIFLKLELLMTPNLLLIQLGAIAFIVLNN
                     FIYLFIVHLTALLLLDRLGNPIPRPPHWLQVLMDYE"
     gene            606381..607481
                     /locus_tag="ANA_C10570"
     CDS             606381..607481
                     /locus_tag="ANA_C10570"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93370.1"
                     /translation="MINIYTQVPQGKAWLHRYRGKLPIFACILGFTETGLIPGISAAG
                     LTPQDRQYTACADGEFLYYGAEHQPKYPLPPLTSGASPVLISRAVVANLNIPVYLFNA
                     GLPHTPPVPLIDLGGAPAKCLSQGAAMDIDTVKHLLVQGLRWGDQLSSELSSHGYLIL
                     SECVVGGTTTALAILTGLGIDAVGKVNSSHPVCNHGQKWDLVQAGLAKMPPSVDPLEL
                     VAAVGDPMQVVVAGMAIAASRSCGVLLGGGTQMLAVYALIQAIAYTYSLSWQPAEIVI
                     GTTRWVAEDPTGATVDLAQSLHKNSIPPLLATQLSFANSRYPQLQAYERGFVKEGIGA
                     GAACIAASLSQNWQQNQLLAAIEAQLEEISRN"
     gene            complement(607478..607825)
                     /locus_tag="ANA_C10571"
     CDS             complement(607478..607825)
                     /locus_tag="ANA_C10571"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93371.1"
                     /translation="MESLEKQILTLSQKVDAIYEVIERLDMRLSQALSDSSLDKLPVI
                     EHYLEKKQPVPELKELKHKDILSDGIVEMNYQTTDKQITPEIQIQRLTAQLTAAYHRI
                     AALEEQLLRQRAY"
     gene            608013..608282
                     /locus_tag="ANA_C10572"
     CDS             608013..608282
                     /locus_tag="ANA_C10572"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93372.1"
                     /translation="MSRRDTFTFHNPTLYLRGMLEEVVDDPAKFLLAGHRGGGKTTEL
                     RRLEQKLGNTHTVIWIDTQTALDRYNIGYAEVVGFDWFANCTASY"
     gene            608840..610048
                     /gene="nupC"
                     /locus_tag="ANA_C10573"
     CDS             608840..610048
                     /gene="nupC"
                     /locus_tag="ANA_C10573"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+ dependent nucleoside transporter"
                     /protein_id="AFW93373.1"
                     /translation="MERTISFLGICVFISICYVLSVSRQAVRWRTVAWGLGLEFILAI
                     VILKTPWGLNLFKSLGNIVGNFLAFSDVGAKFVFGENFKDHLFAFEILPTIIFFSSFI
                     SILYYYGILQRVVNALAWLMMKTMKTSGSESLSCAGNIFLGPTEAALMVKPYLANMTK
                     SELHAVMTGGFATIAGGVLGAYLSFGIPPEHLIAAFFMTSPVSLIVSKIMYPETEVSE
                     TTGTVNIEIKSNYVNVLDAATSGAIDGVKLAVNVGVIIIAFLSLLAAVNASLSWLGSL
                     VSYPQLSLEWMLSFVMFPVAWLMGIPWADCGQVGALLGKKTILNEFIAYLDLGEMIKK
                     QEISQRSAIIATYALCNFANIGSIGITIGGMTGIAPNRQQDLARMGVRTMIGGLLAGF
                     ITAGIAGILI"
     gene            610111..610851
                     /locus_tag="ANA_C10574"
     CDS             610111..610851
                     /locus_tag="ANA_C10574"
                     /codon_start=1
                     /transl_table=11
                     /product="phytochelatin synthase"
                     /protein_id="AFW93374.1"
