LOCUS       CP002686            23459830 bp    DNA     linear   PLN 20-JUL-2017
DEFINITION  Arabidopsis thaliana chromosome 3 sequence.
ACCESSION   CP002686
VERSION     CP002686.1
DBLINK      BioProject: PRJNA10719
            BioSample: SAMN03081427
KEYWORDS    .
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 23459830)
  AUTHORS   Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M.,
            Fartmann,B., Valle,G., Blocker,H., Perez-Alonso,M., Obermaier,B.,
            Delseny,M., Boutry,M., Grivell,L.A., Mache,R., Puigdomenech,P., De
            Simone,V., Choisne,N., Artiguenave,F., Robert,C., Brottier,P.,
            Wincker,P., Cattolico,L., Weissenbach,J., Saurin,W., Quetier,F.,
            Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Benes,V.,
            Wurmbach,E., Drzonek,H., Erfle,H., Jordan,N., Bangert,S.,
            Wiedelmann,R., Kranz,H., Voss,H., Holland,R., Brandt,P.,
            Nyakatura,G., Vezzi,A., D'Angelo,M., Pallavicini,A., Toppo,S.,
            Simionati,B., Conrad,A., Hornischer,K., Kauer,G., Lohnert,T.H.,
            Nordsiek,G., Reichelt,J., Scharfe,M., Schon,O., Bargues,M.,
            Terol,J., Climent,J., Navarro,P., Collado,C., Perez-Perez,A.,
            Ottenwalder,B., Duchemin,D., Cooke,R., Laudie,M., Berger-Llauro,C.,
            Purnelle,B., Masuy,D., de Haan,M., Maarse,A.C., Alcaraz,J.P.,
            Cottet,A., Casacuberta,E., Monfort,A., Argiriou,A., flores,M.,
            Liguori,R., Vitale,D., Mannhaupt,G., Haase,D., Schoof,H., Rudd,S.,
            Zaccaria,P., Mewes,H.W., Mayer,K.F., Kaul,S., Town,C.D., Koo,H.L.,
            Tallon,L.J., Jenkins,J., Rooney,T., Rizzo,M., Walts,A.,
            Utterback,T., Fujii,C.Y., Shea,T.P., Creasy,T.H., Haas,B.,
            Maiti,R., Wu,D., Peterson,J., Van Aken,S., Pai,G., Militscher,J.,
            Sellers,P., Gill,J.E., Feldblyum,T.V., Preuss,D., Lin,X.,
            Nierman,W.C., Salzberg,S.L., White,O., Venter,J.C., Fraser,C.M.,
            Kaneko,T., Nakamura,Y., Sato,S., Kato,T., Asamizu,E., Sasamoto,S.,
            Kimura,T., Idesawa,K., Kawashima,K., Kishida,Y., Kiyokawa,C.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A.,
            Yamada,M., Yasuda,M. and Tabata,S.
  CONSRTM   European Union Chromosome 3 Arabidopsis Sequencing Consortium;
            Institute for Genomic Research; Kazusa DNA Research Institute
  TITLE     Sequence and analysis of chromosome 3 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 820-822 (2000)
   PUBMED   11130713
REFERENCE   2  (bases 1 to 23459830)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
REFERENCE   3  (bases 1 to 23459830)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
FEATURES             Location/Qualifiers
     source          1..23459830
                     /organism="Arabidopsis thaliana"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:3702"
                     /chromosome="3"
                     /ecotype="Columbia"
     gap             1..100
                     /estimated_length=unknown
     gene            complement(1609..4159)
                     /locus_tag="AT3G01015"
                     /gene_synonym="TEL3N.1"
                     /gene_synonym="TEL3N_1"
                     /db_xref="Araport:AT3G01015"
                     /db_xref="TAIR:AT3G01015"
     mRNA            complement(join(1609..1936,2048..2142,2223..2282,
                     2428..2526,2690..2809,2885..2977,3064..3109,3203..4159))
                     /locus_tag="AT3G01015"
                     /gene_synonym="TEL3N.1"
                     /gene_synonym="TEL3N_1"
                     /product="TPX2 (targeting protein for Xklp2) protein
                     family"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG440036.1,INSD:EG440030.1,INSD:EG440020.1,
                     INSD:EG440025.1,INSD:EG440022.1,INSD:EG440016.1,
                     INSD:EG440032.1,INSD:EG440015.1,INSD:EG440029.1,
                     INSD:EG440048.1,INSD:EG440038.1,INSD:EG440034.1,
                     INSD:EG440023.1,INSD:EG440031.1,INSD:EG440037.1,
                     INSD:EG440024.1,INSD:ES210013.1,INSD:EG440044.1,
                     INSD:EG440045.1,INSD:EG440035.1,INSD:EG440046.1,
                     INSD:EG440047.1,INSD:EG440041.1,INSD:EG440033.1,
                     INSD:EG440043.1,INSD:EG440021.1,INSD:EG440052.1,
                     INSD:EG440027.1,INSD:EG440050.1,INSD:EG440014.1,
                     INSD:EG440026.1,INSD:EG440019.1,INSD:EG440042.1,
                     INSD:EG440013.1,INSD:EG440012.1,INSD:EG440049.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:DQ056582.1,INSD:AY735598.1"
                     /db_xref="TAIR:AT3G01015"
                     /db_xref="Araport:AT3G01015"
     CDS             complement(join(1798..1936,2048..2142,2223..2282,
                     2428..2526,2690..2809,2885..2977,3064..3109,3203..4017))
                     /locus_tag="AT3G01015"
                     /gene_synonym="TEL3N.1"
                     /gene_synonym="TEL3N_1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG440036.1,INSD:EG440030.1,INSD:EG440020.1,
                     INSD:EG440025.1,INSD:EG440022.1,INSD:EG440016.1,
                     INSD:EG440032.1,INSD:EG440015.1,INSD:EG440029.1,
                     INSD:EG440048.1,INSD:EG440038.1,INSD:EG440034.1,
                     INSD:EG440023.1,INSD:EG440031.1,INSD:EG440037.1,
                     INSD:EG440024.1,INSD:ES210013.1,INSD:EG440044.1,
                     INSD:EG440045.1,INSD:EG440035.1,INSD:EG440046.1,
                     INSD:EG440047.1,INSD:EG440041.1,INSD:EG440033.1,
                     INSD:EG440043.1,INSD:EG440021.1,INSD:EG440052.1,
                     INSD:EG440027.1,INSD:EG440050.1,INSD:EG440014.1,
                     INSD:EG440026.1,INSD:EG440019.1,INSD:EG440042.1,
                     INSD:EG440013.1,INSD:EG440012.1,INSD:EG440049.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:DQ056582.1,INSD:AY735598.1"
                     /note="TPX2 (targeting protein for Xklp2) protein family;
                     CONTAINS InterPro DOMAIN/s: Xklp2 targeting protein
                     (InterPro:IPR009675); BEST Arabidopsis thaliana protein
                     match is: TPX2 (targeting protein for Xklp2) protein
                     family (TAIR:AT5G15510.1); Has 30201 Blast hits to 17322
                     proteins in 780 species: Archae - 12; Bacteria - 1396;
                     Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
                     Other Eukaryotes - 2996 (source: NCBI BLink)."
                     /codon_start=1
                     /product="TPX2 (targeting protein for Xklp2) protein
                     family"
                     /protein_id="AEE73594.1"
                     /db_xref="TAIR:AT3G01015"
                     /db_xref="Araport:AT3G01015"
                     /translation="MESTNLKNAKHETLVMDPISFQSKAQEVSRFSENSNPNFVSHST
                     PLEKSSKSSAQKNPKWKPNPVPAVFSPRNRIRERRFVVVKKNSRKEKNDSASVDCKCG
                     AKTISNMKKCVCIAYETLRASQEEFFNNRRESVSEIGESSQNLEDGNEQVEFGDSDET
                     RVSLMKRRREKVLEEARMSIPEFGKVMHLVKAFEKLTCFPLSKVTSKEEEDQIKQPLK
                     WELPGMSQPKCSESETDQFTWSSSFYPSSGLILTATNLGLEQPHASVSSSWDNSVSSL
                     NSNGGRRGRRNSFESSASMGSRRSTKKQIKVTSLKPFKLRTEERGRMKEEEFAKKLHE
                     MTLEKAKKRIPIAQGLPWTTDEPENLVKPHVKDITIPVDLKLHSDIRAVERAEFDYQV
                     TEKINLVEQYKTERERQQKLAEEEEIRRLRKELVPKAQPMPYFDRPFIPKRSNKHPTV
                     PRDPKFNIPQHKKIRCCSTSSWSDTGSYMSDLLYQQDL"
     gene            4342..4818
                     /locus_tag="AT3G01010"
                     /db_xref="Araport:AT3G01010"
                     /db_xref="TAIR:AT3G01010"
     mRNA            4342..4818
                     /locus_tag="AT3G01010"
                     /product="UDP-glucose/GDP-mannose dehydrogenase family
                     protein"
                     /db_xref="TAIR:AT3G01010"
                     /db_xref="Araport:AT3G01010"
     CDS             4342..4818
                     /locus_tag="AT3G01010"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family
                     protein; FUNCTIONS IN: NAD or NADH binding, oxidoreductase
                     activity, acting on the CH-OH group of donors, NAD or NADP
                     as acceptor; INVOLVED IN: oxidation reduction; LOCATED IN:
                     endomembrane system; EXPRESSED IN: cultured cell; CONTAINS
                     InterPro DOMAIN/s: UDP-glucose/GDP-mannose dehydrogenase,
                     dimerisation and substrate-binding domain
                     (InterPro:IPR014028), UDP-glucose/GDP-mannose
                     dehydrogenase, C-terminal (InterPro:IPR014027); BEST
                     Arabidopsis thaliana protein match is: UDP-glucose
                     6-dehydrogenase family protein (TAIR:AT5G15490.1); Has
                     4547 Blast hits to 4540 proteins in 1270 species: Archae -
                     101; Bacteria - 2703; Metazoa - 193; Fungi - 72; Plants -
                     179; Viruses - 0; Other Eukaryotes - 1299 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="UDP-glucose/GDP-mannose dehydrogenase family
                     protein"
                     /protein_id="AEE73595.1"
                     /db_xref="TAIR:AT3G01010"
                     /db_xref="Araport:AT3G01010"
                     /translation="MFNTVSNKKIVVLEFAFKKDTRETPAIDVCKGLLGDKARISIYD
                     PQVTEEQIQRDLTMNTFDWDHPLHLQPMSPTTVKQVSVAWDAYAATKDAHGICLLTEW
                     DEYKTLDYERIFENMQKPAFVFDGRNVFDAEKLRKIGFIVYSIGKPLDQWHMPALA"
     gene            5104..6149
                     /gene="ISU2"
                     /locus_tag="AT3G01020"
                     /gene_synonym="ATISU2"
                     /gene_synonym="ISCU-like 2"
                     /gene_synonym="ISCU-LIKE 2"
                     /gene_synonym="T4P13.30"
                     /gene_synonym="T4P13_30"
                     /note="Encodes a mitochondrial protein similar to E.coli
                     IscU. In bacteria, IscU is a scaffold protein accepting
                     sulfur and iron to build a transient Fe-S cluster,which is
                     subsequently transferred to a target apoprotein."
                     /db_xref="Araport:AT3G01020"
                     /db_xref="TAIR:AT3G01020"
     mRNA            join(5104..5427,5536..5590,5746..6149)
                     /gene="ISU2"
                     /locus_tag="AT3G01020"
                     /gene_synonym="ATISU2"
                     /gene_synonym="ISCU-like 2"
                     /gene_synonym="ISCU-LIKE 2"
                     /gene_synonym="T4P13.30"
                     /gene_synonym="T4P13_30"
                     /product="ISCU-like 2"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES058342.1,INSD:ES007958.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AJ866968.1,INSD:DQ056583.1"
                     /db_xref="TAIR:AT3G01020"
                     /db_xref="Araport:AT3G01020"
     CDS             join(5139..5427,5536..5590,5746..5893)
                     /gene="ISU2"
                     /locus_tag="AT3G01020"
                     /gene_synonym="ATISU2"
                     /gene_synonym="ISCU-like 2"
                     /gene_synonym="ISCU-LIKE 2"
                     /gene_synonym="T4P13.30"
                     /gene_synonym="T4P13_30"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES058342.1,INSD:ES007958.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AJ866968.1,INSD:DQ056583.1"
                     /note="ISCU-like 2 (ISU2); CONTAINS InterPro DOMAIN/s: NIF
                     system FeS cluster assembly, NifU, N-terminal
                     (InterPro:IPR002871), ISC system FeS cluster assembly,
                     IscU scaffold (InterPro:IPR011339); BEST Arabidopsis
                     thaliana protein match is: SufE/NifU family protein
                     (TAIR:AT4G22220.1); Has 5480 Blast hits to 5480 proteins
                     in 1991 species: Archae - 108; Bacteria - 3649; Metazoa -
                     148; Fungi - 153; Plants - 89; Viruses - 0; Other
                     Eukaryotes - 1333 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ISCU-like 2"
                     /protein_id="AEE73596.1"
                     /db_xref="TAIR:AT3G01020"
                     /db_xref="Araport:AT3G01020"
                     /translation="MMMLRQTSRKAYLGLQASPLGLGRRLYHENVIDHFENPRNVGSF
                     NRNDPNVGTGLVGAPACGDLMSLQIKVDDSGQIIDTRFKTFGCGSAIASSSVASEWIK
                     GKTLDEVMTIKNAEIAKHLRLPPVKLHCSMLAEDAIKSAVRDYKEKQAKTNAAAAEET
                     VKA"
     gene            6657..7772
                     /locus_tag="AT3G01030"
                     /gene_synonym="T4P13.29"
                     /gene_synonym="T4P13_29"
                     /db_xref="Araport:AT3G01030"
                     /db_xref="TAIR:AT3G01030"
     mRNA            6657..7772
                     /locus_tag="AT3G01030"
                     /gene_synonym="T4P13.29"
                     /gene_synonym="T4P13_29"
                     /product="C2H2 and C2HC zinc fingers superfamily protein"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY568663.1,INSD:AJ630491.1"
                     /db_xref="TAIR:AT3G01030"
                     /db_xref="Araport:AT3G01030"
     CDS             6657..7772
                     /locus_tag="AT3G01030"
                     /gene_synonym="T4P13.29"
                     /gene_synonym="T4P13_29"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY568663.1,INSD:AJ630491.1"
                     /note="C2H2 and C2HC zinc fingers superfamily protein;
                     FUNCTIONS IN: sequence-specific DNA binding transcription
                     factor activity, zinc ion binding, nucleic acid binding;
                     LOCATED IN: intracellular; CONTAINS InterPro DOMAIN/s:
                     Zinc finger, C2H2-like (InterPro:IPR015880), Zinc finger,
                     C2H2-type (InterPro:IPR007087); BEST Arabidopsis thaliana
                     protein match is: C2H2-type zinc finger family protein
                     (TAIR:AT5G15480.1); Has 99 Blast hits to 95 proteins in 17
                     species: Archae - 0; Bacteria - 0; Metazoa - 2; Fungi - 0;
                     Plants - 97; Viruses - 0; Other Eukaryotes - 0 (source:
                     NCBI BLink)."
                     /codon_start=1
                     /product="C2H2 and C2HC zinc fingers superfamily protein"
                     /protein_id="AEE73597.1"
                     /db_xref="TAIR:AT3G01030"
                     /db_xref="Araport:AT3G01030"
                     /translation="MEEQQEFEKPIFEFRPKKLRTSRVSRNLMKKTGFRESMNHYEEL
                     SCNYGLRENPKKTQKSLLDHRFCTRRRRNKKILIRCKECGKGFLYEKCLFNHLQVTHS
                     EESTRRSLFCRFSIVQRRKRSKRVSRYKKILPRFSVSSSSCTMFPVSVDDGGLLEVAE
                     SLILLSMSGGKFVNGLEHFGKALGSTQRKFEDGLLRNEQRLVGEALDSNPEVNLRKDG
                     DFEYGLLSNEQKKLVGISRASVGTSKELSGYLANKKGREDDELGQQKQAGARILREET
                     DNEQKLVRQETAFEDSVSGFEMNIEHRCGLCHKVFSTYQTLGGHQTFHRMRNKSKSQT
                     KRCREESIEAEAGINNGSVTLTISAEFAEGCLGQYML"
     gene            8723..12697
                     /gene="GAUT13"
                     /locus_tag="AT3G01040"
                     /gene_synonym="galacturonosyltransferase 13"
                     /gene_synonym="T4P13.28"
                     /gene_synonym="T4P13_28"
                     /note="Encodes a protein with putative
                     galacturonosyltransferase activity."
                     /db_xref="Araport:AT3G01040"
                     /db_xref="TAIR:AT3G01040"
     mRNA            join(8723..8802,8929..9602,10106..10161,10268..10423,
                     10507..11097,11302..11604,11698..12472)
                     /gene="GAUT13"
                     /locus_tag="AT3G01040"
                     /gene_synonym="galacturonosyltransferase 13"
                     /gene_synonym="T4P13.28"
                     /gene_synonym="T4P13_28"
                     /product="galacturonosyltransferase 13"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV528874.1,INSD:EG491455.1,INSD:EH872269.1,
                     INSD:BP791588.1,INSD:AV803559.1,INSD:AV828951.1,
                     INSD:BP786559.1,INSD:EG492276.1,INSD:EG491454.1,
                     INSD:T76284.1,INSD:EG515479.1,INSD:EG492275.1,
                     INSD:AV523239.1,INSD:AV561982.1,INSD:EG519397.1,
                     INSD:EG519195.1,INSD:CD533901.1,INSD:ES211416.1,
                     INSD:EG519408.1,INSD:EL167483.1,INSD:BP631931.1,
                     INSD:EG515478.1,INSD:AV810149.1,INSD:BP788612.1,
                     INSD:BP794822.1"
                     /db_xref="TAIR:AT3G01040"
                     /db_xref="Araport:AT3G01040"
     mRNA            join(8894..9602,10106..10161,10268..10423,10507..11097,
                     11302..11604,11698..12697)
                     /gene="GAUT13"
                     /locus_tag="AT3G01040"
                     /gene_synonym="galacturonosyltransferase 13"
                     /gene_synonym="T4P13.28"
                     /gene_synonym="T4P13_28"
                     /product="galacturonosyltransferase 13"
                     /db_xref="Araport:AT3G01040"
                     /db_xref="TAIR:AT3G01040"
     mRNA            join(8939..9602,10106..10161,10268..10423,10507..10828,
                     10928..11097,11302..11604,11698..12448)
                     /gene="GAUT13"
                     /locus_tag="AT3G01040"
                     /gene_synonym="galacturonosyltransferase 13"
                     /gene_synonym="T4P13.28"
                     /gene_synonym="T4P13_28"
                     /product="galacturonosyltransferase 13"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV528874.1,INSD:EG491455.1,INSD:EH872269.1,
                     INSD:BP791588.1,INSD:AV803559.1,INSD:BE524306.1,
                     INSD:AV828951.1,INSD:BP786559.1,INSD:EG519194.1,
                     INSD:EG492276.1,INSD:EG491454.1,INSD:T76284.1,
                     INSD:EG515479.1,INSD:EG492275.1,INSD:AV561982.1,
                     INSD:AV523239.1,INSD:EG519195.1,INSD:CD533901.1,
                     INSD:ES211416.1,INSD:EG519408.1,INSD:EL167483.1,
                     INSD:BP631931.1,INSD:EG515478.1,INSD:AV810149.1,
                     INSD:BP788612.1,INSD:BP794822.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT030321.1,INSD:AK226967.1"
                     /db_xref="TAIR:AT3G01040"
                     /db_xref="Araport:AT3G01040"
     CDS             join(9392..9602,10106..10161,10268..10423,10507..11097,
                     11302..11604,11698..11979)
                     /gene="GAUT13"
                     /locus_tag="AT3G01040"
                     /gene_synonym="galacturonosyltransferase 13"
                     /gene_synonym="T4P13.28"
                     /gene_synonym="T4P13_28"
                     /codon_start=1
                     /product="galacturonosyltransferase 13"
                     /protein_id="ANM63701.1"
                     /db_xref="Araport:AT3G01040"
                     /db_xref="TAIR:AT3G01040"
                     /translation="MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILI
                     LAFLLPFVFILTAVVTLEGVNKCSSFDCFGRRLGPRLLGRIDDSERLVRDFYKILNEV
                     STQEIPDGLKLPESFSQLVSDMKNNHYDAKTFALVFRAMVEKFERDLRESKFAELMNK
                     HFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPELLPVLSDNAYHHFVLATDNILA
                     ASVVVSSAVQSSSKPEKIVFHVITDKKTYAGMHSWFALNSVAPAIVEVKSVHQFDWLT
                     RENVPVLEAVESHNSIRNYYHGNHIAGANLSETTPRTFASKLQSRSPKYISLLNHLRI
                     YLPELFPNLDKVVFLDDDIVIQKDLSPLWDIDLNGKVNGAVETCRGEDVWVMSKRLRN
                     YFNFSHPLIAKHLDPEECAWAYGMNIFDLRTWRKTNIRETYHSWLKENLKSNLTMWKL
                     GTLPPALIAFKGHVQPIDSSWHMLGLGYQSKTNLENAKKAAVIHYNGQSKPWLEIGFE
                     HLRPFWTKYVNYSNDFIKNCHILE"
     CDS             join(9392..9602,10106..10161,10268..10423,10507..11097,
                     11302..11604,11698..11979)
                     /gene="GAUT13"
                     /locus_tag="AT3G01040"
                     /gene_synonym="galacturonosyltransferase 13"
                     /gene_synonym="T4P13.28"
                     /gene_synonym="T4P13_28"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV528874.1,INSD:EG491455.1,INSD:EH872269.1,
                     INSD:BP791588.1,INSD:AV803559.1,INSD:AV828951.1,
                     INSD:BP786559.1,INSD:EG492276.1,INSD:EG491454.1,
                     INSD:T76284.1,INSD:EG515479.1,INSD:EG492275.1,
                     INSD:AV523239.1,INSD:AV561982.1,INSD:EG519397.1,
                     INSD:EG519195.1,INSD:CD533901.1,INSD:ES211416.1,
                     INSD:EG519408.1,INSD:EL167483.1,INSD:BP631931.1,
                     INSD:EG515478.1,INSD:AV810149.1,INSD:BP788612.1,
                     INSD:BP794822.1"
                     /note="galacturonosyltransferase 13 (GAUT13); CONTAINS
                     InterPro DOMAIN/s: Glycosyl transferase, family 8
                     (InterPro:IPR002495); BEST Arabidopsis thaliana protein
                     match is: galacturonosyltransferase 14 (TAIR:AT5G15470.1);
                     Has 30201 Blast hits to 17322 proteins in 780 species:
                     Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi -
                     3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="galacturonosyltransferase 13"
                     /protein_id="AEE73599.1"
                     /db_xref="TAIR:AT3G01040"
                     /db_xref="Araport:AT3G01040"
                     /translation="MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILI
                     LAFLLPFVFILTAVVTLEGVNKCSSFDCFGRRLGPRLLGRIDDSERLVRDFYKILNEV
                     STQEIPDGLKLPESFSQLVSDMKNNHYDAKTFALVFRAMVEKFERDLRESKFAELMNK
                     HFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPELLPVLSDNAYHHFVLATDNILA
                     ASVVVSSAVQSSSKPEKIVFHVITDKKTYAGMHSWFALNSVAPAIVEVKSVHQFDWLT
                     RENVPVLEAVESHNSIRNYYHGNHIAGANLSETTPRTFASKLQSRSPKYISLLNHLRI
                     YLPELFPNLDKVVFLDDDIVIQKDLSPLWDIDLNGKVNGAVETCRGEDVWVMSKRLRN
                     YFNFSHPLIAKHLDPEECAWAYGMNIFDLRTWRKTNIRETYHSWLKENLKSNLTMWKL
                     GTLPPALIAFKGHVQPIDSSWHMLGLGYQSKTNLENAKKAAVIHYNGQSKPWLEIGFE
                     HLRPFWTKYVNYSNDFIKNCHILE"
     CDS             join(9392..9602,10106..10161,10268..10423,10507..10828,
                     10928..11097,11302..11604,11698..11979)
                     /gene="GAUT13"
                     /locus_tag="AT3G01040"
                     /gene_synonym="galacturonosyltransferase 13"
                     /gene_synonym="T4P13.28"
                     /gene_synonym="T4P13_28"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV528874.1,INSD:EG491455.1,INSD:EH872269.1,
                     INSD:BP791588.1,INSD:AV803559.1,INSD:BE524306.1,
                     INSD:AV828951.1,INSD:BP786559.1,INSD:EG519194.1,
                     INSD:EG492276.1,INSD:EG491454.1,INSD:T76284.1,
                     INSD:EG515479.1,INSD:EG492275.1,INSD:AV561982.1,
                     INSD:AV523239.1,INSD:EG519195.1,INSD:CD533901.1,
                     INSD:ES211416.1,INSD:EG519408.1,INSD:EL167483.1,
                     INSD:BP631931.1,INSD:EG515478.1,INSD:AV810149.1,
                     INSD:BP788612.1,INSD:BP794822.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT030321.1,INSD:AK226967.1"
                     /note="galacturonosyltransferase 13 (GAUT13); CONTAINS
                     InterPro DOMAIN/s: Glycosyl transferase, family 8
                     (InterPro:IPR002495); BEST Arabidopsis thaliana protein
                     match is: galacturonosyltransferase 14 (TAIR:AT5G15470.1);
                     Has 1671 Blast hits to 1663 proteins in 335 species:
                     Archae - 0; Bacteria - 670; Metazoa - 145; Fungi - 4;
                     Plants - 816; Viruses - 2; Other Eukaryotes - 34 (source:
                     NCBI BLink)."
                     /codon_start=1
                     /product="galacturonosyltransferase 13"
                     /protein_id="AEE73598.2"
                     /db_xref="TAIR:AT3G01040"
                     /db_xref="Araport:AT3G01040"
                     /translation="MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILI
                     LAFLLPFVFILTAVVTLEGVNKCSSFDCFGRRLGPRLLGRIDDSERLVRDFYKILNEV
                     STQEIPDGLKLPESFSQLVSDMKNNHYDAKTFALVFRAMVEKFERDLRESKFAELMNK
                     HFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPELLPVLSDNAYHHFVLATDNILA
                     ASVVVSSAVQSSSKPEKIVFHVITDKKTYAVLEAVESHNSIRNYYHGNHIAGANLSET
                     TPRTFASKLQSRSPKYISLLNHLRIYLPELFPNLDKVVFLDDDIVIQKDLSPLWDIDL
                     NGKVNGAVETCRGEDVWVMSKRLRNYFNFSHPLIAKHLDPEECAWAYGMNIFDLRTWR
                     KTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVQPIDSSWHMLGLGYQSKTN
                     LENAKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHILE"
     gene            13046..15906
                     /gene="MUB1"
                     /locus_tag="AT3G01050"
                     /gene_synonym="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /gene_synonym="T4P13.27"
                     /gene_synonym="T4P13_27"
                     /db_xref="Araport:AT3G01050"
                     /db_xref="TAIR:AT3G01050"
     mRNA            join(13046..13325,13725..13986,14325..14489,14620..14927)
                     /gene="MUB1"
                     /locus_tag="AT3G01050"
                     /gene_synonym="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /gene_synonym="T4P13.27"
                     /gene_synonym="T4P13_27"
                     /product="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /db_xref="Araport:AT3G01050"
                     /db_xref="TAIR:AT3G01050"
     mRNA            join(13139..13325,13725..13986,14325..14489,14620..14880,
                     15244..15474)
                     /gene="MUB1"
                     /locus_tag="AT3G01050"
                     /gene_synonym="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /gene_synonym="T4P13.27"
                     /gene_synonym="T4P13_27"
                     /product="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR199568.1,INSD:EL215725.1,INSD:DR199583.1,
                     INSD:EH961713.1,INSD:DR199584.1,INSD:DR199571.1,
                     INSD:DR199581.1,INSD:Z33827.1,INSD:DR199573.1,
                     INSD:DR199574.1,INSD:DR199566.1,INSD:Z34085.1,
                     INSD:EL142026.1,INSD:DR199567.1,INSD:DR199569.1,
                     INSD:EL171349.1,INSD:DR199580.1,INSD:DR199578.1,
                     INSD:EL062393.1,INSD:EL184050.1,INSD:DR199579.1,
                     INSD:DR199582.1,INSD:DR199576.1,INSD:DR199577.1,
                     INSD:BE529202.1,INSD:DR199572.1,INSD:EG527948.1,
                     INSD:DR374539.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT012419.1,INSD:BT010661.1"
                     /db_xref="TAIR:AT3G01050"
                     /db_xref="Araport:AT3G01050"
     mRNA            join(13230..13325,13725..13986,14325..14489,14620..14671,
                     15244..15906)
                     /gene="MUB1"
                     /locus_tag="AT3G01050"
                     /gene_synonym="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /gene_synonym="T4P13.27"
                     /gene_synonym="T4P13_27"
                     /product="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /db_xref="Araport:AT3G01050"
                     /db_xref="TAIR:AT3G01050"
     mRNA            join(13459..13986,14325..14489,14620..14880,15244..15474)
                     /gene="MUB1"
                     /locus_tag="AT3G01050"
                     /gene_synonym="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /gene_synonym="T4P13.27"
                     /gene_synonym="T4P13_27"
                     /product="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /db_xref="Araport:AT3G01050"
                     /db_xref="TAIR:AT3G01050"
     mRNA            join(13495..13986,14325..14489,14620..14870)
                     /gene="MUB1"
                     /locus_tag="AT3G01050"
                     /gene_synonym="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /gene_synonym="T4P13.27"
                     /gene_synonym="T4P13_27"
                     /product="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /db_xref="Araport:AT3G01050"
                     /db_xref="TAIR:AT3G01050"
     CDS             join(13854..13986,14325..14489,14620..14671,15244..15247)
                     /gene="MUB1"
                     /locus_tag="AT3G01050"
                     /gene_synonym="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /gene_synonym="T4P13.27"
                     /gene_synonym="T4P13_27"
                     /codon_start=1
                     /product="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /protein_id="ANM65145.1"
                     /db_xref="Araport:AT3G01050"
                     /db_xref="TAIR:AT3G01050"
                     /translation="MAEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPR
                     EKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKEKK
                     PKGDPKMNKCVCSVM"
     CDS             join(13854..13986,14325..14489,14620..14675)
                     /gene="MUB1"
                     /locus_tag="AT3G01050"
                     /gene_synonym="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /gene_synonym="T4P13.27"
                     /gene_synonym="T4P13_27"
                     /codon_start=1
                     /product="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /protein_id="ANM65143.1"
                     /db_xref="Araport:AT3G01050"
                     /db_xref="TAIR:AT3G01050"
                     /translation="MAEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPR
                     EKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKEKK
                     PKGDPKMNKCVCSVM"
     CDS             join(13854..13986,14325..14489,14620..14675)
                     /gene="MUB1"
                     /locus_tag="AT3G01050"
                     /gene_synonym="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /gene_synonym="T4P13.27"
                     /gene_synonym="T4P13_27"
                     /codon_start=1
                     /product="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /protein_id="ANM65144.1"
                     /db_xref="Araport:AT3G01050"
                     /db_xref="TAIR:AT3G01050"
                     /translation="MAEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPR
                     EKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKEKK
                     PKGDPKMNKCVCSVM"
     CDS             join(13854..13986,14325..14489,14620..14675)
                     /gene="MUB1"
                     /locus_tag="AT3G01050"
                     /gene_synonym="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /gene_synonym="T4P13.27"
                     /gene_synonym="T4P13_27"
                     /codon_start=1
                     /product="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /protein_id="ANM65146.1"
                     /db_xref="Araport:AT3G01050"
                     /db_xref="TAIR:AT3G01050"
                     /translation="MAEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPR
                     EKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKEKK
                     PKGDPKMNKCVCSVM"
     CDS             join(13854..13986,14325..14489,14620..14675)
                     /gene="MUB1"
                     /locus_tag="AT3G01050"
                     /gene_synonym="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /gene_synonym="T4P13.27"
                     /gene_synonym="T4P13_27"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR199568.1,INSD:EL215725.1,INSD:DR199583.1,
                     INSD:EH961713.1,INSD:DR199584.1,INSD:DR199571.1,
                     INSD:DR199581.1,INSD:Z33827.1,INSD:DR199573.1,
                     INSD:DR199574.1,INSD:DR199566.1,INSD:Z34085.1,
                     INSD:EL142026.1,INSD:DR199567.1,INSD:DR199569.1,
                     INSD:EL171349.1,INSD:DR199580.1,INSD:DR199578.1,
                     INSD:EL062393.1,INSD:EL184050.1,INSD:DR199579.1,
                     INSD:DR199582.1,INSD:DR199576.1,INSD:DR199577.1,
                     INSD:BE529202.1,INSD:DR199572.1,INSD:EG527948.1,
                     INSD:DR374539.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT012419.1,INSD:BT010661.1"
                     /note="membrane-anchored ubiquitin-fold protein 1
                     precursor (MUB1); CONTAINS InterPro DOMAIN/s:
                     Membrane-anchored ubiquitin-fold protein, HCG-1
                     (InterPro:IPR017000), Ubiquitin supergroup
                     (InterPro:IPR019955); BEST Arabidopsis thaliana protein
                     match is: membrane-anchored ubiquitin-fold protein 2
                     (TAIR:AT5G15460.2); Has 161 Blast hits to 161 proteins in
                     21 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
                     4; Plants - 157; Viruses - 0; Other Eukaryotes - 0
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="membrane-anchored ubiquitin-fold protein 1
                     precursor"
                     /protein_id="AEE73600.1"
                     /db_xref="TAIR:AT3G01050"
                     /db_xref="Araport:AT3G01050"
                     /translation="MAEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPR
                     EKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKEKK
                     PKGDPKMNKCVCSVM"
     gene            15934..16320
                     /locus_tag="AT3G00970"
                     /db_xref="Araport:AT3G00970"
     ncRNA           join(15934..16036,16173..16320)
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT3G00970"
                     /product="other RNA"
                     /db_xref="Araport:AT3G00970"
     gene            complement(16631..18909)
                     /locus_tag="AT3G01060"
                     /gene_synonym="T4P13.26"
                     /gene_synonym="T4P13_26"
                     /db_xref="Araport:AT3G01060"
                     /db_xref="TAIR:AT3G01060"
     mRNA            complement(join(16631..17133,17209..17351,17430..17648,
                     17723..17981,18208..18357,18489..18909))
                     /locus_tag="AT3G01060"
                     /gene_synonym="T4P13.26"
                     /gene_synonym="T4P13_26"
                     /product="lysine-tRNA ligase"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BX839595.1,INSD:EL295007.1,INSD:EH862692.1,
                     INSD:AV803217.1,INSD:EH843295.1,INSD:DR230743.1,
                     INSD:AV792113.1,INSD:DR230741.1,INSD:EL056405.1,
                     INSD:BP792404.1,INSD:EL170257.1,INSD:BU636151.1,
                     INSD:Z18122.1,INSD:AV533309.1,INSD:EL201918.1,
                     INSD:EH933023.1,INSD:AV549754.1,INSD:Z18113.1,
                     INSD:BP593682.1,INSD:ES013488.1,INSD:EL301381.1,
                     INSD:AV782030.1,INSD:EL196536.1,INSD:ES109391.1,
                     INSD:DR368870.1,INSD:DR230742.1,INSD:AY063009.1,
                     INSD:DR230739.1,INSD:BU635129.1,INSD:AV793092.1,
                     INSD:AV802072.1,INSD:EH913979.1,INSD:EL109937.1,
                     INSD:EL298096.1,INSD:EH897373.1,INSD:DR230738.1,
                     INSD:EL301844.1,INSD:ES207071.1,INSD:Z18112.1,
                     INSD:BU635764.1,INSD:AV537735.1,INSD:AV818639.1,
                     INSD:BP784881.1,INSD:BP561508.2,INSD:BP636100.1,
                     INSD:CA781607.1,INSD:DR375981.1,INSD:DR230740.1,
                     INSD:BX835744.1,INSD:BP635861.1,INSD:DR230744.1,
                     INSD:ES073840.1,INSD:AV821537.1,INSD:EL107308.1,
                     INSD:BP782617.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AF370276.1,INSD:BX823456.1,INSD:AY093064.1,
                     INSD:AY087657.1,INSD:BX823687.1,INSD:BX822611.1,
                     INSD:BX822421.1"
                     /db_xref="TAIR:AT3G01060"
                     /db_xref="Araport:AT3G01060"
     mRNA            complement(join(16643..17108,17209..17351,17430..17648,
                     17723..17981,18208..18357,18489..18840))
                     /locus_tag="AT3G01060"
                     /gene_synonym="T4P13.26"
                     /gene_synonym="T4P13_26"
                     /product="lysine-tRNA ligase"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH862692.1,INSD:EL295007.1,INSD:AV793092.1,
                     INSD:AV803217.1,INSD:EH843295.1,INSD:AV802072.1,
                     INSD:DR230743.1,INSD:EH913979.1,INSD:AV792113.1,
                     INSD:EL109937.1,INSD:DR230741.1,INSD:EL056405.1,
                     INSD:EL298096.1,INSD:BP792404.1,INSD:EL170257.1,
                     INSD:EH897373.1,INSD:Z18122.1,INSD:DR230738.1,
                     INSD:EL201918.1,INSD:EL301844.1,INSD:EH933023.1,
                     INSD:ES207071.1,INSD:AV537735.1,INSD:AV818639.1,
                     INSD:AV549754.1,INSD:BP784881.1,INSD:BP561508.2,
                     INSD:BP593682.1,INSD:ES013488.1,INSD:EL301381.1,
                     INSD:AV782030.1,INSD:BP636100.1,INSD:EL196536.1,
                     INSD:DR375981.1,INSD:DR230740.1,INSD:BP635861.1,
                     INSD:ES109391.1,INSD:DR368870.1,INSD:DR230742.1,
                     INSD:DR230744.1,INSD:ES073840.1,INSD:AV821537.1,
                     INSD:DR230739.1,INSD:EL107308.1,INSD:BP782617.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:BX823933.1"
                     /db_xref="TAIR:AT3G01060"
                     /db_xref="Araport:AT3G01060"
     mRNA            complement(join(16643..17133,17209..17351,17430..17624,
                     17723..17981,18208..18357,18489..18813))
                     /locus_tag="AT3G01060"
                     /gene_synonym="T4P13.26"
                     /gene_synonym="T4P13_26"
                     /product="lysine-tRNA ligase"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BX839595.1,INSD:BU635129.1,INSD:EH862692.1,
                     INSD:EL295007.1,INSD:AV803217.1,INSD:AV793092.1,
                     INSD:EH843295.1,INSD:AV802072.1,INSD:DR230743.1,
                     INSD:EH913979.1,INSD:EL109937.1,INSD:DR230741.1,
                     INSD:EL056405.1,INSD:EL298096.1,INSD:BP792404.1,
                     INSD:EL170257.1,INSD:BU636151.1,INSD:EH897373.1,
                     INSD:AV533309.1,INSD:DR230738.1,INSD:EL201918.1,
                     INSD:EL301844.1,INSD:EH933023.1,INSD:ES207071.1,
                     INSD:BU635764.1,INSD:Z18112.1,INSD:AV818639.1,
                     INSD:AV549754.1,INSD:BP784881.1,INSD:BP561508.2,
                     INSD:Z18113.1,INSD:ES013488.1,INSD:EL301381.1,
                     INSD:EL196536.1,INSD:DR230740.1,INSD:ES109391.1,
                     INSD:DR230742.1,INSD:DR230744.1,INSD:ES073840.1,
                     INSD:AV821537.1,INSD:DR230739.1,INSD:EL107308.1,
                     INSD:BP782617.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:BX823898.1"
                     /db_xref="TAIR:AT3G01060"
                     /db_xref="Araport:AT3G01060"
     CDS             complement(join(16831..17133,17209..17351,17430..17624,
                     17723..17981,18208..18357,18489..18782))
                     /locus_tag="AT3G01060"
                     /gene_synonym="T4P13.26"
                     /gene_synonym="T4P13_26"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH862692.1,INSD:EL295007.1,INSD:AV793092.1,
                     INSD:AV803217.1,INSD:EH843295.1,INSD:AV802072.1,
                     INSD:DR230743.1,INSD:EH913979.1,INSD:AV792113.1,
                     INSD:EL109937.1,INSD:DR230741.1,INSD:EL056405.1,
                     INSD:EL298096.1,INSD:BP792404.1,INSD:EL170257.1,
                     INSD:EH897373.1,INSD:Z18122.1,INSD:DR230738.1,
                     INSD:EL201918.1,INSD:EL301844.1,INSD:EH933023.1,
                     INSD:ES207071.1,INSD:AV537735.1,INSD:AV818639.1,
                     INSD:AV549754.1,INSD:BP784881.1,INSD:BP561508.2,
                     INSD:BP593682.1,INSD:ES013488.1,INSD:EL301381.1,
                     INSD:AV782030.1,INSD:BP636100.1,INSD:EL196536.1,
                     INSD:DR375981.1,INSD:DR230740.1,INSD:BP635861.1,
                     INSD:ES109391.1,INSD:DR368870.1,INSD:DR230742.1,
                     INSD:DR230744.1,INSD:ES073840.1,INSD:AV821537.1,
                     INSD:DR230739.1,INSD:EL107308.1,INSD:BP782617.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:BX823933.1"
                     /note="unknown protein; Has 637 Blast hits to 635 proteins
                     in 201 species: Archae - 0; Bacteria - 291; Metazoa - 0;
                     Fungi - 72; Plants - 72; Viruses - 0; Other Eukaryotes -
                     202 (source: NCBI BLink)."
                     /codon_start=1
                     /product="lysine-tRNA ligase"
                     /protein_id="AEE73601.1"
                     /db_xref="TAIR:AT3G01060"
                     /db_xref="Araport:AT3G01060"
                     /translation="MAAAAMAVHLPKHSSFLPKPKLPLDKKTNFLGGSFNLGRPMSVN
                     REFNSPVMVSASSTSKTVLTDDVDGDQSKRFYINFTGFPFPLGPFLNRRTIRTEAVKG
                     CIWMFEQEQALGFSSVSTNIRMTVIKLKSGGLWVHAPIAPTKECVQLIKELGAPVEYI
                     VLPTFAYEHKIFVGPFSRKFPKAQVWVAPRQWSWPLNLPLEFFGIFRAKIIKDRDLST
                     PWAEEIEQKVLSSPEVAFYHKRSRTLLVTDAVIFVPRKPPSSISNESLLASAKNGLAV
                     KILSKGKDIPNDPVVDNPNTRQKGWERMVLQILFLGPSNLLEPNASFARMSQKLIVSP
                     IVKTLVFSKVPEKVRDWIDEIARDWRFKRIIPAHFEAPINAGRSDFLAAFGFLEDLLG
                     ERYVTRPSLSLLFTSLMGKAASYFPPDDMRTLSSLDQFLVSVGAVKKTVSGRKRR"
     CDS             complement(join(16831..17133,17209..17351,17430..17648,
                     17723..17981,18208..18357,18489..18782))
                     /locus_tag="AT3G01060"
                     /gene_synonym="T4P13.26"
                     /gene_synonym="T4P13_26"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BX839595.1,INSD:EL295007.1,INSD:EH862692.1,
                     INSD:AV803217.1,INSD:EH843295.1,INSD:DR230743.1,
                     INSD:AV792113.1,INSD:DR230741.1,INSD:EL056405.1,
                     INSD:BP792404.1,INSD:EL170257.1,INSD:BU636151.1,
                     INSD:Z18122.1,INSD:AV533309.1,INSD:EL201918.1,
                     INSD:EH933023.1,INSD:AV549754.1,INSD:Z18113.1,
                     INSD:BP593682.1,INSD:ES013488.1,INSD:EL301381.1,
                     INSD:AV782030.1,INSD:EL196536.1,INSD:ES109391.1,
                     INSD:DR368870.1,INSD:DR230742.1,INSD:AY063009.1,
                     INSD:DR230739.1,INSD:BU635129.1,INSD:AV793092.1,
                     INSD:AV802072.1,INSD:EH913979.1,INSD:EL109937.1,
                     INSD:EL298096.1,INSD:EH897373.1,INSD:DR230738.1,
                     INSD:EL301844.1,INSD:ES207071.1,INSD:Z18112.1,
                     INSD:BU635764.1,INSD:AV537735.1,INSD:AV818639.1,
                     INSD:BP784881.1,INSD:BP561508.2,INSD:BP636100.1,
                     INSD:CA781607.1,INSD:DR375981.1,INSD:DR230740.1,
                     INSD:BX835744.1,INSD:BP635861.1,INSD:DR230744.1,
                     INSD:ES073840.1,INSD:AV821537.1,INSD:EL107308.1,
                     INSD:BP782617.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AF370276.1,INSD:BX823456.1,INSD:AY093064.1,
                     INSD:AY087657.1,INSD:BX823687.1,INSD:BX822611.1,
                     INSD:BX822421.1"
                     /note="unknown protein; Has 640 Blast hits to 638 proteins
                     in 201 species: Archae - 0; Bacteria - 293; Metazoa - 0;
                     Fungi - 71; Plants - 72; Viruses - 0; Other Eukaryotes -
                     204 (source: NCBI BLink)."