                     /translation="MKLAAINPIKTSIRVIILGICLAKGNVFAQTLSLSPNLIGFDTP
                     EGETLLIASKSKSDFFPLSTQFVTQINQAYCGVASMVMVLNSLKIPAPEAPQYKPFRV
                     FTQDNFFSNEKTRKVVNSEVVARQGMTLDQLGGLLESYDVQVKVYHAGGINLAEFRKL
                     AAENVKQPGNFIIINYLRQEIGQERGGHISPLAAYNELTDRFLIMDVSRYKYPPVWVK
                     TADLWKAMNTVDSTAAKTRGFVFVSKNN"
     gene            611003..611230
                     /locus_tag="ANA_C10575"
     CDS             611003..611230
                     /locus_tag="ANA_C10575"
                     /codon_start=1
                     /transl_table=11
                     /product="hyppothetical protein"
                     /protein_id="AFW93375.1"
                     /translation="MNSITTNFLQRRYGVSLGRRYVLAAASVMLLGAFAYSSIDNSNN
                     VFTRSYLPNTELGFLPESLKTRSFPTYREVL"
     gene            complement(611225..612385)
                     /locus_tag="ANA_C10576"
     CDS             complement(611225..612385)
                     /locus_tag="ANA_C10576"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93376.1"
                     /translation="MQTRKLLNWWQTLTPIARYLAIALLAPLLVLNGWAIAAIFNYFH
                     SLIVILVGASVIAFLLNYPVSWMENHGAKREQVAILVFLLALSILLALGVTLFPLALT
                     QAQQLVARLPDLIDSGRSQLMILNGKAESVGLPINLDALAAQINDRVKGQLQSIAGQV
                     LNLAVITVTSLLDFLLTMVLTFYLLQHGGELWQSLVEWLPSKFRAPFSKTVRLSFQNF
                     FITQLILSTCMASALIPTFLWLKVPFGLLFGLTIGVMALIPFGGSVGIALTTSLVSLQ
                     DVSMGVRVLIAAVIVQQILENLIAPRILGSFTGLNPVWILISVLTGARIGGLLGVIVA
                     VPCAVVIKSIISAIRPSALSLDPEDSSLDDIATPMTPEASPKVETNNSLSVS"
     gene            612567..612929
                     /locus_tag="ANA_C10577"
     CDS             612567..612929
                     /locus_tag="ANA_C10577"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93377.1"
                     /translation="MDNLPAKDTDISKTQLILYLIPIIGFFPSLWTLYQRQGSRQQVT
                     ASRLSITLAFIWMLGYLLLTTGAVTDFLTLRLLILNSFLTSGYFLVSVWLIFRVIQGK
                     SSRLPGFSNLAERLWHKY"
     gene            613180..614604
                     /locus_tag="ANA_C10578"
     CDS             613180..614604
                     /locus_tag="ANA_C10578"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="AFW93378.1"
                     /translation="MTSQKTSAAQQKAAKAKYKGKGQNSRPSKLGRWLWFAVGMGGIA
                     IVSGLAGALLAVSWESTPLQQAQLSPQEEAVFDGDSISGNGLQFSQLTRPVNILLMGM
                     SVLPPDVQNPPSDSKNLSYLPQINSFDGLSDVMLLIKFDPETKKIVMLSVPRDTRAEI
                     EGYGVKKINAANAEGGPALTAKTVSNLLGGVGIDRYIRINVLGVSKLIEALGGVNIYV
                     PKNMKYRDDSQHLYINLKAGQQHLNGEQALQLLRYRHDELGDIGRIQRQQMVLRSLIE
                     QTLNPTTITKLPDILNVVKENIDTNLSVEELVALVGFGSKINRSNMQMLMLPGRFSDN
                     HEFDASYWVPDGRNIAKVMTQHFGLEAKTAEISFAEPSHLRVAIQDSTGNNRSQLRPL
                     IRTLEKAGYKNIFVSKPWGQPLDITHIVAQQGDGDSAESVRSLLGFGEVRVESTGNIG