                     /codon_start=1
                     /product="lysine-tRNA ligase"
                     /protein_id="AEE73603.1"
                     /db_xref="TAIR:AT3G01060"
                     /db_xref="Araport:AT3G01060"
                     /translation="MAAAAMAVHLPKHSSFLPKPKLPLDKKTNFLGGSFNLGRPMSVN
                     REFNSPVMVSASSTSKTVLTDDVDGDQSKRFYINFTGFPFPLGPFLNRRTIRTEAVKG
                     CIWMFEQEQALGFSSVSTNIRMTVIKLKSGGLWVHAPIAPTKECVQLIKELGAPVEYI
                     VLPTFAYEHKIFVGPFSRKFPKAQVWVAPRQWSWPLNLPLEFFGIFRAKIIKDRDLST
                     PWAEEIEQKVLSSPEVGIGPYVEVAFYHKRSRTLLVTDAVIFVPRKPPSSISNESLLA
                     SAKNGLAVKILSKGKDIPNDPVVDNPNTRQKGWERMVLQILFLGPSNLLEPNASFARM
                     SQKLIVSPIVKTLVFSKVPEKVRDWIDEIARDWRFKRIIPAHFEAPINAGRSDFLAAF
                     GFLEDLLGERYVTRPSLSLLFTSLMGKAASYFPPDDMRTLSSLDQFLVSVGAVKKTVS
                     GRKRR"
     CDS             complement(join(17055..17108,17209..17351,17430..17648,
                     17723..17981,18208..18357,18489..18782))
                     /locus_tag="AT3G01060"
                     /gene_synonym="T4P13.26"
                     /gene_synonym="T4P13_26"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BX839595.1,INSD:BU635129.1,INSD:EH862692.1,
                     INSD:EL295007.1,INSD:AV803217.1,INSD:AV793092.1,
                     INSD:EH843295.1,INSD:AV802072.1,INSD:DR230743.1,
                     INSD:EH913979.1,INSD:EL109937.1,INSD:DR230741.1,
                     INSD:EL056405.1,INSD:EL298096.1,INSD:BP792404.1,
                     INSD:EL170257.1,INSD:BU636151.1,INSD:EH897373.1,
                     INSD:AV533309.1,INSD:DR230738.1,INSD:EL201918.1,
                     INSD:EL301844.1,INSD:EH933023.1,INSD:ES207071.1,
                     INSD:BU635764.1,INSD:Z18112.1,INSD:AV818639.1,
                     INSD:AV549754.1,INSD:BP784881.1,INSD:BP561508.2,
                     INSD:Z18113.1,INSD:ES013488.1,INSD:EL301381.1,
                     INSD:EL196536.1,INSD:DR230740.1,INSD:ES109391.1,
                     INSD:DR230742.1,INSD:DR230744.1,INSD:ES073840.1,
                     INSD:AV821537.1,INSD:DR230739.1,INSD:EL107308.1,
                     INSD:BP782617.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:BX823898.1"
                     /note="unknown protein; Has 35333 Blast hits to 34131
                     proteins in 2444 species: Archae - 798; Bacteria - 22429;
                     Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
                     Other Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="lysine-tRNA ligase"
                     /protein_id="AEE73602.1"
                     /db_xref="TAIR:AT3G01060"
                     /db_xref="Araport:AT3G01060"
                     /translation="MAAAAMAVHLPKHSSFLPKPKLPLDKKTNFLGGSFNLGRPMSVN
                     REFNSPVMVSASSTSKTVLTDDVDGDQSKRFYINFTGFPFPLGPFLNRRTIRTEAVKG
                     CIWMFEQEQALGFSSVSTNIRMTVIKLKSGGLWVHAPIAPTKECVQLIKELGAPVEYI
                     VLPTFAYEHKIFVGPFSRKFPKAQVWVAPRQWSWPLNLPLEFFGIFRAKIIKDRDLST
                     PWAEEIEQKVLSSPEVGIGPYVEVAFYHKRSRTLLVTDAVIFVPRKPPSSISNESLLA
                     SAKNGLAVKILSKGKDIPNDPVVDNPNTRQKGWERMVLQILFLGPSNLLEPNASFARM
                     SQKLIVSPIVKTLVFSKVPEKPVTGDLKGLSQLISKLQ"
     gene            19409..20806
                     /gene="ENODL16"
                     /locus_tag="AT3G01070"
                     /gene_synonym="AtENODL16"
                     /gene_synonym="early nodulin-like protein 16"
                     /gene_synonym="T4P13.25"
                     /gene_synonym="T4P13_25"
                     /db_xref="Araport:AT3G01070"
                     /db_xref="TAIR:AT3G01070"
     mRNA            join(19409..19827,20110..20806)
                     /gene="ENODL16"
                     /locus_tag="AT3G01070"
                     /gene_synonym="AtENODL16"
                     /gene_synonym="early nodulin-like protein 16"
                     /gene_synonym="T4P13.25"
                     /gene_synonym="T4P13_25"
                     /product="early nodulin-like protein 16"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES001181.1,INSD:DR314317.1,INSD:AI995441.1,
                     INSD:DR314318.1,INSD:BP827988.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK221055.1,INSD:AY088441.1,INSD:BT043476.1"
                     /db_xref="TAIR:AT3G01070"
                     /db_xref="Araport:AT3G01070"
     CDS             join(19659..19827,20110..20444)
                     /gene="ENODL16"
                     /locus_tag="AT3G01070"
                     /gene_synonym="AtENODL16"
                     /gene_synonym="early nodulin-like protein 16"
                     /gene_synonym="T4P13.25"
                     /gene_synonym="T4P13_25"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES001181.1,INSD:DR314317.1,INSD:AI995441.1,
                     INSD:DR314318.1,INSD:BP827988.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK221055.1,INSD:AY088441.1,INSD:BT043476.1"
                     /note="early nodulin-like protein 16 (ENODL16); FUNCTIONS
                     IN: electron carrier activity, copper ion binding; LOCATED
                     IN: anchored to membrane; EXPRESSED IN: 9 plant
                     structures; EXPRESSED DURING: 4 anthesis, C globular
                     stage, F mature embryo stage, petal differentiation and
                     expansion stage, D bilateral stage; CONTAINS InterPro
                     DOMAIN/s: Plastocyanin-like (InterPro:IPR003245),
                     Cupredoxin (InterPro:IPR008972); BEST Arabidopsis thaliana
                     protein match is: early nodulin-like protein 17
                     (TAIR:AT5G15350.1); Has 1364 Blast hits to 1323 proteins
                     in 59 species: Archae - 0; Bacteria - 0; Metazoa - 0;
                     Fungi - 0; Plants - 1364; Viruses - 0; Other Eukaryotes -
                     0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="early nodulin-like protein 16"
                     /protein_id="AEE73604.1"
                     /db_xref="TAIR:AT3G01070"
                     /db_xref="Araport:AT3G01070"
                     /translation="MARVAVLVAGAVLAFLLAATNVTAKRWTVGDNKFWNPNINYTIW
                     AQDKHFYLDDWLYFVYERNQYNVIEVNETNYISCNPNNPIANWSRGAGRDLVHLNVTR
                     HYYLISGNGGGCYGGMKLAVLVEKPPPPPAAAPNKNSARRTFSVSGFAYQFLIPVAVF
                     AAVGTRY"
     gene            25355..27712
                     /gene="WRKY58"
                     /locus_tag="AT3G01080"
                     /gene_synonym="ATWRKY58"
                     /gene_synonym="T4P13.24"
                     /gene_synonym="T4P13_24"
                     /gene_synonym="WRKY DNA-binding protein 58"
                     /gene_synonym="WRKY DNA-BINDING PROTEIN 58"
                     /note="member of WRKY Transcription Factor; Group I"
                     /db_xref="Araport:AT3G01080"
                     /db_xref="TAIR:AT3G01080"
     mRNA            join(25355..25890,26242..26801,26895..27041,27155..27712)
                     /gene="WRKY58"
                     /locus_tag="AT3G01080"
                     /gene_synonym="ATWRKY58"
                     /gene_synonym="T4P13.24"
                     /gene_synonym="T4P13_24"
                     /gene_synonym="WRKY DNA-binding protein 58"
                     /gene_synonym="WRKY DNA-BINDING PROTEIN 58"
                     /product="WRKY DNA-binding protein 58"
                     /db_xref="Araport:AT3G01080"
                     /db_xref="TAIR:AT3G01080"
     mRNA            join(25439..25890,26242..27041,27155..27641)
                     /gene="WRKY58"
                     /locus_tag="AT3G01080"
                     /gene_synonym="ATWRKY58"
                     /gene_synonym="T4P13.24"
                     /gene_synonym="T4P13_24"
                     /gene_synonym="WRKY DNA-binding protein 58"
                     /gene_synonym="WRKY DNA-BINDING PROTEIN 58"
                     /product="WRKY DNA-binding protein 58"
                     /db_xref="Araport:AT3G01080"
                     /db_xref="TAIR:AT3G01080"
     mRNA            join(25507..25742,25857..25890,26242..26801,26895..27041,
                     27155..27641)
                     /gene="WRKY58"
                     /locus_tag="AT3G01080"
                     /gene_synonym="ATWRKY58"
                     /gene_synonym="T4P13.24"
                     /gene_synonym="T4P13_24"
                     /gene_synonym="WRKY DNA-binding protein 58"
                     /gene_synonym="WRKY DNA-BINDING PROTEIN 58"
                     /product="WRKY DNA-binding protein 58"
                     /inference="Similar to RNA sequence, mRNA:INSD:AF426254.1"
                     /db_xref="TAIR:AT3G01080"
                     /db_xref="Araport:AT3G01080"
     CDS             join(25507..25890,26242..26801,26895..27041,27155..27449)
                     /gene="WRKY58"
                     /locus_tag="AT3G01080"
                     /gene_synonym="ATWRKY58"
                     /gene_synonym="T4P13.24"
                     /gene_synonym="T4P13_24"
                     /gene_synonym="WRKY DNA-binding protein 58"
                     /gene_synonym="WRKY DNA-BINDING PROTEIN 58"
                     /codon_start=1
                     /product="WRKY DNA-binding protein 58"
                     /protein_id="ANM63536.1"
                     /db_xref="Araport:AT3G01080"
                     /db_xref="TAIR:AT3G01080"
                     /translation="MAVEDDVSLIRTTTLVAPTRPTITVPHRPPAIETAAYFFGGGDG
                     LSLSPGPLSFVSSLFVDNFPDVLTPDNQRTTSFTQLLNGTMSVSPGGGGRSTAGMFAG
                     GGPMFTIPSGFSPSSLLTSPMFFPPQSSAHTGFIQPRQQSQPQPQRPDTFPHHMPPST
                     SVAVHGRQSLDVSQVDQRARNHYNNPGNNNNNRSYNVVNVDKPADDGYNWRKYGQKPI
                     KGCEYPRSYYKCTHVNCPVKKKVERSSDGQITQIIYKGQHDHERPQNRRGGGGRDSTE
                     VGGAGQMMESSDDSGYRKDHDDDDDDDEDDEDLPASKIRRIDGVSTTHRTVTEPKIIV
                     QTKSEVDLLDDGYRWRKYGQKVVKGNPHPRSYYKCTTPNCTVRKHVERASTDAKAVIT
                     TYEGKHNHDVPAARNGTAAATAAAVGPSDHHRMRSMSGNNMQQHMSFGNNNNTGQSPV
                     LLRLKEEKITI"
     CDS             join(25507..25742,25857..25890,26242..26801,26895..27041,
                     27155..27449)
                     /gene="WRKY58"
                     /locus_tag="AT3G01080"
                     /gene_synonym="ATWRKY58"
                     /gene_synonym="T4P13.24"
                     /gene_synonym="T4P13_24"
                     /gene_synonym="WRKY DNA-binding protein 58"
                     /gene_synonym="WRKY DNA-BINDING PROTEIN 58"
                     /inference="Similar to RNA sequence, mRNA:INSD:AF426254.1"
                     /note="WRKY DNA-binding protein 58 (WRKY58); CONTAINS
                     InterPro DOMAIN/s: DNA-binding WRKY (InterPro:IPR003657);
                     BEST Arabidopsis thaliana protein match is: WRKY
                     DNA-binding protein 3 (TAIR:AT2G03340.1); Has 5867 Blast
                     hits to 3142 proteins in 208 species: Archae - 0; Bacteria
                     - 0; Metazoa - 30; Fungi - 6; Plants - 5775; Viruses - 0;
                     Other Eukaryotes - 56 (source: NCBI BLink)."
                     /codon_start=1
                     /product="WRKY DNA-binding protein 58"
                     /protein_id="AEE73605.1"
                     /db_xref="TAIR:AT3G01080"
                     /db_xref="Araport:AT3G01080"
                     /translation="MAVEDDVSLIRTTTLVAPTRPTITVPHRPPAIETAAYFFGGGDG
                     LSLSPGPLSFVSSLFVDNFPDVLTPDNQRTTSFTHLLTSPMFFPPQSSAHTGFIQPRQ
                     QSQPQPQRPDTFPHHMPPSTSVAVHGRQSLDVSQVDQRARNHYNNPGNNNNNRSYNVV
                     NVDKPADDGYNWRKYGQKPIKGCEYPRSYYKCTHVNCPVKKKVERSSDGQITQIIYKG
                     QHDHERPQNRRGGGGRDSTEVGGAGQMMESSDDSGYRKDHDDDDDDDEDDEDLPASKI
                     RRIDGVSTTHRTVTEPKIIVQTKSEVDLLDDGYRWRKYGQKVVKGNPHPRSYYKCTTP
                     NCTVRKHVERASTDAKAVITTYEGKHNHDVPAARNGTAAATAAAVGPSDHHRMRSMSG
                     NNMQQHMSFGNNNNTGQSPVLLRLKEEKITI"
     CDS             join(25507..25890,26242..26835)
                     /gene="WRKY58"
                     /locus_tag="AT3G01080"
                     /gene_synonym="ATWRKY58"
                     /gene_synonym="T4P13.24"
                     /gene_synonym="T4P13_24"
                     /gene_synonym="WRKY DNA-binding protein 58"
                     /gene_synonym="WRKY DNA-BINDING PROTEIN 58"
                     /codon_start=1
                     /product="WRKY DNA-binding protein 58"
                     /protein_id="ANM63537.1"
                     /db_xref="Araport:AT3G01080"
                     /db_xref="TAIR:AT3G01080"
                     /translation="MAVEDDVSLIRTTTLVAPTRPTITVPHRPPAIETAAYFFGGGDG
                     LSLSPGPLSFVSSLFVDNFPDVLTPDNQRTTSFTQLLNGTMSVSPGGGGRSTAGMFAG
                     GGPMFTIPSGFSPSSLLTSPMFFPPQSSAHTGFIQPRQQSQPQPQRPDTFPHHMPPST
                     SVAVHGRQSLDVSQVDQRARNHYNNPGNNNNNRSYNVVNVDKPADDGYNWRKYGQKPI
                     KGCEYPRSYYKCTHVNCPVKKKVERSSDGQITQIIYKGQHDHERPQNRRGGGGRDSTE
                     VGGAGQMMESSDDSGYRKDHDDDDDDDEDDEDLPASKIRYSRSASDYHT"
     gene            27926..31114
                     /locus_tag="AT3G01085"
                     /db_xref="Araport:AT3G01085"
                     /db_xref="TAIR:AT3G01085"
     mRNA            join(27926..28419,28525..28809,28903..29220,29300..29530,
                     29625..29725,29801..29912,29999..30355,30431..30718)
                     /locus_tag="AT3G01085"
                     /product="Protein kinase superfamily protein"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX822850.1,INSD:BT043495.1"
                     /db_xref="TAIR:AT3G01085"
                     /db_xref="Araport:AT3G01085"
     mRNA            join(27936..28419,28525..28809,28903..29220,29300..29530,
                     29625..29725,29801..29912,29999..30355,30431..30707,
                     30812..31114)
                     /locus_tag="AT3G01085"
                     /product="Protein kinase superfamily protein"
                     /db_xref="Araport:AT3G01085"
                     /db_xref="TAIR:AT3G01085"
     mRNA            join(27936..28419,28525..28809,28903..29220,29300..29530,
                     29625..29725,29801..29912,29999..30355,30431..30551,
                     30812..31114)
                     /locus_tag="AT3G01085"
                     /product="Protein kinase superfamily protein"
                     /db_xref="Araport:AT3G01085"
                     /db_xref="TAIR:AT3G01085"
     CDS             join(28060..28419,28525..28809,28903..29220,29300..29530,
                     29625..29725,29801..29912,29999..30355,30431..30551,
                     30812..30822)
                     /locus_tag="AT3G01085"
                     /codon_start=1
                     /product="Protein kinase superfamily protein"
                     /protein_id="ANM63535.1"
                     /db_xref="Araport:AT3G01085"
                     /db_xref="TAIR:AT3G01085"
                     /translation="MGCFNSKHSSPAGPPRPVRRRLDTNVHRSHTQDPHNRHVLPGPP
                     SHRRVVNSSPKKHRNNDDDAPKSRTTGVSLRSGLPHSNVEAEQVAAGWPSWLSSAAPE
                     AVHGWVPLRAEDFEKREKIGQGTYSNVFRACEVSTGRVMALKKIRIQNFETENIRFIA
                     REIMILRRLDHPNIMKLEGIIASRNSNSMYFVFDYMEHDLEGLCSSPDIKFTEAQIKC
                     YMKQLLWGVEHCHLRGIMHRDIKAANILVNNKGVLKLADFGLANIVTPRNKNQLTSRV
                     VTLWYRAPELLMGSTSYSVSVDLWSVGCVFAEILTGRPLLKGRTEIEQLHKIYKLSGS
                     PDEEFWEKNKLHPQTKMFRPQHQYEGCLRERFDEFPKTAINLLENLLSIDPEKRGTAS
                     SALMSEYFNTQPYACDPSTLPKYPPNKEMDAKYREELQRRRRVSIKKRDNLATKKLGK
                     SRRATVKEPTNLNRLPTHQETKKEAETEIVVQTPSETSQATTRSEFPYNSLSQTTAPA
                     SGFAWAGTKKRKENDVASTLTYIQPGSASHVSGMSMAFAKNTFGLTINEDKPFLRPHV
                     SLDPSDVLLFSGVNHKKTEEDMDLTNLGANPKIFQTNGMNEILRRTESDVRVGVRRPP
                     RIERGED"
     CDS             join(28060..28419,28525..28809,28903..29220,29300..29530,
                     29625..29725,29801..29912,29999..30355,30431..30556)
                     /locus_tag="AT3G01085"
                     /codon_start=1
                     /product="Protein kinase superfamily protein"
                     /protein_id="ANM63534.1"
                     /db_xref="Araport:AT3G01085"
                     /db_xref="TAIR:AT3G01085"
                     /translation="MGCFNSKHSSPAGPPRPVRRRLDTNVHRSHTQDPHNRHVLPGPP
                     SHRRVVNSSPKKHRNNDDDAPKSRTTGVSLRSGLPHSNVEAEQVAAGWPSWLSSAAPE
                     AVHGWVPLRAEDFEKREKIGQGTYSNVFRACEVSTGRVMALKKIRIQNFETENIRFIA
                     REIMILRRLDHPNIMKLEGIIASRNSNSMYFVFDYMEHDLEGLCSSPDIKFTEAQIKC
                     YMKQLLWGVEHCHLRGIMHRDIKAANILVNNKGVLKLADFGLANIVTPRNKNQLTSRV
                     VTLWYRAPELLMGSTSYSVSVDLWSVGCVFAEILTGRPLLKGRTEIEQLHKIYKLSGS
                     PDEEFWEKNKLHPQTKMFRPQHQYEGCLRERFDEFPKTAINLLENLLSIDPEKRGTAS
                     SALMSEYFNTQPYACDPSTLPKYPPNKEMDAKYREELQRRRRVSIKKRDNLATKKLGK
                     SRRATVKEPTNLNRLPTHQETKKEAETEIVVQTPSETSQATTRSEFPYNSLSQTTAPA
                     SGFAWAGTKKRKENDVASTLTYIQPGSASHVSGMSMAFAKNTFGLTINEDKPFLRPHV
                     SLDPSDVLLFSGVNHKKTEEDMDLTNLGANPKIFQTNGMNEILRRTESDVRVGVRRPP
                     RIERG"
     CDS             join(28060..28419,28525..28809,28903..29220,29300..29530,
                     29625..29725,29801..29912,29999..30355,30431..30556)
                     /locus_tag="AT3G01085"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX822850.1,INSD:BT043495.1"
                     /note="Protein kinase superfamily protein; FUNCTIONS IN:
                     protein serine/threonine kinase activity, protein kinase
                     activity, kinase activity, ATP binding; INVOLVED IN:
                     protein amino acid phosphorylation, N-terminal protein
                     myristoylation; LOCATED IN: chloroplast; CONTAINS InterPro
                     DOMAIN/s: Protein kinase, ATP binding site
                     (InterPro:IPR017441), Protein kinase, catalytic domain
                     (InterPro:IPR000719), Serine/threonine-protein kinase
                     domain (InterPro:IPR002290), Serine/threonine-protein
                     kinase-like domain (InterPro:IPR017442), Protein
                     kinase-like domain (InterPro:IPR011009),
                     Serine/threonine-protein kinase, active site
                     (InterPro:IPR008271); BEST Arabidopsis thaliana protein
                     match is: CDC2C (TAIR:AT5G39420.1); Has 35333 Blast hits
                     to 34131 proteins in 2444 species: Archae - 798; Bacteria
                     - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses
                     - 0; Other Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Protein kinase superfamily protein"
                     /protein_id="AEE73606.1"
                     /db_xref="TAIR:AT3G01085"
                     /db_xref="Araport:AT3G01085"
                     /translation="MGCFNSKHSSPAGPPRPVRRRLDTNVHRSHTQDPHNRHVLPGPP
                     SHRRVVNSSPKKHRNNDDDAPKSRTTGVSLRSGLPHSNVEAEQVAAGWPSWLSSAAPE
                     AVHGWVPLRAEDFEKREKIGQGTYSNVFRACEVSTGRVMALKKIRIQNFETENIRFIA
                     REIMILRRLDHPNIMKLEGIIASRNSNSMYFVFDYMEHDLEGLCSSPDIKFTEAQIKC
                     YMKQLLWGVEHCHLRGIMHRDIKAANILVNNKGVLKLADFGLANIVTPRNKNQLTSRV
                     VTLWYRAPELLMGSTSYSVSVDLWSVGCVFAEILTGRPLLKGRTEIEQLHKIYKLSGS
                     PDEEFWEKNKLHPQTKMFRPQHQYEGCLRERFDEFPKTAINLLENLLSIDPEKRGTAS
                     SALMSEYFNTQPYACDPSTLPKYPPNKEMDAKYREELQRRRRVSIKKRDNLATKKLGK
                     SRRATVKEPTNLNRLPTHQETKKEAETEIVVQTPSETSQATTRSEFPYNSLSQTTAPA
                     SGFAWAGTKKRKENDVASTLTYIQPGSASHVSGMSMAFAKNTFGLTINEDKPFLRPHV
                     SLDPSDVLLFSGVNHKKTEEDMDLTNLGANPKIFQTNGMNEILRRTESDVRVGVRRPP
                     RIERG"
     gene            complement(31145..34670)
                     /gene="KIN10"
                     /locus_tag="AT3G01090"
                     /gene_synonym="AKIN10"
                     /gene_synonym="SNF1 kinase homolog 10"
                     /gene_synonym="SNF1-RELATED PROTEIN KINASE"
                     /gene_synonym="SNF1-RELATED PROTEIN KINASE 1.1"
                     /gene_synonym="SNRK1.1"
                     /gene_synonym="T4P13.22"
                     /gene_synonym="T4P13_22"
                     /note="encodes a SNF1-related protein kinase that
                     physically interacts with SCF subunit SKP1/ASK1 and 20S
                     proteosome subunit PAD1. It can also interact with PRL1
                     DWD-containing protein. Based on in vitro degradation
                     assays and cul4cs and prl1 mutants, there is evidence that
                     AKIN10 is degraded in a proteasome-dependent manner, and
                     that this depends on a CUL4-PRL1 E3 ligase"
                     /db_xref="Araport:AT3G01090"
                     /db_xref="TAIR:AT3G01090"
     mRNA            complement(join(31145..31550,31761..31997,32083..32220,
                     32294..32377,32487..32576,32668..32853,32970..33101,
                     33194..33376,33479..33663,33788..33980,34300..34451))
                     /gene="KIN10"
                     /locus_tag="AT3G01090"
                     /gene_synonym="AKIN10"
                     /gene_synonym="SNF1 kinase homolog 10"
                     /gene_synonym="SNF1-RELATED PROTEIN KINASE"
                     /gene_synonym="SNF1-RELATED PROTEIN KINASE 1.1"
                     /gene_synonym="SNRK1.1"
                     /gene_synonym="T4P13.22"
                     /gene_synonym="T4P13_22"
                     /product="SNF1 kinase homolog 10"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL261369.1,INSD:BP566693.1,INSD:AI099749.1,
                     INSD:BP577805.1,INSD:EL270548.1,INSD:ES128604.1,
                     INSD:ES150238.1,INSD:T44073.1,INSD:DR355866.1,
                     INSD:BP648889.1,INSD:ES044722.1,INSD:ES029549.1,
                     INSD:ES047693.1,INSD:BE521912.1,INSD:BP570395.1,
                     INSD:ES136403.1,INSD:BE522636.1,INSD:BP653381.1,
                     INSD:ES072589.1,INSD:ES003237.1,INSD:BP589760.1,
                     INSD:ES046108.1,INSD:EH835621.1,INSD:CF774074.1,
                     INSD:BP584420.1,INSD:EL971542.1,INSD:EH951338.1,
                     INSD:BE526815.1,INSD:EL252922.1,INSD:EH876832.1,
                     INSD:EH858622.1,INSD:EH799057.1,INSD:BP657302.1,
                     INSD:ES030867.1,INSD:ES023195.1,INSD:ES180977.1,
                     INSD:ES003588.1,INSD:BP612579.1,INSD:DR354550.1,
                     INSD:BP579165.1,INSD:EL318204.1,INSD:BP782643.1,
                     INSD:EG495339.1,INSD:EL087931.1,INSD:BE521911.1,
                     INSD:AV534094.1,INSD:DR383278.1,INSD:BP659881.1,
                     INSD:EL160788.1,INSD:EL023473.1,INSD:T43680.1,
                     INSD:AI099751.1,INSD:EH917396.1,INSD:DR355689.1,
                     INSD:BP563655.1,INSD:AV552767.1,INSD:ES123995.1,
                     INSD:BP565452.1,INSD:AV814860.1,INSD:EH873482.1,
                     INSD:BP579896.1,INSD:BP577775.1,INSD:EH835270.1,
                     INSD:ES020848.1,INSD:ES129963.1,INSD:EL265194.1,
                     INSD:ES207122.1,INSD:AV544268.1,INSD:EL176463.1,
                     INSD:N65189.1,INSD:EG495341.1,INSD:ES185764.1,
                     INSD:CB260584.1,INSD:EL136010.1,INSD:BP577814.1,
                     INSD:AV806484.1,INSD:EH961695.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:DQ778957.1"
                     /db_xref="TAIR:AT3G01090"
                     /db_xref="Araport:AT3G01090"
     mRNA            complement(join(31163..31550,31761..31997,32083..32220,
                     32294..32377,32487..32576,32668..32853,32970..33101,
                     33194..33376,33479..33663,33788..33980,34403..34670))
                     /gene="KIN10"
                     /locus_tag="AT3G01090"
                     /gene_synonym="AKIN10"
                     /gene_synonym="SNF1 kinase homolog 10"
                     /gene_synonym="SNF1-RELATED PROTEIN KINASE"
                     /gene_synonym="SNF1-RELATED PROTEIN KINASE 1.1"
                     /gene_synonym="SNRK1.1"
                     /gene_synonym="T4P13.22"
                     /gene_synonym="T4P13_22"
                     /product="SNF1 kinase homolog 10"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL261369.1,INSD:BP566693.1,INSD:AI099749.1,
                     INSD:BP577805.1,INSD:EL270548.1,INSD:ES128604.1,
                     INSD:ES150238.1,INSD:T44073.1,INSD:DR355866.1,
                     INSD:BP648889.1,INSD:ES044722.1,INSD:ES029549.1,
                     INSD:ES047693.1,INSD:BE521912.1,INSD:BP570395.1,
                     INSD:ES136403.1,INSD:BE522636.1,INSD:BP653381.1,
                     INSD:ES072589.1,INSD:ES003237.1,INSD:BP589760.1,
                     INSD:ES046108.1,INSD:EH835621.1,INSD:CF774074.1,
                     INSD:BP584420.1,INSD:EH951338.1,INSD:EL971542.1,
                     INSD:BE526815.1,INSD:EL252922.1,INSD:EH876832.1,
                     INSD:EH858622.1,INSD:EH799057.1,INSD:BP657302.1,
                     INSD:ES030867.1,INSD:ES023195.1,INSD:ES180977.1,
                     INSD:ES003588.1,INSD:BP612579.1,INSD:DR354550.1,
                     INSD:BP579165.1,INSD:EL318204.1,INSD:BP782643.1,
                     INSD:EG495339.1,INSD:EL087931.1,INSD:BE521911.1,
                     INSD:AV534094.1,INSD:DR383278.1,INSD:BP659881.1,
                     INSD:EL160788.1,INSD:EL023473.1,INSD:T43680.1,
                     INSD:AI099751.1,INSD:EH917396.1,INSD:DR355689.1,
                     INSD:BP563655.1,INSD:AV552767.1,INSD:ES123995.1,
                     INSD:BP565452.1,INSD:AV814860.1,INSD:EH873482.1,
                     INSD:BP579896.1,INSD:BP577775.1,INSD:EH835270.1,
                     INSD:ES020848.1,INSD:ES129963.1,INSD:EL265194.1,
                     INSD:ES207122.1,INSD:AV828372.1,INSD:AV544268.1,
                     INSD:EL176463.1,INSD:N65189.1,INSD:ES185764.1,
                     INSD:CB260584.1,INSD:EL136010.1,INSD:BP577814.1,
                     INSD:AV806484.1,INSD:EH961695.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY093170.1,INSD:DQ778957.1,INSD:BT010386.1"
                     /db_xref="TAIR:AT3G01090"
                     /db_xref="Araport:AT3G01090"
     mRNA            complement(join(31181..31550,31761..31997,32083..32220,
                     32294..32377,32487..32576,32668..32853,32970..33101,
                     33194..33376,33479..33663,33788..33980,34078..34487))
                     /gene="KIN10"
                     /locus_tag="AT3G01090"
                     /gene_synonym="AKIN10"
                     /gene_synonym="SNF1 kinase homolog 10"
                     /gene_synonym="SNF1-RELATED PROTEIN KINASE"
                     /gene_synonym="SNF1-RELATED PROTEIN KINASE 1.1"
                     /gene_synonym="SNRK1.1"
                     /gene_synonym="T4P13.22"
                     /gene_synonym="T4P13_22"
                     /product="SNF1 kinase homolog 10"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP577805.1,INSD:AA721876.1,INSD:BP798775.1,
                     INSD:ES128604.1,INSD:EL270548.1,INSD:ES150238.1,
                     INSD:BP648889.1,INSD:BE521912.1,INSD:BP570395.1,
                     INSD:ES162792.1,INSD:BP653381.1,INSD:ES046108.1,
                     INSD:EH835621.1,INSD:CF774074.1,INSD:BP829665.1,
                     INSD:EH951338.1,INSD:BP584420.1,INSD:EL984132.1,
                     INSD:EH858622.1,INSD:DR354548.1,INSD:BP657302.1,
                     INSD:ES030867.1,INSD:ES003588.1,INSD:ES180977.1,
                     INSD:DR354550.1,INSD:EL318204.1,INSD:ES176549.1,
                     INSD:BE521911.1,INSD:AV534094.1,INSD:DR383278.1,
                     INSD:BP659881.1,INSD:EL160788.1,INSD:T43680.1,
                     INSD:ES119834.1,INSD:ES123995.1,INSD:BP565452.1,
                     INSD:AV814860.1,INSD:EH873482.1,INSD:ES020848.1,
                     INSD:BP577775.1,INSD:EL265194.1,INSD:ES207122.1,
                     INSD:AV544268.1,INSD:N65189.1,INSD:EL176463.1,
                     INSD:ES185764.1,INSD:EL136010.1,INSD:EH915081.1,
                     INSD:ES138453.1,INSD:ES194001.1,INSD:ES145189.1,
                     INSD:EL261369.1,INSD:ES174416.1,INSD:BP566693.1,
                     INSD:AI099749.1,INSD:ES124829.1,INSD:T44073.1,
                     INSD:DR355866.1,INSD:ES044722.1,INSD:ES029549.1,
                     INSD:ES047693.1,INSD:ES136403.1,INSD:BE522636.1,
                     INSD:ES072589.1,INSD:ES003237.1,INSD:BP589760.1,
                     INSD:EL275889.1,INSD:EL971542.1,INSD:BE526815.1,
                     INSD:EL252922.1,INSD:EH876832.1,INSD:BP800562.1,
                     INSD:EH799057.1,INSD:ES023195.1,INSD:BP612579.1,
                     INSD:BP579165.1,INSD:AV829484.1,INSD:ES152862.1,
                     INSD:CB256092.1,INSD:ES147483.1,INSD:EG495339.1,
                     INSD:BP782643.1,INSD:EL087931.1,INSD:EL023473.1,
                     INSD:AI099751.1,INSD:EH917396.1,INSD:DR355689.1,
                     INSD:BP563655.1,INSD:AV552767.1,INSD:DR354549.1,
                     INSD:ES150855.1,INSD:ES129963.1,INSD:ES210186.1,
                     INSD:EH835270.1,INSD:BP579896.1,INSD:ES011844.1,
                     INSD:CB260584.1,INSD:BP799401.1,INSD:AV806484.1,
                     INSD:BP577814.1,INSD:BX839781.1,INSD:EH961695.1,
                     INSD:BP853302.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:DQ778957.1,INSD:X94757.1"
                     /db_xref="TAIR:AT3G01090"
                     /db_xref="Araport:AT3G01090"
     CDS             complement(join(31437..31550,31761..31997,32083..32220,
                     32294..32377,32487..32576,32668..32853,32970..33101,
                     33194..33376,33479..33663,33788..33980,34078..34143))
                     /gene="KIN10"
                     /locus_tag="AT3G01090"
                     /gene_synonym="AKIN10"
                     /gene_synonym="SNF1 kinase homolog 10"
                     /gene_synonym="SNF1-RELATED PROTEIN KINASE"
                     /gene_synonym="SNF1-RELATED PROTEIN KINASE 1.1"
                     /gene_synonym="SNRK1.1"
                     /gene_synonym="T4P13.22"
                     /gene_synonym="T4P13_22"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL261369.1,INSD:BP566693.1,INSD:AI099749.1,
                     INSD:BP577805.1,INSD:EL270548.1,INSD:ES128604.1,
                     INSD:ES150238.1,INSD:T44073.1,INSD:DR355866.1,
                     INSD:BP648889.1,INSD:ES044722.1,INSD:ES029549.1,
                     INSD:ES047693.1,INSD:BE521912.1,INSD:BP570395.1,
                     INSD:ES136403.1,INSD:BE522636.1,INSD:BP653381.1,
                     INSD:ES072589.1,INSD:ES003237.1,INSD:BP589760.1,
                     INSD:ES046108.1,INSD:EH835621.1,INSD:CF774074.1,
                     INSD:BP584420.1,INSD:EH951338.1,INSD:EL971542.1,
                     INSD:BE526815.1,INSD:EL252922.1,INSD:EH876832.1,
                     INSD:EH858622.1,INSD:EH799057.1,INSD:BP657302.1,
                     INSD:ES030867.1,INSD:ES023195.1,INSD:ES180977.1,
                     INSD:ES003588.1,INSD:BP612579.1,INSD:DR354550.1,
                     INSD:BP579165.1,INSD:EL318204.1,INSD:BP782643.1,
                     INSD:EG495339.1,INSD:EL087931.1,INSD:BE521911.1,
                     INSD:AV534094.1,INSD:DR383278.1,INSD:BP659881.1,
                     INSD:EL160788.1,INSD:EL023473.1,INSD:T43680.1,
                     INSD:AI099751.1,INSD:EH917396.1,INSD:DR355689.1,
                     INSD:BP563655.1,INSD:AV552767.1,INSD:ES123995.1,
                     INSD:BP565452.1,INSD:AV814860.1,INSD:EH873482.1,
                     INSD:BP579896.1,INSD:BP577775.1,INSD:EH835270.1,
                     INSD:ES020848.1,INSD:ES129963.1,INSD:EL265194.1,
                     INSD:ES207122.1,INSD:AV828372.1,INSD:AV544268.1,
                     INSD:EL176463.1,INSD:N65189.1,INSD:ES185764.1,
                     INSD:CB260584.1,INSD:EL136010.1,INSD:BP577814.1,
                     INSD:AV806484.1,INSD:EH961695.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY093170.1,INSD:DQ778957.1,INSD:BT010386.1"
                     /note="SNF1 kinase homolog 10 (KIN10); FUNCTIONS IN:
                     protein binding, protein serine/threonine kinase activity,
                     protein kinase activity; INVOLVED IN: in 8 processes;
                     LOCATED IN: nuclear ubiquitin ligase complex; EXPRESSED
                     IN: 25 plant structures; EXPRESSED DURING: 15 growth
                     stages; CONTAINS InterPro DOMAIN/s:
                     Ubiquitin-associated/translation elongation factor EF1B,
                     N-terminal (InterPro:IPR000449), Protein kinase, ATP
                     binding site (InterPro:IPR017441), Kinase-associated KA1
                     (InterPro:IPR001772), Serine/threonine-protein kinase
                     domain (InterPro:IPR002290), Serine/threonine-protein
                     kinase-like domain (InterPro:IPR017442), Protein
                     kinase-like domain (InterPro:IPR011009),
                     Serine/threonine-protein kinase, active site
                     (InterPro:IPR008271), Protein kinase, Snf1-like AMPK
                     (InterPro:IPR015741), Ubiquitin-associated/translation
                     elongation factor EF1B, N-terminal, eukaryote
                     (InterPro:IPR015940), Protein kinase, catalytic domain
                     (InterPro:IPR000719), Calcium/calmodulin-dependent protein
                     kinase-like (InterPro:IPR020636), Tyrosine-protein kinase,
                     catalytic domain (InterPro:IPR020635); BEST Arabidopsis
                     thaliana protein match is: SNF1 kinase homolog 11
                     (TAIR:AT3G29160.2); Has 133590 Blast hits to 131265
                     proteins in 4759 species: Archae - 166; Bacteria - 15153;
                     Metazoa - 49555; Fungi - 13420; Plants - 32561; Viruses -
                     542; Other Eukaryotes - 22193 (source: NCBI BLink)."
                     /codon_start=1
                     /product="SNF1 kinase homolog 10"
                     /protein_id="AEE73608.1"
                     /db_xref="TAIR:AT3G01090"
                     /db_xref="Araport:AT3G01090"
                     /translation="MFKRVDEFNLVSSTIDHRIFKSRMDGSGTGSRSGVESILPNYKL
                     GRTLGIGSFGRVKIAEHALTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHI
                     IRLYEVIETPTDIYLVMEYVNSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNM
                     VVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAG
                     PEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLV
                     VDPMKRVTIPEIRQHPWFQAHLPRYLAVPPPDTVQQAKKIDEEILQEVINMGFDRNHL
                     IESLRNRTQNDGTVTYYLILDNRFRASSGYLGAEFQETMEGTPRMHPAESVASPVSHR
                     LPGLMEYQGVGLRSQYPVERKWALGLQSRAHPREIMTEVLKALQDLNVCWKKIGHYNM
                     KCRWVPNSSADGMLSNSMHDNNYFGDESSIIENEAAVKSPNVVKFEIQLYKTRDDKYL
                     LDLQRVQGPQFLFLDLCAAFLAQLRVL"
     CDS             complement(join(31437..31550,31761..31997,32083..32220,
                     32294..32377,32487..32576,32668..32853,32970..33101,
                     33194..33376,33479..33663,33788..33977))
                     /gene="KIN10"
                     /locus_tag="AT3G01090"
                     /gene_synonym="AKIN10"
                     /gene_synonym="SNF1 kinase homolog 10"
                     /gene_synonym="SNF1-RELATED PROTEIN KINASE"
                     /gene_synonym="SNF1-RELATED PROTEIN KINASE 1.1"
                     /gene_synonym="SNRK1.1"
                     /gene_synonym="T4P13.22"
                     /gene_synonym="T4P13_22"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP577805.1,INSD:AA721876.1,INSD:BP798775.1,
                     INSD:ES128604.1,INSD:EL270548.1,INSD:ES150238.1,
                     INSD:BP648889.1,INSD:BE521912.1,INSD:BP570395.1,
                     INSD:ES162792.1,INSD:BP653381.1,INSD:ES046108.1,
                     INSD:EH835621.1,INSD:CF774074.1,INSD:BP829665.1,
                     INSD:EH951338.1,INSD:BP584420.1,INSD:EL984132.1,
                     INSD:EH858622.1,INSD:DR354548.1,INSD:BP657302.1,
                     INSD:ES030867.1,INSD:ES003588.1,INSD:ES180977.1,
                     INSD:DR354550.1,INSD:EL318204.1,INSD:ES176549.1,
                     INSD:BE521911.1,INSD:AV534094.1,INSD:DR383278.1,
                     INSD:BP659881.1,INSD:EL160788.1,INSD:T43680.1,
                     INSD:ES119834.1,INSD:ES123995.1,INSD:BP565452.1,
                     INSD:AV814860.1,INSD:EH873482.1,INSD:ES020848.1,
                     INSD:BP577775.1,INSD:EL265194.1,INSD:ES207122.1,
                     INSD:AV544268.1,INSD:N65189.1,INSD:EL176463.1,
                     INSD:ES185764.1,INSD:EL136010.1,INSD:EH915081.1,
                     INSD:ES138453.1,INSD:ES194001.1,INSD:ES145189.1,
                     INSD:EL261369.1,INSD:ES174416.1,INSD:BP566693.1,
                     INSD:AI099749.1,INSD:ES124829.1,INSD:T44073.1,
                     INSD:DR355866.1,INSD:ES044722.1,INSD:ES029549.1,
                     INSD:ES047693.1,INSD:ES136403.1,INSD:BE522636.1,
                     INSD:ES072589.1,INSD:ES003237.1,INSD:BP589760.1,
                     INSD:EL275889.1,INSD:EL971542.1,INSD:BE526815.1,
                     INSD:EL252922.1,INSD:EH876832.1,INSD:BP800562.1,
                     INSD:EH799057.1,INSD:ES023195.1,INSD:BP612579.1,
                     INSD:BP579165.1,INSD:AV829484.1,INSD:ES152862.1,
                     INSD:CB256092.1,INSD:ES147483.1,INSD:EG495339.1,
                     INSD:BP782643.1,INSD:EL087931.1,INSD:EL023473.1,
                     INSD:AI099751.1,INSD:EH917396.1,INSD:DR355689.1,
                     INSD:BP563655.1,INSD:AV552767.1,INSD:DR354549.1,
                     INSD:ES150855.1,INSD:ES129963.1,INSD:ES210186.1,
                     INSD:EH835270.1,INSD:BP579896.1,INSD:ES011844.1,
                     INSD:CB260584.1,INSD:BP799401.1,INSD:AV806484.1,
                     INSD:BP577814.1,INSD:BX839781.1,INSD:EH961695.1,
                     INSD:BP853302.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:DQ778957.1,INSD:X94757.1"
                     /note="SNF1 kinase homolog 10 (KIN10); FUNCTIONS IN:
                     protein binding, protein serine/threonine kinase activity,
                     protein kinase activity; INVOLVED IN: in 8 processes;
                     LOCATED IN: nuclear ubiquitin ligase complex; EXPRESSED
                     IN: 25 plant structures; EXPRESSED DURING: 15 growth
                     stages; CONTAINS InterPro DOMAIN/s: Protein kinase, ATP
                     binding site (InterPro:IPR017441),
                     Ubiquitin-associated/translation elongation factor EF1B,
                     N-terminal (InterPro:IPR000449), Kinase-associated KA1
                     (InterPro:IPR001772), Serine/threonine-protein kinase
                     domain (InterPro:IPR002290), Serine/threonine-protein
                     kinase-like domain (InterPro:IPR017442), Protein
                     kinase-like domain (InterPro:IPR011009),
                     Serine/threonine-protein kinase, active site
                     (InterPro:IPR008271), Ubiquitin-associated/translation
                     elongation factor EF1B, N-terminal, eukaryote
                     (InterPro:IPR015940), Protein kinase, Snf1-like AMPK
                     (InterPro:IPR015741), Protein kinase, catalytic domain
                     (InterPro:IPR000719), Calcium/calmodulin-dependent protein
                     kinase-like (InterPro:IPR020636); BEST Arabidopsis
                     thaliana protein match is: SNF1 kinase homolog 11
                     (TAIR:AT3G29160.2); Has 133405 Blast hits to 131080
                     proteins in 4728 species: Archae - 166; Bacteria - 15101;
                     Metazoa - 49470; Fungi - 13387; Plants - 32551; Viruses -
                     541; Other Eukaryotes - 22189 (source: NCBI BLink)."
                     /codon_start=1
                     /product="SNF1 kinase homolog 10"
                     /protein_id="AEE73607.1"
                     /db_xref="TAIR:AT3G01090"
                     /db_xref="Araport:AT3G01090"
                     /translation="MDGSGTGSRSGVESILPNYKLGRTLGIGSFGRVKIAEHALTGHK
                     VAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETPTDIYLVMEYVNSG
                     ELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIAD
                     FGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFD
                     DENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRVTIPEIRQHPWFQAHLP
                     RYLAVPPPDTVQQAKKIDEEILQEVINMGFDRNHLIESLRNRTQNDGTVTYYLILDNR
                     FRASSGYLGAEFQETMEGTPRMHPAESVASPVSHRLPGLMEYQGVGLRSQYPVERKWA
                     LGLQSRAHPREIMTEVLKALQDLNVCWKKIGHYNMKCRWVPNSSADGMLSNSMHDNNY
                     FGDESSIIENEAAVKSPNVVKFEIQLYKTRDDKYLLDLQRVQGPQFLFLDLCAAFLAQ
                     LRVL"
     CDS             complement(join(31437..31550,31761..31997,32083..32220,
                     32294..32377,32487..32576,32668..32853,32970..33101,
                     33194..33376,33479..33663,33788..33977))
                     /gene="KIN10"
                     /locus_tag="AT3G01090"
                     /gene_synonym="AKIN10"
                     /gene_synonym="SNF1 kinase homolog 10"
                     /gene_synonym="SNF1-RELATED PROTEIN KINASE"
                     /gene_synonym="SNF1-RELATED PROTEIN KINASE 1.1"
                     /gene_synonym="SNRK1.1"
                     /gene_synonym="T4P13.22"
                     /gene_synonym="T4P13_22"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL261369.1,INSD:BP566693.1,INSD:AI099749.1,
                     INSD:BP577805.1,INSD:EL270548.1,INSD:ES128604.1,
                     INSD:ES150238.1,INSD:T44073.1,INSD:DR355866.1,
                     INSD:BP648889.1,INSD:ES044722.1,INSD:ES029549.1,
                     INSD:ES047693.1,INSD:BE521912.1,INSD:BP570395.1,
                     INSD:ES136403.1,INSD:BE522636.1,INSD:BP653381.1,
                     INSD:ES072589.1,INSD:ES003237.1,INSD:BP589760.1,
                     INSD:ES046108.1,INSD:EH835621.1,INSD:CF774074.1,
                     INSD:BP584420.1,INSD:EL971542.1,INSD:EH951338.1,
                     INSD:BE526815.1,INSD:EL252922.1,INSD:EH876832.1,
                     INSD:EH858622.1,INSD:EH799057.1,INSD:BP657302.1,
                     INSD:ES030867.1,INSD:ES023195.1,INSD:ES180977.1,
                     INSD:ES003588.1,INSD:BP612579.1,INSD:DR354550.1,
                     INSD:BP579165.1,INSD:EL318204.1,INSD:BP782643.1,
                     INSD:EG495339.1,INSD:EL087931.1,INSD:BE521911.1,
                     INSD:AV534094.1,INSD:DR383278.1,INSD:BP659881.1,
                     INSD:EL160788.1,INSD:EL023473.1,INSD:T43680.1,
                     INSD:AI099751.1,INSD:EH917396.1,INSD:DR355689.1,
                     INSD:BP563655.1,INSD:AV552767.1,INSD:ES123995.1,
                     INSD:BP565452.1,INSD:AV814860.1,INSD:EH873482.1,
                     INSD:BP579896.1,INSD:BP577775.1,INSD:EH835270.1,
                     INSD:ES020848.1,INSD:ES129963.1,INSD:EL265194.1,
                     INSD:ES207122.1,INSD:AV544268.1,INSD:EL176463.1,
                     INSD:N65189.1,INSD:EG495341.1,INSD:ES185764.1,
                     INSD:CB260584.1,INSD:EL136010.1,INSD:BP577814.1,
                     INSD:AV806484.1,INSD:EH961695.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:DQ778957.1"
                     /note="SNF1 kinase homolog 10 (KIN10); FUNCTIONS IN:
                     protein binding, protein serine/threonine kinase activity,
                     protein kinase activity; INVOLVED IN: in 8 processes;
                     LOCATED IN: nuclear ubiquitin ligase complex; EXPRESSED
                     IN: 25 plant structures; EXPRESSED DURING: 15 growth
                     stages; CONTAINS InterPro DOMAIN/s: Protein kinase, ATP
                     binding site (InterPro:IPR017441),
                     Ubiquitin-associated/translation elongation factor EF1B,
                     N-terminal (InterPro:IPR000449), Kinase-associated KA1
                     (InterPro:IPR001772), Serine/threonine-protein kinase
                     domain (InterPro:IPR002290), Serine/threonine-protein
                     kinase-like domain (InterPro:IPR017442), Protein
                     kinase-like domain (InterPro:IPR011009),
                     Serine/threonine-protein kinase, active site
                     (InterPro:IPR008271), Ubiquitin-associated/translation
                     elongation factor EF1B, N-terminal, eukaryote
                     (InterPro:IPR015940), Protein kinase, Snf1-like AMPK
                     (InterPro:IPR015741), Protein kinase, catalytic domain
                     (InterPro:IPR000719), Calcium/calmodulin-dependent protein
                     kinase-like (InterPro:IPR020636); BEST Arabidopsis
                     thaliana protein match is: SNF1 kinase homolog 11
                     (TAIR:AT3G29160.2); Has 30201 Blast hits to 17322 proteins
                     in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
                     17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
                     Eukaryotes - 2996 (source: NCBI BLink)."