                     SDITIQIGKDWFQNQAIFQNSTSP"
     gene            complement(614752..615882)
                     /locus_tag="ANA_C10579"
     CDS             complement(614752..615882)
                     /locus_tag="ANA_C10579"
                     /codon_start=1
                     /transl_table=11
                     /product="solute-binding protein"
                     /protein_id="AFW93379.1"
                     /translation="MDRRSFLLGTSTLTLSQLITGCGTNQQPPLNVQLLKNSIPGQVV
                     NQFRKTVTQGGKLKFTPVNQLQELFKLLQTWQQPPTNNQQEWTRYLPFNQNQKSPTAN
                     LVTLGDYWLQAAIDQKLIQPLATTNIKNLANLNEKWQQLIKRDQEGKIWGVPYRWGNT
                     VIIYNQEKFQELGWKPTDWSDLWRSELQNRISLLNHPREVIGLVLKKLGKSYNTENIK
                     QISALKPELQALNQQVKFYDSQNYLEPLITGDTWLAVGWSHDIIPVISRYQKFAAVVP
                     QSGTAIWTDLWVSPTGVSNDGLAYQWLDFCLQPNTSKQIALLTKSNSPVDNAMVLGDI
                     QKQLQNLLLTDAEILAKSEFILPLPPAVMKEYEDLFIKIKQS"
     gene            complement(616198..617880)
                     /locus_tag="ANA_C10580"
     CDS             complement(616198..617880)
                     /locus_tag="ANA_C10580"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="AFW93380.1"
                     /translation="MDGCFSVHCINPHCQRPYPQPWGNKFCNSCGAPLHLLNRYFSLK
                     PLGAGGFAQIYTIWDEKTQTEKVLKVLVETSPKALELFKQEAEVLSSFRNSGVPTVDA
                     DGYFQINLVNPKPYQLPCLVMEKINGYTLEEVLINSPQGCSEDLVIGWFIQAVQILQE
                     LHQRQIIHRDIKPSNLMLRTSTPATPGKDDKLVLIDFGGAKQFSGSVLRSHPTSTRLY
                     SSGYSPYEQIRGGNVGPAADFYALGRTIIQLLTGKYPPDLEDSLTGKLRWRNYRQIKS
                     DLADLLDEMVQDDPKFRPADAAIIHKRLIKIASLRPHKGLLISAGHFVVTSITDITQF
                     ISNTTVFIIEGIYKFLLACLATIWVMILTSICAGIGTIIGFVLAYHTSLGDRWLELLT
                     YPLPTLVQKQPYIAAESIVYGFAGLGTGWGLTLSGCFGQKRRFLITALMGLIGYSLGW
                     IACQFITTPNPAESLVTWILISLPLLTLGLGLRTHQIAYAVIAGLGSANLIAIFVRLG
                     LGLHLFHFSSQPQGLDVFSPIGFFSLVSILISFSLSISYYLVVPCLRWLGWR"
     gene            complement(618085..620466)
                     /locus_tag="ANA_C10581"
     CDS             complement(618085..620466)
                     /locus_tag="ANA_C10581"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="AFW93381.1"
                     /translation="MLQISQMYKELNLPKYFIVVLWFLLSLMGVVMLLGTFQPANTNN
                     PLETSNTVVLHDQQEQYKLGKSVEIFQDPTQQLTIADVSQQPQKFTPSHTDIPNMGFS
                     KSAIWAKVKLQNHSTVTSEWYLQGAPNNVDQVELYIPQGNTWIKKQIGRLLPFSNREL
                     SDRKLIFILPLAVDEEKTIYLRYTSQGTIAIDVILWTPLAYYKSSSTQQLLLGGFYGI
                     LLSFVIINLLLVCLLKDVVYQYYILFIIGVSGQFFIRYGLAFQYLWPEFPGYNIPVLL
                     IFLCIILVGCSSFFISFLQVRVYSYQLYKLMNWFRWTSVGYTLFNWYFPVRNSIIIIM
                     LLLIIMSIVMIYASFYIWSKGFTPARFAILAFSCFLLGIAMLCATYLGWLSVNPLTEA
                     FIRLEVIGLLFFLAIALSDHINLLKKERNKLASEQQKLAMIVENSSEFITITNLNGET