                     /codon_start=1
                     /product="SNF1 kinase homolog 10"
                     /protein_id="AEE73609.1"
                     /db_xref="TAIR:AT3G01090"
                     /db_xref="Araport:AT3G01090"
                     /translation="MDGSGTGSRSGVESILPNYKLGRTLGIGSFGRVKIAEHALTGHK
                     VAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETPTDIYLVMEYVNSG
                     ELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIAD
                     FGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFD
                     DENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRVTIPEIRQHPWFQAHLP
                     RYLAVPPPDTVQQAKKIDEEILQEVINMGFDRNHLIESLRNRTQNDGTVTYYLILDNR
                     FRASSGYLGAEFQETMEGTPRMHPAESVASPVSHRLPGLMEYQGVGLRSQYPVERKWA
                     LGLQSRAHPREIMTEVLKALQDLNVCWKKIGHYNMKCRWVPNSSADGMLSNSMHDNNY
                     FGDESSIIENEAAVKSPNVVKFEIQLYKTRDDKYLLDLQRVQGPQFLFLDLCAAFLAQ
                     LRVL"
     gene            complement(34658..38660)
                     /gene="HYP1"
                     /locus_tag="AT3G01100"
                     /gene_synonym="ARABIDOPSIS THALIANA HYPOTHETICAL PROTEIN
                     1"
                     /gene_synonym="AT3G01110"
                     /gene_synonym="ATHYP1"
                     /gene_synonym="hypothetical protein 1"
                     /gene_synonym="T4P13.21"
                     /gene_synonym="T4P13_21"
                     /note="unknown protein, has cDNAs and ESTs associated to
                     it"
                     /db_xref="Araport:AT3G01100"
                     /db_xref="TAIR:AT3G01100"
     mRNA            complement(join(34658..35141,35322..35555,35852..36127,
                     36214..36490,36576..36874,36950..37138,37220..37429,
                     37515..37578,37667..37816,37893..38217,38416..38660))
                     /gene="HYP1"
                     /locus_tag="AT3G01100"
                     /gene_synonym="ARABIDOPSIS THALIANA HYPOTHETICAL PROTEIN
                     1"
                     /gene_synonym="AT3G01110"
                     /gene_synonym="ATHYP1"
                     /gene_synonym="hypothetical protein 1"
                     /gene_synonym="T4P13.21"
                     /gene_synonym="T4P13_21"
                     /product="hypothetical protein 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP859232.1,INSD:BP616056.1,INSD:BP562420.2,
                     INSD:BP600839.1,INSD:EL198867.1,INSD:AV814121.1,
                     INSD:BX839277.1,INSD:BP597964.1,INSD:EL280856.1,
                     INSD:AW004463.1,INSD:BP795263.1,INSD:EL998023.1,
                     INSD:BP784528.1,INSD:BP620755.1,INSD:AV556627.1,
                     INSD:AV555025.1,INSD:BP786567.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT002498.1,INSD:AK221381.1,INSD:X78422.1,
                     INSD:BT008419.1"
                     /db_xref="TAIR:AT3G01100"
                     /db_xref="Araport:AT3G01100"
     mRNA            complement(join(34658..35141,35322..36127,36214..36490,
                     36576..36874,36950..37138,37220..37429,37515..37578,
                     37667..37816,37893..38217,38416..38660))
                     /gene="HYP1"
                     /locus_tag="AT3G01100"
                     /gene_synonym="ARABIDOPSIS THALIANA HYPOTHETICAL PROTEIN
                     1"
                     /gene_synonym="AT3G01110"
                     /gene_synonym="ATHYP1"
                     /gene_synonym="hypothetical protein 1"
                     /gene_synonym="T4P13.21"
                     /gene_synonym="T4P13_21"
                     /product="hypothetical protein 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP859232.1,INSD:BP616056.1,INSD:BP562420.2,
                     INSD:BP600839.1,INSD:EL198867.1,INSD:AV814121.1,
                     INSD:BX839277.1,INSD:BP597964.1,INSD:EL280856.1,
                     INSD:AW004463.1,INSD:BP795263.1,INSD:EL998023.1,
                     INSD:BP784528.1,INSD:AV560821.1,INSD:BP620755.1,
                     INSD:AV556627.1,INSD:AV555025.1,INSD:BP786567.1"
                     /db_xref="TAIR:AT3G01100"
                     /db_xref="Araport:AT3G01100"
     mRNA            complement(join(34718..35141,35322..35555,35852..36127,
                     36214..36490,36576..36874,36950..37138,37220..37429,
                     37515..37578,37667..38217,38416..38582))
                     /gene="HYP1"
                     /locus_tag="AT3G01100"
                     /gene_synonym="ARABIDOPSIS THALIANA HYPOTHETICAL PROTEIN
                     1"
                     /gene_synonym="AT3G01110"
                     /gene_synonym="ATHYP1"
                     /gene_synonym="hypothetical protein 1"
                     /gene_synonym="T4P13.21"
                     /gene_synonym="T4P13_21"
                     /product="hypothetical protein 1"
                     /db_xref="Araport:AT3G01100"
                     /db_xref="TAIR:AT3G01100"
     mRNA            complement(join(34719..35141,35322..35555,35852..36127,
                     36214..36490,36576..36874,36950..37138,37220..37429,
                     37515..37578,37667..37816,37893..38217,38317..38635))
                     /gene="HYP1"
                     /locus_tag="AT3G01100"
                     /gene_synonym="ARABIDOPSIS THALIANA HYPOTHETICAL PROTEIN
                     1"
                     /gene_synonym="AT3G01110"
                     /gene_synonym="ATHYP1"
                     /gene_synonym="hypothetical protein 1"
                     /gene_synonym="T4P13.21"
                     /gene_synonym="T4P13_21"
                     /product="hypothetical protein 1"
                     /db_xref="Araport:AT3G01100"
                     /db_xref="TAIR:AT3G01100"
     CDS             complement(join(35013..35141,35322..35555,35852..36127,
                     36214..36490,36576..36874,36950..37138,37220..37429,
                     37515..37578,37667..37816,37893..38217,38317..38413))
                     /gene="HYP1"
                     /locus_tag="AT3G01100"
                     /gene_synonym="ARABIDOPSIS THALIANA HYPOTHETICAL PROTEIN
                     1"
                     /gene_synonym="AT3G01110"
                     /gene_synonym="ATHYP1"
                     /gene_synonym="hypothetical protein 1"
                     /gene_synonym="T4P13.21"
                     /gene_synonym="T4P13_21"
                     /codon_start=1
                     /product="hypothetical protein 1"
                     /protein_id="ANM65208.1"
                     /db_xref="Araport:AT3G01100"
                     /db_xref="TAIR:AT3G01100"
                     /translation="MYFGKFVSCFLFDPDQKTLCRLILGLSVPYHHNSWQASLGLSEF
                     GVMLLSALLTSVGINLGLCFLFFTLYSILRKQPSNVTVYGPRLVKKDGKSQQSNEFNL
                     ERLLPTAGWVKRALEPTNDEILSNLGLDALVFIRVFVFSIRVFSFASVVGIFILLPVN
                     YMGTEFEEFFDLPKKSMDNFSISNVNDGSNKLWIHFCAIYIFTAVVCSLLYYEHKYIL
                     TKRIAHLYSSKPQPQEFTVLVSGVPLVSGNSISETVENFFREYHSSSYLSHIVVHRTD
                     KLKVLMNDAEKLYKKLTRVKSGSISRQKSRWGGFLGMFGNNVDVVDHYQKKLDKLEDD
                     MRLKQSLLAGEEVPAAFVSFRTRHGAAIATNIQQGIDPTQWLTEAAPEPEDVHWPFFT
                     ASFVRRWISNVVVLVAFVALLILYIVPVVLVQGLANLHQLETWFPFLKGILNMKIVSQ
                     VITGYLPSLIFQLFLLIVPPIMLLLSSMQGFISHSQIEKSACIKLLIFTVWNSFFANV
                     LSGSALYRVNVFLEPKTIPRVLAAAVPAQASFFVSYVVTSGWTGLSSEILRLVPLLWS
                     FITKLFGKEDDKEFEVPSTPFCQEIPRILFFGLLGITYFFLSPLILPFLLVYYCLGYI
                     IYRNQLLNVYAAKYETGGKFWPIVHSYTIFSLVLMHIIAVGLFGLKELPVASSLTIPL
                     PVLTVLFSIYCQRRFLPNFKSYPTQCLVNKDKADEREQNMSEFYSELVVAYRDPALSA
                     SQDSRDISP"
     CDS             complement(join(35013..35141,35322..35555,35852..36127,
                     36214..36490,36576..36874,36950..37138,37220..37429,
                     37515..37578,37667..37816,37893..38176))
                     /gene="HYP1"
                     /locus_tag="AT3G01100"
                     /gene_synonym="ARABIDOPSIS THALIANA HYPOTHETICAL PROTEIN
                     1"
                     /gene_synonym="AT3G01110"
                     /gene_synonym="ATHYP1"
                     /gene_synonym="hypothetical protein 1"
                     /gene_synonym="T4P13.21"
                     /gene_synonym="T4P13_21"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP859232.1,INSD:BP616056.1,INSD:BP562420.2,
                     INSD:BP600839.1,INSD:EL198867.1,INSD:AV814121.1,
                     INSD:BX839277.1,INSD:BP597964.1,INSD:EL280856.1,
                     INSD:AW004463.1,INSD:BP795263.1,INSD:EL998023.1,
                     INSD:BP784528.1,INSD:BP620755.1,INSD:AV556627.1,
                     INSD:AV555025.1,INSD:BP786567.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT002498.1,INSD:AK221381.1,INSD:X78422.1,
                     INSD:BT008419.1"
                     /note="hypothetical protein 1 (HYP1); LOCATED IN:
                     endomembrane system, membrane; EXPRESSED IN: 24 plant
                     structures; EXPRESSED DURING: 14 growth stages; CONTAINS
                     InterPro DOMAIN/s: Protein of unknown function DUF221
                     (InterPro:IPR003864); BEST Arabidopsis thaliana protein
                     match is: Early-responsive to dehydration stress protein
                     (ERD4) (TAIR:AT1G69450.2); Has 1409 Blast hits to 1276
                     proteins in 193 species: Archae - 0; Bacteria - 2; Metazoa
                     - 184; Fungi - 674; Plants - 429; Viruses - 0; Other
                     Eukaryotes - 120 (source: NCBI BLink)."
                     /codon_start=1
                     /product="hypothetical protein 1"
                     /protein_id="AEE73610.1"
                     /db_xref="TAIR:AT3G01100"
                     /db_xref="Araport:AT3G01100"
                     /translation="MLLSALLTSVGINLGLCFLFFTLYSILRKQPSNVTVYGPRLVKK
                     DGKSQQSNEFNLERLLPTAGWVKRALEPTNDEILSNLGLDALVFIRVFVFSIRVFSFA
                     SVVGIFILLPVNYMGTEFEEFFDLPKKSMDNFSISNVNDGSNKLWIHFCAIYIFTAVV
                     CSLLYYEHKYILTKRIAHLYSSKPQPQEFTVLVSGVPLVSGNSISETVENFFREYHSS
                     SYLSHIVVHRTDKLKVLMNDAEKLYKKLTRVKSGSISRQKSRWGGFLGMFGNNVDVVD
                     HYQKKLDKLEDDMRLKQSLLAGEEVPAAFVSFRTRHGAAIATNIQQGIDPTQWLTEAA
                     PEPEDVHWPFFTASFVRRWISNVVVLVAFVALLILYIVPVVLVQGLANLHQLETWFPF
                     LKGILNMKIVSQVITGYLPSLIFQLFLLIVPPIMLLLSSMQGFISHSQIEKSACIKLL
                     IFTVWNSFFANVLSGSALYRVNVFLEPKTIPRVLAAAVPAQASFFVSYVVTSGWTGLS
                     SEILRLVPLLWSFITKLFGKEDDKEFEVPSTPFCQEIPRILFFGLLGITYFFLSPLIL
                     PFLLVYYCLGYIIYRNQLLNVYAAKYETGGKFWPIVHSYTIFSLVLMHIIAVGLFGLK
                     ELPVASSLTIPLPVLTVLFSIYCQRRFLPNFKSYPTQCLVNKDKADEREQNMSEFYSE
                     LVVAYRDPALSASQDSRDISP"
     CDS             complement(join(35013..35141,35322..35555,35852..36127,
                     36214..36490,36576..36874,36950..37138,37220..37429,
                     37515..37578,37667..37755))
                     /gene="HYP1"
                     /locus_tag="AT3G01100"
                     /gene_synonym="ARABIDOPSIS THALIANA HYPOTHETICAL PROTEIN
                     1"
                     /gene_synonym="AT3G01110"
                     /gene_synonym="ATHYP1"
                     /gene_synonym="hypothetical protein 1"
                     /gene_synonym="T4P13.21"
                     /gene_synonym="T4P13_21"
                     /codon_start=1
                     /product="hypothetical protein 1"
                     /protein_id="ANM65207.1"
                     /db_xref="Araport:AT3G01100"
                     /db_xref="TAIR:AT3G01100"
                     /translation="MGTEFEEFFDLPKKSMDNFSISNVNDGSNKLWIHFCAIYIFTAV
                     VCSLLYYEHKYILTKRIAHLYSSKPQPQEFTVLVSGVPLVSGNSISETVENFFREYHS
                     SSYLSHIVVHRTDKLKVLMNDAEKLYKKLTRVKSGSISRQKSRWGGFLGMFGNNVDVV
                     DHYQKKLDKLEDDMRLKQSLLAGEEVPAAFVSFRTRHGAAIATNIQQGIDPTQWLTEA
                     APEPEDVHWPFFTASFVRRWISNVVVLVAFVALLILYIVPVVLVQGLANLHQLETWFP
                     FLKGILNMKIVSQVITGYLPSLIFQLFLLIVPPIMLLLSSMQGFISHSQIEKSACIKL
                     LIFTVWNSFFANVLSGSALYRVNVFLEPKTIPRVLAAAVPAQASFFVSYVVTSGWTGL
                     SSEILRLVPLLWSFITKLFGKEDDKEFEVPSTPFCQEIPRILFFGLLGITYFFLSPLI
                     LPFLLVYYCLGYIIYRNQLLNVYAAKYETGGKFWPIVHSYTIFSLVLMHIIAVGLFGL
                     KELPVASSLTIPLPVLTVLFSIYCQRRFLPNFKSYPTQCLVNKDKADEREQNMSEFYS
                     ELVVAYRDPALSASQDSRDISP"
     CDS             complement(join(35810..36127,36214..36490,36576..36874,
                     36950..37138,37220..37429,37515..37578,37667..37816,
                     37893..38176))
                     /gene="HYP1"
                     /locus_tag="AT3G01100"
                     /gene_synonym="ARABIDOPSIS THALIANA HYPOTHETICAL PROTEIN
                     1"
                     /gene_synonym="AT3G01110"
                     /gene_synonym="ATHYP1"
                     /gene_synonym="hypothetical protein 1"
                     /gene_synonym="T4P13.21"
                     /gene_synonym="T4P13_21"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP859232.1,INSD:BP616056.1,INSD:BP562420.2,
                     INSD:BP600839.1,INSD:EL198867.1,INSD:AV814121.1,
                     INSD:BX839277.1,INSD:BP597964.1,INSD:EL280856.1,
                     INSD:AW004463.1,INSD:BP795263.1,INSD:EL998023.1,
                     INSD:BP784528.1,INSD:AV560821.1,INSD:BP620755.1,
                     INSD:AV556627.1,INSD:AV555025.1,INSD:BP786567.1"
                     /note="hypothetical protein 1 (HYP1); LOCATED IN:
                     endomembrane system, membrane; EXPRESSED IN: 24 plant
                     structures; EXPRESSED DURING: 14 growth stages; CONTAINS
                     InterPro DOMAIN/s: Protein of unknown function DUF221
                     (InterPro:IPR003864); BEST Arabidopsis thaliana protein
                     match is: Early-responsive to dehydration stress protein
                     (ERD4) (TAIR:AT1G69450.2); Has 35333 Blast hits to 34131
                     proteins in 2444 species: Archae - 798; Bacteria - 22429;
                     Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
                     Other Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="hypothetical protein 1"
                     /protein_id="AEE73611.1"
                     /db_xref="TAIR:AT3G01100"
                     /db_xref="Araport:AT3G01100"
                     /translation="MLLSALLTSVGINLGLCFLFFTLYSILRKQPSNVTVYGPRLVKK
                     DGKSQQSNEFNLERLLPTAGWVKRALEPTNDEILSNLGLDALVFIRVFVFSIRVFSFA
                     SVVGIFILLPVNYMGTEFEEFFDLPKKSMDNFSISNVNDGSNKLWIHFCAIYIFTAVV
                     CSLLYYEHKYILTKRIAHLYSSKPQPQEFTVLVSGVPLVSGNSISETVENFFREYHSS
                     SYLSHIVVHRTDKLKVLMNDAEKLYKKLTRVKSGSISRQKSRWGGFLGMFGNNVDVVD
                     HYQKKLDKLEDDMRLKQSLLAGEEVPAAFVSFRTRHGAAIATNIQQGIDPTQWLTEAA
                     PEPEDVHWPFFTASFVRRWISNVVVLVAFVALLILYIVPVVLVQGLANLHQLETWFPF
                     LKGILNMKIVSQVITGYLPSLIFQLFLLIVPPIMLLLSSMQGFISHSQIEKSACIKLL
                     IFTVWNSFFANVLSGSALYRVNVFLEPKTIPRVLAAAVPAQASFFVSYVVTSGWTGLS
                     SEILRLVPLLWSFITKLFGKEDDKEFEVPSTPFCQEIPRILFFGLLGITYFFLSPLIL
                     PFLLVYYCLGYIIYRNQVTEPISLLSIILC"
     gene            complement(38759..42159)
                     /gene="MTO1"
                     /locus_tag="AT3G01120"
                     /gene_synonym="A. THALIANA CYSTATHIONINE GAMMA-SYNTHASE 1"
                     /gene_synonym="A. thaliana cystathionine gamma-synthetase
                     1"
                     /gene_synonym="AtCGS1"
                     /gene_synonym="AtCYS1"
                     /gene_synonym="ATCYS1"
                     /gene_synonym="CGS"
                     /gene_synonym="CGS1"
                     /gene_synonym="CYSTATHIONINE GAMMA-SYNTHASE"
                     /gene_synonym="CYSTATHIONINE GAMMA-SYNTHASE 1"
                     /gene_synonym="CYSTATHIONINE-GAMMA-SYNTHASE"
                     /gene_synonym="METHIONINE OVERACCUMULATION 1"
                     /gene_synonym="T4P13.19"
                     /gene_synonym="T4P13_19"
                     /note="encodes a cystathionine gamma-synthase, which
                     performs the first committed step in methionine
                     biosynthesis. A conserved motif of 13 amino acids in the
                     first exon is required for posttranscriptional
                     autoregulation. This enzyme shares the same substrate as
                     threonine synthase (TS) and its absence transcriptionally
                     affects 8 genes in the genome."
                     /db_xref="Araport:AT3G01120"
                     /db_xref="TAIR:AT3G01120"
     mRNA            complement(join(38759..39357,39464..39582,39674..39769,
                     39857..39964,40043..40129,40224..40427,40508..40567,
                     40668..40836,40944..41017,41136..41239,41319..42159))
                     /gene="MTO1"
                     /locus_tag="AT3G01120"
                     /gene_synonym="A. THALIANA CYSTATHIONINE GAMMA-SYNTHASE 1"
                     /gene_synonym="A. thaliana cystathionine gamma-synthetase
                     1"
                     /gene_synonym="AtCGS1"
                     /gene_synonym="AtCYS1"
                     /gene_synonym="ATCYS1"
                     /gene_synonym="CGS"
                     /gene_synonym="CGS1"
                     /gene_synonym="CYSTATHIONINE GAMMA-SYNTHASE"
                     /gene_synonym="CYSTATHIONINE GAMMA-SYNTHASE 1"
                     /gene_synonym="CYSTATHIONINE-GAMMA-SYNTHASE"
                     /gene_synonym="METHIONINE OVERACCUMULATION 1"
                     /gene_synonym="T4P13.19"
                     /gene_synonym="T4P13_19"
                     /product="Pyridoxal phosphate (PLP)-dependent transferases
                     superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES200492.1,INSD:EL232302.1,INSD:ES025148.1,
                     INSD:BP789251.1,INSD:AV541172.1,INSD:EH807580.1,
                     INSD:BP570838.1,INSD:BP778829.1,INSD:EL126325.1,
                     INSD:EL188097.1,INSD:BP620154.1,INSD:EH804690.1,
                     INSD:EL184816.1,INSD:BP834006.1,INSD:AV792954.1,
                     INSD:BE526007.1,INSD:ES146422.1,INSD:DR231403.1,
                     INSD:BP564712.1,INSD:BP781720.1,INSD:BP779299.1,
                     INSD:EH883710.1,INSD:BP834271.1,INSD:EL315542.1,
                     INSD:BP618578.1,INSD:AV829821.1,INSD:EL333696.1,
                     INSD:EH901277.1,INSD:AV544715.1,INSD:EL146228.1,
                     INSD:BP801217.1,INSD:AI994530.1,INSD:N96185.1,
                     INSD:AV803329.1,INSD:R65080.1,INSD:R29827.1,
                     INSD:BP658302.1,INSD:EL062068.1,INSD:BP653261.1,
                     INSD:EL083476.1,INSD:BP861691.1,INSD:BP787457.1,
                     INSD:EH940542.1,INSD:Z18175.1,INSD:EL046384.1,
                     INSD:EL250243.1,INSD:EH980199.1,INSD:BP580467.1,
                     INSD:EL156531.1,INSD:BP587614.1,INSD:ES158790.1,
                     INSD:EL107749.1,INSD:AV818324.1,INSD:BP781609.1,
                     INSD:BP819746.1,INSD:EL194904.1,INSD:BP817564.1,
                     INSD:BP839099.1,INSD:AV815918.1,INSD:BP853160.1,
                     INSD:EL167778.1,INSD:BP814760.1,INSD:BP826297.1,
                     INSD:AV538973.1,INSD:EH833028.1,INSD:EL167612.1,
                     INSD:ES083436.1,INSD:BP659038.1,INSD:BP617020.1,
                     INSD:EL301366.1,INSD:EH836093.1,INSD:EL127294.1,
                     INSD:BP829986.1,INSD:EL132148.1,INSD:BP834227.1,
                     INSD:AV559218.1,INSD:BP573238.1,INSD:DR377005.1,
                     INSD:AA713065.1,INSD:AV829995.1,INSD:ES115171.1,
                     INSD:BP569243.1,INSD:BP626181.1,INSD:AV521800.1,
                     INSD:AV808763.1,INSD:EL002915.1,INSD:BP648354.1,
                     INSD:BP828283.1,INSD:DR375941.1,INSD:ES196117.1,
                     INSD:EH867785.1,INSD:EL206909.1,INSD:EL198145.1,
                     INSD:EL126351.1,INSD:BE038626.1,INSD:ES102883.1,
                     INSD:BP828458.1,INSD:CA781263.1,INSD:BP861909.1,
                     INSD:BP782835.1,INSD:AV548193.1,INSD:BP655017.1,
                     INSD:EL975760.1,INSD:BP790669.1,INSD:EH929245.1,
                     INSD:BP787796.1,INSD:ES124627.1,INSD:BP817239.1,
                     INSD:ES155000.1,INSD:ES107807.1,INSD:BP823220.1,
                     INSD:CA781909.1,INSD:AA067577.1,INSD:EH797732.1,
                     INSD:ES097066.1,INSD:BP638897.1,INSD:BP824632.1,
                     INSD:AV537285.1,INSD:AV812997.1,INSD:BP635742.1,
                     INSD:BP778275.1,INSD:AV549008.1,INSD:DR269194.1,
                     INSD:EL279133.1,INSD:ES188271.1,INSD:BP639835.1,
                     INSD:EL271546.1,INSD:BP785610.1,INSD:BP648287.1,
                     INSD:EH874387.1,INSD:BP562493.2,INSD:BP851716.1,
                     INSD:AV521655.1,INSD:BP809212.1,INSD:EL332031.1,
                     INSD:ES143217.1,INSD:EL024006.1,INSD:BP790563.1,
                     INSD:DR223434.1,INSD:EH934377.1,INSD:EL163390.1,
                     INSD:EL322442.1,INSD:EL260366.1,INSD:BP792922.1,
                     INSD:AV824100.1,INSD:BP785615.1,INSD:EH850717.1,
                     INSD:CA782041.1,INSD:BU635746.1,INSD:EH965526.1,
                     INSD:EL984458.1,INSD:ES102362.1,INSD:AV565870.1,
                     INSD:AV792388.1,INSD:BP645916.1,INSD:EH956629.1,
                     INSD:EH879519.1,INSD:ES023245.1,INSD:EH880925.1,
                     INSD:ES074704.1,INSD:BP641249.1,INSD:BP783531.1,
                     INSD:BP851274.1,INSD:EH880727.1,INSD:AV549965.1,
                     INSD:BP670843.1,INSD:EL228763.1,INSD:BP781264.1,
                     INSD:BP794805.1,INSD:AV810851.1,INSD:EL302557.1,
                     INSD:BP573008.1,INSD:AV798044.1,INSD:EL239832.1,
                     INSD:AV785249.1,INSD:BP636692.1,INSD:EH951800.1,
                     INSD:DR379854.1,INSD:DR269193.1,INSD:CK120046.1,
                     INSD:BP863422.2,INSD:AV551310.1,INSD:BP601001.1,
                     INSD:EL970092.1,INSD:BP643986.1,INSD:BP786327.1,
                     INSD:EL253848.1,INSD:EH859898.1,INSD:BP821834.2,
                     INSD:BP638129.1,INSD:EL067240.1,INSD:BP786662.1,
                     INSD:AV809033.1,INSD:AV828457.1,INSD:BP659090.1,
                     INSD:AV548976.1,INSD:EH908347.1,INSD:BE528115.1,
                     INSD:BP622388.1,INSD:BP655690.1,INSD:AA597921.1,
                     INSD:EL073409.1,INSD:BP779607.1,INSD:ES010164.1,
                     INSD:AV790386.1,INSD:AV805604.1,INSD:BP616775.1,
                     INSD:AV542154.1,INSD:AV791549.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:U43709.1,INSD:BT002753.1,INSD:X94756.1,
                     INSD:BX823490.1,INSD:AY091062.1,INSD:U83500.1,
                     INSD:AY094438.1"
                     /db_xref="TAIR:AT3G01120"
                     /db_xref="Araport:AT3G01120"
     CDS             complement(join(39234..39357,39464..39582,39674..39769,
                     39857..39964,40043..40129,40224..40427,40508..40567,
                     40668..40836,40944..41017,41136..41239,41319..41865))
                     /gene="MTO1"
                     /locus_tag="AT3G01120"
                     /gene_synonym="A. THALIANA CYSTATHIONINE GAMMA-SYNTHASE 1"
                     /gene_synonym="A. thaliana cystathionine gamma-synthetase
                     1"
                     /gene_synonym="AtCGS1"
                     /gene_synonym="AtCYS1"
                     /gene_synonym="ATCYS1"
                     /gene_synonym="CGS"
                     /gene_synonym="CGS1"
                     /gene_synonym="CYSTATHIONINE GAMMA-SYNTHASE"
                     /gene_synonym="CYSTATHIONINE GAMMA-SYNTHASE 1"
                     /gene_synonym="CYSTATHIONINE-GAMMA-SYNTHASE"
                     /gene_synonym="METHIONINE OVERACCUMULATION 1"
                     /gene_synonym="T4P13.19"
                     /gene_synonym="T4P13_19"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES200492.1,INSD:EL232302.1,INSD:ES025148.1,
                     INSD:BP789251.1,INSD:AV541172.1,INSD:EH807580.1,
                     INSD:BP570838.1,INSD:BP778829.1,INSD:EL126325.1,
                     INSD:EL188097.1,INSD:BP620154.1,INSD:EH804690.1,
                     INSD:EL184816.1,INSD:BP834006.1,INSD:AV792954.1,
                     INSD:BE526007.1,INSD:ES146422.1,INSD:DR231403.1,
                     INSD:BP564712.1,INSD:BP781720.1,INSD:BP779299.1,
                     INSD:EH883710.1,INSD:BP834271.1,INSD:EL315542.1,
                     INSD:BP618578.1,INSD:AV829821.1,INSD:EL333696.1,
                     INSD:EH901277.1,INSD:AV544715.1,INSD:EL146228.1,
                     INSD:BP801217.1,INSD:AI994530.1,INSD:N96185.1,
                     INSD:AV803329.1,INSD:R65080.1,INSD:R29827.1,
                     INSD:BP658302.1,INSD:EL062068.1,INSD:BP653261.1,
                     INSD:EL083476.1,INSD:BP861691.1,INSD:BP787457.1,
                     INSD:EH940542.1,INSD:Z18175.1,INSD:EL046384.1,
                     INSD:EL250243.1,INSD:EH980199.1,INSD:BP580467.1,
                     INSD:EL156531.1,INSD:BP587614.1,INSD:ES158790.1,
                     INSD:EL107749.1,INSD:AV818324.1,INSD:BP781609.1,
                     INSD:BP819746.1,INSD:EL194904.1,INSD:BP817564.1,
                     INSD:BP839099.1,INSD:AV815918.1,INSD:BP853160.1,
                     INSD:EL167778.1,INSD:BP814760.1,INSD:BP826297.1,
                     INSD:AV538973.1,INSD:EH833028.1,INSD:EL167612.1,
                     INSD:ES083436.1,INSD:BP659038.1,INSD:BP617020.1,
                     INSD:EL301366.1,INSD:EH836093.1,INSD:EL127294.1,
                     INSD:BP829986.1,INSD:EL132148.1,INSD:BP834227.1,
                     INSD:AV559218.1,INSD:BP573238.1,INSD:DR377005.1,
                     INSD:AA713065.1,INSD:AV829995.1,INSD:ES115171.1,
                     INSD:BP569243.1,INSD:BP626181.1,INSD:AV521800.1,
                     INSD:AV808763.1,INSD:EL002915.1,INSD:BP648354.1,
                     INSD:BP828283.1,INSD:DR375941.1,INSD:ES196117.1,
                     INSD:EH867785.1,INSD:EL206909.1,INSD:EL198145.1,
                     INSD:EL126351.1,INSD:BE038626.1,INSD:ES102883.1,
                     INSD:BP828458.1,INSD:CA781263.1,INSD:BP861909.1,
                     INSD:BP782835.1,INSD:AV548193.1,INSD:BP655017.1,
                     INSD:EL975760.1,INSD:BP790669.1,INSD:EH929245.1,
                     INSD:BP787796.1,INSD:ES124627.1,INSD:BP817239.1,
                     INSD:ES155000.1,INSD:ES107807.1,INSD:BP823220.1,
                     INSD:CA781909.1,INSD:AA067577.1,INSD:EH797732.1,
                     INSD:ES097066.1,INSD:BP638897.1,INSD:BP824632.1,
                     INSD:AV537285.1,INSD:AV812997.1,INSD:BP635742.1,
                     INSD:BP778275.1,INSD:AV549008.1,INSD:DR269194.1,
                     INSD:EL279133.1,INSD:ES188271.1,INSD:BP639835.1,
                     INSD:EL271546.1,INSD:BP785610.1,INSD:BP648287.1,
                     INSD:EH874387.1,INSD:BP562493.2,INSD:BP851716.1,
                     INSD:AV521655.1,INSD:BP809212.1,INSD:EL332031.1,
                     INSD:ES143217.1,INSD:EL024006.1,INSD:BP790563.1,
                     INSD:DR223434.1,INSD:EH934377.1,INSD:EL163390.1,
                     INSD:EL322442.1,INSD:EL260366.1,INSD:BP792922.1,
                     INSD:AV824100.1,INSD:BP785615.1,INSD:EH850717.1,
                     INSD:CA782041.1,INSD:BU635746.1,INSD:EH965526.1,
                     INSD:EL984458.1,INSD:ES102362.1,INSD:AV565870.1,
                     INSD:AV792388.1,INSD:BP645916.1,INSD:EH956629.1,
                     INSD:EH879519.1,INSD:ES023245.1,INSD:EH880925.1,
                     INSD:ES074704.1,INSD:BP641249.1,INSD:BP783531.1,
                     INSD:BP851274.1,INSD:EH880727.1,INSD:AV549965.1,
                     INSD:BP670843.1,INSD:EL228763.1,INSD:BP781264.1,
                     INSD:BP794805.1,INSD:AV810851.1,INSD:EL302557.1,
                     INSD:BP573008.1,INSD:AV798044.1,INSD:EL239832.1,
                     INSD:AV785249.1,INSD:BP636692.1,INSD:EH951800.1,
                     INSD:DR379854.1,INSD:DR269193.1,INSD:CK120046.1,
                     INSD:BP863422.2,INSD:AV551310.1,INSD:BP601001.1,
                     INSD:EL970092.1,INSD:BP643986.1,INSD:BP786327.1,
                     INSD:EL253848.1,INSD:EH859898.1,INSD:BP821834.2,
                     INSD:BP638129.1,INSD:EL067240.1,INSD:BP786662.1,
                     INSD:AV809033.1,INSD:AV828457.1,INSD:BP659090.1,
                     INSD:AV548976.1,INSD:EH908347.1,INSD:BE528115.1,
                     INSD:BP622388.1,INSD:BP655690.1,INSD:AA597921.1,
                     INSD:EL073409.1,INSD:BP779607.1,INSD:ES010164.1,
                     INSD:AV790386.1,INSD:AV805604.1,INSD:BP616775.1,
                     INSD:AV542154.1,INSD:AV791549.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:U43709.1,INSD:BT002753.1,INSD:X94756.1,
                     INSD:BX823490.1,INSD:AY091062.1,INSD:U83500.1,
                     INSD:AY094438.1"
                     /note="METHIONINE OVERACCUMULATION 1 (MTO1); FUNCTIONS IN:
                     cystathionine gamma-synthase activity; INVOLVED IN:
                     methionine biosynthetic process; LOCATED IN: chloroplast;
                     EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 15
                     growth stages; CONTAINS InterPro DOMAIN/s: Pyridoxal
                     phosphate-dependent transferase, major domain
                     (InterPro:IPR015424), Cys/Met metabolism, pyridoxal
                     phosphate-dependent enzyme (InterPro:IPR000277), Pyridoxal
                     phosphate-dependent transferase, major region, subdomain 1
                     (InterPro:IPR015421), Pyridoxal phosphate-dependent
                     transferase, major region, subdomain 2
                     (InterPro:IPR015422); BEST Arabidopsis thaliana protein
                     match is: Pyridoxal phosphate (PLP)-dependent transferases
                     superfamily protein (TAIR:AT1G33320.1); Has 21364 Blast
                     hits to 20702 proteins in 2452 species: Archae - 220;
                     Bacteria - 11705; Metazoa - 241; Fungi - 842; Plants -
                     284; Viruses - 13; Other Eukaryotes - 8059 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="Pyridoxal phosphate (PLP)-dependent transferases
                     superfamily protein"
                     /protein_id="AEE73612.1"
                     /db_xref="TAIR:AT3G01120"
                     /db_xref="Araport:AT3G01120"
                     /translation="MAVSSFQCPTIFSSSSISGFQCRSDPDLVGSPVGGSSRRRVHAS
                     AGISSSFTGDAGLSSRILRFPPNFVRQLSIKARRNCSNIGVAQIVAAKWSNNPSSALP
                     SAAAAAATSSASAVSSAASAAAASSAAAAPVAAAPPVVLKSVDEEVVVAEEGIREKIG
                     SVQLTDSKHSFLSSDGSLTVHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKE
                     KRSVSFEYGRYGNPTTVVLEDKISALEGAESTLVMASGMCASTVMLLALVPAGGHIVT
                     TTDCYRKTRIFMENFLPKLGITVTVIDPADIAGLEAAVNEFKVSLFFTESPTNPFLRC
                     VDIELVSKICHKRGTLVCIDGTFATPLNQKALALGADLVVHSATKYIGGHNDVLAGCI
                     CGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHP
                     KVSHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFG
                     GCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI"
     gene            complement(44045..45809)
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /db_xref="Araport:AT3G01130"
                     /db_xref="TAIR:AT3G01130"
     mRNA            complement(join(44045..44761,45312..45377,45475..45809))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /product="ATP synthase E chain"
                     /db_xref="Araport:AT3G01130"
                     /db_xref="TAIR:AT3G01130"
     mRNA            complement(join(44045..45209,45312..45377,45475..45809))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /product="ATP synthase E chain"
                     /db_xref="Araport:AT3G01130"
                     /db_xref="TAIR:AT3G01130"
     mRNA            complement(join(44045..44761,44903..45377,45475..45809))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /product="ATP synthase E chain"
                     /db_xref="Araport:AT3G01130"
                     /db_xref="TAIR:AT3G01130"
     mRNA            complement(join(44045..44186,44427..44761,45312..45377,
                     45475..45724))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /product="ATP synthase E chain"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL980724.1,INSD:DR380218.1,INSD:EL152120.1,
                     INSD:EL031291.1,INSD:ES211609.1,INSD:EL991316.1,
                     INSD:ES110481.1,INSD:ES045903.1,INSD:CB263506.1,
                     INSD:EL169954.1,INSD:EH876771.1,INSD:EL025284.1,
                     INSD:ES139561.1,INSD:DR244289.1,INSD:EL077415.1,
                     INSD:EL096377.1,INSD:ES084046.1,INSD:BP797266.1,
                     INSD:EH884929.1,INSD:ES029282.1,INSD:EL028282.1,
                     INSD:ES173185.1,INSD:ES000219.1,INSD:ES197546.1,
                     INSD:EL044077.1,INSD:EH991087.1,INSD:AA597841.1,
                     INSD:ES024577.1,INSD:EL018779.1,INSD:ES019334.1,
                     INSD:EL077304.1,INSD:ES005587.1,INSD:AV522225.1,
                     INSD:ES003342.1,INSD:EH887090.1,INSD:ES011038.1,
                     INSD:CB263291.1,INSD:ES111579.1,INSD:EH808893.1,
                     INSD:ES074566.1,INSD:EG482396.1,INSD:ES043941.1,
                     INSD:DR244286.1,INSD:EL034073.1,INSD:EH823238.1,
                     INSD:DR244285.1,INSD:ES176724.1,INSD:ES001897.1,
                     INSD:ES062105.1,INSD:EL973880.1,INSD:BP810951.1,
                     INSD:EG482380.1,INSD:EL046201.1,INSD:EH973532.1,
                     INSD:ES073328.1,INSD:ES194244.1,INSD:DR244287.1,
                     INSD:ES119001.1,INSD:DR244284.1,INSD:EL334272.1,
                     INSD:ES209391.1,INSD:DR244288.1,INSD:EH961712.1,
                     INSD:BP798546.1,INSD:EL309576.1,INSD:EH910276.1,
                     INSD:ES050422.1,INSD:ES060572.1,INSD:EH890125.1,
                     INSD:EH986998.1,INSD:ES059254.1,INSD:ES094375.1,
                     INSD:EL301544.1,INSD:ES155525.1,INSD:BE524225.1,
                     INSD:EG482404.1,INSD:ES207334.1,INSD:EL243991.1,
                     INSD:ES001940.1,INSD:AM111228.1,INSD:EH804088.1,
                     INSD:EL308981.1,INSD:EL317704.1,INSD:ES083338.1,
                     INSD:ES055770.1,INSD:EL969890.1,INSD:EH809664.1,
                     INSD:ES021453.1,INSD:ES064284.1,INSD:EH946343.1,
                     INSD:EL283087.1,INSD:EL303744.1,INSD:EL034843.1,
                     INSD:EG482394.1,INSD:ES002217.1,INSD:ES036414.1,
                     INSD:EL987127.1,INSD:ES158324.1,INSD:ES155255.1,
                     INSD:ES138889.1,INSD:EH957934.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX823504.1,INSD:BT025695.1"
                     /db_xref="TAIR:AT3G01130"
                     /db_xref="Araport:AT3G01130"
     mRNA            complement(join(44045..44186,44427..45209,45312..45377,
                     45475..45724))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /product="ATP synthase E chain"
                     /db_xref="Araport:AT3G01130"
                     /db_xref="TAIR:AT3G01130"
     mRNA            complement(join(44045..44186,44427..45212,45312..45377,
                     45475..45724))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /product="ATP synthase E chain"
                     /db_xref="Araport:AT3G01130"
                     /db_xref="TAIR:AT3G01130"
     mRNA            complement(join(44045..44186,44427..44761,45142..45377,
                     45475..45654))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /product="ATP synthase E chain"
                     /db_xref="Araport:AT3G01130"
                     /db_xref="TAIR:AT3G01130"
     mRNA            complement(join(44045..44186,44427..44761,44903..44949,
                     45312..45377,45475..45590))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /product="ATP synthase E chain"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL973880.1,INSD:ES062105.1,INSD:DR348181.1,
                     INSD:EG482380.1,INSD:EL046201.1,INSD:EH973532.1,
                     INSD:EL980724.1,INSD:ES073328.1,INSD:EL152120.1,
                     INSD:EL031291.1,INSD:ES110481.1,INSD:EL991316.1,
                     INSD:ES211609.1,INSD:ES194244.1,INSD:ES119001.1,
                     INSD:ES045903.1,INSD:ES209391.1,INSD:EL334272.1,
                     INSD:EH961712.1,INSD:EL169954.1,INSD:EH876771.1,
                     INSD:EL025284.1,INSD:EL309576.1,INSD:EH910276.1,
                     INSD:ES050422.1,INSD:ES060572.1,INSD:DR372693.1,
                     INSD:EH890125.1,INSD:EH986998.1,INSD:ES059254.1,
                     INSD:EL077415.1,INSD:ES094375.1,INSD:DR348179.1,
                     INSD:ES155525.1,INSD:EL096377.1,INSD:EL301544.1,
                     INSD:EG482404.1,INSD:EH884929.1,INSD:ES207334.1,
                     INSD:DR348180.1,INSD:ES029282.1,INSD:DR348184.1,
                     INSD:EL028282.1,INSD:EL243991.1,INSD:EH804088.1,
                     INSD:EL308981.1,INSD:EL317704.1,INSD:ES083338.1,
                     INSD:ES197546.1,INSD:ES055770.1,INSD:EL044077.1,
                     INSD:EL969890.1,INSD:DR348178.1,INSD:EH991087.1,
                     INSD:EL018779.1,INSD:EH946343.1,INSD:ES019334.1,
                     INSD:ES005587.1,INSD:EL077304.1,INSD:EL283087.1,
                     INSD:ES003342.1,INSD:EH887090.1,INSD:DR348185.1,
                     INSD:EL034843.1,INSD:EL303744.1,INSD:EG482394.1,
                     INSD:ES011038.1,INSD:DR348182.1,INSD:ES111579.1,
                     INSD:ES036414.1,INSD:ES002217.1,INSD:ES074566.1,
                     INSD:EH808893.1,INSD:DR348183.1,INSD:EL987127.1,
                     INSD:ES043941.1,INSD:EG482396.1,INSD:ES158324.1,
                     INSD:ES155255.1,INSD:EL034073.1,INSD:ES138889.1,
                     INSD:EH823238.1,INSD:EH957934.1,INSD:ES176724.1,
                     INSD:ES001897.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:AY085714.1"
                     /db_xref="TAIR:AT3G01130"
                     /db_xref="Araport:AT3G01130"
     CDS             complement(join(44714..44761,45312..45377,45475..45522))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /codon_start=1
                     /product="ATP synthase E chain"
                     /protein_id="ANM64363.1"
                     /db_xref="Araport:AT3G01130"
                     /db_xref="TAIR:AT3G01130"
                     /translation="MAPPPGLYSGTSTLALVARASAFGLGLIYGNIKLKALKIKKNSQ
                     IKAEAKAHH"
     CDS             complement(join(44714..44761,45312..45377,45475..45522))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL980724.1,INSD:DR380218.1,INSD:EL152120.1,
                     INSD:EL031291.1,INSD:ES211609.1,INSD:EL991316.1,
                     INSD:ES110481.1,INSD:ES045903.1,INSD:CB263506.1,
                     INSD:EL169954.1,INSD:EH876771.1,INSD:EL025284.1,
                     INSD:ES139561.1,INSD:DR244289.1,INSD:EL077415.1,
                     INSD:EL096377.1,INSD:ES084046.1,INSD:BP797266.1,
                     INSD:EH884929.1,INSD:ES029282.1,INSD:EL028282.1,
                     INSD:ES173185.1,INSD:ES000219.1,INSD:ES197546.1,
                     INSD:EL044077.1,INSD:EH991087.1,INSD:AA597841.1,
                     INSD:ES024577.1,INSD:EL018779.1,INSD:ES019334.1,
                     INSD:EL077304.1,INSD:ES005587.1,INSD:AV522225.1,
                     INSD:ES003342.1,INSD:EH887090.1,INSD:ES011038.1,
                     INSD:CB263291.1,INSD:ES111579.1,INSD:EH808893.1,
                     INSD:ES074566.1,INSD:EG482396.1,INSD:ES043941.1,
                     INSD:DR244286.1,INSD:EL034073.1,INSD:EH823238.1,
                     INSD:DR244285.1,INSD:ES176724.1,INSD:ES001897.1,
                     INSD:ES062105.1,INSD:EL973880.1,INSD:BP810951.1,
                     INSD:EG482380.1,INSD:EL046201.1,INSD:EH973532.1,
                     INSD:ES073328.1,INSD:ES194244.1,INSD:DR244287.1,
                     INSD:ES119001.1,INSD:DR244284.1,INSD:EL334272.1,
                     INSD:ES209391.1,INSD:DR244288.1,INSD:EH961712.1,
                     INSD:BP798546.1,INSD:EL309576.1,INSD:EH910276.1,
                     INSD:ES050422.1,INSD:ES060572.1,INSD:EH890125.1,
                     INSD:EH986998.1,INSD:ES059254.1,INSD:ES094375.1,
                     INSD:EL301544.1,INSD:ES155525.1,INSD:BE524225.1,
                     INSD:EG482404.1,INSD:ES207334.1,INSD:EL243991.1,
                     INSD:ES001940.1,INSD:AM111228.1,INSD:EH804088.1,
                     INSD:EL308981.1,INSD:EL317704.1,INSD:ES083338.1,
                     INSD:ES055770.1,INSD:EL969890.1,INSD:EH809664.1,
                     INSD:ES021453.1,INSD:ES064284.1,INSD:EH946343.1,
                     INSD:EL283087.1,INSD:EL303744.1,INSD:EL034843.1,
                     INSD:EG482394.1,INSD:ES002217.1,INSD:ES036414.1,
                     INSD:EL987127.1,INSD:ES158324.1,INSD:ES155255.1,
                     INSD:ES138889.1,INSD:EH957934.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX823504.1,INSD:BT025695.1"
                     /note="unknown protein; FUNCTIONS IN: molecular_function
                     unknown; INVOLVED IN: biological_process unknown; LOCATED
                     IN: endomembrane system; EXPRESSED IN: male gametophyte,
                     pollen tube; EXPRESSED DURING: M germinated pollen stage;
                     BEST Arabidopsis thaliana protein match is: unknown
                     protein (TAIR:AT5G15320.1); Has 64 Blast hits to 64
                     proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa
                     - 0; Fungi - 0; Plants - 64; Viruses - 0; Other Eukaryotes
                     - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ATP synthase E chain"
                     /protein_id="AEE73613.1"
                     /db_xref="TAIR:AT3G01130"
                     /db_xref="Araport:AT3G01130"
                     /translation="MAPPPGLYSGTSTLALVARASAFGLGLIYGNIKLKALKIKKNSQ
                     IKAEAKAHH"
     CDS             complement(join(44911..44949,45312..45377,45475..45522))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL973880.1,INSD:ES062105.1,INSD:DR348181.1,
                     INSD:EG482380.1,INSD:EL046201.1,INSD:EH973532.1,
                     INSD:EL980724.1,INSD:ES073328.1,INSD:EL152120.1,
                     INSD:EL031291.1,INSD:ES110481.1,INSD:EL991316.1,
                     INSD:ES211609.1,INSD:ES194244.1,INSD:ES119001.1,
                     INSD:ES045903.1,INSD:ES209391.1,INSD:EL334272.1,
                     INSD:EH961712.1,INSD:EL169954.1,INSD:EH876771.1,
                     INSD:EL025284.1,INSD:EL309576.1,INSD:EH910276.1,
                     INSD:ES050422.1,INSD:ES060572.1,INSD:DR372693.1,
                     INSD:EH890125.1,INSD:EH986998.1,INSD:ES059254.1,
                     INSD:EL077415.1,INSD:ES094375.1,INSD:DR348179.1,
                     INSD:ES155525.1,INSD:EL096377.1,INSD:EL301544.1,
                     INSD:EG482404.1,INSD:EH884929.1,INSD:ES207334.1,
                     INSD:DR348180.1,INSD:ES029282.1,INSD:DR348184.1,
                     INSD:EL028282.1,INSD:EL243991.1,INSD:EH804088.1,
                     INSD:EL308981.1,INSD:EL317704.1,INSD:ES083338.1,
                     INSD:ES197546.1,INSD:ES055770.1,INSD:EL044077.1,
                     INSD:EL969890.1,INSD:DR348178.1,INSD:EH991087.1,
                     INSD:EL018779.1,INSD:EH946343.1,INSD:ES019334.1,
                     INSD:ES005587.1,INSD:EL077304.1,INSD:EL283087.1,
                     INSD:ES003342.1,INSD:EH887090.1,INSD:DR348185.1,
                     INSD:EL034843.1,INSD:EL303744.1,INSD:EG482394.1,
                     INSD:ES011038.1,INSD:DR348182.1,INSD:ES111579.1,
                     INSD:ES036414.1,INSD:ES002217.1,INSD:ES074566.1,
                     INSD:EH808893.1,INSD:DR348183.1,INSD:EL987127.1,
                     INSD:ES043941.1,INSD:EG482396.1,INSD:ES158324.1,
                     INSD:ES155255.1,INSD:EL034073.1,INSD:ES138889.1,
                     INSD:EH823238.1,INSD:EH957934.1,INSD:ES176724.1,
                     INSD:ES001897.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:AY085714.1"
                     /note="unknown protein; FUNCTIONS IN: molecular_function
                     unknown; INVOLVED IN: biological_process unknown;
                     EXPRESSED IN: male gametophyte, pollen tube; EXPRESSED
                     DURING: M germinated pollen stage; BEST Arabidopsis
                     thaliana protein match is: unknown protein
                     (TAIR:AT5G15320.1); Has 64 Blast hits to 64 proteins in 11
                     species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
                     Plants - 64; Viruses - 0; Other Eukaryotes - 0 (source:
                     NCBI BLink)."
                     /codon_start=1
                     /product="ATP synthase E chain"
                     /protein_id="AEE73614.1"
                     /db_xref="TAIR:AT3G01130"
                     /db_xref="Araport:AT3G01130"
                     /translation="MAPPPGLYSGTSTLALVARASAFGLGLIYGNIKLKALKHKFAML
                     CLVSKP"
     CDS             complement(join(45177..45209,45312..45377,45475..45522))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /codon_start=1
                     /product="ATP synthase E chain"
                     /protein_id="ANM64364.1"
                     /db_xref="Araport:AT3G01130"
                     /db_xref="TAIR:AT3G01130"
                     /translation="MAPPPGLYSGTSTLALVARASAFGLGLIYGNIKLKALKQIRMFM
                     AFEL"
     CDS             complement(join(45177..45209,45312..45377,45475..45522))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /codon_start=1
                     /product="ATP synthase E chain"
                     /protein_id="ANM64365.1"
                     /db_xref="Araport:AT3G01130"
                     /db_xref="TAIR:AT3G01130"
                     /translation="MAPPPGLYSGTSTLALVARASAFGLGLIYGNIKLKALKQIRMFM
                     AFEL"
     CDS             complement(join(45177..45212,45312..45377,45475..45522))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /codon_start=1
                     /product="ATP synthase E chain"
                     /protein_id="ANM64361.1"
                     /db_xref="Araport:AT3G01130"
                     /db_xref="TAIR:AT3G01130"
                     /translation="MAPPPGLYSGTSTLALVARASAFGLGLIYGNIKLKALKQQIRMF
                     MAFEL"
     CDS             complement(join(45234..45377,45475..45522))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /codon_start=1
                     /product="ATP synthase E chain"
                     /protein_id="ANM64360.1"
                     /db_xref="Araport:AT3G01130"
                     /db_xref="TAIR:AT3G01130"
                     /translation="MAPPPGLYSGTSTLALVARASAFGLGLIYGNIKLKALKVHLSIF
                     LVLFLSDEKLFSLGFILTS"
     CDS             complement(join(45234..45377,45475..45522))
                     /locus_tag="AT3G01130"
                     /gene_synonym="T4P13.18"
                     /gene_synonym="T4P13_18"
                     /codon_start=1
                     /product="ATP synthase E chain"
                     /protein_id="ANM64362.1"
                     /db_xref="Araport:AT3G01130"
                     /db_xref="TAIR:AT3G01130"
                     /translation="MAPPPGLYSGTSTLALVARASAFGLGLIYGNIKLKALKVHLSIF
                     LVLFLSDEKLFSLGFILTS"
     gene            complement(46330..48296)
                     /gene="MYB106"
                     /locus_tag="AT3G01140"
                     /gene_synonym="AtMYB106"
                     /gene_synonym="myb domain protein 106"
                     /gene_synonym="NOECK"
                     /gene_synonym="NOK"
                     /gene_synonym="T4P13.17"
                     /gene_synonym="T4P13_17"
                     /note="Encodes a MIXTA-like MYB gene NOECK (NOK). Loss of
                     function mutations show an increased number of
                     branchpoints in leaf trichomes suggesting a role in
                     negative regulation of trichome branching."
                     /db_xref="Araport:AT3G01140"
                     /db_xref="TAIR:AT3G01140"
     mRNA            complement(join(46330..47040,47118..47470,47559..47688,
                     47773..47905))
                     /gene="MYB106"
                     /locus_tag="AT3G01140"
                     /gene_synonym="AtMYB106"
                     /gene_synonym="myb domain protein 106"
                     /gene_synonym="NOECK"
                     /gene_synonym="NOK"
                     /gene_synonym="T4P13.17"
                     /gene_synonym="T4P13_17"
                     /product="myb domain protein 106"
                     /db_xref="Araport:AT3G01140"
                     /db_xref="TAIR:AT3G01140"
     mRNA            complement(join(46396..47040,47118..47470,47559..47688,
                     47773..47897,48007..48296))
                     /gene="MYB106"
                     /locus_tag="AT3G01140"
                     /gene_synonym="AtMYB106"
                     /gene_synonym="myb domain protein 106"
                     /gene_synonym="NOECK"
                     /gene_synonym="NOK"
                     /gene_synonym="T4P13.17"
                     /gene_synonym="T4P13_17"
                     /product="myb domain protein 106"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR750661.1,INSD:EL203877.1,INSD:CK119118.1,
                     INSD:AU227806.1,INSD:ES179511.1,INSD:ES155256.1,
                     INSD:AV442579.1,INSD:DR750900.1,INSD:ES138486.1,
                     INSD:EG437263.1,INSD:EH941310.1"
                     /db_xref="TAIR:AT3G01140"
                     /db_xref="Araport:AT3G01140"
     CDS             complement(join(46619..47040,47118..47470,47559..47688,
                     47773..47897,48007..48143))
                     /gene="MYB106"
                     /locus_tag="AT3G01140"
                     /gene_synonym="AtMYB106"
                     /gene_synonym="myb domain protein 106"
                     /gene_synonym="NOECK"
                     /gene_synonym="NOK"
                     /gene_synonym="T4P13.17"
                     /gene_synonym="T4P13_17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR750661.1,INSD:EL203877.1,INSD:CK119118.1,
                     INSD:AU227806.1,INSD:ES179511.1,INSD:ES155256.1,
                     INSD:AV442579.1,INSD:DR750900.1,INSD:ES138486.1,
                     INSD:EG437263.1,INSD:EH941310.1"
                     /note="myb domain protein 106 (MYB106); FUNCTIONS IN: DNA
                     binding, sequence-specific DNA binding transcription
                     factor activity; INVOLVED IN: trichome branching,
                     regulation of transcription, DNA-dependent; EXPRESSED IN:
                     18 plant structures; EXPRESSED DURING: 7 growth stages;
                     CONTAINS InterPro DOMAIN/s: SANT, DNA-binding
                     (InterPro:IPR001005), Homeodomain-like
                     (InterPro:IPR009057), Myb, DNA-binding
                     (InterPro:IPR014778), Myb transcription factor
                     (InterPro:IPR015495), Homeodomain-related
                     (InterPro:IPR012287), HTH transcriptional regulator,
                     Myb-type, DNA-binding (InterPro:IPR017930); BEST
                     Arabidopsis thaliana protein match is: myb domain protein
                     16 (TAIR:AT5G15310.1); Has 8850 Blast hits to 8247
                     proteins in 477 species: Archae - 0; Bacteria - 0; Metazoa
                     - 708; Fungi - 505; Plants - 5831; Viruses - 3; Other
                     Eukaryotes - 1803 (source: NCBI BLink)."
                     /codon_start=1
                     /product="myb domain protein 106"
                     /protein_id="AEE73615.1"
                     /db_xref="TAIR:AT3G01140"
                     /db_xref="Araport:AT3G01140"
                     /translation="MPIHVRDREKGRLQNLNRDIFCCVSPSIYQSDAKRAAFVIILIM
                     IISPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTN
                     YLRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLI
                     KMGIDPVTHKHKNETLSSSTGQSKNAATLSHMAQWESARLEAEARLARESKLLHLQHY
                     QNNNNLNKSAAPQQHCFTQKTSTNWTKPNQGNGDQQLESPTSTVTFSENLLMPLGIPT
                     DSSRNRNNNNNESSAMIELAVSSSTSSDVSLVKEHEHDWIRQINCGSGGIGEGFTSLL
                     IGDSVGRGLPTGKNEATAGVGNESEYNYYEDNKNYWNSILNLVDSSPSDSATMF"
     CDS             complement(join(46619..47040,47118..47470,47559..47688,
                     47773..47905))
                     /gene="MYB106"
                     /locus_tag="AT3G01140"
                     /gene_synonym="AtMYB106"
                     /gene_synonym="myb domain protein 106"
                     /gene_synonym="NOECK"
                     /gene_synonym="NOK"
                     /gene_synonym="T4P13.17"
                     /gene_synonym="T4P13_17"
                     /codon_start=1
                     /product="myb domain protein 106"
                     /protein_id="ANM64392.1"
                     /db_xref="Araport:AT3G01140"
                     /db_xref="TAIR:AT3G01140"
                     /translation="MGRSPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKA
                     GLQRCGKSCRLRWTNYLRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDN
                     EIKNYWNTHLKKRLIKMGIDPVTHKHKNETLSSSTGQSKNAATLSHMAQWESARLEAE
                     ARLARESKLLHLQHYQNNNNLNKSAAPQQHCFTQKTSTNWTKPNQGNGDQQLESPTST
                     VTFSENLLMPLGIPTDSSRNRNNNNNESSAMIELAVSSSTSSDVSLVKEHEHDWIRQI
                     NCGSGGIGEGFTSLLIGDSVGRGLPTGKNEATAGVGNESEYNYYEDNKNYWNSILNLV
                     DSSPSDSATMF"
     gene            46718..48296
                     /locus_tag="AT3G01142"
                     /note="Natural antisense transcript overlaps with
                     AT3G01140;
                     Potential natural antisense gene, locus overlaps with
                     AT3G01140"
                     /db_xref="Araport:AT3G01142"
                     /db_xref="TAIR:AT3G01142"
     ncRNA           46718..48296
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT3G01142"
                     /product="other RNA"
                     /db_xref="Araport:AT3G01142"
                     /db_xref="TAIR:AT3G01142"
     gene            complement(48372..48583)
                     /locus_tag="AT3G00975"
                     /db_xref="Araport:AT3G00975"
     ncRNA           complement(48372..48583)
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT3G00975"
                     /product="other RNA"
                     /db_xref="Araport:AT3G00975"
     gene            51496..54544
                     /gene="PTB1"
                     /locus_tag="AT3G01150"
                     /gene_synonym="ATPTB1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING"
                     /gene_synonym="polypyrimidine tract-binding protein 1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING PROTEIN 1"
                     /gene_synonym="PTB"
                     /gene_synonym="T4P13.16"
                     /gene_synonym="T4P13_16"
                     /note="Encodes one of the two polypyrimidine tract-binding
                     (PTB) protein homologs in the Arabidopsis genome. Double
                     mutants have defects in pollen germination."
                     /db_xref="Araport:AT3G01150"
                     /db_xref="TAIR:AT3G01150"
     mRNA            join(51496..51914,52155..52364,52645..52746,52889..52951,
                     53043..53212,53300..53357,53452..53556,53636..53717,
                     53846..53958,54129..54544)
                     /gene="PTB1"
                     /locus_tag="AT3G01150"
                     /gene_synonym="ATPTB1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING"
                     /gene_synonym="polypyrimidine tract-binding protein 1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING PROTEIN 1"
                     /gene_synonym="PTB"
                     /gene_synonym="T4P13.16"
                     /gene_synonym="T4P13_16"
                     /product="polypyrimidine tract-binding protein 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES105956.1,INSD:EL124653.1,INSD:EG427811.1,
                     INSD:T42135.1,INSD:DR299213.1,INSD:ES020955.1,
                     INSD:CF774130.1,INSD:DR371069.1,INSD:EH897835.1,
                     INSD:T04473.1,INSD:EL265989.1,INSD:EL191737.1,
                     INSD:DR299216.1,INSD:DR299214.1,INSD:BE530321.1,
                     INSD:DR299211.1,INSD:ES016377.1,INSD:EL252275.1,
                     INSD:BP794786.1,INSD:DR299215.1,INSD:DR299217.1,
                     INSD:DR299208.1,INSD:ES168313.1,INSD:DR299218.1,
                     INSD:AV807552.1,INSD:AV809137.1,INSD:DR299210.1,
                     INSD:EL028796.1,INSD:AV441089.1,INSD:EL263814.1,
                     INSD:AV829325.1,INSD:AV536210.1,INSD:DR299206.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:BX823271.1"
                     /db_xref="TAIR:AT3G01150"
                     /db_xref="Araport:AT3G01150"
     mRNA            join(51496..51914,52155..52364,52889..52951,53043..53212,
                     53300..53357,53452..53556,53636..53717,53846..53958,
                     54129..54544)
                     /gene="PTB1"
                     /locus_tag="AT3G01150"
                     /gene_synonym="ATPTB1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING"
                     /gene_synonym="polypyrimidine tract-binding protein 1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING PROTEIN 1"
                     /gene_synonym="PTB"
                     /gene_synonym="T4P13.16"
                     /gene_synonym="T4P13_16"
                     /product="polypyrimidine tract-binding protein 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES105956.1,INSD:EL124653.1,INSD:EG427811.1,
                     INSD:T42135.1,INSD:DR299213.1,INSD:ES020955.1,
                     INSD:CF774130.1,INSD:DR371069.1,INSD:EH897835.1,
                     INSD:T04473.1,INSD:DR299207.1,INSD:EL265989.1,
                     INSD:DR299212.1,INSD:EL191737.1,INSD:DR299216.1,
                     INSD:DR299214.1,INSD:BE530321.1,INSD:DR299211.1,
                     INSD:EL252275.1,INSD:ES016377.1,INSD:BP794786.1,
                     INSD:DR299215.1,INSD:DR299219.1,INSD:DR299217.1,
                     INSD:DR299208.1,INSD:ES168313.1,INSD:DR357367.1,
                     INSD:DR299218.1,INSD:AV807552.1,INSD:AV809137.1,
                     INSD:DR299210.1,INSD:EL028796.1,INSD:AV441089.1,
                     INSD:AV552212.1,INSD:EL263814.1,INSD:AV829325.1,
                     INSD:AV536210.1,INSD:DR299206.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX823271.1,INSD:AF076924.1,INSD:BX825797.1,
                     INSD:BX822327.1"
                     /db_xref="TAIR:AT3G01150"
                     /db_xref="Araport:AT3G01150"
     mRNA            join(51496..51914,52155..52364,52889..52951,53043..53212,
                     53300..53357,53452..53556,53636..53717,53846..53911,
                     54129..54544)
                     /gene="PTB1"
                     /locus_tag="AT3G01150"
                     /gene_synonym="ATPTB1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING"
                     /gene_synonym="polypyrimidine tract-binding protein 1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING PROTEIN 1"
                     /gene_synonym="PTB"
                     /gene_synonym="T4P13.16"
                     /gene_synonym="T4P13_16"
                     /product="polypyrimidine tract-binding protein 1"
                     /db_xref="Araport:AT3G01150"
                     /db_xref="TAIR:AT3G01150"
     mRNA            join(51542..51914,52155..52364,52645..52746,52889..52951,
                     53043..53212,53300..53357,53452..53556,53636..53717,
                     53846..53911,54129..54535)
                     /gene="PTB1"
                     /locus_tag="AT3G01150"
                     /gene_synonym="ATPTB1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING"
                     /gene_synonym="polypyrimidine tract-binding protein 1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING PROTEIN 1"
                     /gene_synonym="PTB"
                     /gene_synonym="T4P13.16"
                     /gene_synonym="T4P13_16"
                     /product="polypyrimidine tract-binding protein 1"
                     /db_xref="Araport:AT3G01150"
                     /db_xref="TAIR:AT3G01150"
     CDS             join(51732..51914,52155..52364,52889..52951,53043..53212,
                     53300..53357,53452..53556,53636..53717,53846..53958,
                     54129..54344)
                     /gene="PTB1"
                     /locus_tag="AT3G01150"
                     /gene_synonym="ATPTB1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING"
                     /gene_synonym="polypyrimidine tract-binding protein 1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING PROTEIN 1"
                     /gene_synonym="PTB"
                     /gene_synonym="T4P13.16"
                     /gene_synonym="T4P13_16"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES105956.1,INSD:EL124653.1,INSD:EG427811.1,
                     INSD:T42135.1,INSD:DR299213.1,INSD:ES020955.1,
                     INSD:CF774130.1,INSD:DR371069.1,INSD:EH897835.1,
                     INSD:T04473.1,INSD:DR299207.1,INSD:EL265989.1,
                     INSD:DR299212.1,INSD:EL191737.1,INSD:DR299216.1,
                     INSD:DR299214.1,INSD:BE530321.1,INSD:DR299211.1,
                     INSD:EL252275.1,INSD:ES016377.1,INSD:BP794786.1,
                     INSD:DR299215.1,INSD:DR299219.1,INSD:DR299217.1,
                     INSD:DR299208.1,INSD:ES168313.1,INSD:DR357367.1,
                     INSD:DR299218.1,INSD:AV807552.1,INSD:AV809137.1,
                     INSD:DR299210.1,INSD:EL028796.1,INSD:AV441089.1,
                     INSD:AV552212.1,INSD:EL263814.1,INSD:AV829325.1,
                     INSD:AV536210.1,INSD:DR299206.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX823271.1,INSD:AF076924.1,INSD:BX825797.1,
                     INSD:BX822327.1"
                     /note="polypyrimidine tract-binding protein 1 (PTB1);
                     FUNCTIONS IN: RNA binding, nucleotide binding, nucleic
                     acid binding; INVOLVED IN: pollen germination, regulation
                     of RNA splicing, regulation of translation; LOCATED IN:
                     nucleus, cytoplasmic mRNA processing body, cytoplasm;
                     EXPRESSED IN: 28 plant structures; EXPRESSED DURING: 14
                     growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition
                     motif, RNP-1 (InterPro:IPR000504), Nucleotide-binding,
                     alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis
                     thaliana protein match is: polypyrimidine tract-binding
                     protein 2 (TAIR:AT5G53180.1); Has 1792 Blast hits to 964
                     proteins in 150 species: Archae - 0; Bacteria - 0; Metazoa
                     - 1278; Fungi - 41; Plants - 303; Viruses - 0; Other
                     Eukaryotes - 170 (source: NCBI BLink)."
                     /codon_start=1
                     /product="polypyrimidine tract-binding protein 1"
                     /protein_id="AEE73616.1"
                     /db_xref="TAIR:AT3G01150"
                     /db_xref="Araport:AT3G01150"
                     /translation="MSSSGQTQFRYTQTPSKVVHLRNLPWECVEEELIDLCKRFGKIV
                     NTKSNVGANRNQAFVEFADLNQAISMVSYYASSSEPAQIRGKTVYIQYSNRHEIVNNQ
                     SPGDVPGNVLLVTFEGVESHEVSIDVIHLVFSAFGFVHKIATFEKAAGFQALVQFTDV
                     ETASAARSALDGRSIPRYLLSAHVGSCSLRMSYSAHTDLNIKFQSHRSRDYTNPYLPV
                     NQTAMDGSMQPALGADGKKVESQSNVLLGLIENMQYAVTVDVLHTVFSAYGTVQKIAI
                     FEKNGSTQALIQYSDIPTAAMAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKAFSDKS
                     RDYTLPDLSLLVAQKGPAVSGSAPPAGWQNPQAQSQYSGYGGSPYMYPSSDPNGASPS
                     GQPPYYG"
     CDS             join(51732..51914,52155..52364,52889..52951,53043..53212,
                     53300..53357,53452..53556,53636..53717,53846..53911,
                     54129..54136)
                     /gene="PTB1"
                     /locus_tag="AT3G01150"
                     /gene_synonym="ATPTB1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING"
                     /gene_synonym="polypyrimidine tract-binding protein 1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING PROTEIN 1"
                     /gene_synonym="PTB"
                     /gene_synonym="T4P13.16"
                     /gene_synonym="T4P13_16"
                     /codon_start=1
                     /product="polypyrimidine tract-binding protein 1"
                     /protein_id="ANM65687.1"
                     /db_xref="Araport:AT3G01150"
                     /db_xref="TAIR:AT3G01150"
                     /translation="MSSSGQTQFRYTQTPSKVVHLRNLPWECVEEELIDLCKRFGKIV
                     NTKSNVGANRNQAFVEFADLNQAISMVSYYASSSEPAQIRGKTVYIQYSNRHEIVNNQ
                     SPGDVPGNVLLVTFEGVESHEVSIDVIHLVFSAFGFVHKIATFEKAAGFQALVQFTDV
                     ETASAARSALDGRSIPRYLLSAHVGSCSLRMSYSAHTDLNIKFQSHRSRDYTNPYLPV
                     NQTAMDGSMQPALGADGKKVESQSNVLLGLIENMQYAVTVDVLHTVFSAYGTVQKIAI
                     FEKNGSTQALIQYSDIPTAAMAKEALEGHCIYDGGYCF"
     CDS             join(52729..52746,52889..52951,53043..53212,53300..53357,
                     53452..53556,53636..53717,53846..53958,54129..54344)
                     /gene="PTB1"
                     /locus_tag="AT3G01150"
                     /gene_synonym="ATPTB1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING"
                     /gene_synonym="polypyrimidine tract-binding protein 1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING PROTEIN 1"
                     /gene_synonym="PTB"
                     /gene_synonym="T4P13.16"
                     /gene_synonym="T4P13_16"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES105956.1,INSD:EL124653.1,INSD:EG427811.1,
                     INSD:T42135.1,INSD:DR299213.1,INSD:ES020955.1,
                     INSD:CF774130.1,INSD:DR371069.1,INSD:EH897835.1,
                     INSD:T04473.1,INSD:EL265989.1,INSD:EL191737.1,
                     INSD:DR299216.1,INSD:DR299214.1,INSD:BE530321.1,
                     INSD:DR299211.1,INSD:ES016377.1,INSD:EL252275.1,
                     INSD:BP794786.1,INSD:DR299215.1,INSD:DR299217.1,
                     INSD:DR299208.1,INSD:ES168313.1,INSD:DR299218.1,
                     INSD:AV807552.1,INSD:AV809137.1,INSD:DR299210.1,
                     INSD:EL028796.1,INSD:AV441089.1,INSD:EL263814.1,
                     INSD:AV829325.1,INSD:AV536210.1,INSD:DR299206.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:BX823271.1"
                     /note="POLYPYRIMIDINE TRACT-BINDING (PTB); FUNCTIONS IN:
                     RNA binding, nucleotide binding, nucleic acid binding;
                     INVOLVED IN: pollen germination, regulation of RNA
                     splicing, regulation of translation; LOCATED IN: nucleus,
                     cytoplasmic mRNA processing body, cytoplasm; EXPRESSED IN:
                     28 plant structures; EXPRESSED DURING: 14 growth stages;
                     CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1
                     (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait
                     (InterPro:IPR012677); BEST Arabidopsis thaliana protein
                     match is: polypyrimidine tract-binding protein 2
                     (TAIR:AT5G53180.1); Has 30201 Blast hits to 17322 proteins
                     in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
                     17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
                     Eukaryotes - 2996 (source: NCBI BLink)."
                     /codon_start=1
                     /product="polypyrimidine tract-binding protein 1"
                     /protein_id="AEE73617.2"
                     /db_xref="TAIR:AT3G01150"
                     /db_xref="Araport:AT3G01150"
                     /translation="MPIIGQVFSAFGFVHKIATFEKAAGFQALVQFTDVETASAARSA
                     LDGRSIPRYLLSAHVGSCSLRMSYSAHTDLNIKFQSHRSRDYTNPYLPVNQTAMDGSM
                     QPALGADGKKVESQSNVLLGLIENMQYAVTVDVLHTVFSAYGTVQKIAIFEKNGSTQA
                     LIQYSDIPTAAMAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKAFSDKSRDYTLPDLS
                     LLVAQKGPAVSGSAPPAGWQNPQAQSQYSGYGGSPYMYPSSDPNGASPSGQPPYYG"
     CDS             join(52729..52746,52889..52951,53043..53212,53300..53357,
                     53452..53556,53636..53717,53846..53911,54129..54136)
                     /gene="PTB1"
                     /locus_tag="AT3G01150"
                     /gene_synonym="ATPTB1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING"
                     /gene_synonym="polypyrimidine tract-binding protein 1"
                     /gene_synonym="POLYPYRIMIDINE TRACT-BINDING PROTEIN 1"
                     /gene_synonym="PTB"
                     /gene_synonym="T4P13.16"
                     /gene_synonym="T4P13_16"
                     /codon_start=1
                     /product="polypyrimidine tract-binding protein 1"
                     /protein_id="ANM65686.1"
                     /db_xref="Araport:AT3G01150"
                     /db_xref="TAIR:AT3G01150"
                     /translation="MPIIGQVFSAFGFVHKIATFEKAAGFQALVQFTDVETASAARSA
                     LDGRSIPRYLLSAHVGSCSLRMSYSAHTDLNIKFQSHRSRDYTNPYLPVNQTAMDGSM
                     QPALGADGKKVESQSNVLLGLIENMQYAVTVDVLHTVFSAYGTVQKIAIFEKNGSTQA
                     LIQYSDIPTAAMAKEALEGHCIYDGGYCF"
     gene            complement(54524..57541)
                     /locus_tag="AT3G01160"
                     /gene_synonym="T4P13.15"
                     /gene_synonym="T4P13_15"
                     /db_xref="Araport:AT3G01160"
                     /db_xref="TAIR:AT3G01160"
     mRNA            complement(join(54524..54928,55009..55709,55816..55944,
                     56030..56192,56274..56509,56702..56776,56886..57541))
                     /locus_tag="AT3G01160"
                     /gene_synonym="T4P13.15"
                     /gene_synonym="T4P13_15"
                     /product="pre-rRNA-processing ESF1-like protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH975828.1,INSD:ES069470.1,INSD:EL325235.1,
                     INSD:EL090747.1,INSD:ES060008.1,INSD:ES005252.1,
                     INSD:EH855071.1,INSD:AI998217.1,INSD:EL114276.1,
                     INSD:EL265989.1,INSD:EH799531.1,INSD:EL146563.1,
                     INSD:AV824829.1,INSD:ES014264.1,INSD:ES013249.1,
                     INSD:ES012438.1,INSD:BE529473.1,INSD:EH839302.1,
                     INSD:EH983738.1,INSD:ES183681.1,INSD:AV788000.1,
                     INSD:EH853473.1,INSD:EH807888.1,INSD:ES010568.1,
                     INSD:EH842232.1,INSD:ES043138.1,INSD:EL055986.1,
                     INSD:EL052986.1,INSD:CB252800.1,INSD:EH890872.1,
                     INSD:EG526257.1,INSD:ES011783.1,INSD:EL175154.1"
                     /db_xref="TAIR:AT3G01160"
                     /db_xref="Araport:AT3G01160"
     CDS             complement(join(54655..54928,55009..55709,55816..55944,
                     56030..56192,56274..56509,56702..56776,56886..57449))
                     /locus_tag="AT3G01160"
                     /gene_synonym="T4P13.15"
                     /gene_synonym="T4P13_15"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH975828.1,INSD:ES069470.1,INSD:EL325235.1,
                     INSD:EL090747.1,INSD:ES060008.1,INSD:ES005252.1,
                     INSD:EH855071.1,INSD:AI998217.1,INSD:EL114276.1,
                     INSD:EL265989.1,INSD:EH799531.1,INSD:EL146563.1,
                     INSD:AV824829.1,INSD:ES014264.1,INSD:ES013249.1,
                     INSD:ES012438.1,INSD:BE529473.1,INSD:EH839302.1,
                     INSD:EH983738.1,INSD:ES183681.1,INSD:AV788000.1,
                     INSD:EH853473.1,INSD:EH807888.1,INSD:ES010568.1,
                     INSD:EH842232.1,INSD:ES043138.1,INSD:EL055986.1,
                     INSD:EL052986.1,INSD:CB252800.1,INSD:EH890872.1,
                     INSD:EG526257.1,INSD:ES011783.1,INSD:EL175154.1"
                     /note="FUNCTIONS IN: molecular_function unknown; INVOLVED
                     IN: biological_process unknown; LOCATED IN: cytosol,
                     nucleus; EXPRESSED IN: 22 plant structures; EXPRESSED
                     DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
                     NUC153 (InterPro:IPR012580); Has 36638 Blast hits to 21323
                     proteins in 1057 species: Archae - 109; Bacteria - 2369;
                     Metazoa - 13796; Fungi - 4858; Plants - 1657; Viruses -
                     489; Other Eukaryotes - 13360 (source: NCBI BLink)."
                     /codon_start=1
                     /product="pre-rRNA-processing ESF1-like protein"
                     /protein_id="AEE73618.1"
                     /db_xref="TAIR:AT3G01160"
                     /db_xref="Araport:AT3G01160"
                     /translation="MGSKNKKQRKGESIEEAKGSSGVAEEGNEMIKDPRFSSAHTDPK
                     FRRMRRRDSKVAIDSRFQPMFNDKRFATGSAPVDKRGKRRTGGTGKDSLREFYRIEDE
                     GKQKTEEESGDESGSETEINDLKSEKSSHVESEEESESELKVASLDDESDEKADSEEL
                     SSQEEEEEEDDTDEDDEAMYEDEGPEIPEENIPLIQEETHRLAIVNMDWRHVSAKDLY
                     VVLNSFLPKDGRILSVAVYPSEFGLERMKEEEIHGPVIDGDKKNDASDDEDEEEEEDE
                     DVINQKLRAYEISRLKYYFAVAECDSSATADYLYKSCDGIEFERSSNKLDLRFIPDSM
                     EFKHPPRDIASEAPAGYEGLDFQSRALQMSKVNLSWDEDEPHRIKTLNQKFNPEQLAN
                     LEMKEFLASDESDSDEEDDLGNEVINQSKKKDKKKDKYRALIEAEDVDSDKDLEEEND
                     QDMEVTFNTGLEDLSKEILKKKDNQSESVWETYLRQRREKKRARKNKQKDDDSSPDDD
                     DDYNIDRKAVKDDGDDDFFMEEPPLKKKKKEGKTKKEEVAAEEKSRAELELLLADENA
                     GDGNGLKGYNIKRKAKKGKTDISEDKIPAAELDDPRFSALFSSPYYALDPTDPQFKRS
                     ATYARQLALKQKEDPKGHEDVKAPKEKQELNSDGNLGSKKERHELTSTVKSLKMKMMN
                     KDSEKKKAGNPASSSTLAQRIKKKAKDLSKK"
     gene            57545..58924
                     /locus_tag="AT3G01170"
                     /gene_synonym="T4P13.14"
                     /gene_synonym="T4P13_14"
                     /db_xref="Araport:AT3G01170"
                     /db_xref="TAIR:AT3G01170"
     mRNA            57545..58924
                     /locus_tag="AT3G01170"
                     /gene_synonym="T4P13.14"
                     /gene_synonym="T4P13_14"
                     /product="Ribosomal protein L34e superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL223202.1,INSD:EH911274.1,INSD:DR281726.1,
                     INSD:AU228881.1,INSD:AV442785.1,INSD:DR379048.1,
                     INSD:AU237789.1,INSD:ES049856.1,INSD:EL153233.1,
                     INSD:DR281722.1,INSD:DR281727.1,INSD:AV552321.1,
                     INSD:EL076474.1,INSD:ES166429.1,INSD:BP662878.1,
                     INSD:DR281721.1,INSD:BP864060.1,INSD:DR281723.1,
                     INSD:AV521178.1,INSD:DR281725.1,INSD:EH808394.1,
                     INSD:EH826451.1,INSD:EL128730.1,INSD:DR281724.1,
                     INSD:AV543879.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK175253.1,INSD:BT012180.1,INSD:AK229300.1"
                     /db_xref="TAIR:AT3G01170"
                     /db_xref="Araport:AT3G01170"
     mRNA            join(57633..58344,58421..58909)
                     /locus_tag="AT3G01170"
                     /gene_synonym="T4P13.14"
                     /gene_synonym="T4P13_14"
                     /product="Ribosomal protein L34e superfamily protein"
                     /db_xref="Araport:AT3G01170"
                     /db_xref="TAIR:AT3G01170"
     CDS             58043..58690
                     /locus_tag="AT3G01170"
                     /gene_synonym="T4P13.14"
                     /gene_synonym="T4P13_14"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL223202.1,INSD:EH911274.1,INSD:DR281726.1,
                     INSD:AU228881.1,INSD:AV442785.1,INSD:DR379048.1,
                     INSD:AU237789.1,INSD:ES049856.1,INSD:EL153233.1,
                     INSD:DR281722.1,INSD:DR281727.1,INSD:AV552321.1,
                     INSD:EL076474.1,INSD:ES166429.1,INSD:BP662878.1,
                     INSD:DR281721.1,INSD:BP864060.1,INSD:DR281723.1,
                     INSD:AV521178.1,INSD:DR281725.1,INSD:EH808394.1,
                     INSD:EH826451.1,INSD:EL128730.1,INSD:DR281724.1,
                     INSD:AV543879.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK175253.1,INSD:BT012180.1,INSD:AK229300.1"
                     /note="Ribosomal protein L34e superfamily protein;
                     FUNCTIONS IN: structural constituent of ribosome; INVOLVED
                     IN: translation; LOCATED IN: ribosome, intracellular,
                     chloroplast; EXPRESSED IN: 23 plant structures; EXPRESSED
                     DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
                     Ribosomal protein L34e (InterPro:IPR008195); BEST
                     Arabidopsis thaliana protein match is: Ribosomal protein
                     L34e superfamily protein (TAIR:AT5G15260.1); Has 77 Blast
                     hits to 76 proteins in 14 species: Archae - 0; Bacteria -
                     0; Metazoa - 0; Fungi - 0; Plants - 77; Viruses - 0; Other
                     Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Ribosomal protein L34e superfamily protein"
                     /protein_id="AEE73619.1"
                     /db_xref="TAIR:AT3G01170"
                     /db_xref="Araport:AT3G01170"
                     /translation="MVYLHSSISVCNSVDPMIMSHSSPKSRNTRNKSSSSPTCSKFPV
                     CDGSQSAAIDVVILIAVITACGFLFFPYVKLITLKSIEVFSDLSLLVKQEILQNPIVY
                     GSLALSIFCAAISTWLVILLCTMQRCGKPNCKGLRKAVEFDIQLETEECVKSSSNKRG
                     MFELPRVHHRELEAELKKMAPPNGRAVLVFRARCGCSVRRLVVSGPKKQQRKIKK"
     CDS             join(58043..58344,58421..58571)
                     /locus_tag="AT3G01170"
                     /gene_synonym="T4P13.14"
                     /gene_synonym="T4P13_14"
                     /codon_start=1
                     /product="Ribosomal protein L34e superfamily protein"
                     /protein_id="ANM65592.1"
                     /db_xref="Araport:AT3G01170"
                     /db_xref="TAIR:AT3G01170"
                     /translation="MVYLHSSISVCNSVDPMIMSHSSPKSRNTRNKSSSSPTCSKFPV
                     CDGSQSAAIDVVILIAVITACGFLFFPYVKLITLKSIEVFSDLSLLVKQEILQNPIVD
                     AANRIVKALGKLLSLIFSLRLRNASRAPATRGECLSCLVFITVNWKLS"
     gene            59423..62291
                     /locus_tag="AT3G01175"
                     /db_xref="Araport:AT3G01175"
                     /db_xref="TAIR:AT3G01175"
     mRNA            join(59423..60336,60493..60837,61591..61850,61927..62291)
                     /locus_tag="AT3G01175"
                     /product="transmembrane protein"
                     /inference="Similar to RNA sequence, EST:INSD:AV527576.1"
                     /db_xref="TAIR:AT3G01175"
                     /db_xref="Araport:AT3G01175"
     CDS             join(59484..60336,60493..60837,61591..61850,61927..62202)
                     /locus_tag="AT3G01175"
                     /inference="Similar to RNA sequence, EST:INSD:AV527576.1"
                     /note="Protein of unknown function (DUF1666); CONTAINS
                     InterPro DOMAIN/s: Protein of unknown function DUF1666
                     (InterPro:IPR012870); BEST Arabidopsis thaliana protein
                     match is: Protein of unknown function (DUF1666)
                     (TAIR:AT5G39785.2); Has 140 Blast hits to 138 proteins in
                     34 species: Archae - 0; Bacteria - 8; Metazoa - 4; Fungi -
                     7; Plants - 86; Viruses - 0; Other Eukaryotes - 35
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="transmembrane protein"
                     /protein_id="AEE73620.2"
                     /db_xref="TAIR:AT3G01175"
                     /db_xref="Araport:AT3G01175"
                     /translation="MALLSACWLMIESIVIQDGFLKSSYMKLYMHPLVLFLCQLLIWL
                     YLFFLWLLPPFQALYNAFSSVLFTFSKLVSSSFRVIMFKKEVTCHIESRQEIKNTLDN
                     LELSTSTHNPVPAFSFSFKYQVDSHLKVRISMQKGKILEEEEDVDDFFYEYDQEDVVE
                     LLDAKEVEEEHDVDIFDGVNMEKNLEFEIQTMPIHQEDEASLTNDDEEEEIVNSDVEN
                     DLSFLVSSKRDHPSPLSIASLDSALQDSVTIENIQTQGVEDDHVYKKYCERMRWYDIL
                     SRDRSYGLNVITNQLTASSLSLWGKTAEKRIKQSMKKDLELVYVAQVCLSWEALQHQY
                     ILVRDSSNPADSRGRFDDDISREFQNFQVLLERFLEDERCEGKRVLSFVQRRFELISF
                     FQVPRLSDFPYLLFFSKGYNREGPHEGEKERQGKQVLKAIETCIEVFYDFVKVDIKKP
                     LMWERLQNSLVNSPLMELEDPRDFRLFLDLKISLQKKEQLLKEMQGNKKKIWFKKKSF
                     NMDEDKIEKDEHFMLVRCITIDLKLVSRVLHMPLVSSSHLKWCQHKLDNIHINGDKIS
                     KTFSPVLFPSS"
     gene            complement(62245..66111)
                     /gene="SS2"
                     /locus_tag="AT3G01180"
                     /gene_synonym="AtSS2"
                     /gene_synonym="starch synthase 2"
                     /gene_synonym="T4P13.13"
                     /gene_synonym="T4P13_13"
                     /db_xref="Araport:AT3G01180"
                     /db_xref="TAIR:AT3G01180"
     mRNA            complement(join(62245..63412,63501..63674,63762..63806,
                     63891..64001,64105..64182,64294..64358,64461..65127,
                     65397..66111))
                     /gene="SS2"
                     /locus_tag="AT3G01180"
                     /gene_synonym="AtSS2"
                     /gene_synonym="starch synthase 2"
                     /gene_synonym="T4P13.13"
                     /gene_synonym="T4P13_13"
                     /product="starch synthase 2"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV529982.1,INSD:EG516523.1,INSD:EL037831.1,
                     INSD:BP792043.1,INSD:EL218324.1,INSD:EL321680.1,
                     INSD:EH823009.1,INSD:EL045357.1,INSD:EG472753.1,
                     INSD:AV555566.1,INSD:BP788980.1,INSD:AV524010.1,
                     INSD:AV523912.1,INSD:EG516522.1,INSD:BP561460.2,
                     INSD:AV524142.1,INSD:ES010338.1,INSD:AV786784.1,
                     INSD:ES211074.1,INSD:ES151689.1,INSD:AV791782.1,
                     INSD:ES162881.1,INSD:EH918223.1,INSD:EL066511.1,
                     INSD:AV801219.1,INSD:EL191368.1,INSD:EL223877.1,
                     INSD:BP780248.1,INSD:EH849601.1,INSD:EH800188.1,
                     INSD:BP781185.1,INSD:EH970682.1,INSD:ES137787.1,
                     INSD:AV525848.1,INSD:EL181546.1,INSD:ES195855.1,
                     INSD:AV518542.1,INSD:EL314126.1,INSD:AV441053.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY054467.1,INSD:BT002555.1"
                     /db_xref="TAIR:AT3G01180"
                     /db_xref="Araport:AT3G01180"
     CDS             complement(join(62456..63412,63501..63674,63762..63806,
                     63891..64001,64105..64182,64294..64358,64461..65127,
                     65397..65678))
                     /gene="SS2"
                     /locus_tag="AT3G01180"
                     /gene_synonym="AtSS2"
                     /gene_synonym="starch synthase 2"
                     /gene_synonym="T4P13.13"
                     /gene_synonym="T4P13_13"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV529982.1,INSD:EG516523.1,INSD:EL037831.1,
                     INSD:BP792043.1,INSD:EL218324.1,INSD:EL321680.1,
                     INSD:EH823009.1,INSD:EL045357.1,INSD:EG472753.1,
                     INSD:AV555566.1,INSD:BP788980.1,INSD:AV524010.1,
                     INSD:AV523912.1,INSD:EG516522.1,INSD:BP561460.2,
                     INSD:AV524142.1,INSD:ES010338.1,INSD:AV786784.1,
                     INSD:ES211074.1,INSD:ES151689.1,INSD:AV791782.1,
                     INSD:ES162881.1,INSD:EH918223.1,INSD:EL066511.1,
                     INSD:AV801219.1,INSD:EL191368.1,INSD:EL223877.1,
                     INSD:BP780248.1,INSD:EH849601.1,INSD:EH800188.1,
                     INSD:BP781185.1,INSD:EH970682.1,INSD:ES137787.1,
                     INSD:AV525848.1,INSD:EL181546.1,INSD:ES195855.1,
                     INSD:AV518542.1,INSD:EL314126.1,INSD:AV441053.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY054467.1,INSD:BT002555.1"
                     /note="starch synthase 2 (SS2); FUNCTIONS IN: transferase
                     activity, transferring glycosyl groups; INVOLVED IN:
                     cellulose biosynthetic process, glucan biosynthetic
                     process, biosynthetic process, glycogen biosynthetic
                     process; LOCATED IN: chloroplast; EXPRESSED IN: 24 plant
                     structures; EXPRESSED DURING: 13 growth stages; CONTAINS
                     InterPro DOMAIN/s: Glycogen/starch synthases, ADP-glucose
                     type (InterPro:IPR011835), Starch synthase, catalytic
                     domain (InterPro:IPR013534), Glycosyl transferase, group 1
                     (InterPro:IPR001296); BEST Arabidopsis thaliana protein
                     match is: Glycogen/starch synthases, ADP-glucose type
                     (TAIR:AT5G24300.2); Has 15927 Blast hits to 11968 proteins
                     in 3394 species: Archae - 233; Bacteria - 4788; Metazoa -
                     1175; Fungi - 1070; Plants - 4691; Viruses - 26; Other
                     Eukaryotes - 3944 (source: NCBI BLink)."