                     IFMNDAAKKMIGLIGENYDSEVNILDYLCPEERNLFESQILPTVLEIGSWEGELKFCN
                     LKTGTIIYSIAYFLLIKDQLTARTTNLASIIRDISPIKQAKNEIIEALKKQKAISEMK
                     SRFMTMSSHEFRTPLTIISSSTSILQNFGDRLTSENKQGHLETIQETITRMIQLLDDV
                     LTINRTEAEKIEFNPELSDIIAFCHDLKKKIETTCQHHTIDFSWNLGAGVADSSLIVN
                     FDQKLLHQILTNLLTNAIKYSPGKTLVDFNLTKENDQLIFKITDSGIGIPEKDQVNLF
                     TSFYRASNVGSISGTGLGLSIVKKCVDLHKGKIILDSQVGQGTTFTVIIPWEQ"
     gene            complement(620481..622086)
                     /locus_tag="ANA_C10582"
                     /note="hypothetical protein;
                     frameshift"
                     /pseudo
     gene            622370..622627
                     /locus_tag="ANA_C10583"
     CDS             622370..622627
                     /locus_tag="ANA_C10583"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93382.1"
                     /translation="MASPEPLHDTELVDCARANANQGIETAACQCGYGDDINTFAQEL
                     RQACEKMNLQVKELKELITDQDIMLKLGAGEIIAPETASEL"
     gene            622963..624450
                     /locus_tag="ANA_C10584"
     CDS             622963..624450
                     /locus_tag="ANA_C10584"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M50"
                     /protein_id="AFW93383.1"
                     /translation="MLTSSETPIIAAIVLIASGILGWGFYRARPFGKLGILAWLQSLV
                     LMTPWLLFFGLFAAGIYINIVGILFLVVASAGLYIFLGRKLRDAGQDAILKQRATERL
                     AAQTASEGDKDSSVVVSELQLAPTPIPEADLSLIRGIFGIDTFFATETIPYQEGVVFK
                     GNLRGEPEAVHNRLTKTLRERLDDKYRLFLVEDTDSKPVMIVLPSRTDPQRTQLAQKA
                     FAVILLIATIATSLEVGGILQNFDLFSNPERFAETLPIALGLLVILISHEVGHWLLAR
                     RHQVKLSWPFFLPAVQIGSFGAITRFESLVPSRNALFDIALAGPAFGGITSLLLLVIG
                     LLLSHPGSLFQLPNQFFQGSILVGSLARVVLGSALQSPLVNIHPLVIVGWLGLVITAL
                     NLMPAGQLDGGRIVQAIYGRKTAGRTTFATIVLLAIVSLGNPLAMYWAIVILFLQRDL
                     ERPSLNEISEPDDARAALCLLALFLMIATLLPLTPALAGRLGIGS"
     gene            complement(624580..625797)
                     /locus_tag="ANA_C10585"
     CDS             complement(624580..625797)
                     /locus_tag="ANA_C10585"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93384.1"
                     /translation="MKKILIKWERQTKKLGFLAAIMAVSMIAFFMLSFPLNAQIPKST
                     ELRGVWLTNIDSDVLFESNRLKQSLRTLQQLNFNTVYPAVWNWGYTLYPSKVAAKVIG
                     KAVDPTPGLQKRDMLKEIVTEGHKQNLTVIPWFEFGFMAPADSLLAKNRPTWLTNRRD
                     GTKIVKEGTHNRVWLNPFRPEVQQFIQDLIIEIVKNYDIDGIQFDDHFGLPSELGYDA
                     YTTALYKKEHQGKLPPADFKDPEWVNWRANKITDFMKRVFTAIKANKKDCIVSVAPNP
                     QRFSYEYFLADWQKWERMGIIEDLVLQIYRNDLNVFISELEYPEVKQAQTHIPVSIGI
                     LSGLKNRTVPMEQIKTQIEKVREQKFAGVSFFFYETLWNMSQEKPQQRQQTWQKIFPT
                     PTNYPNLLANWKP"
     gene            complement(625910..626863)
                     /locus_tag="ANA_C10586"