                     /codon_start=1
                     /product="starch synthase 2"
                     /protein_id="AEE73621.1"
                     /db_xref="TAIR:AT3G01180"
                     /db_xref="Araport:AT3G01180"
                     /translation="MASVAESSFPLLCQIKTQRRINSSTLRHSRVSYHDLPSGSLSFR
                     SRSFVLGHRCKCVSRVEASGSDDDEPEDALQATIDKSKKVLAMQRNLLHQIAERRKLV
                     SSIKESTPDLDDAKASSKQESASSVNANTDATKKEIMDGDANGSVSPSTYGKSSLSKE
                     PEAKTFSPSTESLKNRKQSSASVISSSPVTSPQKPSDVATNGKPWSSVVASSVDPPYK
                     PSSVMTSPEKTSDPVTSPGKPSKSRAGAFWSDPLPSYLTKAPQTSTMKTEKYVEKTPD
                     VASSETNEPGKDEEKPPPLAGANVMNVILVAAECAPFSKTGGLGDVAGALPKSLARRG
                     HRVMVVVPRYAEYAEAKDLGVRKRYKVAGQDMEVMYFHAFIDGVDFVFIDSPEFRHLS
                     NNIYGGNRLDILKRMVLFCKAAVEVPWYVPCGGVCYGDGNLAFIANDWHTALLPVYLK
                     AYYRDHGIMKYTRSVLVIHNIAHQGRGPVDDFSYVDLPSHYLDSFKLYDPVGGEHFNI
                     FAAGLKAADRVLTVSHGYSWEVKTLEGGWGLHNIINENDWKFRGIVNGIDTQEWNPEF
                     DTYLHSDDYTNYSLENLHIGKPQCKAALQKELGLPVRPDVPLIGFIGRLDHQKGVDLI
                     AEAVPWMMSQDVQLVMLGTGRPDLEEVLRQMEHQYRDKARGWVGFSVKTAHRITAGAD
                     ILLMPSRFEPCGLNQLYAMNYGTIPVVHAVGGLRDTVQQFDPYSETGLGWTFDSAEAG
                     KLIHALGNCLLTYREYKESWEGLQRRGMTQDLSWDNAAEKYEEVLVAAKYHW"
     gene            66151..66980
                     /locus_tag="AT3G01185"
                     /db_xref="Araport:AT3G01185"
                     /db_xref="TAIR:AT3G01185"
     mRNA            66151..66980
                     /locus_tag="AT3G01185"
                     /product="prolamin-like protein (DUF784)"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES004083.1,INSD:EG461573.1,INSD:ES167407.1,
                     INSD:EG461572.1,INSD:EG461570.1,INSD:EG461579.1,
                     INSD:ES101645.1,INSD:EG461567.1,INSD:EG461569.1,
                     INSD:ES109108.1,INSD:ES202717.1,INSD:EG455481.1,
                     INSD:EG461564.1,INSD:EG461568.1,INSD:EG461571.1,
                     INSD:EG455493.1,INSD:EL984410.1,INSD:EG461575.1,
                     INSD:EG455489.1,INSD:EG461577.1,INSD:ES197058.1,
                     INSD:EG461578.1,INSD:ES125956.1,INSD:ES139103.1,
                     INSD:ES159763.1,INSD:EL982285.1,INSD:EG461566.1,
                     INSD:ES013403.1,INSD:EL986155.1,INSD:EG455492.1,
                     INSD:EG455491.1,INSD:EG461576.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:EF182809.1"
                     /db_xref="TAIR:AT3G01185"
                     /db_xref="Araport:AT3G01185"
     CDS             66471..66917
                     /locus_tag="AT3G01185"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES004083.1,INSD:EG461573.1,INSD:ES167407.1,
                     INSD:EG461572.1,INSD:EG461570.1,INSD:EG461579.1,
                     INSD:ES101645.1,INSD:EG461567.1,INSD:EG461569.1,
                     INSD:ES109108.1,INSD:ES202717.1,INSD:EG455481.1,
                     INSD:EG461564.1,INSD:EG461568.1,INSD:EG461571.1,
                     INSD:EG455493.1,INSD:EL984410.1,INSD:EG461575.1,
                     INSD:EG455489.1,INSD:EG461577.1,INSD:ES197058.1,
                     INSD:EG461578.1,INSD:ES125956.1,INSD:ES139103.1,
                     INSD:ES159763.1,INSD:EL982285.1,INSD:EG461566.1,
                     INSD:ES013403.1,INSD:EL986155.1,INSD:EG455492.1,
                     INSD:EG455491.1,INSD:EG461576.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:EF182809.1"
                     /note="Protein of unknown function (DUF784); FUNCTIONS IN:
                     molecular_function unknown; INVOLVED IN:
                     biological_process unknown; LOCATED IN: endomembrane
                     system; CONTAINS InterPro DOMAIN/s: Protein of unknown
                     function DUF784, Arabidopsis thaliana
                     (InterPro:IPR008502); BEST Arabidopsis thaliana protein
                     match is: Protein of unknown function (DUF784)
                     (TAIR:AT2G21655.1); Has 30201 Blast hits to 17322 proteins
                     in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
                     17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
                     Eukaryotes - 2996 (source: NCBI BLink)."
                     /codon_start=1
                     /product="prolamin-like protein (DUF784)"
                     /protein_id="AEE73622.1"
                     /db_xref="TAIR:AT3G01185"
                     /db_xref="Araport:AT3G01185"
                     /translation="MKKNNHVYMAFVLITTLVLFAYPSLADDEKPLIDPNIDLDSTFA
                     RSPSTSEYNIDMLNKQSTELVQFAGTCAGLMGGEKCSDQVMSEILQNIPTSRYCCLKM
                     IIYGQECHMVLRNLLFQTYYYKPFASKGRPRILKVWNRCSAEVGGF"
     gene            complement(67032..68665)
                     /locus_tag="AT3G01190"
                     /gene_synonym="T4P13.12"
                     /gene_synonym="T4P13_12"
                     /db_xref="Araport:AT3G01190"
                     /db_xref="TAIR:AT3G01190"
     mRNA            complement(join(67032..67642,67726..67885,67984..68169,
                     68265..68665))
                     /locus_tag="AT3G01190"
                     /gene_synonym="T4P13.12"
                     /gene_synonym="T4P13_12"
                     /product="Peroxidase superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:H37080.1,INSD:AV790546.1,INSD:BP570389.1,
                     INSD:BP803815.1,INSD:BP596299.1,INSD:BP629910.1,
                     INSD:DR337635.1,INSD:AV817656.1,INSD:AV784766.1,
                     INSD:BP568364.1,INSD:BP578527.1,INSD:H35976.1,
                     INSD:T44878.1,INSD:DR337632.1,INSD:DR337634.1,
                     INSD:BP570837.1,INSD:DR376021.1,INSD:BP797486.1,
                     INSD:AV539857.1,INSD:DR337633.1,INSD:BP606905.1,
                     INSD:BP802598.1,INSD:T21676.1,INSD:BP564492.1,
                     INSD:BP594426.1,INSD:BP800474.1,INSD:DR337637.1,
                     INSD:T41919.1,INSD:H37548.1,INSD:CF652090.1,
                     INSD:BP803948.1,INSD:BP799211.1,INSD:T88211.1,
                     INSD:T88101.1,INSD:BP579127.1,INSD:AV823732.1,
                     INSD:AV536583.1,INSD:EL161851.1,INSD:BP797879.1,
                     INSD:AV553877.1,INSD:AI099825.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY087679.1,INSD:X98775.1,INSD:BX824856.1,
                     INSD:AY062810.1,INSD:X98319.1,INSD:AY081573.1,
                     INSD:BX823902.1"
                     /db_xref="TAIR:AT3G01190"
                     /db_xref="Araport:AT3G01190"
     CDS             complement(join(67236..67642,67726..67885,67984..68169,
                     68265..68477))
                     /locus_tag="AT3G01190"
                     /gene_synonym="T4P13.12"
                     /gene_synonym="T4P13_12"
                     /inference="Similar to RNA sequence,
                     EST:INSD:H37080.1,INSD:AV790546.1,INSD:BP570389.1,
                     INSD:BP803815.1,INSD:BP596299.1,INSD:BP629910.1,
                     INSD:DR337635.1,INSD:AV817656.1,INSD:AV784766.1,
                     INSD:BP568364.1,INSD:BP578527.1,INSD:H35976.1,
                     INSD:T44878.1,INSD:DR337632.1,INSD:DR337634.1,
                     INSD:BP570837.1,INSD:DR376021.1,INSD:BP797486.1,
                     INSD:AV539857.1,INSD:DR337633.1,INSD:BP606905.1,
                     INSD:BP802598.1,INSD:T21676.1,INSD:BP564492.1,
                     INSD:BP594426.1,INSD:BP800474.1,INSD:DR337637.1,
                     INSD:T41919.1,INSD:H37548.1,INSD:CF652090.1,
                     INSD:BP803948.1,INSD:BP799211.1,INSD:T88211.1,
                     INSD:T88101.1,INSD:BP579127.1,INSD:AV823732.1,
                     INSD:AV536583.1,INSD:EL161851.1,INSD:BP797879.1,
                     INSD:AV553877.1,INSD:AI099825.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY087679.1,INSD:X98775.1,INSD:BX824856.1,
                     INSD:AY062810.1,INSD:X98319.1,INSD:AY081573.1,
                     INSD:BX823902.1"
                     /note="Peroxidase superfamily protein; FUNCTIONS IN:
                     peroxidase activity, heme binding; INVOLVED IN: response
                     to oxidative stress, oxidation reduction; LOCATED IN:
                     endomembrane system; EXPRESSED IN: hypocotyl, root;
                     CONTAINS InterPro DOMAIN/s: Haem peroxidase
                     (InterPro:IPR010255), Plant peroxidase
                     (InterPro:IPR000823), Peroxidases heam-ligand binding site
                     (InterPro:IPR019793), Haem peroxidase,
                     plant/fungal/bacterial (InterPro:IPR002016), Peroxidase,
                     active site (InterPro:IPR019794); BEST Arabidopsis
                     thaliana protein match is: Peroxidase superfamily protein
                     (TAIR:AT5G15180.1); Has 4151 Blast hits to 4125 proteins
                     in 211 species: Archae - 0; Bacteria - 4; Metazoa - 8;
                     Fungi - 32; Plants - 4087; Viruses - 0; Other Eukaryotes -
                     20 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Peroxidase superfamily protein"
                     /protein_id="AEE73623.1"
                     /db_xref="TAIR:AT3G01190"
                     /db_xref="Araport:AT3G01190"
                     /translation="MAASKRLVVSCLFLVLLFAQANSQGLKVGFYSKTCPQLEGIVKK
                     VVFDAMNKAPTLGAPLLRMFFHDCFVRGCDGSVLLDKPNNQGEKSAVPNLSLRGFGII
                     DDSKAALEKVCPGIVSCSDILALVARDAMVALEGPSWEVETGRRDGRVSNINEVNLPS
                     PFDNITKLISDFRSKGLNEKDLVILSGGHTIGMGHCPLLTNRLYNFTGKGDSDPSLDS
                     EYAAKLRKKCKPTDTTTALEMDPGSFKTFDLSYFTLVAKRRGLFQSDAALLDNSKTRA
                     YVLQQIRTHGSMFFNDFGVSMVKMGRTGVLTGKAGEIRKTCRSAN"
     gene            complement(69468..71362)
                     /gene="RP2"
                     /locus_tag="AT3G01200"
                     /gene_synonym="AtRP2"
                     /gene_synonym="PPDK regulatory protein 2"
                     /gene_synonym="T4P13.11"
                     /gene_synonym="T4P13_11"
                     /note="Encodes a PPDK regulatory protein that has protein
                     kinase activity but lacks protein phosphatase activity
                     towards PPDK (pyruvate orthophosphate dikinase)."
                     /db_xref="Araport:AT3G01200"
                     /db_xref="TAIR:AT3G01200"
     mRNA            complement(join(69468..69932,70072..70711,70962..71362))
                     /gene="RP2"
                     /locus_tag="AT3G01200"
                     /gene_synonym="AtRP2"
                     /gene_synonym="PPDK regulatory protein 2"
                     /gene_synonym="T4P13.11"
                     /gene_synonym="T4P13_11"
                     /product="PPDK regulatory protein 2"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AI998168.1,INSD:EG515323.1,INSD:EL245467.1,
                     INSD:AA042511.1,INSD:BE528998.1,INSD:ES004294.1,
                     INSD:EL983649.1,INSD:DR362245.1,INSD:ES054568.1,
                     INSD:BE524786.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX823787.1,INSD:BX823788.1,INSD:BX822879.1,
                     INSD:BX823654.1,INSD:BX824076.1,INSD:BX823332.1"
                     /db_xref="TAIR:AT3G01200"
                     /db_xref="Araport:AT3G01200"
     CDS             complement(join(69826..69932,70072..70711,70962..71348))
                     /gene="RP2"
                     /locus_tag="AT3G01200"
                     /gene_synonym="AtRP2"
                     /gene_synonym="PPDK regulatory protein 2"
                     /gene_synonym="T4P13.11"
                     /gene_synonym="T4P13_11"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AI998168.1,INSD:EG515323.1,INSD:EL245467.1,
                     INSD:AA042511.1,INSD:BE528998.1,INSD:ES004294.1,
                     INSD:EL983649.1,INSD:DR362245.1,INSD:ES054568.1,
                     INSD:BE524786.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX823787.1,INSD:BX823788.1,INSD:BX822879.1,
                     INSD:BX823654.1,INSD:BX824076.1,INSD:BX823332.1"
                     /note="PPDK regulatory protein 2 (RP2); CONTAINS InterPro
                     DOMAIN/s: Pyruvate Pi dikinase regulator
                     (InterPro:IPR017409), Protein of unknown function DUF299,
                     phosphotransferase, predicted (InterPro:IPR005177); BEST
                     Arabidopsis thaliana protein match is: PPDK regulatory
                     protein (TAIR:AT4G21210.1); Has 4458 Blast hits to 4458
                     proteins in 1423 species: Archae - 0; Bacteria - 3131;
                     Metazoa - 0; Fungi - 0; Plants - 63; Viruses - 0; Other
                     Eukaryotes - 1264 (source: NCBI BLink)."
                     /codon_start=1
                     /product="PPDK regulatory protein 2"
                     /protein_id="AEE73624.1"
                     /db_xref="TAIR:AT3G01200"
                     /db_xref="Araport:AT3G01200"
                     /translation="MNLHGVSGHHEPNSEPPIPTGSSSPKLKISPKLNRWSRGRALRS
                     GVKLDRPIPRSDNSPRRQVTEAQPTDEADKKTTAIDVEVTAGKSIYLVSDGTGWTAEH
                     SVNAALGQFEDFSLNRGSSVNTHLFSWVEDEERLIEIIKQAAKEGAMCFYTLANPSMA
                     KSAKQACDQLGVLSVDILGPIIEGIASHLGVSPSGLTRGAPGRVKTLNDAYFKRIEAI
                     EFTIKQDDGTLPENLSKADIVLVGVSRTGKTPLSTYIAQKGYKVANVPFVMGVEPPRT
                     LFQVEPRKVFGLKIQLVVLQAIRRTRVKTLGVDTEAENNYSGIDLVRKELDFASRIYE
                     RNPGWAVIDVTNKAIEETAAVILRLYHDGRDTSTTVPRISKRY"
     gene            69854..71415
                     /locus_tag="AT3G01202"
                     /note="Natural antisense transcript overlaps with
                     AT3G01200;
                     Potential natural antisense gene, locus overlaps with
                     AT3G01200"
                     /db_xref="Araport:AT3G01202"
                     /db_xref="TAIR:AT3G01202"
     ncRNA           join(69854..70410,70498..70738,70966..71415)
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT3G01202"
                     /product="other RNA"
                     /db_xref="Araport:AT3G01202"
                     /db_xref="TAIR:AT3G01202"
     gene            71556..73407
                     /locus_tag="AT3G01210"
                     /gene_synonym="T4P13.10"
                     /gene_synonym="T4P13_10"
                     /db_xref="Araport:AT3G01210"
                     /db_xref="TAIR:AT3G01210"
     mRNA            join(71556..71811,72147..72297,72382..72457,72528..72626,
                     72701..73407)
                     /locus_tag="AT3G01210"
                     /gene_synonym="T4P13.10"
                     /gene_synonym="T4P13_10"
                     /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL134984.1,INSD:AU239446.1,INSD:BP654356.1,
                     INSD:N97131.1,INSD:AU230753.1,INSD:EH940845.1,
                     INSD:BP622628.1,INSD:ES150528.1,INSD:ES205898.1,
                     INSD:EL077131.1,INSD:AI993803.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT003717.1,INSD:AK118577.1"
                     /db_xref="TAIR:AT3G01210"
                     /db_xref="Araport:AT3G01210"
     mRNA            join(71860..71881,72147..72297,72382..72457,72528..72626,
                     72701..73334)
                     /locus_tag="AT3G01210"
                     /gene_synonym="T4P13.10"
                     /gene_synonym="T4P13_10"
                     /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
                     /db_xref="Araport:AT3G01210"
                     /db_xref="TAIR:AT3G01210"
     CDS             join(72182..72297,72382..72457,72528..72626,72701..73159)
                     /locus_tag="AT3G01210"
                     /gene_synonym="T4P13.10"
                     /gene_synonym="T4P13_10"
                     /codon_start=1
                     /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
                     /protein_id="ANM65071.1"
                     /db_xref="Araport:AT3G01210"
                     /db_xref="TAIR:AT3G01210"
                     /translation="MYPCGYVAQVTNLSPQATEKDVHRFFSHCGIVELVEITGCQGDA
                     LTAYVTFRDAYALDMAVLLSGATIVDQTVWISVYGVYLHESNNLRQEEDYSVTVTRSD
                     AFASSPGEAITVAQQVVQTMLAKGYVLSKDAIGKAKALDESQRFSSLVATKLAEISHY
                     LGLTQNIQSSMELVRSADEKYHFSDFTKSAVLVTGTAAVAAATITGKVAAAAATSVVN
                     SRYFANGALWFSDALGRAAKAAAHIGGGGSN"
     CDS             join(72182..72297,72382..72457,72528..72626,72701..73159)
                     /locus_tag="AT3G01210"
                     /gene_synonym="T4P13.10"
                     /gene_synonym="T4P13_10"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL134984.1,INSD:AU239446.1,INSD:BP654356.1,
                     INSD:N97131.1,INSD:AU230753.1,INSD:EH940845.1,
                     INSD:BP622628.1,INSD:ES150528.1,INSD:ES205898.1,
                     INSD:EL077131.1,INSD:AI993803.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT003717.1,INSD:AK118577.1"
                     /note="RNA-binding (RRM/RBD/RNP motifs) family protein;
                     FUNCTIONS IN: oxidoreductase activity, nucleic acid
                     binding; INVOLVED IN: oxidation reduction; LOCATED IN:
                     cellular_component unknown; EXPRESSED IN: 22 plant
                     structures; EXPRESSED DURING: 13 growth stages; CONTAINS
                     InterPro DOMAIN/s: Aldo/keto reductase
                     (InterPro:IPR001395), RNA recognition motif, RNP-1
                     (InterPro:IPR000504); BEST Arabidopsis thaliana protein
                     match is: RNA-binding (RRM/RBD/RNP motifs) family protein
                     (TAIR:AT1G14340.1); Has 327 Blast hits to 327 proteins in
                     73 species: Archae - 0; Bacteria - 0; Metazoa - 4; Fungi -
                     84; Plants - 228; Viruses - 0; Other Eukaryotes - 11
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
                     /protein_id="AEE73625.1"
                     /db_xref="TAIR:AT3G01210"
                     /db_xref="Araport:AT3G01210"
                     /translation="MYPCGYVAQVTNLSPQATEKDVHRFFSHCGIVELVEITGCQGDA
                     LTAYVTFRDAYALDMAVLLSGATIVDQTVWISVYGVYLHESNNLRQEEDYSVTVTRSD
                     AFASSPGEAITVAQQVVQTMLAKGYVLSKDAIGKAKALDESQRFSSLVATKLAEISHY
                     LGLTQNIQSSMELVRSADEKYHFSDFTKSAVLVTGTAAVAAATITGKVAAAAATSVVN
                     SRYFANGALWFSDALGRAAKAAAHIGGGGSN"
     gene            73307..75539
                     /gene="HB20"
                     /locus_tag="AT3G01220"
                     /gene_synonym="ATHB20"
                     /gene_synonym="homeobox protein 20"
                     /gene_synonym="T4P13.9"
                     /gene_synonym="T4P13_9"
                     /note="Encodes a homeodomain leucine zipper class I
                     (HD-Zip I) protein. Expressed during seed germination in
                     the micropylar endosperm and in the root cap, and
                     increases ABA sensitivity and seed dormancy when mutated."
                     /db_xref="Araport:AT3G01220"
                     /db_xref="TAIR:AT3G01220"
     mRNA            join(73307..73737,73814..74199,74960..75539)
                     /gene="HB20"
                     /locus_tag="AT3G01220"
                     /gene_synonym="ATHB20"
                     /gene_synonym="homeobox protein 20"
                     /gene_synonym="T4P13.9"
                     /gene_synonym="T4P13_9"
                     /product="homeobox protein 20"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL232356.1,INSD:DR750730.1,INSD:DR318533.1,
                     INSD:AU228448.1,INSD:DR750524.1,INSD:DR318534.1,
                     INSD:BP611854.1,INSD:DR318536.1,INSD:EH985186.1,
                     INSD:DR318535.1,INSD:DR356558.1,INSD:EH909251.1,
                     INSD:DR370593.1,INSD:DR750729.1,INSD:BP601346.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT029221.1,INSD:AK228890.1,INSD:AY087631.1"
                     /db_xref="TAIR:AT3G01220"
                     /db_xref="Araport:AT3G01220"
     CDS             join(73599..73737,73814..74199,74960..75295)
                     /gene="HB20"
                     /locus_tag="AT3G01220"
                     /gene_synonym="ATHB20"
                     /gene_synonym="homeobox protein 20"
                     /gene_synonym="T4P13.9"
                     /gene_synonym="T4P13_9"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL232356.1,INSD:DR750730.1,INSD:DR318533.1,
                     INSD:AU228448.1,INSD:DR750524.1,INSD:DR318534.1,
                     INSD:BP611854.1,INSD:DR318536.1,INSD:EH985186.1,
                     INSD:DR318535.1,INSD:DR356558.1,INSD:EH909251.1,
                     INSD:DR370593.1,INSD:DR750729.1,INSD:BP601346.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT029221.1,INSD:AK228890.1,INSD:AY087631.1"
                     /note="homeobox protein 20 (HB20); FUNCTIONS IN: DNA
                     binding, sequence-specific DNA binding transcription
                     factor activity; INVOLVED IN: response to auxin stimulus,
                     regulation of transcription, DNA-dependent; LOCATED IN:
                     nucleus; EXPRESSED IN: 11 plant structures; EXPRESSED
                     DURING: E expanded cotyledon stage; CONTAINS InterPro
                     DOMAIN/s: Homeobox, conserved site (InterPro:IPR017970),
                     Homeobox (InterPro:IPR001356), Homeodomain-like
                     (InterPro:IPR009057), Helix-turn-helix motif, lambda-like
                     repressor (InterPro:IPR000047), Leucine zipper,
                     homeobox-associated (InterPro:IPR003106),
                     Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis
                     thaliana protein match is: homeobox 3 (TAIR:AT5G15150.1);
                     Has 9615 Blast hits to 9578 proteins in 515 species:
                     Archae - 0; Bacteria - 1; Metazoa - 7277; Fungi - 141;
                     Plants - 2025; Viruses - 4; Other Eukaryotes - 167
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="homeobox protein 20"
                     /protein_id="AEE73626.1"
                     /db_xref="TAIR:AT3G01220"
                     /db_xref="Araport:AT3G01220"
                     /translation="MYVFDPTTEAGLRLEMAFPQHGFMFQQLHEDNSQDQLPSCPPHL
                     FNGGGNYMMNRSMSLMNVQEDHNQTLDEENLSDDGAHTMLGEKKKRLQLEQVKALEKS
                     FELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARWKTRQLERDYDSLKKQFESLKS
                     DNASLLAYNKKLLAEVMALKNKECNEGNIVKREAEASWSNNGSTENSSDINLEMPRET
                     ITTHVNTIKDLFPSSIRSSAHDDDHHQNHEIVQEESLCNMFNGIDETTPAGYWAWSDP
                     NHNHHHHQFN"
     gene            complement(76631..77411)
                     /locus_tag="AT3G01230"
                     /gene_synonym="T4P13.8"
                     /gene_synonym="T4P13_8"
                     /db_xref="Araport:AT3G01230"
                     /db_xref="TAIR:AT3G01230"
     mRNA            complement(76631..77411)
                     /locus_tag="AT3G01230"
                     /gene_synonym="T4P13.8"
                     /gene_synonym="T4P13_8"
                     /product="splicing regulatory glutamine/lysine-rich-like
                     protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG512906.1,INSD:AU236748.1,INSD:ES178566.1,
                     INSD:EH896421.1,INSD:BP644589.1,INSD:AU227724.1,
                     INSD:BP656532.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX825307.1,INSD:BT005181.1,INSD:BX825455.1,
                     INSD:BT003890.1,INSD:BX825506.1,INSD:BX825584.1,
                     INSD:BX822653.1"
                     /db_xref="TAIR:AT3G01230"
                     /db_xref="Araport:AT3G01230"
     CDS             complement(76937..77317)
                     /locus_tag="AT3G01230"
                     /gene_synonym="T4P13.8"
                     /gene_synonym="T4P13_8"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG512906.1,INSD:AU236748.1,INSD:ES178566.1,
                     INSD:EH896421.1,INSD:BP644589.1,INSD:AU227724.1,
                     INSD:BP656532.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX825307.1,INSD:BT005181.1,INSD:BX825455.1,
                     INSD:BT003890.1,INSD:BX825506.1,INSD:BX825584.1,
                     INSD:BX822653.1"
                     /note="unknown protein; FUNCTIONS IN: molecular_function
                     unknown; INVOLVED IN: biological_process unknown; LOCATED
                     IN: endomembrane system; BEST Arabidopsis thaliana protein
                     match is: unknown protein (TAIR:AT3G01240.1); Has 11 Blast
                     hits to 11 proteins in 2 species: Archae - 0; Bacteria -
                     0; Metazoa - 0; Fungi - 0; Plants - 11; Viruses - 0; Other
                     Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="splicing regulatory glutamine/lysine-rich-like
                     protein"
                     /protein_id="AEE73627.1"
                     /db_xref="TAIR:AT3G01230"
                     /db_xref="Araport:AT3G01230"
                     /translation="MAKISFALVVVALIVFQQVSEAHRPIDFNEEVLEKDLHEAKDLI
                     EEDLREKETSIRNLESEVSLLTKSEMMLTQLELAYKNGRNLEHFGKKLKKFNRRIKRA
                     PEEVRYVSIIQSILKDLGLNGGRH"
     gene            complement(78095..79037)
                     /locus_tag="AT3G01240"
                     /gene_synonym="T4P13.7"
                     /gene_synonym="T4P13_7"
                     /db_xref="Araport:AT3G01240"
                     /db_xref="TAIR:AT3G01240"
     mRNA            complement(78095..79037)
                     /locus_tag="AT3G01240"
                     /gene_synonym="T4P13.7"
                     /gene_synonym="T4P13_7"
                     /product="splicing regulatory glutamine/lysine-rich-like
                     protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR383272.1,INSD:AV825088.1,INSD:AV789850.1,
                     INSD:DR369761.1,INSD:DR356584.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY065444.1,INSD:AY096362.1"
                     /db_xref="TAIR:AT3G01240"
                     /db_xref="Araport:AT3G01240"
     CDS             complement(78545..78937)
                     /locus_tag="AT3G01240"
                     /gene_synonym="T4P13.7"
                     /gene_synonym="T4P13_7"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR383272.1,INSD:AV825088.1,INSD:AV789850.1,
                     INSD:DR369761.1,INSD:DR356584.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY065444.1,INSD:AY096362.1"
                     /note="unknown protein; FUNCTIONS IN: molecular_function
                     unknown; INVOLVED IN: biological_process unknown; LOCATED
                     IN: endomembrane system; EXPRESSED IN: 11 plant
                     structures; EXPRESSED DURING: L mature pollen stage, M
                     germinated pollen stage, 4 anthesis, C globular stage,
                     petal differentiation and expansion stage; BEST
                     Arabidopsis thaliana protein match is: unknown protein
                     (TAIR:AT3G01230.1); Has 12 Blast hits to 12 proteins in 3
                     species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
                     Plants - 11; Viruses - 0; Other Eukaryotes - 1 (source:
                     NCBI BLink)."
                     /codon_start=1
                     /product="splicing regulatory glutamine/lysine-rich-like
                     protein"
                     /protein_id="AEE73628.1"
                     /db_xref="TAIR:AT3G01240"
                     /db_xref="Araport:AT3G01240"
                     /translation="MAKISFVLFVVALIAFLHAYEARKVVNLGEAFEKDLHKAEAMIA
                     EELKAKKTNIQGLKSEVKTLSKSEVMLKELGNAYKKDMDLRPYEKKLKNFSRIVALKK
                     APMKNNNKKPVSIIQSILKDFGLNGGRN"
     gene            79297..80173
                     /locus_tag="AT3G01250"
                     /gene_synonym="T4P13.6"
                     /gene_synonym="T4P13_6"
                     /db_xref="Araport:AT3G01250"
                     /db_xref="TAIR:AT3G01250"
     mRNA            79297..80173
                     /locus_tag="AT3G01250"
                     /gene_synonym="T4P13.6"
                     /gene_synonym="T4P13_6"
                     /product="transmembrane protein"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX826271.1,INSD:BX825193.1,INSD:BT043480.1"
                     /db_xref="TAIR:AT3G01250"
                     /db_xref="Araport:AT3G01250"
     CDS             79404..79898
                     /locus_tag="AT3G01250"
                     /gene_synonym="T4P13.6"
                     /gene_synonym="T4P13_6"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX826271.1,INSD:BX825193.1,INSD:BT043480.1"
                     /note="unknown protein; FUNCTIONS IN: molecular_function
                     unknown; INVOLVED IN: biological_process unknown; LOCATED
                     IN: endomembrane system; EXPRESSED IN: 9 plant structures;
                     EXPRESSED DURING: L mature pollen stage, M germinated
                     pollen stage, 4 anthesis, C globular stage, petal
                     differentiation and expansion stage; Has 50 Blast hits to
                     50 proteins in 23 species: Archae - 0; Bacteria - 28;
                     Metazoa - 15; Fungi - 0; Plants - 4; Viruses - 0; Other
                     Eukaryotes - 3 (source: NCBI BLink)."
                     /codon_start=1
                     /product="transmembrane protein"
                     /protein_id="AEE73629.1"
                     /db_xref="TAIR:AT3G01250"
                     /db_xref="Araport:AT3G01250"
                     /translation="MAKNSYALSGLIVALVIALVCNIDDAAARDVKLVKLRDVKPETL
                     NKLKGEKESELMQAEEKNNLLKEIEKAKKLLGELKTLKKQSTGDMKSELKSLVKSESL
                     LNEISDSLKNGTYNHIKANIFVEKESFFYRAWKENAYNSVVPEKEKEYMSTIKRIVKL
                     VKKT"
     gene            complement(80003..82182)
                     /locus_tag="AT3G01260"
                     /gene_synonym="T4P13.5"
                     /gene_synonym="T4P13_5"
                     /db_xref="Araport:AT3G01260"
                     /db_xref="TAIR:AT3G01260"
     mRNA            complement(join(80003..80523,80639..80939,81040..81150,
                     81247..81337,81418..81467,81558..82182))
                     /locus_tag="AT3G01260"
                     /gene_synonym="T4P13.5"
                     /gene_synonym="T4P13_5"
                     /product="Galactose mutarotase-like superfamily protein"
                     /inference="Similar to RNA sequence, EST:INSD:N37262.1"
                     /db_xref="TAIR:AT3G01260"
                     /db_xref="Araport:AT3G01260"
     CDS             complement(join(80244..80523,80639..80939,81040..81150,
                     81247..81337,81418..81467,81558..82005))
                     /locus_tag="AT3G01260"
                     /gene_synonym="T4P13.5"
                     /gene_synonym="T4P13_5"
                     /inference="Similar to RNA sequence, EST:INSD:N37262.1"
                     /note="Galactose mutarotase-like superfamily protein;
                     FUNCTIONS IN: carbohydrate binding, isomerase activity,
                     aldose 1-epimerase activity, catalytic activity; INVOLVED
                     IN: galactose metabolic process, hexose metabolic process,
                     carbohydrate metabolic process; LOCATED IN: endomembrane
                     system; EXPRESSED IN: root; CONTAINS InterPro DOMAIN/s:
                     Aldose 1-epimerase (InterPro:IPR008183), Glycoside
                     hydrolase-type carbohydrate-binding (InterPro:IPR011013),
                     Aldose 1-epimerase, subgroup (InterPro:IPR015443),
                     Glycoside hydrolase-type carbohydrate-binding, subgroup
                     (InterPro:IPR014718); BEST Arabidopsis thaliana protein
                     match is: Galactose mutarotase-like superfamily protein
                     (TAIR:AT5G15140.1); Has 6350 Blast hits to 6088 proteins
                     in 1398 species: Archae - 6; Bacteria - 3037; Metazoa -
                     664; Fungi - 417; Plants - 287; Viruses - 26; Other
                     Eukaryotes - 1913 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Galactose mutarotase-like superfamily protein"
                     /protein_id="AEE73630.1"
                     /db_xref="TAIR:AT3G01260"
                     /db_xref="Araport:AT3G01260"
                     /translation="MVRISVLVCLVLLVTIGVMVSVSLADNNEEKSTDLKKFKGGVTD
                     HSISKANDNDHDDDDHDQDDDNDGDHDDDDHDDDNDHDDDNNDHDDDDNNDDNNDGDD
                     DHDDDNNDDGDDEKKTLRVHELKKGNLTVKFTNRGASIMSLLFPNINGKLEDIVLGYD
                     SVNDHMIDTVFCGVTLARVASKKEKAAANDGKNTIHGGTKESSDVIWRVKKHKHNGKK
                     PYIVFTYTTSPDGDQGKLEVTVTYKLVGENRLKMVMQAKAKEKTTPLNLVHRSYWNLG
                     GHNNEDIFSEEIQILGSGYTHLDDNLTPTGKILAVKGTPFDFRQLRPIKDNINELKTG
                     YGINYCLDGVANKMRKVVELVDNKSKIKMELSTDQSGLRLKTTKPKNGSVHKAYSGLC
                     LESHAINYQYRSSQIIEPGETYKHTMLFKFSFVP"
     gene            complement(82581..84901)
                     /locus_tag="AT3G01270"
                     /gene_synonym="T22N4.10"
                     /gene_synonym="T22N4_10"
                     /gene_synonym="T4P13.4"
                     /gene_synonym="T4P13_4"
                     /db_xref="Araport:AT3G01270"
                     /db_xref="TAIR:AT3G01270"
     mRNA            complement(join(82581..83116,83194..83439,83538..84297,
                     84524..84901))
                     /locus_tag="AT3G01270"
                     /gene_synonym="T22N4.10"
                     /gene_synonym="T22N4_10"
                     /gene_synonym="T4P13.4"
                     /gene_synonym="T4P13_4"
                     /product="Pectate lyase family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV541937.1,INSD:DR296722.1,INSD:CK120438.1,
                     INSD:Z48374.1,INSD:Z17720.1,INSD:AA598116.1,INSD:Z48375.1,
                     INSD:DR379035.1,INSD:CK120741.1,INSD:BP836972.1,
                     INSD:BP815315.1,INSD:AU236983.1,INSD:AA605589.1,
                     INSD:BP638549.1,INSD:BP832471.1,INSD:BP637122.1,
                     INSD:BP654319.1,INSD:BP659477.1,INSD:BP839865.1,
                     INSD:BP643101.1,INSD:DR296721.1,INSD:AV531140.1,
                     INSD:BP828949.1,INSD:DR296723.1,INSD:AA597562.1,
                     INSD:BP838776.1,INSD:BP651083.1,INSD:AV535991.1,
                     INSD:AU227995.1,INSD:BP841120.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT004191.1,INSD:BT029009.1,INSD:AY084341.1,
                     INSD:AK221131.1,INSD:BX822786.1"
                     /db_xref="TAIR:AT3G01270"
                     /db_xref="Araport:AT3G01270"
     CDS             complement(join(82892..83116,83194..83439,83538..84297,
                     84524..84720))
                     /locus_tag="AT3G01270"
                     /gene_synonym="T22N4.10"
                     /gene_synonym="T22N4_10"
                     /gene_synonym="T4P13.4"
                     /gene_synonym="T4P13_4"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV541937.1,INSD:DR296722.1,INSD:CK120438.1,
                     INSD:Z48374.1,INSD:Z17720.1,INSD:AA598116.1,INSD:Z48375.1,
                     INSD:DR379035.1,INSD:CK120741.1,INSD:BP836972.1,
                     INSD:BP815315.1,INSD:AU236983.1,INSD:AA605589.1,
                     INSD:BP638549.1,INSD:BP832471.1,INSD:BP637122.1,
                     INSD:BP654319.1,INSD:BP659477.1,INSD:BP839865.1,
                     INSD:BP643101.1,INSD:DR296721.1,INSD:AV531140.1,
                     INSD:BP828949.1,INSD:DR296723.1,INSD:AA597562.1,
                     INSD:BP838776.1,INSD:BP651083.1,INSD:AV535991.1,
                     INSD:AU227995.1,INSD:BP841120.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT004191.1,INSD:BT029009.1,INSD:AY084341.1,
                     INSD:AK221131.1,INSD:BX822786.1"
                     /note="Pectate lyase family protein; FUNCTIONS IN: lyase
                     activity, pectate lyase activity; INVOLVED IN:
                     biological_process unknown; LOCATED IN: endomembrane
                     system; EXPRESSED IN: 20 plant structures; EXPRESSED
                     DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s:
                     Pectin lyase fold/virulence factor (InterPro:IPR011050),
                     Pectate lyase, N-terminal (InterPro:IPR007524),
                     AmbAllergen (InterPro:IPR018082), Pectate lyase/Amb
                     allergen (InterPro:IPR002022), Pectin lyase fold
                     (InterPro:IPR012334); BEST Arabidopsis thaliana protein
                     match is: Pectate lyase family protein (TAIR:AT5G15110.1);
                     Has 1587 Blast hits to 1580 proteins in 266 species:
                     Archae - 0; Bacteria - 700; Metazoa - 0; Fungi - 174;
                     Plants - 701; Viruses - 0; Other Eukaryotes - 12 (source:
                     NCBI BLink)."
                     /codon_start=1
                     /product="Pectate lyase family protein"
                     /protein_id="AEE73631.1"
                     /db_xref="TAIR:AT3G01270"
                     /db_xref="Araport:AT3G01270"
                     /translation="METARLFKLVCVICIASLIPTIRANVADETDEYWVNKANEARKH
                     TLMAYHPDPYEIVDHFHERHYDNSTDVEGTEEEKAVASEEEDVIEMISSPTNSTRRSL
                     TGRGKGKGKGKWSKLTGPCTASNPIDKCWRCQPDWARRRKKLVHCVRGFGYRTTGGKR
                     GRIYVVTSPRDDDMVNPRPGTLRHAVIQKEPLWIVFKHDMSIRLSQELMITSDKTIDA
                     RGANVHIAYGAGITMQYVHNIIIHGLHVHHIVKSSGGLIRDSINHFGHRGEADGDGIS
                     IFGATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDKK
                     MQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIA
                     PPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMNNAYFRQSGNPHFKCSHSRQQMIK
                     PKNGMAVSKLTKYAGALDCRVGKAC"
     gene            85551..88070
                     /gene="VDAC1"
                     /locus_tag="AT3G01280"
                     /gene_synonym="5076"
                     /gene_synonym="ARABIDOPSIS THALIANA VOLTAGE DEPENDENT
                     ANION CHANNEL 1"
                     /gene_synonym="ATVDAC1"
                     /gene_synonym="T22N4.9"
                     /gene_synonym="T22N4_9"
                     /gene_synonym="voltage dependent anion channel 1"
                     /note="Encodes a voltage-dependent anion channel (VDAC:
                     AT3G01280/VDAC1, AT5G67500/VDAC2, AT5G15090/VDAC3,
                     AT5G57490/VDAC4, AT5G15090/VDAC5). VDACs are reported to
                     be porin-type, beta-barrel diffusion pores. They are
                     prominently localized in the outer mitochondrial membrane
                     and are involved in metabolite exchange between the
                     organelle and the cytosol."
                     /db_xref="Araport:AT3G01280"
                     /db_xref="TAIR:AT3G01280"
     mRNA            join(85551..85802,86302..86369,86599..86709,86824..86910,
                     87011..87219,87306..88070)
                     /gene="VDAC1"
                     /locus_tag="AT3G01280"
                     /gene_synonym="5076"
                     /gene_synonym="ARABIDOPSIS THALIANA VOLTAGE DEPENDENT
                     ANION CHANNEL 1"
                     /gene_synonym="ATVDAC1"
                     /gene_synonym="T22N4.9"
                     /gene_synonym="T22N4_9"
                     /gene_synonym="voltage dependent anion channel 1"
                     /product="voltage dependent anion channel 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL068995.1,INSD:AI099688.1,INSD:DR234172.1,
                     INSD:DR234267.1,INSD:BP657314.1,INSD:DR234254.1,
                     INSD:DR234294.1,INSD:ES182791.1,INSD:BP651987.1,
                     INSD:DR234269.1,INSD:DR234281.1,INSD:DR234189.1,
                     INSD:DR234162.1,INSD:EL991936.1,INSD:BP670758.1,
                     INSD:ES021072.1,INSD:DR234220.1,INSD:BP560620.2,
                     INSD:DR185823.1,INSD:EL977926.1,INSD:DR234164.1,
                     INSD:DR234278.1,INSD:ES125193.1,INSD:EL096081.1,
                     INSD:ES010086.1,INSD:DR234243.1,INSD:BP564640.1,
                     INSD:AV561749.1,INSD:ES181028.1,INSD:EL058416.1,
                     INSD:DR234198.1,INSD:ES009645.1,INSD:EL201320.1,
                     INSD:DR234268.1,INSD:DR234289.1,INSD:Z33766.1,
                     INSD:BP642088.1,INSD:BP861762.1,INSD:T43834.1,
                     INSD:DR234179.1,INSD:DR234239.1,INSD:DR234292.1,
                     INSD:DR234228.1,INSD:ES133516.1,INSD:AV545065.1,
                     INSD:EL276349.1,INSD:EL988259.1,INSD:DR234229.1,
                     INSD:EL970230.1,INSD:AV564760.1,INSD:DR234169.1,
                     INSD:DR234221.1,INSD:EL139067.1,INSD:BP777203.1,
                     INSD:DR234291.1,INSD:EL074747.1,INSD:DR234194.1,
                     INSD:EH983281.1,INSD:BP789925.1,INSD:DR234295.1,
                     INSD:EL101172.1,INSD:EL982617.1,INSD:DR234274.1,
                     INSD:ES166881.1,INSD:EL198441.1,INSD:BP626582.1,
                     INSD:DR234184.1,INSD:EL112871.1,INSD:DR382567.1,
                     INSD:DR234259.1,INSD:ES141796.1,INSD:EG518049.1,
                     INSD:BP617710.1,INSD:DR234222.1,INSD:ES209951.1,
                     INSD:ES195463.1,INSD:BP640581.1,INSD:DR234244.1,
                     INSD:BP609031.1,INSD:DR185829.1,INSD:EL087601.1,
                     INSD:DR234219.1,INSD:DR234166.1,INSD:DR234282.1,
                     INSD:ES005220.1,INSD:DR234199.1,INSD:ES179990.1,
                     INSD:ES160663.1,INSD:DR234271.1,INSD:AV565517.1,
                     INSD:EH935074.1,INSD:DR185820.1,INSD:BP807371.1,
                     INSD:AV782839.1,INSD:ES017397.1,INSD:AI993460.1,
                     INSD:DR234256.1,INSD:EL322979.1,INSD:AV538694.1,
                     INSD:DR234181.1,INSD:DR234182.1,INSD:DR234165.1,
                     INSD:ES018418.1,INSD:DR234270.1,INSD:AV545069.1,
                     INSD:EH923578.1,INSD:EH984304.1,INSD:EH834512.1,
                     INSD:AV521932.1,INSD:DR185825.1,INSD:DR234283.1,
                     INSD:DR234180.1,INSD:DR234186.1,INSD:DR185819.1,
                     INSD:EG519778.1,INSD:DR234277.1,INSD:EH822595.1,
                     INSD:EG518066.1,INSD:AV564677.1,INSD:ES203817.1,
                     INSD:BP642396.1,INSD:AV553724.1,INSD:EL176600.1,
                     INSD:AV794805.1,INSD:DR234275.1,INSD:ES087330.1,
                     INSD:EL969929.1,INSD:EL268396.1,INSD:EH933024.1,
                     INSD:DR234178.1,INSD:DR234257.1,INSD:DR234196.1,
                     INSD:DR234213.1,INSD:EH976045.1,INSD:ES118091.1,
                     INSD:AV441290.2,INSD:AV542481.1,INSD:EL114457.1,
                     INSD:AV785681.1,INSD:DR234242.1,INSD:AV539909.1,
                     INSD:BP858117.1,INSD:DR234185.1,INSD:DR234230.1,
                     INSD:DR185826.1,INSD:DR234279.1,INSD:DR234224.1,
                     INSD:DR234225.1,INSD:DR234251.1,INSD:DR234263.1,
                     INSD:EG518065.1,INSD:DR234280.1,INSD:DR234216.1,
                     INSD:ES207459.1,INSD:ES106760.1,INSD:DR234236.1,
                     INSD:EH963931.1,INSD:ES031653.1,INSD:Z25639.1,
                     INSD:DR234203.1,INSD:DR234187.1,INSD:DR234232.1,
                     INSD:DR234288.1,INSD:T20435.1,INSD:EL312893.1,
                     INSD:ES145412.1,INSD:DR234287.1,INSD:DR234235.1,
                     INSD:EL281812.1,INSD:EH834525.1,INSD:EL971757.1,
                     INSD:ES009492.1,INSD:BP598430.1,INSD:EL061033.1,
                     INSD:DR234205.1,INSD:DR234227.1,INSD:DR234252.1,
                     INSD:DR234177.1,INSD:AV560505.1,INSD:AV797414.1,
                     INSD:DR234241.1,INSD:EL163915.1,INSD:DR234249.1,
                     INSD:DR234208.1,INSD:AV549243.1,INSD:DR234193.1,
                     INSD:ES099934.1,INSD:DR234201.1,INSD:DR234188.1,
                     INSD:ES054116.1,INSD:Z34040.1,INSD:EL039404.1,
                     INSD:EL996927.1,INSD:DR234226.1,INSD:EH831644.1,
                     INSD:DR185817.1,INSD:DR185821.1,INSD:DR234265.1,
                     INSD:EL222533.1,INSD:ES006025.1,INSD:EL004483.1,
                     INSD:DR234238.1,INSD:EG518050.1,INSD:ES209109.1,
                     INSD:DR234250.1,INSD:DR234276.1,INSD:ES090889.1,
                     INSD:EL985326.1,INSD:ES026401.1,INSD:ES186755.1,
                     INSD:AV564799.1,INSD:EL201929.1,INSD:EL165527.1,
                     INSD:DR185827.1,INSD:ES214907.1,INSD:T46788.1,
                     INSD:DR234190.1,INSD:AV542659.1,INSD:ES060161.1,
                     INSD:ES151561.1,INSD:BE526010.1,INSD:DR234261.1,
                     INSD:DR234204.1,INSD:N65445.1,INSD:ES084667.1,
                     INSD:DR234192.1,INSD:EH938712.1,INSD:AV533992.1,
                     INSD:DR234218.1,INSD:DR234286.1,INSD:EL304623.1,
                     INSD:DR234273.1,INSD:DR234209.1,INSD:EL279398.1,
                     INSD:EH869417.1,INSD:ES027765.1,INSD:DR234253.1,
                     INSD:DR185822.1,INSD:DR234247.1,INSD:EH951133.1,
                     INSD:ES158132.1,INSD:EH882153.1,INSD:EH929825.1,
                     INSD:T88037.1,INSD:EH936212.1,INSD:DR234168.1,
                     INSD:AV560509.1,INSD:EL195914.1,INSD:DR234217.1,
                     INSD:EL198774.1,INSD:EH918858.1,INSD:EH850448.1,
                     INSD:AV822162.1,INSD:DR234206.1,INSD:H76474.1,
                     INSD:AV553771.1,INSD:EL240091.1,INSD:EL971334.1,
                     INSD:DR234266.1,INSD:DR234233.1,INSD:DR234171.1,
                     INSD:EH858463.1,INSD:T42735.1,INSD:EL977125.1,
                     INSD:EH921402.1,INSD:BP620588.1,INSD:ES086765.1,
                     INSD:AV562881.1,INSD:DR234183.1,INSD:T43888.1,
                     INSD:DR376584.1,INSD:DR234174.1,INSD:ES033508.1,
                     INSD:BP621347.1,INSD:AV535622.1,INSD:DR234212.1,
                     INSD:DR234195.1,INSD:AV539135.1,INSD:EL085629.1,
                     INSD:AI998695.1,INSD:EL003220.1,INSD:BP644117.1,
                     INSD:DR234260.1,INSD:DR234258.1,INSD:AV563378.1,
                     INSD:DR234214.1,INSD:BP784398.1,INSD:EL980215.1,
                     INSD:ES125946.1,INSD:DR234284.1,INSD:ES001746.1,
                     INSD:EH989026.1,INSD:DR234293.1,INSD:BP789522.1,
                     INSD:AV558390.1,INSD:DR234285.1,INSD:DR234200.1,
                     INSD:BP671492.1,INSD:DR234248.1,INSD:EL246231.1,
                     INSD:EL977956.1,INSD:DR234255.1,INSD:EH838211.1,
                     INSD:EL238308.1,INSD:DR234223.1,INSD:DR234272.1,
                     INSD:AV811390.1,INSD:BP654890.1,INSD:DR234161.1,
                     INSD:AV785422.1,INSD:EL089050.1,INSD:DR234163.1,
                     INSD:DR232153.1,INSD:ES204483.1,INSD:AV797470.1,
                     INSD:ES115602.1,INSD:ES005460.1,INSD:AV537400.1,
                     INSD:DR234202.1,INSD:AI100079.1,INSD:BP595188.1,
                     INSD:DR234207.1,INSD:DR234231.1,INSD:EL026850.1,
                     INSD:BP639280.1,INSD:DR234246.1,INSD:DR234197.1,
                     INSD:EH902520.1,INSD:DR234176.1,INSD:DR234211.1,
                     INSD:AV536961.1,INSD:DR234191.1,INSD:AV551032.1,
                     INSD:EH881151.1,INSD:DR234173.1,INSD:DR185828.1,
                     INSD:ES120593.1,INSD:BP834280.1,INSD:AV518904.1,
                     INSD:EL212376.1,INSD:EH828107.1,INSD:AV557053.1,
                     INSD:ES063859.1,INSD:EH908927.1,INSD:AV537842.1,
                     INSD:ES066527.1,INSD:AV564609.1,INSD:DR234234.1,
                     INSD:DR234290.1,INSD:DR234210.1,INSD:DR234175.1,
                     INSD:EL163089.1,INSD:DR234215.1,INSD:ES153999.1,
                     INSD:DR234245.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX823136.1,INSD:AY113169.1,INSD:BX822289.1,
                     INSD:AY087979.1,INSD:AY037217.1"
                     /db_xref="TAIR:AT3G01280"
                     /db_xref="Araport:AT3G01280"
     CDS             join(85754..85802,86302..86369,86599..86709,86824..86910,
                     87011..87219,87306..87612)
                     /gene="VDAC1"
                     /locus_tag="AT3G01280"
                     /gene_synonym="5076"
                     /gene_synonym="ARABIDOPSIS THALIANA VOLTAGE DEPENDENT
                     ANION CHANNEL 1"
                     /gene_synonym="ATVDAC1"
                     /gene_synonym="T22N4.9"
                     /gene_synonym="T22N4_9"
                     /gene_synonym="voltage dependent anion channel 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL068995.1,INSD:AI099688.1,INSD:DR234172.1,
                     INSD:DR234267.1,INSD:BP657314.1,INSD:DR234254.1,
                     INSD:DR234294.1,INSD:ES182791.1,INSD:BP651987.1,
                     INSD:DR234269.1,INSD:DR234281.1,INSD:DR234189.1,
                     INSD:DR234162.1,INSD:EL991936.1,INSD:BP670758.1,
                     INSD:ES021072.1,INSD:DR234220.1,INSD:BP560620.2,
                     INSD:DR185823.1,INSD:EL977926.1,INSD:DR234164.1,
                     INSD:DR234278.1,INSD:ES125193.1,INSD:EL096081.1,
                     INSD:ES010086.1,INSD:DR234243.1,INSD:BP564640.1,
                     INSD:AV561749.1,INSD:ES181028.1,INSD:EL058416.1,
                     INSD:DR234198.1,INSD:ES009645.1,INSD:EL201320.1,
                     INSD:DR234268.1,INSD:DR234289.1,INSD:Z33766.1,
                     INSD:BP642088.1,INSD:BP861762.1,INSD:T43834.1,
                     INSD:DR234179.1,INSD:DR234239.1,INSD:DR234292.1,
                     INSD:DR234228.1,INSD:ES133516.1,INSD:AV545065.1,
                     INSD:EL276349.1,INSD:EL988259.1,INSD:DR234229.1,
                     INSD:EL970230.1,INSD:AV564760.1,INSD:DR234169.1,
                     INSD:DR234221.1,INSD:EL139067.1,INSD:BP777203.1,
                     INSD:DR234291.1,INSD:EL074747.1,INSD:DR234194.1,
                     INSD:EH983281.1,INSD:BP789925.1,INSD:DR234295.1,
                     INSD:EL101172.1,INSD:EL982617.1,INSD:DR234274.1,
                     INSD:ES166881.1,INSD:EL198441.1,INSD:BP626582.1,
                     INSD:DR234184.1,INSD:EL112871.1,INSD:DR382567.1,
                     INSD:DR234259.1,INSD:ES141796.1,INSD:EG518049.1,
                     INSD:BP617710.1,INSD:DR234222.1,INSD:ES209951.1,
                     INSD:ES195463.1,INSD:BP640581.1,INSD:DR234244.1,
                     INSD:BP609031.1,INSD:DR185829.1,INSD:EL087601.1,
                     INSD:DR234219.1,INSD:DR234166.1,INSD:DR234282.1,
                     INSD:ES005220.1,INSD:DR234199.1,INSD:ES179990.1,
                     INSD:ES160663.1,INSD:DR234271.1,INSD:AV565517.1,
                     INSD:EH935074.1,INSD:DR185820.1,INSD:BP807371.1,
                     INSD:AV782839.1,INSD:ES017397.1,INSD:AI993460.1,
                     INSD:DR234256.1,INSD:EL322979.1,INSD:AV538694.1,
                     INSD:DR234181.1,INSD:DR234182.1,INSD:DR234165.1,
                     INSD:ES018418.1,INSD:DR234270.1,INSD:AV545069.1,
                     INSD:EH923578.1,INSD:EH984304.1,INSD:EH834512.1,
                     INSD:AV521932.1,INSD:DR185825.1,INSD:DR234283.1,
                     INSD:DR234180.1,INSD:DR234186.1,INSD:DR185819.1,
                     INSD:EG519778.1,INSD:DR234277.1,INSD:EH822595.1,
                     INSD:EG518066.1,INSD:AV564677.1,INSD:ES203817.1,
                     INSD:BP642396.1,INSD:AV553724.1,INSD:EL176600.1,
                     INSD:AV794805.1,INSD:DR234275.1,INSD:ES087330.1,
                     INSD:EL969929.1,INSD:EL268396.1,INSD:EH933024.1,
                     INSD:DR234178.1,INSD:DR234257.1,INSD:DR234196.1,
                     INSD:DR234213.1,INSD:EH976045.1,INSD:ES118091.1,
                     INSD:AV441290.2,INSD:AV542481.1,INSD:EL114457.1,
                     INSD:AV785681.1,INSD:DR234242.1,INSD:AV539909.1,
                     INSD:BP858117.1,INSD:DR234185.1,INSD:DR234230.1,
                     INSD:DR185826.1,INSD:DR234279.1,INSD:DR234224.1,
                     INSD:DR234225.1,INSD:DR234251.1,INSD:DR234263.1,
                     INSD:EG518065.1,INSD:DR234280.1,INSD:DR234216.1,
                     INSD:ES207459.1,INSD:ES106760.1,INSD:DR234236.1,
                     INSD:EH963931.1,INSD:ES031653.1,INSD:Z25639.1,
                     INSD:DR234203.1,INSD:DR234187.1,INSD:DR234232.1,
                     INSD:DR234288.1,INSD:T20435.1,INSD:EL312893.1,
                     INSD:ES145412.1,INSD:DR234287.1,INSD:DR234235.1,
                     INSD:EL281812.1,INSD:EH834525.1,INSD:EL971757.1,
                     INSD:ES009492.1,INSD:BP598430.1,INSD:EL061033.1,
                     INSD:DR234205.1,INSD:DR234227.1,INSD:DR234252.1,
                     INSD:DR234177.1,INSD:AV560505.1,INSD:AV797414.1,
                     INSD:DR234241.1,INSD:EL163915.1,INSD:DR234249.1,
                     INSD:DR234208.1,INSD:AV549243.1,INSD:DR234193.1,
                     INSD:ES099934.1,INSD:DR234201.1,INSD:DR234188.1,
                     INSD:ES054116.1,INSD:Z34040.1,INSD:EL039404.1,
                     INSD:EL996927.1,INSD:DR234226.1,INSD:EH831644.1,
                     INSD:DR185817.1,INSD:DR185821.1,INSD:DR234265.1,
                     INSD:EL222533.1,INSD:ES006025.1,INSD:EL004483.1,
                     INSD:DR234238.1,INSD:EG518050.1,INSD:ES209109.1,
                     INSD:DR234250.1,INSD:DR234276.1,INSD:ES090889.1,
                     INSD:EL985326.1,INSD:ES026401.1,INSD:ES186755.1,
                     INSD:AV564799.1,INSD:EL201929.1,INSD:EL165527.1,
                     INSD:DR185827.1,INSD:ES214907.1,INSD:T46788.1,
                     INSD:DR234190.1,INSD:AV542659.1,INSD:ES060161.1,
                     INSD:ES151561.1,INSD:BE526010.1,INSD:DR234261.1,
                     INSD:DR234204.1,INSD:N65445.1,INSD:ES084667.1,
                     INSD:DR234192.1,INSD:EH938712.1,INSD:AV533992.1,
                     INSD:DR234218.1,INSD:DR234286.1,INSD:EL304623.1,
                     INSD:DR234273.1,INSD:DR234209.1,INSD:EL279398.1,
                     INSD:EH869417.1,INSD:ES027765.1,INSD:DR234253.1,
                     INSD:DR185822.1,INSD:DR234247.1,INSD:EH951133.1,
                     INSD:ES158132.1,INSD:EH882153.1,INSD:EH929825.1,
                     INSD:T88037.1,INSD:EH936212.1,INSD:DR234168.1,
                     INSD:AV560509.1,INSD:EL195914.1,INSD:DR234217.1,
                     INSD:EL198774.1,INSD:EH918858.1,INSD:EH850448.1,
                     INSD:AV822162.1,INSD:DR234206.1,INSD:H76474.1,
                     INSD:AV553771.1,INSD:EL240091.1,INSD:EL971334.1,
                     INSD:DR234266.1,INSD:DR234233.1,INSD:DR234171.1,
                     INSD:EH858463.1,INSD:T42735.1,INSD:EL977125.1,
                     INSD:EH921402.1,INSD:BP620588.1,INSD:ES086765.1,
                     INSD:AV562881.1,INSD:DR234183.1,INSD:T43888.1,
                     INSD:DR376584.1,INSD:DR234174.1,INSD:ES033508.1,
                     INSD:BP621347.1,INSD:AV535622.1,INSD:DR234212.1,
                     INSD:DR234195.1,INSD:AV539135.1,INSD:EL085629.1,
                     INSD:AI998695.1,INSD:EL003220.1,INSD:BP644117.1,
                     INSD:DR234260.1,INSD:DR234258.1,INSD:AV563378.1,
                     INSD:DR234214.1,INSD:BP784398.1,INSD:EL980215.1,
                     INSD:ES125946.1,INSD:DR234284.1,INSD:ES001746.1,
                     INSD:EH989026.1,INSD:DR234293.1,INSD:BP789522.1,
                     INSD:AV558390.1,INSD:DR234285.1,INSD:DR234200.1,
                     INSD:BP671492.1,INSD:DR234248.1,INSD:EL246231.1,
                     INSD:EL977956.1,INSD:DR234255.1,INSD:EH838211.1,
                     INSD:EL238308.1,INSD:DR234223.1,INSD:DR234272.1,
                     INSD:AV811390.1,INSD:BP654890.1,INSD:DR234161.1,
                     INSD:AV785422.1,INSD:EL089050.1,INSD:DR234163.1,
                     INSD:DR232153.1,INSD:ES204483.1,INSD:AV797470.1,
                     INSD:ES115602.1,INSD:ES005460.1,INSD:AV537400.1,
                     INSD:DR234202.1,INSD:AI100079.1,INSD:BP595188.1,
                     INSD:DR234207.1,INSD:DR234231.1,INSD:EL026850.1,
                     INSD:BP639280.1,INSD:DR234246.1,INSD:DR234197.1,
                     INSD:EH902520.1,INSD:DR234176.1,INSD:DR234211.1,
                     INSD:AV536961.1,INSD:DR234191.1,INSD:AV551032.1,
                     INSD:EH881151.1,INSD:DR234173.1,INSD:DR185828.1,
                     INSD:ES120593.1,INSD:BP834280.1,INSD:AV518904.1,
                     INSD:EL212376.1,INSD:EH828107.1,INSD:AV557053.1,
                     INSD:ES063859.1,INSD:EH908927.1,INSD:AV537842.1,
                     INSD:ES066527.1,INSD:AV564609.1,INSD:DR234234.1,
                     INSD:DR234290.1,INSD:DR234210.1,INSD:DR234175.1,
                     INSD:EL163089.1,INSD:DR234215.1,INSD:ES153999.1,
                     INSD:DR234245.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX823136.1,INSD:AY113169.1,INSD:BX822289.1,
                     INSD:AY087979.1,INSD:AY037217.1"
                     /note="voltage dependent anion channel 1 (VDAC1);
                     FUNCTIONS IN: voltage-gated anion channel activity;
                     INVOLVED IN: response to bacterium, anion transport;
                     LOCATED IN: in 7 components; EXPRESSED IN: 27 plant
                     structures; EXPRESSED DURING: 17 growth stages; CONTAINS
                     InterPro DOMAIN/s: Porin, eukaryotic type
                     (InterPro:IPR001925); BEST Arabidopsis thaliana protein
                     match is: voltage dependent anion channel 3
                     (TAIR:AT5G15090.2); Has 888 Blast hits to 888 proteins in
                     197 species: Archae - 0; Bacteria - 0; Metazoa - 413;
                     Fungi - 146; Plants - 300; Viruses - 0; Other Eukaryotes -
                     29 (source: NCBI BLink)."
                     /codon_start=1
                     /product="voltage dependent anion channel 1"
                     /protein_id="AEE73632.1"
                     /db_xref="TAIR:AT3G01280"
                     /db_xref="Araport:AT3G01280"
                     /translation="MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITST
                     GTKKGDLLLGDVAFQSRRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPDQN
                     SGKVELQYLHEYAGISTSMGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNFTKINA
                     GLSFTKEDLIASLTVNDKGDLLNASYYHIVNPLFNTAVGAEVSHKLSSKDSTITVGTQ
                     HSLDPLTSVKARVNSAGIASALIQHEWKPKSFFTISGEVDTKSIDKSAKVGLALALKP
                     "
     gene            complement(87684..89593)
                     /gene="HIR2"
                     /locus_tag="AT3G01290"
                     /gene_synonym="AtHIR2"
                     /gene_synonym="hypersensitive induced reaction 2"
                     /gene_synonym="T22N4.8"
                     /gene_synonym="T22N4_8"
                     /db_xref="Araport:AT3G01290"
                     /db_xref="TAIR:AT3G01290"
     mRNA            complement(join(87684..88610,88693..88881,88970..89090,
                     89168..89593))
                     /gene="HIR2"
                     /locus_tag="AT3G01290"
                     /gene_synonym="AtHIR2"
                     /gene_synonym="hypersensitive induced reaction 2"
                     /gene_synonym="T22N4.8"
                     /gene_synonym="T22N4_8"
                     /product="SPFH/Band 7/PHB domain-containing
                     membrane-associated protein family"
                     /inference="Similar to RNA sequence,
                     EST:INSD:N37362.1,INSD:EH914469.1,INSD:EL239038.1,
                     INSD:CD533158.1,INSD:AV536451.1,INSD:CB252994.1,
                     INSD:EL076648.1,INSD:EL306036.1,INSD:CB252942.1,
                     INSD:EL229904.1,INSD:CB253275.1,INSD:EG480110.1,
                     INSD:T13676.1,INSD:EL225085.1,INSD:EL274032.1,
                     INSD:F13948.1,INSD:EH946990.1,INSD:EH908210.1,
                     INSD:CB254759.1,INSD:DR272254.1,INSD:CB252398.1,
                     INSD:EH828412.1,INSD:T45880.1,INSD:CB254267.1,
                     INSD:EL247019.1,INSD:T21144.1,INSD:EH811413.1,
                     INSD:R90300.1,INSD:EG480111.1,INSD:EH808165.1,
                     INSD:EH991392.1,INSD:EL049026.1,INSD:EH932704.1,
                     INSD:AI992747.1,INSD:EL074312.1,INSD:EL195615.1,
                     INSD:Z32566.1,INSD:CB254822.1,INSD:H36895.1,
                     INSD:EH994472.1,INSD:EL153827.1,INSD:EH855259.1,
                     INSD:CB252099.1,INSD:EL052057.1,INSD:EL192935.1,
                     INSD:EL090421.1,INSD:EL067765.1,INSD:EH963452.1,
                     INSD:CB254184.1,INSD:CB252516.1,INSD:CB255369.1,
                     INSD:EL236125.1,INSD:R65336.1,INSD:EH884665.1,
                     INSD:EH826745.1,INSD:T04423.1,INSD:CB252097.1,
                     INSD:T21440.1,INSD:T75660.1,INSD:EL225091.1,
                     INSD:EL222593.1,INSD:EH976749.1,INSD:EL037941.1,
                     INSD:EL223037.1,INSD:Z34713.1,INSD:EL200762.1,
                     INSD:EH879821.1,INSD:BE662989.1,INSD:T44876.1,
                     INSD:CB074592.1,INSD:CB252836.1,INSD:EL049244.1,
                     INSD:CB254589.1,INSD:CB252190.1,INSD:EL028089.1,
                     INSD:EH883213.1,INSD:EL260692.1,INSD:EH904281.1,
                     INSD:EL106965.1,INSD:EL055988.1,INSD:EL060524.1,
                     INSD:CB252610.1,INSD:DR272255.1,INSD:EL258547.1,
                     INSD:EL139757.1,INSD:EL334464.1,INSD:EL087130.1,
                     INSD:EH890731.1,INSD:EL248587.1,INSD:CB253739.1,
                     INSD:DR272253.1,INSD:BE662895.1,INSD:EL313613.1,
                     INSD:DR379254.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX824999.1,INSD:AY084426.1,INSD:BT024707.1,
                     INSD:BX825825.1,INSD:BX823828.1"
                     /db_xref="TAIR:AT3G01290"
                     /db_xref="Araport:AT3G01290"
     CDS             complement(join(88252..88610,88693..88881,88970..89090,
                     89168..89356))
                     /gene="HIR2"
                     /locus_tag="AT3G01290"
                     /gene_synonym="AtHIR2"
                     /gene_synonym="hypersensitive induced reaction 2"
                     /gene_synonym="T22N4.8"
                     /gene_synonym="T22N4_8"
                     /inference="Similar to RNA sequence,
                     EST:INSD:N37362.1,INSD:EH914469.1,INSD:EL239038.1,
                     INSD:CD533158.1,INSD:AV536451.1,INSD:CB252994.1,
                     INSD:EL076648.1,INSD:EL306036.1,INSD:CB252942.1,
                     INSD:EL229904.1,INSD:CB253275.1,INSD:EG480110.1,
                     INSD:T13676.1,INSD:EL225085.1,INSD:EL274032.1,
                     INSD:F13948.1,INSD:EH946990.1,INSD:EH908210.1,
                     INSD:CB254759.1,INSD:DR272254.1,INSD:CB252398.1,
                     INSD:EH828412.1,INSD:T45880.1,INSD:CB254267.1,
                     INSD:EL247019.1,INSD:T21144.1,INSD:EH811413.1,
                     INSD:R90300.1,INSD:EG480111.1,INSD:EH808165.1,
                     INSD:EH991392.1,INSD:EL049026.1,INSD:EH932704.1,
                     INSD:AI992747.1,INSD:EL074312.1,INSD:EL195615.1,
                     INSD:Z32566.1,INSD:CB254822.1,INSD:H36895.1,
                     INSD:EH994472.1,INSD:EL153827.1,INSD:EH855259.1,
                     INSD:CB252099.1,INSD:EL052057.1,INSD:EL192935.1,
                     INSD:EL090421.1,INSD:EL067765.1,INSD:EH963452.1,
                     INSD:CB254184.1,INSD:CB252516.1,INSD:CB255369.1,
                     INSD:EL236125.1,INSD:R65336.1,INSD:EH884665.1,
                     INSD:EH826745.1,INSD:T04423.1,INSD:CB252097.1,
                     INSD:T21440.1,INSD:T75660.1,INSD:EL225091.1,
                     INSD:EL222593.1,INSD:EH976749.1,INSD:EL037941.1,
                     INSD:EL223037.1,INSD:Z34713.1,INSD:EL200762.1,
                     INSD:EH879821.1,INSD:BE662989.1,INSD:T44876.1,
                     INSD:CB074592.1,INSD:CB252836.1,INSD:EL049244.1,
                     INSD:CB254589.1,INSD:CB252190.1,INSD:EL028089.1,
                     INSD:EH883213.1,INSD:EL260692.1,INSD:EH904281.1,
                     INSD:EL106965.1,INSD:EL055988.1,INSD:EL060524.1,
                     INSD:CB252610.1,INSD:DR272255.1,INSD:EL258547.1,
                     INSD:EL139757.1,INSD:EL334464.1,INSD:EL087130.1,
                     INSD:EH890731.1,INSD:EL248587.1,INSD:CB253739.1,
                     INSD:DR272253.1,INSD:BE662895.1,INSD:EL313613.1,
                     INSD:DR379254.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX824999.1,INSD:AY084426.1,INSD:BT024707.1,
                     INSD:BX825825.1,INSD:BX823828.1"
                     /note="SPFH/Band 7/PHB domain-containing
                     membrane-associated protein family; INVOLVED IN:
                     N-terminal protein myristoylation; LOCATED IN:
                     mitochondrion, plasma membrane, vacuole, membrane;
                     EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 9
                     growth stages; CONTAINS InterPro DOMAIN/s: Band 7 protein
                     (InterPro:IPR001107); BEST Arabidopsis thaliana protein
                     match is: SPFH/Band 7/PHB domain-containing
                     membrane-associated protein family (TAIR:AT5G62740.1); Has
                     7523 Blast hits to 7522 proteins in 1968 species: Archae -
                     210; Bacteria - 4831; Metazoa - 573; Fungi - 279; Plants -
                     280; Viruses - 3; Other Eukaryotes - 1347 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="SPFH/Band 7/PHB domain-containing
                     membrane-associated protein family"
                     /protein_id="AEE73633.1"
                     /db_xref="TAIR:AT3G01290"
                     /db_xref="Araport:AT3G01290"
                     /translation="MGNLFCCVLVKQSDVAVKERFGKFQKVLNPGLQFVPWVIGDYVA
                     GTLTLRLQQLDVQCETKTKDNVFVTVVASIQYRVLADKASDAFYRLSNPTTQIKAYVF
                     DVIRACVPKLNLDDVFEQKNEIAKSVEEELDKAMTAYGYEILQTLIIDIEPDQQVKRA
                     MNEINAAARMRVAASEKAEAEKIIQIKRAEGEAESKYLSGLGIARQRQAIVDGLRDSV
                     LGFAGNVPGTSAKDVLDMVMMTQYFDTMRDIGATSKSSAVFIPHGPGAVSDVAAQIRN
                     GLLQANNAS"
     gene            complement(90396..93588)
                     /locus_tag="AT3G01300"
                     /gene_synonym="T22N4.7"
                     /gene_synonym="T22N4_7"
                     /db_xref="Araport:AT3G01300"
                     /db_xref="TAIR:AT3G01300"
     mRNA            complement(join(90396..91328,91514..91637,91730..91866,
                     92262..92397,92485..92822,93110..93588))
                     /locus_tag="AT3G01300"
                     /gene_synonym="T22N4.7"
                     /gene_synonym="T22N4_7"
                     /product="Protein kinase superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BX835501.1,INSD:DR374701.1,INSD:AV803095.1,
                     INSD:EH936116.1,INSD:EL218029.1,INSD:AI993345.1,
                     INSD:EL172657.1,INSD:DR232423.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT028957.1,INSD:BX822941.1,INSD:AY057584.1,
                     INSD:AY087034.1"
                     /db_xref="TAIR:AT3G01300"
                     /db_xref="Araport:AT3G01300"
     CDS             complement(join(90817..91328,91514..91637,91730..91866,
                     92262..92397,92485..92822,93110..93335))
                     /locus_tag="AT3G01300"
                     /gene_synonym="T22N4.7"
                     /gene_synonym="T22N4_7"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BX835501.1,INSD:DR374701.1,INSD:AV803095.1,
                     INSD:EH936116.1,INSD:EL218029.1,INSD:AI993345.1,
                     INSD:EL172657.1,INSD:DR232423.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT028957.1,INSD:BX822941.1,INSD:AY057584.1,
                     INSD:AY087034.1"
                     /note="Protein kinase superfamily protein; FUNCTIONS IN:
                     protein serine/threonine kinase activity, protein kinase
                     activity, kinase activity, ATP binding; INVOLVED IN:
                     protein amino acid phosphorylation; LOCATED IN:
                     cellular_component unknown; CONTAINS InterPro DOMAIN/s:
                     Protein kinase, ATP binding site (InterPro:IPR017441),
                     Protein kinase, catalytic domain (InterPro:IPR000719),
                     Serine-threonine/tyrosine-protein kinase
                     (InterPro:IPR001245), Protein kinase-like domain
                     (InterPro:IPR011009), Serine/threonine-protein kinase,
                     active site (InterPro:IPR008271); BEST Arabidopsis
                     thaliana protein match is: Protein kinase superfamily
                     protein (TAIR:AT5G15080.1); Has 113948 Blast hits to
                     112631 proteins in 3965 species: Archae - 101; Bacteria -
                     13609; Metazoa - 41797; Fungi - 9320; Plants - 32432;
                     Viruses - 368; Other Eukaryotes - 16321 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="Protein kinase superfamily protein"
                     /protein_id="AEE73634.1"
                     /db_xref="TAIR:AT3G01300"
                     /db_xref="Araport:AT3G01300"
                     /translation="MGFDSVKVMENWQSKTSNENEKKKKKRRRKKNNNVRNSEHYEEE
                     ANGCWVKFRYIVCCASSTSDVETSLTLSTSTVGSQSAIVQSNDQPVGPVSSTTTTSNA
                     ESSLSTPIISEELNIYSHLKKFSFIDLKLATRNFRPESLLGEGGFGCVFKGWVEENGT
                     APVKPGTGLTVAVKTLNPDGLQGHKEWLAEINYLGNLLHPNLVKLVGYCIEDDQRLLV
                     YEFMPRGSLENHLFRRSLPLPWSIRMKIALGAAKGLSFLHEEALKPVIYRDFKTSNIL
                     LDGEYNAKLSDFGLAKDAPDEGKTHVSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGV
                     VLLEMLTGRRSMDKNRPNGEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSVKGAQKVT
                     QLAAQCLSRDSKIRPKMSEVVEVLKPLPHLKDMASASYYFQTMQAERLKAGSGSGSGR
                     GFGSRNGQPVFRTLSSPHGQAGSSPYRHQIPSPKPKGATT"
     gene            complement(93995..102010)
                     /locus_tag="AT3G01310"
                     /gene_synonym="Arabidopsis homolog of yeast Vip1 1"
                     /gene_synonym="AtVIP1"
                     /gene_synonym="T22N4.6"
                     /gene_synonym="T22N4_6"
                     /gene_synonym="T4P13.1"
                     /gene_synonym="T4P13_1"
                     /note="Encodes a myo-inositol hexakisphosphate kinase."
                     /db_xref="Araport:AT3G01310"
                     /db_xref="TAIR:AT3G01310"
     mRNA            complement(join(93995..94609,94685..94759,94854..95021,
                     95107..95164,95246..95484,95589..95660,95804..95870,
                     95957..96001,96109..96344,96551..96682,96858..96932,
                     97014..97076,97230..97312,97418..97460,97609..97767,
                     98015..98096,98276..98346,98432..98531,98623..98829,
                     99005..99090,99214..99288,99485..99577,99858..99962,
                     100084..100154,100263..100416,100547..100610,
                     100735..100818,100970..101016,101297..101356,
                     101532..101660,101851..102010))
                     /locus_tag="AT3G01310"
                     /gene_synonym="Arabidopsis homolog of yeast Vip1 1"
                     /gene_synonym="AtVIP1"
                     /gene_synonym="T22N4.6"
                     /gene_synonym="T22N4_6"
                     /gene_synonym="T4P13.1"
                     /gene_synonym="T4P13_1"
                     /product="Phosphoglycerate mutase-like family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP577715.1,INSD:ES179745.1,INSD:EL087500.1,
                     INSD:ES194260.1,INSD:BP566811.1,INSD:EG491671.1,
                     INSD:AI996873.1,INSD:AV533897.1,INSD:EL039276.1,
                     INSD:EL341786.1,INSD:AV441200.1,INSD:BP609153.1,
                     INSD:EL225147.1,INSD:EL265703.1,INSD:AU235738.1,
                     INSD:EG512547.1,INSD:EL970034.1,INSD:DR356048.1,
                     INSD:EG490893.1,INSD:BP571221.1,INSD:EH925797.1,
                     INSD:EL229747.1,INSD:EL136847.1,INSD:AU226495.1,
                     INSD:EL053867.1,INSD:BP788026.1,INSD:BP568699.1,
                     INSD:EL292190.1,INSD:DR356047.1,INSD:BP667344.1,
                     INSD:BP671557.1,INSD:BP862834.1,INSD:EH846276.1,
                     INSD:EG512546.1,INSD:BP781319.1,INSD:EH957923.1,
                     INSD:EL067766.1,INSD:EH882747.1,INSD:EG491670.1,
                     INSD:ES008205.1,INSD:DR382696.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX825735.1,INSD:BX825734.1,INSD:BT010149.1,
                     INSD:AK227817.1"
                     /db_xref="TAIR:AT3G01310"
                     /db_xref="Araport:AT3G01310"
     mRNA            complement(join(93995..94609,94685..94759,94854..95021,
                     95107..95164,95246..95484,95589..95660,95804..95870,
                     95957..96001,96109..96344,96551..96682,96858..96932,
                     97014..97076,97230..97312,97418..97460,97609..97767,
                     98015..98096,98276..98346,98432..98531,98623..98829,
                     99005..99090,99214..99288,99485..99577,99858..99962,
                     100084..100154,100263..100416,100547..100610,
                     100735..100818,100970..101016,101297..101356,
                     101514..101660,101851..102010))
                     /locus_tag="AT3G01310"
                     /gene_synonym="Arabidopsis homolog of yeast Vip1 1"
                     /gene_synonym="AtVIP1"
                     /gene_synonym="T22N4.6"
                     /gene_synonym="T22N4_6"
                     /gene_synonym="T4P13.1"
                     /gene_synonym="T4P13_1"
                     /product="Phosphoglycerate mutase-like family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP577715.1,INSD:EL087500.1,INSD:ES179745.1,
                     INSD:ES194260.1,INSD:BP566811.1,INSD:EG491671.1,
                     INSD:AI996873.1,INSD:AV533897.1,INSD:EL039276.1,
                     INSD:EL341786.1,INSD:AV441200.1,INSD:BP609153.1,
                     INSD:EL225147.1,INSD:EL265703.1,INSD:AU235738.1,
                     INSD:EG512547.1,INSD:EL970034.1,INSD:DR356048.1,
                     INSD:BP571221.1,INSD:EH925797.1,INSD:EL229747.1,
                     INSD:EL136847.1,INSD:AU226495.1,INSD:EL053867.1,
                     INSD:BP788026.1,INSD:BP568699.1,INSD:EL292190.1,
                     INSD:DR356047.1,INSD:BP667344.1,INSD:BP671557.1,
                     INSD:EH846276.1,INSD:EG512546.1,INSD:BP781319.1,
                     INSD:EL067766.1,INSD:EH957923.1,INSD:EH882747.1,
                     INSD:ES008205.1,INSD:DR382696.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX825735.1,INSD:BX825734.1,INSD:BT010149.1,
                     INSD:AK227817.1"
                     /db_xref="TAIR:AT3G01310"
                     /db_xref="Araport:AT3G01310"
     mRNA            complement(join(94076..94609,94685..94759,94854..95021,
                     95107..95164,95246..95484,95589..95660,95804..95870,
                     95957..96001,96109..96344,96551..96682,96858..96932,
                     97014..97076,97230..97312,97418..97460,97609..97767,
                     98015..98096,98276..98346,98432..98531,98623..98829,
                     99005..99090,99214..99288,99485..99577,99858..99962,
                     100084..100154,100263..100416,100547..100610,
                     100735..100818,100970..101016,101297..101660,
                     101851..102005))
                     /locus_tag="AT3G01310"
                     /gene_synonym="Arabidopsis homolog of yeast Vip1 1"
                     /gene_synonym="AtVIP1"
                     /gene_synonym="T22N4.6"
                     /gene_synonym="T22N4_6"
                     /gene_synonym="T4P13.1"
                     /gene_synonym="T4P13_1"
                     /product="Phosphoglycerate mutase-like family protein"
                     /db_xref="Araport:AT3G01310"
                     /db_xref="TAIR:AT3G01310"
     CDS             complement(join(94343..94609,94685..94759,94854..95021,
                     95107..95164,95246..95484,95589..95660,95804..95870,
                     95957..96001,96109..96344,96551..96682,96858..96932,
                     97014..97076,97230..97312,97418..97460,97609..97767,
                     98015..98096,98276..98346,98432..98531,98623..98829,
                     99005..99090,99214..99288,99485..99577,99858..99962,
                     100084..100154,100263..100416,100547..100610,
                     100735..100818,100970..101016,101297..101356,
                     101532..101603))
                     /locus_tag="AT3G01310"
                     /gene_synonym="Arabidopsis homolog of yeast Vip1 1"
                     /gene_synonym="AtVIP1"
                     /gene_synonym="T22N4.6"
                     /gene_synonym="T22N4_6"
                     /gene_synonym="T4P13.1"
                     /gene_synonym="T4P13_1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP577715.1,INSD:ES179745.1,INSD:EL087500.1,
                     INSD:ES194260.1,INSD:BP566811.1,INSD:EG491671.1,
                     INSD:AI996873.1,INSD:AV533897.1,INSD:EL039276.1,
                     INSD:EL341786.1,INSD:AV441200.1,INSD:BP609153.1,
                     INSD:EL225147.1,INSD:EL265703.1,INSD:AU235738.1,
                     INSD:EG512547.1,INSD:EL970034.1,INSD:DR356048.1,
                     INSD:EG490893.1,INSD:BP571221.1,INSD:EH925797.1,
                     INSD:EL229747.1,INSD:EL136847.1,INSD:AU226495.1,
                     INSD:EL053867.1,INSD:BP788026.1,INSD:BP568699.1,
                     INSD:EL292190.1,INSD:DR356047.1,INSD:BP667344.1,
                     INSD:BP671557.1,INSD:BP862834.1,INSD:EH846276.1,
                     INSD:EG512546.1,INSD:BP781319.1,INSD:EH957923.1,
                     INSD:EL067766.1,INSD:EH882747.1,INSD:EG491670.1,
                     INSD:ES008205.1,INSD:DR382696.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX825735.1,INSD:BX825734.1,INSD:BT010149.1,
                     INSD:AK227817.1"
                     /note="Phosphoglycerate mutase-like family protein;
                     FUNCTIONS IN: oxidoreductase activity, transition metal
                     ion binding, acid phosphatase activity; INVOLVED IN:
                     oxidation reduction; LOCATED IN: plasma membrane;
                     EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 13
                     growth stages; CONTAINS InterPro DOMAIN/s: ATP-grasp fold,
                     RimK-type (InterPro:IPR013651), Histidine phosphatase
                     superfamily, clade-2 (InterPro:IPR000560),
                     Ferritin/ribonucleotide reductase-like
                     (InterPro:IPR009078); BEST Arabidopsis thaliana protein
                     match is: Phosphoglycerate mutase-like family protein
                     (TAIR:AT5G15070.1); Has 35333 Blast hits to 34131 proteins
                     in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
                     974; Fungi - 991; Plants - 531; Viruses - 0; Other
                     Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Phosphoglycerate mutase-like family protein"
                     /protein_id="AEE73636.1"
                     /db_xref="TAIR:AT3G01310"
                     /db_xref="Araport:AT3G01310"
                     /translation="MEMEEGASGVGEKIKIGVCVMEKKVFSAPMGEILDRLQSFGEFE
                     ILHFGDKVILEDPIESWPICDCLIAFHSSGYPLEKAQAYAALRKPFLVNELDPQYLLH
                     DRRKVYEHLEMYGIPVPRYACVNRKVPNQDLHYFVEEEDFVEVHGERFWKPFVEKPVN
                     GDDHSIMIYYPSSAGGGMKELFRKIGNRSSEFHPDVRRVRREGSYIYEEFMATGGTDV
                     KVYTVGPEYAHAEARKSPVVDGVVMRNTDGKEVRYPVLLTPAEKQMAREVCIAFRQAV
                     CGFDLLRSEGCSYVCDVNGWSFVKNSYKYYDDAACVLRKMCLDAKAPHLSSTLPPTLP
                     WKVNEPVQSNEGLTRQGSGIIGTFGQSEELRCVIAVVRHGDRTPKQKVKLKVTEEKLL
                     NLMLKYNGGKPRAETKLKSAVQLQDLLDATRMLVPRTRPGRESDSDAEDLEHAEKLRQ
                     VKAVLEEGGHFSGIYRKVQLKPLKWVKIPKSDGDGEEERPVEALMVLKYGGVLTHAGR
                     KQAEELGRYFRNNMYPGEGTGLLRLHSTYRHDLKIYSSDEGRVQMSAAAFAKGLLDLE
                     GQLTPILVSLVSKDSSMLDGLDNASIEMEAAKARLNEIVTSGTKMIDDDQVSSEDFPW
                     MTDGAGLPPNAHELLRELVKLTKNVTEQVRLLAMDEDENLTEPYDIIPPYDQAKALGK
                     TNIDSDRIASGLPCGSEGFLLMFARWIKLARDLYNERKDRFDITQIPDVYDSCKYDLL
                     HNSHLDLKGLDELFKVAQLLADGVIPNEYGINPQQKLKIGSKIARRLMGKILIDLRNT
                     REEALSVAELKESQEQVLSLSASQREDRNSQPKLFINSDELRRPGTGDKDEDDDKETK
                     YRLDPKYANVKTPERHVRTRLYFTSESHIHSLMNVLRYCNLDESLLGEESLICQNALE
                     RLCKTKELDYMSYIVLRLFENTEVSLEDPKRFRIELTFSRGADLSPLRNNDDEAETLL
                     REHTLPIMGPERLQEVGSCLSLETMEKMVRPFAMPAEDFPPASTPVGFSGYFSKSAAV
                     LERLVNLFHNYKNSSSNGRS"
     CDS             complement(join(94343..94609,94685..94759,94854..95021,
                     95107..95164,95246..95484,95589..95660,95804..95870,
                     95957..96001,96109..96344,96551..96682,96858..96932,
                     97014..97076,97230..97312,97418..97460,97609..97767,
                     98015..98096,98276..98346,98432..98531,98623..98829,
                     99005..99090,99214..99288,99485..99577,99858..99962,
                     100084..100154,100263..100416,100547..100610,
                     100735..100818,100970..101016,101297..101356,
                     101514..101603))
                     /locus_tag="AT3G01310"
                     /gene_synonym="Arabidopsis homolog of yeast Vip1 1"
                     /gene_synonym="AtVIP1"
                     /gene_synonym="T22N4.6"
                     /gene_synonym="T22N4_6"
                     /gene_synonym="T4P13.1"
                     /gene_synonym="T4P13_1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP577715.1,INSD:EL087500.1,INSD:ES179745.1,
                     INSD:ES194260.1,INSD:BP566811.1,INSD:EG491671.1,
                     INSD:AI996873.1,INSD:AV533897.1,INSD:EL039276.1,
                     INSD:EL341786.1,INSD:AV441200.1,INSD:BP609153.1,
                     INSD:EL225147.1,INSD:EL265703.1,INSD:AU235738.1,
                     INSD:EG512547.1,INSD:EL970034.1,INSD:DR356048.1,
                     INSD:BP571221.1,INSD:EH925797.1,INSD:EL229747.1,
                     INSD:EL136847.1,INSD:AU226495.1,INSD:EL053867.1,
                     INSD:BP788026.1,INSD:BP568699.1,INSD:EL292190.1,
                     INSD:DR356047.1,INSD:BP667344.1,INSD:BP671557.1,
                     INSD:EH846276.1,INSD:EG512546.1,INSD:BP781319.1,
                     INSD:EL067766.1,INSD:EH957923.1,INSD:EH882747.1,
                     INSD:ES008205.1,INSD:DR382696.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX825735.1,INSD:BX825734.1,INSD:BT010149.1,
                     INSD:AK227817.1"
                     /note="Phosphoglycerate mutase-like family protein;
                     FUNCTIONS IN: oxidoreductase activity, transition metal
                     ion binding, acid phosphatase activity; INVOLVED IN:
                     oxidation reduction; LOCATED IN: plasma membrane;
                     EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 13
                     growth stages; CONTAINS InterPro DOMAIN/s: ATP-grasp fold,
                     RimK-type (InterPro:IPR013651), Histidine phosphatase
                     superfamily, clade-2 (InterPro:IPR000560),
                     Ferritin/ribonucleotide reductase-like
                     (InterPro:IPR009078); BEST Arabidopsis thaliana protein
                     match is: Phosphoglycerate mutase-like family protein
                     (TAIR:AT5G15070.1); Has 618 Blast hits to 482 proteins in
                     186 species: Archae - 0; Bacteria - 7; Metazoa - 225;
                     Fungi - 193; Plants - 69; Viruses - 0; Other Eukaryotes -
                     124 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Phosphoglycerate mutase-like family protein"
                     /protein_id="AEE73635.1"
                     /db_xref="TAIR:AT3G01310"
                     /db_xref="Araport:AT3G01310"
                     /translation="MEMEEGASGVGEKIKIGVCVMEKKVKCGSEVFSAPMGEILDRLQ
                     SFGEFEILHFGDKVILEDPIESWPICDCLIAFHSSGYPLEKAQAYAALRKPFLVNELD
                     PQYLLHDRRKVYEHLEMYGIPVPRYACVNRKVPNQDLHYFVEEEDFVEVHGERFWKPF
                     VEKPVNGDDHSIMIYYPSSAGGGMKELFRKIGNRSSEFHPDVRRVRREGSYIYEEFMA
                     TGGTDVKVYTVGPEYAHAEARKSPVVDGVVMRNTDGKEVRYPVLLTPAEKQMAREVCI
                     AFRQAVCGFDLLRSEGCSYVCDVNGWSFVKNSYKYYDDAACVLRKMCLDAKAPHLSST
                     LPPTLPWKVNEPVQSNEGLTRQGSGIIGTFGQSEELRCVIAVVRHGDRTPKQKVKLKV
                     TEEKLLNLMLKYNGGKPRAETKLKSAVQLQDLLDATRMLVPRTRPGRESDSDAEDLEH
                     AEKLRQVKAVLEEGGHFSGIYRKVQLKPLKWVKIPKSDGDGEEERPVEALMVLKYGGV
                     LTHAGRKQAEELGRYFRNNMYPGEGTGLLRLHSTYRHDLKIYSSDEGRVQMSAAAFAK
                     GLLDLEGQLTPILVSLVSKDSSMLDGLDNASIEMEAAKARLNEIVTSGTKMIDDDQVS
                     SEDFPWMTDGAGLPPNAHELLRELVKLTKNVTEQVRLLAMDEDENLTEPYDIIPPYDQ
                     AKALGKTNIDSDRIASGLPCGSEGFLLMFARWIKLARDLYNERKDRFDITQIPDVYDS
                     CKYDLLHNSHLDLKGLDELFKVAQLLADGVIPNEYGINPQQKLKIGSKIARRLMGKIL
                     IDLRNTREEALSVAELKESQEQVLSLSASQREDRNSQPKLFINSDELRRPGTGDKDED
                     DDKETKYRLDPKYANVKTPERHVRTRLYFTSESHIHSLMNVLRYCNLDESLLGEESLI
                     CQNALERLCKTKELDYMSYIVLRLFENTEVSLEDPKRFRIELTFSRGADLSPLRNNDD
                     EAETLLREHTLPIMGPERLQEVGSCLSLETMEKMVRPFAMPAEDFPPASTPVGFSGYF
                     SKSAAVLERLVNLFHNYKNSSSNGRS"
     CDS             complement(join(94343..94609,94685..94759,94854..95021,
                     95107..95164,95246..95484,95589..95660,95804..95870,
                     95957..96001,96109..96344,96551..96682,96858..96932,
                     97014..97076,97230..97312,97418..97460,97609..97767,
                     98015..98096,98276..98346,98432..98531,98623..98829,
                     99005..99090,99214..99288,99485..99577,99858..99962,
                     100084..100154,100263..100416,100547..100610,
                     100735..100818,100970..101016,101297..101341))
                     /locus_tag="AT3G01310"
                     /gene_synonym="Arabidopsis homolog of yeast Vip1 1"
                     /gene_synonym="AtVIP1"
                     /gene_synonym="T22N4.6"
                     /gene_synonym="T22N4_6"
                     /gene_synonym="T4P13.1"
                     /gene_synonym="T4P13_1"
                     /codon_start=1
                     /product="Phosphoglycerate mutase-like family protein"
                     /protein_id="ANM65894.1"
                     /db_xref="Araport:AT3G01310"
                     /db_xref="TAIR:AT3G01310"
                     /translation="MGEILDRLQSFGEFEILHFGDKVILEDPIESWPICDCLIAFHSS
                     GYPLEKAQAYAALRKPFLVNELDPQYLLHDRRKVYEHLEMYGIPVPRYACVNRKVPNQ
                     DLHYFVEEEDFVEVHGERFWKPFVEKPVNGDDHSIMIYYPSSAGGGMKELFRKIGNRS
                     SEFHPDVRRVRREGSYIYEEFMATGGTDVKVYTVGPEYAHAEARKSPVVDGVVMRNTD
                     GKEVRYPVLLTPAEKQMAREVCIAFRQAVCGFDLLRSEGCSYVCDVNGWSFVKNSYKY
                     YDDAACVLRKMCLDAKAPHLSSTLPPTLPWKVNEPVQSNEGLTRQGSGIIGTFGQSEE
                     LRCVIAVVRHGDRTPKQKVKLKVTEEKLLNLMLKYNGGKPRAETKLKSAVQLQDLLDA
                     TRMLVPRTRPGRESDSDAEDLEHAEKLRQVKAVLEEGGHFSGIYRKVQLKPLKWVKIP
                     KSDGDGEEERPVEALMVLKYGGVLTHAGRKQAEELGRYFRNNMYPGEGTGLLRLHSTY
                     RHDLKIYSSDEGRVQMSAAAFAKGLLDLEGQLTPILVSLVSKDSSMLDGLDNASIEME
                     AAKARLNEIVTSGTKMIDDDQVSSEDFPWMTDGAGLPPNAHELLRELVKLTKNVTEQV
                     RLLAMDEDENLTEPYDIIPPYDQAKALGKTNIDSDRIASGLPCGSEGFLLMFARWIKL
                     ARDLYNERKDRFDITQIPDVYDSCKYDLLHNSHLDLKGLDELFKVAQLLADGVIPNEY
                     GINPQQKLKIGSKIARRLMGKILIDLRNTREEALSVAELKESQEQVLSLSASQREDRN
                     SQPKLFINSDELRRPGTGDKDEDDDKETKYRLDPKYANVKTPERHVRTRLYFTSESHI
                     HSLMNVLRYCNLDESLLGEESLICQNALERLCKTKELDYMSYIVLRLFENTEVSLEDP
                     KRFRIELTFSRGADLSPLRNNDDEAETLLREHTLPIMGPERLQEVGSCLSLETMEKMV
                     RPFAMPAEDFPPASTPVGFSGYFSKSAAVLERLVNLFHNYKNSSSNGRS"
     gene            complement(102679..104495)
                     /locus_tag="AT3G01311"
                     /db_xref="Araport:AT3G01311"
                     /db_xref="TAIR:AT3G01311"
     mRNA            complement(join(102679..102811,103126..103414,
                     103501..103773,104054..104495))
                     /locus_tag="AT3G01311"
                     /product="actin cross-linking protein, putative (DUF569)"
                     /db_xref="Araport:AT3G01311"
                     /db_xref="TAIR:AT3G01311"
     CDS             complement(join(102798..102811,103126..103414,
                     103501..103773,104054..104287))
                     /locus_tag="AT3G01311"
                     /codon_start=1
                     /product="actin cross-linking protein, putative (DUF569)"
                     /protein_id="ANM65596.1"
                     /db_xref="Araport:AT3G01311"
                     /db_xref="TAIR:AT3G01311"
                     /translation="MEIFRKATIVRLRSHNDKYLSADEDQESVHQDRRGTTKNTRWTV
                     EIVPGSNVIRLQSCYGKYLTATNIHFLLGATGEKVLQTLPEKLDSSAEWEPLSDDGVH
                     VRFKSRYGQYLRANKGVPPWRNSITHDIPSRTVTQDWVMWTVDVLQIRVIKDDAESTH
                     SSSTFSRIESDDSFIVSLPLKSEGRLIYYETGDDSGNINKEIGEKSLIFHGSELIELK
                     KKLEEETEMEDVMIWCRNPLNEKLCPLQLHLPPNNATMHIIVFPSSCEIDK"
     mRNA            complement(join(103043..103414,103501..103773,
                     104054..104339))
                     /locus_tag="AT3G01311"
                     /product="actin cross-linking protein, putative (DUF569)"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG418859.1,INSD:EG419363.1,INSD:EG418852.1,
                     INSD:EG418719.1,INSD:EG418850.1,INSD:EG418861.1,
                     INSD:EG418870.1,INSD:EG418868.1,INSD:EG418865.1,
                     INSD:EG418736.1,INSD:EG418743.1,INSD:EG418867.1,
                     INSD:EG418687.1,INSD:EG418684.1,INSD:EG418863.1,
                     INSD:EG418871.1,INSD:EG418855.1,INSD:EG418718.1,
                     INSD:EG419365.1,INSD:EG419359.1,INSD:EG418860.1,
                     INSD:EG419361.1,INSD:EG418866.1,INSD:EG418739.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:AY648331.1"
                     /db_xref="TAIR:AT3G01311"
                     /db_xref="Araport:AT3G01311"
     CDS             complement(join(103043..103414,103501..103773,
                     104054..104287))
                     /locus_tag="AT3G01311"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG418859.1,INSD:EG419363.1,INSD:EG418852.1,
                     INSD:EG418719.1,INSD:EG418850.1,INSD:EG418861.1,
                     INSD:EG418870.1,INSD:EG418868.1,INSD:EG418865.1,
                     INSD:EG418736.1,INSD:EG418743.1,INSD:EG418867.1,
                     INSD:EG418687.1,INSD:EG418684.1,INSD:EG418863.1,
                     INSD:EG418871.1,INSD:EG418855.1,INSD:EG418718.1,
                     INSD:EG419365.1,INSD:EG419359.1,INSD:EG418860.1,
                     INSD:EG419361.1,INSD:EG418866.1,INSD:EG418739.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:AY648331.1"
                     /note="CONTAINS InterPro DOMAIN/s: Protein of unknown
                     function DUF569 (InterPro:IPR007679), Actin cross-linking
                     (InterPro:IPR008999); BEST Arabidopsis thaliana protein
                     match is: Protein of unknown function (DUF569)
                     (TAIR:AT3G28630.1); Has 35333 Blast hits to 34131 proteins
                     in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
                     974; Fungi - 991; Plants - 531; Viruses - 0; Other
                     Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="actin cross-linking protein, putative (DUF569)"
                     /protein_id="AEE73637.1"
                     /db_xref="TAIR:AT3G01311"
                     /db_xref="Araport:AT3G01311"
                     /translation="MEIFRKATIVRLRSHNDKYLSADEDQESVHQDRRGTTKNTRWTV
                     EIVPGSNVIRLQSCYGKYLTATNIHFLLGATGEKVLQTLPEKLDSSAEWEPLSDDGVH
                     VRFKSRYGQYLRANKGVPPWRNSITHDIPSRTVTQDWVMWTVDVLQIRVIKDDAESTH
                     SSSTFSRIESDDSFIVSLPLKSEGRLIYYETGDDSGNINKEIGEKSLIFHGSELIELK
                     KKLEEETEMEDVMIWCRNPLNEKLCPLQLHLPPNNATMHIIVFPSSCGTKLTSFFIVT
                     IIYNQNIVYAFLIFFN"
     gene            complement(104687..104769)
                     /locus_tag="AT3G01313"
                     /gene_synonym="60221.SNORNA00001"
                     /db_xref="Araport:AT3G01313"
                     /db_xref="TAIR:AT3G01313"
     ncRNA           complement(104687..104769)
                     /ncRNA_class="snoRNA"
                     /locus_tag="AT3G01313"
                     /gene_synonym="60221.SNORNA00001"
                     /product="snoRNA"
                     /db_xref="Araport:AT3G01313"
                     /db_xref="TAIR:AT3G01313"
     gene            complement(104835..104909)
                     /locus_tag="AT3G01316"
                     /gene_synonym="60221.SNORNA00002"
                     /db_xref="Araport:AT3G01316"
                     /db_xref="TAIR:AT3G01316"
     ncRNA           complement(104835..104909)
                     /ncRNA_class="snoRNA"
                     /locus_tag="AT3G01316"
                     /gene_synonym="60221.SNORNA00002"
                     /product="snoRNA"
                     /db_xref="Araport:AT3G01316"
                     /db_xref="TAIR:AT3G01316"
     gene            complement(104968..105271)
                     /locus_tag="AT3G00980"
                     /db_xref="Araport:AT3G00980"
     ncRNA           complement(join(104968..105048,105169..105271))
                     /ncRNA_class="other"
                     /locus_tag="AT3G00980"
                     /product="other RNA"
                     /db_xref="Araport:AT3G00980"
     gene            complement(104978..105057)
                     /locus_tag="AT3G00985"
                     /note="AtsnoR13-2"
                     /db_xref="Araport:AT3G00985"
     ncRNA           complement(104978..105057)
                     /ncRNA_class="snoRNA"
                     /locus_tag="AT3G00985"
                     /product="other RNA"
                     /db_xref="Araport:AT3G00985"
     gene            105645..106179
                     /locus_tag="AT3G00990"
                     /db_xref="Araport:AT3G00990"
     misc_RNA        105645..106179
                     /locus_tag="AT3G00990"
                     /note="novel transcribed region; detected in receptacle,
                     dark-grown seedling, flower, pollen;
                     AT3G00990.1"
                     /db_xref="Araport:AT3G00990"
     gene            106294..113679
                     /gene="SNL1"
                     /locus_tag="AT3G01320"
                     /gene_synonym="SIN3-like 1"
                     /gene_synonym="T22N4.5"
                     /gene_synonym="T22N4_5"
                     /note="Encodes SIN3-like 1, a homolog of the
                     transcriptional repressor SIN3 (AT1G24190)."