     CDS             complement(625910..626863)
                     /locus_tag="ANA_C10586"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93385.1"
                     /translation="MQEDLELKENLIEEDEILSLKHFIYLDKIKLHSYSSQLFGGLVQ
                     LRRLTENEGTKSTQSSGEEYKERIQEDGKEGEISIGPKNYAGGASGKTVDKTTQKDGY
                     KKGVNTTSDEYLYSTTEDIVEHDYGYLTFEEILINKGILKEIKDIEELEKYSSLIKIT
                     GVCRFIDWDSIIELFSHDNVINLFLPNSDQNSKKGFKQNTQQKKEEENHLKTTKAGLE
                     IIKAFSIGSVTVNTNIGNSNLIGTINQEHLRITRDQLRSAYIMPGDVEMTIVGFIPRR
                     GIEKITFPGLSGLIDMTEVWKAWTGEIDLVIEPIAIYTEIK"
     gene            627354..627614
                     /locus_tag="ANA_C10587"
     CDS             627354..627614
                     /locus_tag="ANA_C10587"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93386.1"
                     /translation="MDIQSVGIKEFRANLHKYTQQASEPIAITSHGVPIGYYIPTQPT
                     PQKQDLMALQAAVQKIQQLLETRGINEDELFADFQNAKESTI"
     gene            complement(627625..628836)
                     /locus_tag="ANA_C10588"
     CDS             complement(627625..628836)
                     /locus_tag="ANA_C10588"
                     /EC_number="4.1.1.36"
                     /EC_number="6.3.2.5"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate--cysteine ligase"
                     /protein_id="AFW93387.1"
                     /translation="MPSSTNLKSKRVLICVGGGIAAYKVCELVSTLFKSGLEVRVILT
                     KSAQEFITPLTLSTLSRHQAYTDDNFWQPIYARPLHIELGEWADLIVIAPLTANTLAK
                     LAYGMADNLLTNTVLASTCSVLLAPAMNTDMWQQVAVQRNLQQLLTDSRFYGIGTGSG
                     LLACDRIGAGRMAGAAEIFVYIQSLLHTQGKRDLAGKQVLISAGGTREYLDPVRFIGN
                     PSTGKMGLALAQAALHRGAKVILVHCPANWDVPLGVEAIAVVSAEEMQQVMFKHLGNA
                     DIIIMSAAVADVKPRDYCSEKLPKRSLPENLPLAAVPDIVAEIGNRKQPHQYLIGFAA
                     QTGDIITPAKEKLQRKKLDAIVANPIDKVDSGFGSDHNQAVFLDKEGRELEIPTCSKL
                     EMAHYLFDFVV"
     gene            complement(628916..629128)
                     /locus_tag="ANA_C10589"
     CDS             complement(628916..629128)
                     /locus_tag="ANA_C10589"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AFW93388.1"
                     /translation="MKTLSISKTEISAMTATEVKDLATRLELDNYSNAFEGLNDWHLL
                     RAIAFQRPELVEAYIHLLDLEAYDEA"
     gene            complement(629268..629900)
                     /locus_tag="ANA_C10590"
     CDS             complement(629268..629900)
                     /locus_tag="ANA_C10590"
                     /EC_number="3.1.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="AFW93389.1"
                     /translation="MTPTLDFIRVSPPKNQTPDALIVTLHGWGANAQDVASLIPHVNL
                     PDYEFLLPNAPYPYPYADTGRAWYDLRTENMYDGLNESKQLLIDWLLSLESNTGVPLS
                     RTILSGFSQGGAMTLDVGLSLPLAGLVVISGYLHPSVAMLNQGNFPPTLIMHGTQDEV
                     VPLQAAIKSRDVAQSLGVAVEYHEFAMGHEINFQMLEVLRTFVVNTIG