                     /db_xref="Araport:AT3G01320"
                     /db_xref="TAIR:AT3G01320"
     mRNA            join(106294..106806,106960..107151,107239..107422,
                     107513..107611,107681..107848,107938..108214,
                     108404..108540,108620..108698,108781..108816,
                     108914..109107,109182..109336,109410..109537,
                     109659..109913,110059..110751,110832..110920,
                     111150..111728,111794..111894,111986..112124,
                     112218..112370,112473..112639,112835..112928,
                     113075..113679)
                     /gene="SNL1"
                     /locus_tag="AT3G01320"
                     /gene_synonym="SIN3-like 1"
                     /gene_synonym="T22N4.5"
                     /gene_synonym="T22N4_5"
                     /product="SIN3-like 1"
                     /db_xref="TAIR:AT3G01320"
                     /db_xref="Araport:AT3G01320"
     gene            complement(106296..106436)
                     /locus_tag="AT3G01319"
                     /db_xref="Araport:AT3G01319"
                     /db_xref="TAIR:AT3G01319"
     mRNA            complement(106296..106436)
                     /locus_tag="AT3G01319"
                     /product="hypothetical protein"
                     /db_xref="TAIR:AT3G01319"
                     /db_xref="Araport:AT3G01319"
     CDS             complement(106296..106436)
                     /locus_tag="AT3G01319"
                     /note="unknown protein; Has 30201 Blast hits to 17322
                     proteins in 780 species: Archae - 12; Bacteria - 1396;
                     Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
                     Other Eukaryotes - 2996 (source: NCBI BLink)."
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEE73638.1"
                     /db_xref="TAIR:AT3G01319"
                     /db_xref="Araport:AT3G01319"
                     /translation="MKKTENFRGVCNKDAENFRIRKEKKAERDFAFWGLFDVSLSLCV
                     CC"
     mRNA            join(106298..106806,106960..107151,107239..107422,
                     107513..107611,107681..107848,107938..108178,
                     108404..108540,108620..108698,108781..108816,
                     108914..109107,109182..109336,109410..109537,
                     109659..109913,110059..110751,110832..110920,
                     111150..111728,111794..111894,111986..112124,
                     112218..112370,112473..112639,112835..112928,
                     113075..113554)
                     /gene="SNL1"
                     /locus_tag="AT3G01320"
                     /gene_synonym="SIN3-like 1"
                     /gene_synonym="T22N4.5"
                     /gene_synonym="T22N4_5"
                     /product="SIN3-like 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL982840.1,INSD:ES004793.1,INSD:ES173783.1,
                     INSD:EL106600.1,INSD:EL980435.1,INSD:ES149053.1,
                     INSD:AV547444.1,INSD:EH953494.1,INSD:AV547171.1,
                     INSD:ES216222.1,INSD:EL102255.1,INSD:EL276631.1,
                     INSD:BP808922.1,INSD:EH968723.1"
                     /db_xref="TAIR:AT3G01320"
                     /db_xref="Araport:AT3G01320"
     CDS             join(106730..106806,106960..107151,107239..107422,
                     107513..107611,107681..107848,107938..108214,
                     108404..108540,108620..108698,108781..108816,
                     108914..109107,109182..109336,109410..109537,
                     109659..109913,110059..110751,110832..110920,
                     111150..111728,111794..111894,111986..112124,
                     112218..112370,112473..112639,112835..112928,
                     113075..113197)
                     /gene="SNL1"
                     /locus_tag="AT3G01320"
                     /gene_synonym="SIN3-like 1"
                     /gene_synonym="T22N4.5"
                     /gene_synonym="T22N4_5"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL982840.1,INSD:ES004793.1,INSD:ES173783.1,
                     INSD:EL106600.1,INSD:EL980435.1,INSD:ES149053.1,
                     INSD:AV547444.1,INSD:EH953494.1,INSD:AV547171.1,
                     INSD:ES216222.1,INSD:EL102255.1,INSD:EL276631.1,
                     INSD:BP808922.1,INSD:EH968723.1"
                     /note="SIN3-like 1 (SNL1); FUNCTIONS IN:
                     molecular_function unknown; INVOLVED IN: regulation of
                     transcription, DNA-dependent; LOCATED IN: nucleus;
                     EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 14
                     growth stages; CONTAINS InterPro DOMAIN/s: Histone
                     deacetylase interacting (InterPro:IPR013194), Paired
                     amphipathic helix (InterPro:IPR003822); BEST Arabidopsis
                     thaliana protein match is: SIN3-like 2 (TAIR:AT5G15020.2);
                     Has 8924 Blast hits to 4656 proteins in 481 species:
                     Archae - 44; Bacteria - 2736; Metazoa - 2712; Fungi -
                     1300; Plants - 581; Viruses - 181; Other Eukaryotes - 1370
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="SIN3-like 1"
                     /protein_id="AEE73639.1"
                     /db_xref="TAIR:AT3G01320"
                     /db_xref="Araport:AT3G01320"
                     /translation="MKRIRDDVYASGSQFRRPLGSSRGQLCGQSPVHGSGDTEEEEEG
                     GSRRVSQKLTTNDALSYLREVKEMFQDQREKYDRFLEVMKDFKAQRTDTGGVIARVKE
                     LFKGHNNLIYGFNTFLPKGYEITLIEEDDALPKKTVEFEQAINFVNKIKMRFKHDEHV
                     YKSFLEILNMYRKENKEIKEVYNEVSILFQGHLDLLEQFTRFLPASLPSHSAAQHSRS
                     QAQQYSDRGSDPPLLHQMQVEKERRRERAVALRGDYSVERYDLNDDKTMVKIQREQRK
                     RLDKENRARRGRDLDDREAGQDNLHHFPEKRKSSRRAEALEAYSGSASHSEKDNLKSM
                     YKQAFVFCEKVKDRLCSQDDYQTFLKCLNIFSNGIIQRKDLQNLVSDLLGKFPDLMDE
                     FNQFFERCESITDGFQRLAGVMSKKLFSSEEQLSRPMKVEEKESEHKPELEAVKETEQ
                     CKKEYMGKSIQELDLSDCECCTPSYRLLPADYPIPIASQRSELGAEVLNDHWVSVTSG
                     SEDYSFKHMRRNQYEESLFRCEDDRFELDMLLESVSSAARSAESLLNIITEKKISFSG
                     SFRIEDHFTALNLRCIERLYGDHGLDVIDILNKNPATALPVILTRLKQKQGEWKKCRD
                     DFDKVWANVYAKNHYKSLDHRSFYFKQQDSKNLSAKSLLAEIKELKEKSQNDDDVLLS
                     ISAGYRQPINPNLEYEYLNRAIHEDMFKVVQFSCEELCSTKEQLSKVLRLWENFLEAV
                     LGVPPRAKGTDLVEDVVINPKTLDVNHSTSPNGEAAVSSGGDTARLASRKLKSAANGD
                     ENSSSGTFKHGIGLLNKDSTGKENLEDVEIANRDGVACSAVKPQKEQETGNEAEKRFG
                     KPIPMDISERAAISSISIPSGAENNHCVVGKEVLPGAHEIQAKPSDTLTDIHHDVDSI
                     ETVHSTQGGDVGNSIVLANGLRSDSSKGTRNSDDPEGPSRNEKEEGELSPNGDFEDNF
                     GVYKDHGVKSTSKPENSAEAEVEADAEVENEDDADDVDSENASEASGTESGGDVCSQD
                     EDREEENGEHDEIDGKAESEGEAEGMDPHLLEGESELLPQSERVLLSVRPLSKHVAAV
                     LCDERTKDLQVFYGNDDFYVLFRLHQILYERILYAKRNCSGGELKSKNLKDTNAGDPY
                     ARFMRVLYGLLDGSAENTKFEDECRAIIGNQSYVLFTLDKLIYRLVKQLQAIVADEMD
                     NKLLQLYEYEKSRKPGRVIDSVYYENVRVLVHEENIYRLECSSLPSRLSIQLMDNIIE
                     KPEAYAVSMDPTFASYMQTELLSVSSGKKEEGHDIVLQRNLTGLYDLCKAMEGVEVVN
                     GLECKMSCSSYKIAYVLDTEDYFHRKKKKKKTEQLWQRNKVRVERFHRFLSA"
     CDS             join(106730..106806,106960..107151,107239..107422,
                     107513..107611,107681..107848,107938..108178,
                     108404..108540,108620..108698,108781..108816,
                     108914..109107,109182..109336,109410..109537,
                     109659..109913,110059..110751,110832..110920,
                     111150..111728,111794..111894,111986..112124,
                     112218..112370,112473..112639,112835..112928,
                     113075..113197)
                     /gene="SNL1"
                     /locus_tag="AT3G01320"
                     /gene_synonym="SIN3-like 1"
                     /gene_synonym="T22N4.5"
                     /gene_synonym="T22N4_5"
                     /note="SIN3-like 1 (SNL1); FUNCTIONS IN:
                     molecular_function unknown; INVOLVED IN: regulation of
                     transcription, DNA-dependent; LOCATED IN: nucleus;
                     EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 14
                     growth stages; CONTAINS InterPro DOMAIN/s: Histone
                     deacetylase interacting (InterPro:IPR013194), Paired
                     amphipathic helix (InterPro:IPR003822); BEST Arabidopsis
                     thaliana protein match is: SIN3-like 2
                     (TAIR:AT5G15020.2)."
                     /codon_start=1
                     /product="SIN3-like 1"
                     /protein_id="AEE73640.1"
                     /db_xref="TAIR:AT3G01320"
                     /db_xref="Araport:AT3G01320"
                     /translation="MKRIRDDVYASGSQFRRPLGSSRGQLCGQSPVHGSGDTEEEEEG
                     GSRRVSQKLTTNDALSYLREVKEMFQDQREKYDRFLEVMKDFKAQRTDTGGVIARVKE
                     LFKGHNNLIYGFNTFLPKGYEITLIEEDDALPKKTVEFEQAINFVNKIKMRFKHDEHV
                     YKSFLEILNMYRKENKEIKEVYNEVSILFQGHLDLLEQFTRFLPASLPSHSAAQHSRS
                     QAQQYSDRGSDPPLLHQMQVEKERRRERAVALRGDYSVERYDLNDDKTMVKIQREQRK
                     RLDKENRARRGRDLDDREAGQDNLHHFPEKRKSSRRAEALEAYSGMYKQAFVFCEKVK
                     DRLCSQDDYQTFLKCLNIFSNGIIQRKDLQNLVSDLLGKFPDLMDEFNQFFERCESIT
                     DGFQRLAGVMSKKLFSSEEQLSRPMKVEEKESEHKPELEAVKETEQCKKEYMGKSIQE
                     LDLSDCECCTPSYRLLPADYPIPIASQRSELGAEVLNDHWVSVTSGSEDYSFKHMRRN
                     QYEESLFRCEDDRFELDMLLESVSSAARSAESLLNIITEKKISFSGSFRIEDHFTALN
                     LRCIERLYGDHGLDVIDILNKNPATALPVILTRLKQKQGEWKKCRDDFDKVWANVYAK
                     NHYKSLDHRSFYFKQQDSKNLSAKSLLAEIKELKEKSQNDDDVLLSISAGYRQPINPN
                     LEYEYLNRAIHEDMFKVVQFSCEELCSTKEQLSKVLRLWENFLEAVLGVPPRAKGTDL
                     VEDVVINPKTLDVNHSTSPNGEAAVSSGGDTARLASRKLKSAANGDENSSSGTFKHGI
                     GLLNKDSTGKENLEDVEIANRDGVACSAVKPQKEQETGNEAEKRFGKPIPMDISERAA
                     ISSISIPSGAENNHCVVGKEVLPGAHEIQAKPSDTLTDIHHDVDSIETVHSTQGGDVG
                     NSIVLANGLRSDSSKGTRNSDDPEGPSRNEKEEGELSPNGDFEDNFGVYKDHGVKSTS
                     KPENSAEAEVEADAEVENEDDADDVDSENASEASGTESGGDVCSQDEDREEENGEHDE
                     IDGKAESEGEAEGMDPHLLEGESELLPQSERVLLSVRPLSKHVAAVLCDERTKDLQVF
                     YGNDDFYVLFRLHQILYERILYAKRNCSGGELKSKNLKDTNAGDPYARFMRVLYGLLD
                     GSAENTKFEDECRAIIGNQSYVLFTLDKLIYRLVKQLQAIVADEMDNKLLQLYEYEKS
                     RKPGRVIDSVYYENVRVLVHEENIYRLECSSLPSRLSIQLMDNIIEKPEAYAVSMDPT
                     FASYMQTELLSVSSGKKEEGHDIVLQRNLTGLYDLCKAMEGVEVVNGLECKMSCSSYK
                     IAYVLDTEDYFHRKKKKKKTEQLWQRNKVRVERFHRFLSA"
     gene            114260..114604
                     /locus_tag="AT3G01322"
                     /note="Encodes a ECA1 gametogenesis related family
                     protein"
                     /db_xref="Araport:AT3G01322"
                     /db_xref="TAIR:AT3G01322"
     mRNA            114260..114604
                     /locus_tag="AT3G01322"
                     /product="ECA1-like gametogenesis related family protein"
                     /db_xref="TAIR:AT3G01322"
                     /db_xref="Araport:AT3G01322"
     CDS             114290..114604
                     /locus_tag="AT3G01322"
                     /note="ECA1-like gametogenesis related family protein;
                     LOCATED IN: endomembrane system; BEST Arabidopsis thaliana
                     protein match is: ECA1-like gametogenesis related family
                     protein (TAIR:AT3G01328.1); Has 27 Blast hits to 26
                     proteins in 2 species: Archae - 0; Bacteria - 0; Metazoa -
                     0; Fungi - 0; Plants - 27; Viruses - 0; Other Eukaryotes -
                     0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ECA1-like gametogenesis related family protein"
                     /protein_id="AEE73641.1"
                     /db_xref="TAIR:AT3G01322"
                     /db_xref="Araport:AT3G01322"
                     /translation="MKSKQIKMMFFLLIVVSALILRPSKAQIKTSICSRTQTRPIDNV
                     DGCFDAVRLAADVDIKWLSRDCCKAVKTLDDCLLLVFPNRAYNTNLFKEICFEIFNNL
                     IL"
     gene            115250..115756
                     /locus_tag="AT3G01326"
                     /note="Encodes a ECA1 gametogenesis related family
                     protein"
                     /db_xref="Araport:AT3G01326"
                     /db_xref="TAIR:AT3G01326"
     mRNA            115250..115756
                     /locus_tag="AT3G01326"
                     /product="ECA1 gametogenesis related family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES012411.1,INSD:DR379134.1,INSD:ES060604.1,
                     INSD:DR353038.1,INSD:DR353037.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:DQ108683.1"
                     /db_xref="TAIR:AT3G01326"
                     /db_xref="Araport:AT3G01326"
     CDS             115359..115664
                     /locus_tag="AT3G01326"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES012411.1,INSD:DR379134.1,INSD:ES060604.1,
                     INSD:DR353038.1,INSD:DR353037.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:DQ108683.1"
                     /note="ECA1 gametogenesis related family protein; LOCATED
                     IN: endomembrane system; BEST Arabidopsis thaliana protein
                     match is: ECA1-like gametogenesis related family protein
                     (TAIR:AT3G01327.1); Has 25 Blast hits to 25 proteins in 2
                     species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
                     Plants - 25; Viruses - 0; Other Eukaryotes - 0 (source:
                     NCBI BLink)."
                     /codon_start=1
                     /product="ECA1 gametogenesis related family protein"
                     /protein_id="AEE73642.1"
                     /db_xref="TAIR:AT3G01326"
                     /db_xref="Araport:AT3G01326"
                     /translation="MKTKQIKMMFFVLIVVSALIFRPSEAQMKIQSWICSSEQIAPIV
                     NVSGCFDALKLALGSEKFVRLLSKDCCNAVNILPHCLLIVSPGVEYNTIVLRDLCSQ"
     gene            complement(116226..116568)
                     /locus_tag="AT3G01327"
                     /note="Encodes a ECA1 gametogenesis related family
                     protein"
                     /db_xref="Araport:AT3G01327"
                     /db_xref="TAIR:AT3G01327"
     mRNA            complement(116226..116568)
                     /locus_tag="AT3G01327"
                     /product="ECA1-like gametogenesis related family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES002895.1,INSD:ES104788.1"
                     /db_xref="TAIR:AT3G01327"
                     /db_xref="Araport:AT3G01327"
     CDS             complement(116231..116548)
                     /locus_tag="AT3G01327"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES002895.1,INSD:ES104788.1"
                     /note="ECA1-like gametogenesis related family protein;
                     LOCATED IN: endomembrane system; BEST Arabidopsis thaliana
                     protein match is: ECA1-like gametogenesis related family
                     protein (TAIR:AT3G01322.1); Has 34 Blast hits to 34
                     proteins in 2 species: Archae - 0; Bacteria - 0; Metazoa -
                     0; Fungi - 0; Plants - 34; Viruses - 0; Other Eukaryotes -
                     0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ECA1-like gametogenesis related family protein"
                     /protein_id="AEE73643.1"
                     /db_xref="TAIR:AT3G01327"
                     /db_xref="Araport:AT3G01327"
                     /translation="MKTKQLKMMFFLLILVSALINRPSEAQLKLSVCSSTQTRPIENV
                     AGCLDSLRLAVHQDFRLLSRDCCKAVKTLPDCLFVLYPNIVYNTYIFKNFCFLKFNET
                     KIM"
     gene            complement(117218..117630)
                     /locus_tag="AT3G01328"
                     /note="Encodes a ECA1 gametogenesis related family
                     protein"
                     /db_xref="Araport:AT3G01328"
                     /db_xref="TAIR:AT3G01328"
     mRNA            complement(117218..117630)
                     /locus_tag="AT3G01328"
                     /product="ECA1-like gametogenesis related family protein"
                     /inference="Similar to RNA sequence, EST:INSD:ES194936.1"
                     /db_xref="TAIR:AT3G01328"
                     /db_xref="Araport:AT3G01328"
     CDS             complement(117254..117568)
                     /locus_tag="AT3G01328"
                     /inference="Similar to RNA sequence, EST:INSD:ES194936.1"
                     /note="ECA1-like gametogenesis related family protein;
                     LOCATED IN: endomembrane system; BEST Arabidopsis thaliana
                     protein match is: ECA1-like gametogenesis related family
                     protein (TAIR:AT3G01322.1); Has 26 Blast hits to 26
                     proteins in 2 species: Archae - 0; Bacteria - 0; Metazoa -
                     0; Fungi - 0; Plants - 26; Viruses - 0; Other Eukaryotes -
                     0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ECA1-like gametogenesis related family protein"
                     /protein_id="AEE73644.1"
                     /db_xref="TAIR:AT3G01328"
                     /db_xref="Araport:AT3G01328"
                     /translation="MKPKQIKMMFFLLIVVAAMIFRPSEAQLKTSICTSKQTTPITQV
                     AGCFNAVRLAADKDSKLLTRVCCRAVKTLDDCLLLVYPDRAYNTYIFKGICFEKFNES
                     LL"
     gene            complement(118849..119178)
                     /locus_tag="AT3G01329"
                     /note="Encodes a ECA1 gametogenesis related family
                     protein"
                     /db_xref="Araport:AT3G01329"
                     /db_xref="TAIR:AT3G01329"
     mRNA            complement(118849..119178)
                     /locus_tag="AT3G01329"
                     /product="ECA1-like gametogenesis related family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG468268.1,INSD:EG468266.1,INSD:EG468283.1,
                     INSD:EG502994.1,INSD:EG502993.1,INSD:EG468267.1"
                     /db_xref="TAIR:AT3G01329"
                     /db_xref="Araport:AT3G01329"
     CDS             complement(118873..119178)
                     /locus_tag="AT3G01329"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG468268.1,INSD:EG468266.1,INSD:EG468283.1,
                     INSD:EG502994.1,INSD:EG502993.1,INSD:EG468267.1"
                     /note="ECA1-like gametogenesis related family protein;
                     LOCATED IN: endomembrane system; BEST Arabidopsis thaliana
                     protein match is: ECA1-like gametogenesis related family
                     protein (TAIR:AT3G01324.1); Has 28 Blast hits to 28
                     proteins in 2 species: Archae - 0; Bacteria - 0; Metazoa -
                     0; Fungi - 0; Plants - 28; Viruses - 0; Other Eukaryotes -
                     0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ECA1-like gametogenesis related family protein"
                     /protein_id="AEE73645.1"
                     /db_xref="TAIR:AT3G01329"
                     /db_xref="Araport:AT3G01329"
                     /translation="MKLQQTKVMFFLLALISTLMFQPSEAHNTNLCPTTAIDNVPGCF
                     DAVRKAAAGDFRWFTEVCCKAVRTLPDTCLLLVNPGQAYPTNIFRSICIGKFPPLRH"
     gene            complement(119546..120010)
                     /locus_tag="AT3G01331"
                     /note="Encodes a ECA1 gametogenesis related family
                     protein"
                     /db_xref="Araport:AT3G01331"
                     /db_xref="TAIR:AT3G01331"
     mRNA            complement(119546..120010)
                     /locus_tag="AT3G01331"
                     /product="ECA1 gametogenesis related family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES006477.1,INSD:ES001676.1,INSD:ES001346.1,
                     INSD:ES003752.1,INSD:ES159154.1,INSD:ES018819.1,
                     INSD:ES025644.1"
                     /db_xref="TAIR:AT3G01331"
                     /db_xref="Araport:AT3G01331"
     CDS             complement(119618..119917)
                     /locus_tag="AT3G01331"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES006477.1,INSD:ES001676.1,INSD:ES001346.1,
                     INSD:ES003752.1,INSD:ES159154.1,INSD:ES018819.1,
                     INSD:ES025644.1"
                     /note="ECA1 gametogenesis related family protein; LOCATED
                     IN: endomembrane system; BEST Arabidopsis thaliana protein
                     match is: Expressed protein (TAIR:AT3G01325.1); Has 22
                     Blast hits to 22 proteins in 2 species: Archae - 0;
                     Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 22; Viruses
                     - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ECA1 gametogenesis related family protein"
                     /protein_id="AEE73646.1"
                     /db_xref="TAIR:AT3G01331"
                     /db_xref="Araport:AT3G01331"
                     /translation="MKQEVIFFLLAITLASILRPSEAAPPEVYCLTYRISRVPGCYDA
                     LRLAAGRDYRWLSVDCCRAVYATLPDTCFLTLKPDLALPINVFRVICSNTVPAAA"
     gene            complement(121057..121503)
                     /locus_tag="AT3G01323"
                     /db_xref="Araport:AT3G01323"
                     /db_xref="TAIR:AT3G01323"
     mRNA            complement(121057..121503)
                     /locus_tag="AT3G01323"
                     /product="ECA1-like gametogenesis related family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES164924.1,INSD:ES205334.1,INSD:ES177042.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:BX825215.1"
                     /db_xref="TAIR:AT3G01323"
                     /db_xref="Araport:AT3G01323"
     CDS             complement(121120..121440)
                     /locus_tag="AT3G01323"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES164924.1,INSD:ES205334.1,INSD:ES177042.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:BX825215.1"
                     /note="ECA1-like gametogenesis related family protein;
                     BEST Arabidopsis thaliana protein match is: ECA1-like
                     gametogenesis related family protein (TAIR:AT3G01322.1);
                     Has 35333 Blast hits to 34131 proteins in 2444 species:
                     Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi -
                     991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="ECA1-like gametogenesis related family protein"
                     /protein_id="AEE73647.2"
                     /db_xref="TAIR:AT3G01323"
                     /db_xref="Araport:AT3G01323"
                     /translation="MKLKQTKVMLFLLTLVFTLIFRPSEARLDPSLDPNHLCSDDETT
                     PVANLPGCFYAVRLAADQDIRWLSRDCCEAVKTLPDCLLLVFPYKALNTIILKRICVT
                     KFPG"
     gene            complement(122118..122480)
                     /locus_tag="AT3G01324"
                     /note="Encodes a ECA1 gametogenesis related family
                     protein"
                     /db_xref="Araport:AT3G01324"
                     /db_xref="TAIR:AT3G01324"
     mRNA            complement(122118..122480)
                     /locus_tag="AT3G01324"
                     /product="ECA1-like gametogenesis related family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG502986.1,INSD:EG502990.1,INSD:EG468246.1,
                     INSD:EG468232.1,INSD:EG468227.1,INSD:EG502988.1,
                     INSD:EG502989.1,INSD:EG468239.1"
                     /db_xref="TAIR:AT3G01324"
                     /db_xref="Araport:AT3G01324"
     CDS             complement(122140..122448)
                     /locus_tag="AT3G01324"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG502986.1,INSD:EG502990.1,INSD:EG468246.1,
                     INSD:EG468232.1,INSD:EG468227.1,INSD:EG502988.1,
                     INSD:EG502989.1,INSD:EG468239.1"
                     /note="ECA1-like gametogenesis related family protein;
                     LOCATED IN: endomembrane system; BEST Arabidopsis thaliana
                     protein match is: ECA1-like gametogenesis related family
                     protein (TAIR:AT3G01329.1); Has 28 Blast hits to 28
                     proteins in 2 species: Archae - 0; Bacteria - 0; Metazoa -
                     0; Fungi - 0; Plants - 28; Viruses - 0; Other Eukaryotes -
                     0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ECA1-like gametogenesis related family protein"
                     /protein_id="AEE73648.1"
                     /db_xref="TAIR:AT3G01324"
                     /db_xref="Araport:AT3G01324"
                     /translation="MKMQQTKVMFFLLALISTLMFQPSEARNTNLCETTAIEKEPGCF
                     DALRLAAGDADFRWLNRDCCRAVRTLNDTCLLLIYPGRAYPIRIFKSICIGKFPPLRH
                     "
     gene            complement(123369..123741)
                     /locus_tag="AT3G01325"
                     /db_xref="Araport:AT3G01325"
                     /db_xref="TAIR:AT3G01325"
     mRNA            complement(123369..123741)
                     /locus_tag="AT3G01325"
                     /product="Expressed protein"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT024659.1,INSD:BX826126.1"
                     /db_xref="TAIR:AT3G01325"
                     /db_xref="Araport:AT3G01325"
     CDS             complement(123412..123720)
                     /locus_tag="AT3G01325"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT024659.1,INSD:BX826126.1"
                     /note="Expressed protein; FUNCTIONS IN: molecular_function
                     unknown; INVOLVED IN: biological_process unknown; LOCATED
                     IN: endomembrane system; BEST Arabidopsis thaliana protein
                     match is: ECA1 gametogenesis related family protein
                     (TAIR:AT3G01331.1); Has 35333 Blast hits to 34131 proteins
                     in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
                     974; Fungi - 991; Plants - 531; Viruses - 0; Other
                     Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Expressed protein"
                     /protein_id="AEE73649.1"
                     /db_xref="TAIR:AT3G01325"
                     /db_xref="Araport:AT3G01325"
                     /translation="MELKQTKVMFFLVALILALNFRPSEAAPPVRYCSTLFIERAPRC
                     YEALRRAVHRDVSLLTGKCCRAVFATLPVTCFLKLTSELELPMTNFRNICDAVKPPTS
                     "
     gene            complement(124319..126876)
                     /gene="DEL3"
                     /locus_tag="AT3G01330"
                     /gene_synonym="DP-E2F-like protein 3"
                     /gene_synonym="DP-E2F-LIKE PROTEIN 3"
                     /gene_synonym="E2F-LIKE 2"
                     /gene_synonym="E2FF"
                     /gene_synonym="E2L2"
                     /gene_synonym="T22N4.4"
                     /gene_synonym="T22N4_4"
                     /note="Member of the E2F transcription factors, (cell
                     cycle genes), key components of the cyclin
                     D/retinoblastoma/E2F pathway."
                     /db_xref="Araport:AT3G01330"
                     /db_xref="TAIR:AT3G01330"
     mRNA            complement(join(124319..124669,124770..125130,
                     125234..125295,125392..125464,125559..125626,
                     125840..125918,126044..126097,126187..126264,
                     126335..126387,126564..126631,126711..126876))
                     /gene="DEL3"
                     /locus_tag="AT3G01330"
                     /gene_synonym="DP-E2F-like protein 3"
                     /gene_synonym="DP-E2F-LIKE PROTEIN 3"
                     /gene_synonym="E2F-LIKE 2"
                     /gene_synonym="E2FF"
                     /gene_synonym="E2L2"
                     /gene_synonym="T22N4.4"
                     /gene_synonym="T22N4_4"
                     /product="DP-E2F-like protein 3"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH980493.1,INSD:DR373442.1,INSD:AV832300.1,
                     INSD:DR340468.1,INSD:DR340467.1,INSD:DR340469.1,
                     INSD:AV820471.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT000412.1,INSD:AY093024.1,INSD:AB074532.1,
                     INSD:BX826279.1"
                     /db_xref="TAIR:AT3G01330"
                     /db_xref="Araport:AT3G01330"
     CDS             complement(join(124596..124669,124770..125130,
                     125234..125295,125392..125464,125559..125626,
                     125840..125918,126044..126097,126187..126264,
                     126335..126387,126564..126631,126711..126805))
                     /gene="DEL3"
                     /locus_tag="AT3G01330"
                     /gene_synonym="DP-E2F-like protein 3"
                     /gene_synonym="DP-E2F-LIKE PROTEIN 3"
                     /gene_synonym="E2F-LIKE 2"
                     /gene_synonym="E2FF"
                     /gene_synonym="E2L2"
                     /gene_synonym="T22N4.4"
                     /gene_synonym="T22N4_4"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH980493.1,INSD:DR373442.1,INSD:AV832300.1,
                     INSD:DR340468.1,INSD:DR340467.1,INSD:DR340469.1,
                     INSD:AV820471.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT000412.1,INSD:AY093024.1,INSD:AB074532.1,
                     INSD:BX826279.1"
                     /note="DP-E2F-like protein 3 (DEL3); FUNCTIONS IN: DNA
                     binding, sequence-specific DNA binding transcription
                     factor activity; INVOLVED IN: regulation of transcription,
                     DNA-dependent; LOCATED IN: nucleus, cytoplasm; EXPRESSED
                     IN: 15 plant structures; EXPRESSED DURING: 9 growth
                     stages; CONTAINS InterPro DOMAIN/s: Winged
                     helix-turn-helix transcription repressor DNA-binding
                     (InterPro:IPR011991), Transcription factor
                     E2F/dimerisation partner (TDP) (InterPro:IPR003316), E2F
                     Family (InterPro:IPR015633); BEST Arabidopsis thaliana
                     protein match is: DP-E2F-like 2 (TAIR:AT5G14960.1); Has
                     1046 Blast hits to 870 proteins in 117 species: Archae -
                     0; Bacteria - 4; Metazoa - 638; Fungi - 7; Plants - 262;
                     Viruses - 0; Other Eukaryotes - 135 (source: NCBI BLink)."
                     /codon_start=1
                     /product="DP-E2F-like protein 3"
                     /protein_id="AEE73650.1"
                     /db_xref="TAIR:AT3G01330"
                     /db_xref="Araport:AT3G01330"
                     /translation="MSSAIVVSQDAESLGLQIYSRKEKSLGVLVSNFLRLYNRDDVDL
                     IGLDDAAGQLGVERRRIYDVVNILESIGIVARRGKNQYSWKGFGEIPRSLDELKEEGM
                     RERLGYSSSNNSDKVSNGCEREEPLTLTPDDQENSSSSKMDQKKEKSLWLLAQNFVKM
                     FLCSDDDLITLDSAAKALLSDSPDSVHMRTKVRRLYDIANVFASMNLIEKTHIPVTRK
                     PAYRWLGSKSIAERGLSLFNSGEPKRVFGTEITNLRAKRNKTYCSSIRKQIGYKKHDE
                     ENTEQESKPAASKYVFGPFSPIGASKTNNDKVGKGRLLEIEALASTYQPQYCNQEITG
                     LLGHFTEAWKKWYAEVDRNK"
     gene            complement(127303..128994)
                     /locus_tag="AT3G01340"
                     /gene_synonym="T22N4.3"
                     /gene_synonym="T22N4_3"
                     /db_xref="Araport:AT3G01340"
                     /db_xref="TAIR:AT3G01340"
     mRNA            complement(join(127348..128483,128880..128966))
                     /locus_tag="AT3G01340"
                     /gene_synonym="T22N4.3"
                     /gene_synonym="T22N4_3"
                     /product="Transducin/WD40 repeat-like superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR249473.1,INSD:BP781070.1,INSD:EL150093.1,
                     INSD:AV543072.1,INSD:EL281493.1,INSD:ES213552.1,
                     INSD:BP639708.1,INSD:EL103355.1,INSD:DR249479.1,
                     INSD:EL244162.1,INSD:BP795811.1,INSD:EH852077.1,
                     INSD:EL293900.1,INSD:EG521461.1,INSD:BP596789.1,
                     INSD:BP798049.1,INSD:DR249475.1,INSD:EH954510.1,
                     INSD:BP599221.1,INSD:ES201691.1,INSD:DR249472.1,
                     INSD:ES082492.1,INSD:BP618913.1,INSD:EG522453.1,
                     INSD:EH981529.1,INSD:EH838012.1,INSD:EH944577.1,
                     INSD:BP787342.1,INSD:ES067221.1,INSD:BP655939.1,
                     INSD:BP640291.1,INSD:EL129720.1,INSD:AI996853.1,
                     INSD:BP642812.1,INSD:BP857426.1,INSD:ES090888.1,
                     INSD:EH820845.1,INSD:EL180621.1,INSD:DR249474.1,
                     INSD:DR249480.1,INSD:BP799679.1,INSD:EL232864.1,
                     INSD:DR249471.1,INSD:EH799253.1,INSD:DR249470.1,
                     INSD:BP579317.1,INSD:DR375960.1,INSD:DR249476.1,
                     INSD:BP655846.1,INSD:BP566614.1,INSD:BP576724.1,
                     INSD:EL254171.1,INSD:BP658305.1,INSD:BP601057.1,
                     INSD:ES082937.1,INSD:DR249481.1,INSD:EH914347.1,
                     INSD:EL201550.1,INSD:BP576317.1,INSD:DR249469.1,
                     INSD:BP852360.1,INSD:BP664523.1,INSD:EL182722.1,
                     INSD:EL082731.1,INSD:EG521462.1,INSD:BP616919.1,
                     INSD:ES179539.1,INSD:BP574457.1,INSD:DR249477.1,
                     INSD:EG522452.1,INSD:BP811762.1,INSD:EL305679.1,
                     INSD:AV781874.1,INSD:DR373727.1,INSD:EL017727.1,
                     INSD:DR249483.1,INSD:BP784556.1,INSD:EH959814.1,
                     INSD:DR249478.1,INSD:BP603002.1,INSD:DR249482.1,
                     INSD:ES134479.1,INSD:EL034096.1,INSD:BP861456.1,
                     INSD:AV531521.1,INSD:BP605237.1,INSD:EH870975.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY063079.1,INSD:AY087647.1,INSD:AF370262.1"
                     /db_xref="TAIR:AT3G01340"
                     /db_xref="Araport:AT3G01340"
     mRNA            complement(join(127355..128483,128892..128994))
                     /locus_tag="AT3G01340"
                     /gene_synonym="T22N4.3"
                     /gene_synonym="T22N4_3"
                     /product="Transducin/WD40 repeat-like superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP781070.1,INSD:EL150093.1,INSD:AV543072.1,
                     INSD:EL281493.1,INSD:ES213552.1,INSD:EL103355.1,
                     INSD:BP639708.1,INSD:DR335576.1,INSD:EL244162.1,
                     INSD:BP795811.1,INSD:EH852077.1,INSD:EL293900.1,
                     INSD:EG521461.1,INSD:BP596789.1,INSD:EH954510.1,
                     INSD:BP599221.1,INSD:ES201691.1,INSD:ES082492.1,
                     INSD:BP618913.1,INSD:EG522453.1,INSD:EH981529.1,
                     INSD:EH838012.1,INSD:EH944577.1,INSD:BP828267.1,
                     INSD:BP787342.1,INSD:ES067221.1,INSD:BP655939.1,
                     INSD:BP640291.1,INSD:EL129720.1,INSD:AI996853.1,
                     INSD:BP642812.1,INSD:DR335577.1,INSD:ES090888.1,
                     INSD:EH820845.1,INSD:BP823529.1,INSD:EL180621.1,
                     INSD:BP868508.1,INSD:BP579317.1,INSD:DR375960.1,
                     INSD:BP655846.1,INSD:BP566614.1,INSD:BP576724.1,
                     INSD:EL254171.1,INSD:BP658305.1,INSD:BP601057.1,
                     INSD:ES082937.1,INSD:EH914347.1,INSD:EL201550.1,
                     INSD:BP576317.1,INSD:BP664523.1,INSD:EL082731.1,
                     INSD:EG521462.1,INSD:BP616919.1,INSD:ES179539.1,
                     INSD:BP574457.1,INSD:EG522452.1,INSD:BP811762.1,
                     INSD:EL305679.1,INSD:AV781874.1,INSD:DR373727.1,
                     INSD:EL017727.1,INSD:BP784556.1,INSD:EH959814.1,
                     INSD:EL295742.1,INSD:BP603002.1,INSD:ES134479.1,
                     INSD:BP605237.1,INSD:BP835394.1,INSD:EH870975.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:AY063079.1"
                     /db_xref="TAIR:AT3G01340"
                     /db_xref="Araport:AT3G01340"
     CDS             complement(127557..128465)
                     /locus_tag="AT3G01340"
                     /gene_synonym="T22N4.3"
                     /gene_synonym="T22N4_3"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR249473.1,INSD:BP781070.1,INSD:EL150093.1,
                     INSD:AV543072.1,INSD:EL281493.1,INSD:ES213552.1,
                     INSD:BP639708.1,INSD:EL103355.1,INSD:DR249479.1,
                     INSD:EL244162.1,INSD:BP795811.1,INSD:EH852077.1,
                     INSD:EL293900.1,INSD:EG521461.1,INSD:BP596789.1,
                     INSD:BP798049.1,INSD:DR249475.1,INSD:EH954510.1,
                     INSD:BP599221.1,INSD:ES201691.1,INSD:DR249472.1,
                     INSD:ES082492.1,INSD:BP618913.1,INSD:EG522453.1,
                     INSD:EH981529.1,INSD:EH838012.1,INSD:EH944577.1,
                     INSD:BP787342.1,INSD:ES067221.1,INSD:BP655939.1,
                     INSD:BP640291.1,INSD:EL129720.1,INSD:AI996853.1,
                     INSD:BP642812.1,INSD:BP857426.1,INSD:ES090888.1,
                     INSD:EH820845.1,INSD:EL180621.1,INSD:DR249474.1,
                     INSD:DR249480.1,INSD:BP799679.1,INSD:EL232864.1,
                     INSD:DR249471.1,INSD:EH799253.1,INSD:DR249470.1,
                     INSD:BP579317.1,INSD:DR375960.1,INSD:DR249476.1,
                     INSD:BP655846.1,INSD:BP566614.1,INSD:BP576724.1,
                     INSD:EL254171.1,INSD:BP658305.1,INSD:BP601057.1,
                     INSD:ES082937.1,INSD:DR249481.1,INSD:EH914347.1,
                     INSD:EL201550.1,INSD:BP576317.1,INSD:DR249469.1,
                     INSD:BP852360.1,INSD:BP664523.1,INSD:EL182722.1,
                     INSD:EL082731.1,INSD:EG521462.1,INSD:BP616919.1,
                     INSD:ES179539.1,INSD:BP574457.1,INSD:DR249477.1,
                     INSD:EG522452.1,INSD:BP811762.1,INSD:EL305679.1,
                     INSD:AV781874.1,INSD:DR373727.1,INSD:EL017727.1,
                     INSD:DR249483.1,INSD:BP784556.1,INSD:EH959814.1,
                     INSD:DR249478.1,INSD:BP603002.1,INSD:DR249482.1,
                     INSD:ES134479.1,INSD:EL034096.1,INSD:BP861456.1,
                     INSD:AV531521.1,INSD:BP605237.1,INSD:EH870975.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY063079.1,INSD:AY087647.1,INSD:AF370262.1"
                     /note="Transducin/WD40 repeat-like superfamily protein;
                     FUNCTIONS IN: nucleotide binding; INVOLVED IN:
                     intracellular protein transport, membrane budding; LOCATED
                     IN: cellular_component unknown; EXPRESSED IN: 23 plant
                     structures; EXPRESSED DURING: 14 growth stages; CONTAINS
                     InterPro DOMAIN/s: WD40 repeat 2 (InterPro:IPR019782),
                     WD40 repeat-like-containing domain (InterPro:IPR011046),
                     WD40-repeat-containing domain (InterPro:IPR017986),
                     WD40/YVTN repeat-like-containing domain
                     (InterPro:IPR015943), WD40 repeat (InterPro:IPR001680),
                     WD40 repeat, subgroup (InterPro:IPR019781), G-protein beta
                     WD-40 repeat, region (InterPro:IPR020472); BEST
                     Arabidopsis thaliana protein match is: transducin family
                     protein / WD-40 repeat family protein (TAIR:AT2G30050.1);
                     Has 22236 Blast hits to 13979 proteins in 554 species:
                     Archae - 24; Bacteria - 4553; Metazoa - 7942; Fungi -
                     4712; Plants - 2416; Viruses - 0; Other Eukaryotes - 2589
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="Transducin/WD40 repeat-like superfamily protein"
                     /protein_id="AEE73651.1"
                     /db_xref="TAIR:AT3G01340"
                     /db_xref="Araport:AT3G01340"
                     /translation="MPPQKIETGHSDTIHDVVMDYYGKRVATASSDCTIKITGVSNSG
                     GSQHLATLTGHRGPVWQVAWAHPKFGSLLASCSYDGQIILWKEGNQNQWTQAHVFTDH
                     KVSVNSIAWAPHELGLSLACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAP
                     ATEPGALVSSGMIDPVYKLASGGCDSTVKVWKFSNGSWKMDCFPALNKHTDWVRDVAW
                     APNLGLPKSTIASGSEDGKVIIWTIGKEGEQWEGTVLKDFKTPVWRVSWSLTGNLLAV
                     SDGNNNVTVWKESVDGEWEQVTVVEP"
     CDS             complement(127557..128465)
                     /locus_tag="AT3G01340"
                     /gene_synonym="T22N4.3"
                     /gene_synonym="T22N4_3"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP781070.1,INSD:EL150093.1,INSD:AV543072.1,
                     INSD:EL281493.1,INSD:ES213552.1,INSD:EL103355.1,
                     INSD:BP639708.1,INSD:DR335576.1,INSD:EL244162.1,
                     INSD:BP795811.1,INSD:EH852077.1,INSD:EL293900.1,
                     INSD:EG521461.1,INSD:BP596789.1,INSD:EH954510.1,
                     INSD:BP599221.1,INSD:ES201691.1,INSD:ES082492.1,
                     INSD:BP618913.1,INSD:EG522453.1,INSD:EH981529.1,
                     INSD:EH838012.1,INSD:EH944577.1,INSD:BP828267.1,
                     INSD:BP787342.1,INSD:ES067221.1,INSD:BP655939.1,
                     INSD:BP640291.1,INSD:EL129720.1,INSD:AI996853.1,
                     INSD:BP642812.1,INSD:DR335577.1,INSD:ES090888.1,
                     INSD:EH820845.1,INSD:BP823529.1,INSD:EL180621.1,
                     INSD:BP868508.1,INSD:BP579317.1,INSD:DR375960.1,
                     INSD:BP655846.1,INSD:BP566614.1,INSD:BP576724.1,
                     INSD:EL254171.1,INSD:BP658305.1,INSD:BP601057.1,
                     INSD:ES082937.1,INSD:EH914347.1,INSD:EL201550.1,
                     INSD:BP576317.1,INSD:BP664523.1,INSD:EL082731.1,
                     INSD:EG521462.1,INSD:BP616919.1,INSD:ES179539.1,
                     INSD:BP574457.1,INSD:EG522452.1,INSD:BP811762.1,
                     INSD:EL305679.1,INSD:AV781874.1,INSD:DR373727.1,
                     INSD:EL017727.1,INSD:BP784556.1,INSD:EH959814.1,
                     INSD:EL295742.1,INSD:BP603002.1,INSD:ES134479.1,
                     INSD:BP605237.1,INSD:BP835394.1,INSD:EH870975.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:AY063079.1"
                     /note="Transducin/WD40 repeat-like superfamily protein;
                     FUNCTIONS IN: nucleotide binding; INVOLVED IN:
                     intracellular protein transport, membrane budding; LOCATED
                     IN: cellular_component unknown; EXPRESSED IN: 23 plant
                     structures; EXPRESSED DURING: 14 growth stages; CONTAINS
                     InterPro DOMAIN/s: WD40 repeat 2 (InterPro:IPR019782),
                     WD40 repeat-like-containing domain (InterPro:IPR011046),
                     WD40-repeat-containing domain (InterPro:IPR017986),
                     WD40/YVTN repeat-like-containing domain
                     (InterPro:IPR015943), WD40 repeat (InterPro:IPR001680),
                     WD40 repeat, subgroup (InterPro:IPR019781), G-protein beta
                     WD-40 repeat, region (InterPro:IPR020472); BEST
                     Arabidopsis thaliana protein match is: transducin family
                     protein / WD-40 repeat family protein (TAIR:AT2G30050.1);
                     Has 35333 Blast hits to 34131 proteins in 2444 species:
                     Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi -
                     991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="Transducin/WD40 repeat-like superfamily protein"
                     /protein_id="AEE73652.1"
                     /db_xref="TAIR:AT3G01340"
                     /db_xref="Araport:AT3G01340"
                     /translation="MPPQKIETGHSDTIHDVVMDYYGKRVATASSDCTIKITGVSNSG
                     GSQHLATLTGHRGPVWQVAWAHPKFGSLLASCSYDGQIILWKEGNQNQWTQAHVFTDH
                     KVSVNSIAWAPHELGLSLACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAP
                     ATEPGALVSSGMIDPVYKLASGGCDSTVKVWKFSNGSWKMDCFPALNKHTDWVRDVAW
                     APNLGLPKSTIASGSEDGKVIIWTIGKEGEQWEGTVLKDFKTPVWRVSWSLTGNLLAV
                     SDGNNNVTVWKESVDGEWEQVTVVEP"
     gene            129138..130749
                     /locus_tag="AT3G01345"
                     /db_xref="Araport:AT3G01345"
                     /db_xref="TAIR:AT3G01345"
     mRNA            129138..130749
                     /locus_tag="AT3G01345"
                     /product="Expressed protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV798388.1,INSD:AV827485.1,INSD:AI999235.1,
                     INSD:BP809206.1,INSD:AV533003.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK226905.1,INSD:BX824259.1,INSD:BX823980.1,
                     INSD:BX824941.1"
                     /db_xref="TAIR:AT3G01345"
                     /db_xref="Araport:AT3G01345"
     CDS             129319..130719
                     /locus_tag="AT3G01345"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV798388.1,INSD:AV827485.1,INSD:AI999235.1,
                     INSD:BP809206.1,INSD:AV533003.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK226905.1,INSD:BX824259.1,INSD:BX823980.1,
                     INSD:BX824941.1"
                     /note="Expressed protein; FUNCTIONS IN: hydrolase
                     activity, hydrolyzing O-glycosyl compounds; INVOLVED IN:
                     carbohydrate metabolic process; LOCATED IN: membrane;
                     CONTAINS InterPro DOMAIN/s: Glycoside hydrolase, family 35
                     (InterPro:IPR001944); BEST Arabidopsis thaliana protein
                     match is: unknown protein (TAIR:AT5G28919.1); Has 35333
                     Blast hits to 34131 proteins in 2444 species: Archae -
                     798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants
                     - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="Expressed protein"
                     /protein_id="AEE73653.1"
                     /db_xref="TAIR:AT3G01345"
                     /db_xref="Araport:AT3G01345"
                     /translation="MFRLSFLPLYPKITLTTIPLNTFTSCASSPLIFFATSVVYPSPR
                     LPLKSIPASPYSPLDRSFALTPELLKSFTLEDPTSADRASSQTNFVWLDLVSDALNSA
                     AVNPKSVLPSPSSLVTKRRCAWRLNLMLPQGFRIGPNPSPFCPPPNPLPKLLKPMKPS
                     AGLSPYPLRPRSVFKSVLQSPNFLMLLSFRESNGRFPVMVMMDLAWISSSLSQNLVDS
                     LSRLVRFLQCLSLVLNRLELFSLWKCPRVLLPTPSIVNLLSSSLLLAPSTSVWAGNGR
                     LAIRIVVCLGGNGSYHCRDKMLSFLWTLSETPLPTHRQMAFRVKRIGIMTLSLPSRCY
                     RSLENSQLIHSPFIALIHVMLIYCLDNLQSLDMLKKYGIMTMSSRSGYRLFLNLVNPS
                     ASSTEHFFKSSDALFARASFDHKMVEDFAKPAFMVESAKASTDFSIIRKLMKLLSLFS
                     CNFLFSLCMNLSLLRF"
     gene            132826..133195
                     /locus_tag="AT3G00995"
                     /db_xref="Araport:AT3G00995"
     ncRNA           132826..133195
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT3G00995"
                     /product="other RNA"
                     /db_xref="Araport:AT3G00995"
     gene            134925..137460
                     /locus_tag="AT3G01350"
                     /gene_synonym="T13O15.11"
                     /db_xref="Araport:AT3G01350"
                     /db_xref="TAIR:AT3G01350"
     mRNA            join(134925..135078,135175..135392,135958..136493,
                     136578..137460)
                     /locus_tag="AT3G01350"
                     /gene_synonym="T13O15.11"
                     /product="Major facilitator superfamily protein"
                     /db_xref="TAIR:AT3G01350"
                     /db_xref="Araport:AT3G01350"
     CDS             join(135024..135078,135175..135392,135958..136493,
                     136578..137460)
                     /locus_tag="AT3G01350"
                     /gene_synonym="T13O15.11"
                     /note="Major facilitator superfamily protein; FUNCTIONS
                     IN: transporter activity; INVOLVED IN: oligopeptide
                     transport; LOCATED IN: membrane; EXPRESSED IN: 12 plant
                     structures; EXPRESSED DURING: 6 growth stages; CONTAINS
                     InterPro DOMAIN/s: Oligopeptide transporter
                     (InterPro:IPR000109), Major facilitator superfamily,
                     general substrate transporter (InterPro:IPR016196); BEST
                     Arabidopsis thaliana protein match is: Major facilitator
                     superfamily protein (TAIR:AT5G14940.1); Has 5067 Blast
                     hits to 4897 proteins in 853 species: Archae - 0; Bacteria
                     - 1586; Metazoa - 472; Fungi - 442; Plants - 2170; Viruses
                     - 0; Other Eukaryotes - 397 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Major facilitator superfamily protein"
                     /protein_id="AEE73654.1"
                     /db_xref="TAIR:AT3G01350"
                     /db_xref="Araport:AT3G01350"
                     /translation="MDLEQKTRGLSKSCALLIVIAGMERYAFKGVASNLVTYLTDVVK
                     MSNSRAAKTVNTWAGFTSMLPLFSAPLADTYWDRFFTILASSSVYFVGLVGLTWTAFA
                     GSRSATKTISSYFLYSSLCLVSIGLGVLNPSLQAFGADQLDHDLDKNFDLSSGDQKDA
                     KATRKTQFFQLWYFGVCTGSLMGVTVMAYIQDTFGWVLGFAIPGIVIFLSILVFMSGC
                     GIYVYAPGARLKKKTTTTPFEKILKFIKGRVVKQRSIYTLADEKDLDAMELELEERPL
                     CKCETEDIETPSTTSKGLEDDESSKTVFSGIDNVKLVIRLFPIWMMLLMFAVIFQLPA
                     TFFTKQGVTMKRNIGSNFKIPPATLQSTITLSIILLMPLYDKILIPITKRIKKNGTGI
                     SVMERMGVGMFLSIIAIVIAAIVERKRLAISQKMKTLPDYDPETVPLSIFWLLPQYIL
                     LGISDIFTVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALISIVEAYSSSTG
                     DRQNWFADDMSEARLDKYYWLLALTSTISFVVYIFLCKFFKSSSDQGDEKEEAPK"
     gene            complement(136399..138799)
                     /locus_tag="AT3G01360"
                     /gene_synonym="T13O15.14"
                     /db_xref="Araport:AT3G01360"
                     /db_xref="TAIR:AT3G01360"
     mRNA            complement(join(136399..136842,137057..137560,
                     137770..138731))
                     /locus_tag="AT3G01360"
                     /gene_synonym="T13O15.14"
                     /product="plant viral-response family protein (DUF716)"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP841366.1,INSD:EL341121.1,INSD:BP647544.1,
                     INSD:BP814213.1,INSD:DR363678.1,INSD:AU230320.1,
                     INSD:EH823508.1,INSD:DR363676.1,INSD:EH874405.1,
                     INSD:DR363677.1,INSD:EH923512.1,INSD:EL326585.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK118202.1,INSD:BT011731.1"
                     /db_xref="TAIR:AT3G01360"
                     /db_xref="Araport:AT3G01360"
     mRNA            complement(137594..138799)
                     /locus_tag="AT3G01360"
                     /gene_synonym="T13O15.14"
                     /product="plant viral-response family protein (DUF716)"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL099994.1,INSD:BP841366.1,INSD:EL341121.1,
                     INSD:BP814213.1,INSD:DR363678.1,INSD:EH823508.1,
                     INSD:DR363676.1,INSD:EH874405.1,INSD:BP629004.1,
                     INSD:DR363677.1,INSD:EH923512.1,INSD:EL326585.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK118202.1,INSD:BT011731.1,INSD:AK229512.1"
                     /db_xref="TAIR:AT3G01360"
                     /db_xref="Araport:AT3G01360"
     CDS             complement(137772..138731)
                     /locus_tag="AT3G01360"
                     /gene_synonym="T13O15.14"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP841366.1,INSD:EL341121.1,INSD:BP647544.1,
                     INSD:BP814213.1,INSD:DR363678.1,INSD:AU230320.1,
                     INSD:EH823508.1,INSD:DR363676.1,INSD:EH874405.1,
                     INSD:DR363677.1,INSD:EH923512.1,INSD:EL326585.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK118202.1,INSD:BT011731.1"
                     /note="Family of unknown function (DUF716); CONTAINS
                     InterPro DOMAIN/s: Protein of unknown function DUF716
                     (InterPro:IPR006904); BEST Arabidopsis thaliana protein
                     match is: Family of unknown function (DUF716)
                     (TAIR:AT1G55230.1); Has 208 Blast hits to 208 proteins in
                     19 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
                     0; Plants - 207; Viruses - 0; Other Eukaryotes - 1
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="plant viral-response family protein (DUF716)"
                     /protein_id="AEE73655.1"
                     /db_xref="TAIR:AT3G01360"
                     /db_xref="Araport:AT3G01360"
                     /translation="MGILSYAVAGGGFAVIGAWESLDSSNLDPNSSSGTADSSSPMAQ
                     IRASPPKSVGSSSIPVALLSSLFIANSFFSFFSSIGSRDRVGSMIQLQIVAVAVLFLY
                     YAILTYLVNSKNAVFVALPSSITTLLLLFGFIEEFLMFYLQKKDVSGIENRYYDLMLV
                     PIAICVFSTVFELKSDSSTHRFAKLGRGIGLILQGTWFLQMGVSFFTGLITNNCTFHE
                     KSRGNFTIKCKGHGDYHRAKAIATLQFNCHLALMVVVATGLFSVIANKNGYLRQDHSK
                     YRPLGAELENLSTFTLDSDEEDEVREESNVAKEVGLNGNSSHD"
     CDS             complement(137772..138731)
                     /locus_tag="AT3G01360"
                     /gene_synonym="T13O15.14"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL099994.1,INSD:BP841366.1,INSD:EL341121.1,
                     INSD:BP814213.1,INSD:DR363678.1,INSD:EH823508.1,
                     INSD:DR363676.1,INSD:EH874405.1,INSD:BP629004.1,
                     INSD:DR363677.1,INSD:EH923512.1,INSD:EL326585.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK118202.1,INSD:BT011731.1,INSD:AK229512.1"
                     /note="Family of unknown function (DUF716); CONTAINS
                     InterPro DOMAIN/s: Protein of unknown function DUF716
                     (InterPro:IPR006904); BEST Arabidopsis thaliana protein
                     match is: Family of unknown function (DUF716)
                     (TAIR:AT1G55230.1); Has 35333 Blast hits to 34131 proteins
                     in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
                     974; Fungi - 991; Plants - 531; Viruses - 0; Other
                     Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="plant viral-response family protein (DUF716)"
                     /protein_id="AEE73656.1"
                     /db_xref="TAIR:AT3G01360"
                     /db_xref="Araport:AT3G01360"
                     /translation="MGILSYAVAGGGFAVIGAWESLDSSNLDPNSSSGTADSSSPMAQ
                     IRASPPKSVGSSSIPVALLSSLFIANSFFSFFSSIGSRDRVGSMIQLQIVAVAVLFLY
                     YAILTYLVNSKNAVFVALPSSITTLLLLFGFIEEFLMFYLQKKDVSGIENRYYDLMLV
                     PIAICVFSTVFELKSDSSTHRFAKLGRGIGLILQGTWFLQMGVSFFTGLITNNCTFHE
                     KSRGNFTIKCKGHGDYHRAKAIATLQFNCHLALMVVVATGLFSVIANKNGYLRQDHSK
                     YRPLGAELENLSTFTLDSDEEDEVREESNVAKEVGLNGNSSHD"
     gene            137987..138174
                     /locus_tag="AT3G01005"
                     /note="Natural antisense transcript overlaps with
                     AT3G01360"
                     /db_xref="Araport:AT3G01005"
     ncRNA           137987..138174
                     /ncRNA_class="antisense_RNA"
                     /locus_tag="AT3G01005"
                     /product="other RNA"
                     /db_xref="Araport:AT3G01005"
     gene            139011..143782
                     /gene="CFM2"
                     /locus_tag="AT3G01370"
                     /gene_synonym="Arabidopsis thaliana CRM family member 2"
                     /gene_synonym="ATCFM2"
                     /gene_synonym="CRM family member 2"
                     /gene_synonym="T13O15.1"
                     /gene_synonym="T13O15_1"
                     /note="Encodes a protein containing a CRM domain that is
                     involved in group I and group II intron splicing."
                     /db_xref="Araport:AT3G01370"
                     /db_xref="TAIR:AT3G01370"
     mRNA            join(139011..139722,139856..140363,140450..140580,
                     140717..141031,141117..141273,141432..141724,
                     141860..141919,142004..142060,142155..142268,
                     142385..142564,142651..142840,143049..143179,
                     143268..143782)
                     /gene="CFM2"
                     /locus_tag="AT3G01370"
                     /gene_synonym="Arabidopsis thaliana CRM family member 2"
                     /gene_synonym="ATCFM2"
                     /gene_synonym="CRM family member 2"
                     /gene_synonym="T13O15.1"
                     /gene_synonym="T13O15_1"
                     /product="CRM family member 2"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES064077.1,INSD:BP793889.1,INSD:ES111948.1,
                     INSD:BX841329.1,INSD:ES098202.1,INSD:AV828494.1,
                     INSD:BP854803.1,INSD:EL111813.1,INSD:EH892927.1,
                     INSD:ES157943.1,INSD:AV529993.1,INSD:EH876535.1,
                     INSD:DR262201.1,INSD:BX837172.1,INSD:EH908215.1,
                     INSD:BP609860.1,INSD:BP854222.1,INSD:ES083655.1,
                     INSD:AV559772.1,INSD:ES207275.1,INSD:DR262200.1,
                     INSD:EL222454.1,INSD:BP589774.1,INSD:EL327432.1,
                     INSD:ES207005.1,INSD:AV529412.1,INSD:BX841328.1,
                     INSD:AV828092.1,INSD:EL048217.1,INSD:AV800347.1,
                     INSD:ES038615.1,INSD:BP636134.1,INSD:BP600552.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX822141.1,INSD:BT010594.1,INSD:AY136347.1"
                     /db_xref="TAIR:AT3G01370"
                     /db_xref="Araport:AT3G01370"
     CDS             join(139033..139722,139856..140363,140450..140580,
                     140717..141031,141117..141273,141432..141724,
                     141860..141919,142004..142060,142155..142268,
                     142385..142564,142651..142840,143049..143179,
                     143268..143477)
                     /gene="CFM2"
                     /locus_tag="AT3G01370"
                     /gene_synonym="Arabidopsis thaliana CRM family member 2"
                     /gene_synonym="ATCFM2"
                     /gene_synonym="CRM family member 2"
                     /gene_synonym="T13O15.1"
                     /gene_synonym="T13O15_1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES064077.1,INSD:BP793889.1,INSD:ES111948.1,
                     INSD:BX841329.1,INSD:ES098202.1,INSD:AV828494.1,
                     INSD:BP854803.1,INSD:EL111813.1,INSD:EH892927.1,
                     INSD:ES157943.1,INSD:AV529993.1,INSD:EH876535.1,
                     INSD:DR262201.1,INSD:BX837172.1,INSD:EH908215.1,
                     INSD:BP609860.1,INSD:BP854222.1,INSD:ES083655.1,
                     INSD:AV559772.1,INSD:ES207275.1,INSD:DR262200.1,
                     INSD:EL222454.1,INSD:BP589774.1,INSD:EL327432.1,
                     INSD:ES207005.1,INSD:AV529412.1,INSD:BX841328.1,
                     INSD:AV828092.1,INSD:EL048217.1,INSD:AV800347.1,
                     INSD:ES038615.1,INSD:BP636134.1,INSD:BP600552.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX822141.1,INSD:BT010594.1,INSD:AY136347.1"
                     /note="CRM family member 2 (CFM2); FUNCTIONS IN: RNA
                     binding; INVOLVED IN: Group I intron splicing, Group II
                     intron splicing; LOCATED IN: chloroplast; EXPRESSED IN: 22
                     plant structures; EXPRESSED DURING: 13 growth stages;
                     CONTAINS InterPro DOMAIN/s: RNA-binding, CRM domain
                     (InterPro:IPR001890); BEST Arabidopsis thaliana protein
                     match is: CRM family member 3B (TAIR:AT4G14510.1); Has
                     1269 Blast hits to 881 proteins in 154 species: Archae -
                     0; Bacteria - 46; Metazoa - 247; Fungi - 72; Plants - 683;
                     Viruses - 4; Other Eukaryotes - 217 (source: NCBI BLink)."
                     /codon_start=1
                     /product="CRM family member 2"
                     /protein_id="AEE73657.1"
                     /db_xref="TAIR:AT3G01370"
                     /db_xref="Araport:AT3G01370"
                     /translation="MLLPLFHQQPLILAKTFPDRIFPPFLVPNTLVSRRNVSRANSGI
                     FCSSASGRKTLPQSAIQRIAEKLRSLGFVEEKHDSPTRRITGEESGKNSPGEIFVPLP
                     KQLPIHRVGHTIDTSWSTPSYPVPKPGSGTAISRYHELKRVWKKETEMERKKEEKVPS
                     LAELTLPPAELRRLRTVGIRLTKKLKIGKAGITEGIVNGIHERWRTTEVVKIFCEDIS
                     RMNMKRTHDVLETKTGGLVIWRSGSKILLYRGVNYQYPYFVSDRDLAHEAASGASSMD
                     QGVVDSREKQSIAESSAPSITNKMVKPMLTQGVGSPDKVRFQLPGEVQLVEEADRLLE
                     GLGPRFTDWWAYDPLPVDGDLLPAVVPDYRRPFRLLPYGVSPKLTDDEMTTIRRLGRP
                     LPCHFALGRNRNLQGLAVAIVKLWEKCELAKIAVKRGVQNTNSELMAEELKWLTGGTL
                     ISRDKDFIVLYRGKDFLPSAVSSAIEERRRQTMIMENSSVHGNKLTENEEEIKPRAVK
                     EDIELEAKDQKDHIQTHQMKSRQRNSPEAILEKTSMKLSMALEKKANAEKVLADLENR
                     ESPQLSDIDKEGITNDEKYMLRKIGLKMKPFLLLGRRGVFDGTIENMHLHWKYRELVK
                     IICNEYSIEAAHKVAEILEAESGGILVAVEMVSKGYAIIVYRGKNYERPQCLRPQTLL
                     SKREALKRSVEAQRRKSLKLHVLKLSNNIEELNRQLVEDSATNETWSDGESSNMMVEE
                     ETENQHTEPEKAREKIELGYSSDLSVPSSGEENWEDDSEGEVDPLTTSSQEYQEDESE
                     SASSQRHEGNSLDSTANLSVFAETGSANASSFHDRSLPHNSFLNANRKLPGSSTGSGS
                     QISALRERKSENDGLVTDLSNRERLILRKQALKMKKRPPFAVGRSNVVTGLARTLKMH
                     FQKNPLAIVNVKGRANGTSVQEVIAKLKEETGALLVSQEPSKVILYRGWGAEEEMKSF
                     YPNNNVKSSINLPSTRSFVDDPPHVSPALIEAIRLECGL"
     gene            complement(143880..149880)
                     /locus_tag="AT3G01380"
                     /gene_synonym="T13O15.2"
                     /gene_synonym="T13O15_2"
                     /db_xref="Araport:AT3G01380"
                     /db_xref="TAIR:AT3G01380"
     mRNA            complement(join(143880..144455,144543..144648,
                     144740..144798,144889..144987,145098..145287,
                     145372..145474,145563..145671,145746..145887,
                     146214..146401,146485..146718,146864..147189,
                     147446..147512,147728..147802,147896..148113,
                     148522..148815,148954..149109,149203..149394,
                     149549..149880))
                     /locus_tag="AT3G01380"
                     /gene_synonym="T13O15.2"
                     /gene_synonym="T13O15_2"
                     /product="sulfatase and phosphatidylinositolglycan class N
                     domain-containing protein"
                     /db_xref="Araport:AT3G01380"
                     /db_xref="TAIR:AT3G01380"
     mRNA            complement(join(143880..144455,144543..144648,
                     144740..144798,144889..144987,145098..145287,
                     145372..145474,145563..145671,145746..145887,
                     146214..146401,146485..146718,146864..147189,
                     147446..147512,147728..147802,147896..148113,
                     148522..148815,148954..149065,149203..149394,
                     149549..149866))
                     /locus_tag="AT3G01380"
                     /gene_synonym="T13O15.2"
                     /gene_synonym="T13O15_2"
                     /product="sulfatase and phosphatidylinositolglycan class N
                     domain-containing protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH992561.1,INSD:ES079360.1,INSD:BE037684.1"
                     /db_xref="TAIR:AT3G01380"
                     /db_xref="Araport:AT3G01380"
     CDS             complement(join(144288..144455,144543..144648,
                     144740..144798,144889..144987,145098..145287,
                     145372..145474,145563..145671,145746..145887,
                     146214..146401,146485..146718,146864..147189,
                     147446..147512,147728..147802,147896..148113,
                     148522..148815,148954..149109,149203..149394,
                     149549..149828))
                     /locus_tag="AT3G01380"
                     /gene_synonym="T13O15.2"
                     /gene_synonym="T13O15_2"
                     /codon_start=1
                     /product="sulfatase and phosphatidylinositolglycan class N
                     domain-containing protein"
                     /protein_id="ANM64679.1"
                     /db_xref="Araport:AT3G01380"
                     /db_xref="TAIR:AT3G01380"
                     /translation="MFLVGELGRSMRSDGILGVGGSDQSRATAVVVASRRRWLKRRET
                     WLVVLGVALHAVYMLSIFDIYFKTPIVHGMDPVPPRFSEPPAKRLVLLISDGLRADKF
                     FEPDEEGKYRAPFLRNIIKNQGRWGVSHARPPTESRPGHVAIIAGFYEDPSAVTKGWK
                     ANPVEFDSVFNQSRHTFAFGSPDIIPIFCSALPHSTWNSYPHEYEDFATDASFLDEWS
                     FDQFEGLLNRSHADPKLKELLHQDKLVVFLHLLGCDSNGHAHRPYSSIYLNNVKVVDK
                     IAERVYHLLEDYYRDNRTSYIFTADHGMSDKGSHGDGHPTNTDTPLVAWGAGIQYPKP
                     ASGNSHSDSVTTFVDKHAHDMPTPYDWGLRRVERVDVNQADIAPLMSTLLGLPCPVNS
                     VGNLPLGYMKLNEAEEVEAVVANTKQILNQLLRKSYIKSSNSLFFKPFKPLVHHSFSL
                     SQIDELISAKSYEAAMKLAVDLRNLSLEGLHYFQTYDWLMLMTVITLGYTGWMIVLAL
                     HVLQCYSSLSGDLSKKEHLSVQKKDSGKVYISGCLLMAILSVLNLVEHSPPLYHAYIG
                     MTVFLWTQIFSEYRLIRGLWKYLRERRADYFIKLLFAAAVAVVIVELLVHSFTERKLY
                     TWFFLIAGVVASILLHFSIPWRSGIPVFVCISCWFLSVFTLMPAEIPDNNNLVVTSGA
                     IIIVISLAAKWLDTHAEGNKFWQSITFHESRTQMCSMLYCIQIFLVGVSSVMVFLSTK
                     HRTQNQELHSSHQFINWLVAGSSMVLPLFSANGILSRLSSIFLGFAPPFLLLSIGYEA
                     VFYSALAVVLMAWILFENASHHSSKVKESSLSENNTEEHITIGSDERYLQLSDVRIPL
                     VFMVLFNVAFFGTGNFASIASFEISSVYRFITIFSPFLMAALLIFKLFIPFMLVICAF
                     SAITKLVRVPRLGCYFLVILFSDIMTIHFFFLVKNTGSWMEIGNSISHFGIVSAQVVF
                     VLLLFALTNLYTRSIRIKPLSTSPSLKTL"
     CDS             complement(join(144288..144455,144543..144648,
                     144740..144798,144889..144987,145098..145287,
                     145372..145474,145563..145671,145746..145887,
                     146214..146401,146485..146718,146864..147189,
                     147446..147512,147728..147802,147896..148113,
                     148522..148815,148954..149065,149203..149286))
                     /locus_tag="AT3G01380"
                     /gene_synonym="T13O15.2"
                     /gene_synonym="T13O15_2"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH992561.1,INSD:ES079360.1,INSD:BE037684.1"
                     /note="transferases;sulfuric ester
                     hydrolases;catalytics;transferases; FUNCTIONS IN: sulfuric
                     ester hydrolase activity, transferase activity, catalytic
                     activity; INVOLVED IN: GPI anchor biosynthetic process,
                     metabolic process; LOCATED IN: endoplasmic reticulum;
                     EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 13
                     growth stages; CONTAINS InterPro DOMAIN/s: GPI
                     ethanolamine phosphate transferase 1, C-terminal
                     (InterPro:IPR017852), Alkaline phosphatase-like,
                     alpha/beta/alpha (InterPro:IPR017849), GPI ethanolamine
                     phosphate transferase 1 (InterPro:IPR007070),
                     Alkaline-phosphatase-like, core domain
                     (InterPro:IPR017850), Sulfatase (InterPro:IPR000917); Has
                     1139 Blast hits to 1068 proteins in 222 species: Archae -
                     0; Bacteria - 85; Metazoa - 475; Fungi - 399; Plants - 79;
                     Viruses - 0; Other Eukaryotes - 101 (source: NCBI BLink)."
                     /codon_start=1
                     /product="sulfatase and phosphatidylinositolglycan class N
                     domain-containing protein"
                     /protein_id="AEE73658.2"
                     /db_xref="TAIR:AT3G01380"
                     /db_xref="Araport:AT3G01380"
                     /translation="MLVLLQNLDLAMLLLLLVSMKILVLSLKSRHTFAFGSPDIIPIF
                     CSALPHSTWNSYPHEYEDFATDASFLDEWSFDQFEGLLNRSHADPKLKELLHQDKLVV
                     FLHLLGCDSNGHAHRPYSSIYLNNVKVVDKIAERVYHLLEDYYRDNRTSYIFTADHGM
                     SDKGSHGDGHPTNTDTPLVAWGAGIQYPKPASGNSHSDSVTTFVDKHAHDMPTPYDWG
                     LRRVERVDVNQADIAPLMSTLLGLPCPVNSVGNLPLGYMKLNEAEEVEAVVANTKQIL
                     NQLLRKSYIKSSNSLFFKPFKPLVHHSFSLSQIDELISAKSYEAAMKLAVDLRNLSLE
                     GLHYFQTYDWLMLMTVITLGYTGWMIVLALHVLQCYSSLSGDLSKKEHLSVQKKDSGK
                     VYISGCLLMAILSVLNLVEHSPPLYHAYIGMTVFLWTQIFSEYRLIRGLWKYLRERRA
                     DYFIKLLFAAAVAVVIVELLVHSFTERKLYTWFFLIAGVVASILLHFSIPWRSGIPVF
                     VCISCWFLSVFTLMPAEIPDNNNLVVTSGAIIIVISLAAKWLDTHAEGNKFWQSITFH
                     ESRTQMCSMLYCIQIFLVGVSSVMVFLSTKHRTQNQELHSSHQFINWLVAGSSMVLPL
                     FSANGILSRLSSIFLGFAPPFLLLSIGYEAVFYSALAVVLMAWILFENASHHSSKVKE
                     SSLSENNTEEHITIGSDERYLQLSDVRIPLVFMVLFNVAFFGTGNFASIASFEISSVY
                     RFITIFSPFLMAALLIFKLFIPFMLVICAFSAITKLVRVPRLGCYFLVILFSDIMTIH
                     FFFLVKNTGSWMEIGNSISHFGIVSAQVVFVLLLFALTNLYTRSIRIKPLSTSPSLKT
                     L"
     gene            complement(149940..151572)
                     /gene="VMA10"
                     /locus_tag="AT3G01390"
                     /gene_synonym="AVMA10"
                     /gene_synonym="T13O15.3"
                     /gene_synonym="T13O15_3"
                     /gene_synonym="vacuolar membrane ATPase 10"
                     /gene_synonym="VACUOLAR MEMBRANE ATPASE SUBUNIT G"
                     /gene_synonym="VHA-G1"
                     /note="Subunit G of the vacuolar membrane ATPAse complex"
                     /db_xref="Araport:AT3G01390"
                     /db_xref="TAIR:AT3G01390"
     mRNA            complement(join(149940..150408,150496..150596,
                     150835..150940,151165..151554))
                     /gene="VMA10"
                     /locus_tag="AT3G01390"
                     /gene_synonym="AVMA10"
                     /gene_synonym="T13O15.3"
                     /gene_synonym="T13O15_3"
                     /gene_synonym="vacuolar membrane ATPase 10"
                     /gene_synonym="VACUOLAR MEMBRANE ATPASE SUBUNIT G"
                     /gene_synonym="VHA-G1"
                     /product="vacuolar membrane ATPase 10"
                     /db_xref="Araport:AT3G01390"
                     /db_xref="TAIR:AT3G01390"
     mRNA            complement(join(149940..150408,150496..150596,
                     150835..150940,151035..151554))
                     /gene="VMA10"
                     /locus_tag="AT3G01390"
                     /gene_synonym="AVMA10"
                     /gene_synonym="T13O15.3"
                     /gene_synonym="T13O15_3"
                     /gene_synonym="vacuolar membrane ATPase 10"
                     /gene_synonym="VACUOLAR MEMBRANE ATPASE SUBUNIT G"
                     /gene_synonym="VHA-G1"
                     /product="vacuolar membrane ATPase 10"
                     /db_xref="Araport:AT3G01390"
                     /db_xref="TAIR:AT3G01390"
     mRNA            complement(join(149942..150408,150496..150596,
                     150835..150940,151477..151572))
                     /gene="VMA10"
                     /locus_tag="AT3G01390"
                     /gene_synonym="AVMA10"
                     /gene_synonym="T13O15.3"
                     /gene_synonym="T13O15_3"
                     /gene_synonym="vacuolar membrane ATPase 10"
                     /gene_synonym="VACUOLAR MEMBRANE ATPASE SUBUNIT G"
                     /gene_synonym="VHA-G1"
                     /product="vacuolar membrane ATPase 10"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES175383.1,INSD:BP837169.1,INSD:ES161838.1,
                     INSD:EL093903.1,INSD:ES120904.1,INSD:EL021706.1,
                     INSD:F15431.1,INSD:EL242664.1,INSD:EL271042.1,
                     INSD:EL131981.1,INSD:EH983818.1,INSD:BP830005.1,
                     INSD:ES197766.1,INSD:EL992712.1,INSD:EL295605.1,
                     INSD:EH941224.1,INSD:ES086558.1,INSD:EH854807.1,
                     INSD:EL212929.1,INSD:DR259321.1,INSD:EL082971.1,
                     INSD:ES196690.1,INSD:EL068187.1,INSD:AI100207.1,
                     INSD:EL025200.1,INSD:EL977947.1,INSD:EL228090.1,
                     INSD:EL229611.1,INSD:EL305990.1,INSD:EH954049.1,
                     INSD:AV832339.1,INSD:ES077804.1,INSD:BP856581.1,
                     INSD:DR259315.1,INSD:EL035498.1,INSD:EL068908.1,
                     INSD:ES080867.1,INSD:EH807293.1,INSD:EL037416.1,
                     INSD:DR259316.1,INSD:ES168144.1,INSD:EL984230.1,
                     INSD:ES133625.1,INSD:EH928833.1,INSD:EL178189.1,
                     INSD:EL138879.1,INSD:EL181465.1,INSD:EL089436.1,
                     INSD:EL217272.1,INSD:EL243716.1,INSD:EL336543.1,
                     INSD:EL025887.1,INSD:EL143435.1,INSD:ES047164.1,
                     INSD:DR259314.1,INSD:EH866738.1,INSD:EH814169.1,
                     INSD:EL105015.1,INSD:EH917771.1,INSD:EL296753.1,
                     INSD:BP622771.1,INSD:ES024358.1,INSD:EL996470.1,
                     INSD:EH953952.1,INSD:AV820757.1,INSD:DR259318.1,
                     INSD:EL051308.1,INSD:ES197077.1,INSD:EL253872.1,
                     INSD:ES050096.1,INSD:EL110731.1,INSD:EL201098.1,
                     INSD:ES169162.1,INSD:DR259319.1,INSD:EL139181.1,
                     INSD:EL118107.1,INSD:ES059536.1,INSD:DR259320.1,
                     INSD:BP572864.1,INSD:EL329549.1,INSD:EH946996.1,
                     INSD:EL099600.1,INSD:ES056694.1,INSD:EL090500.1,
                     INSD:AV549235.1,INSD:EL242202.1,INSD:ES005928.1,
                     INSD:ES163620.1,INSD:EL141665.1,INSD:EL260670.1,
                     INSD:ES112376.1,INSD:EL069435.1,INSD:DR259317.1,
                     INSD:EH888488.1,INSD:ES060941.1,INSD:EL983297.1,
                     INSD:DR259312.1,INSD:EH952481.1,INSD:EL109133.1,
                     INSD:EL247119.1,INSD:EL288680.1,INSD:BP570583.1,
                     INSD:ES037578.1,INSD:EH825989.1,INSD:EL225181.1,
                     INSD:ES056896.1,INSD:EH940001.1,INSD:EG525517.1,
                     INSD:EL973534.1,INSD:EL336759.1,INSD:EL971478.1,
                     INSD:EG484005.1,INSD:AV549283.1,INSD:DR259313.1,
                     INSD:EL051296.1,INSD:EL987498.1,INSD:EL212125.1,
                     INSD:EL315663.1,INSD:BP630535.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY114730.1,INSD:AF181688.1,INSD:AY072365.1"
                     /db_xref="TAIR:AT3G01390"
                     /db_xref="Araport:AT3G01390"
     mRNA            complement(join(150004..150408,150496..150596,
                     150835..151500))
                     /gene="VMA10"
                     /locus_tag="AT3G01390"
                     /gene_synonym="AVMA10"
                     /gene_synonym="T13O15.3"
                     /gene_synonym="T13O15_3"
                     /gene_synonym="vacuolar membrane ATPase 10"
                     /gene_synonym="VACUOLAR MEMBRANE ATPASE SUBUNIT G"
                     /gene_synonym="VHA-G1"
                     /product="vacuolar membrane ATPase 10"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES175383.1,INSD:EL025887.1,INSD:ES047164.1,
                     INSD:EL143435.1,INSD:EH814169.1,INSD:EH917771.1,
                     INSD:ES161838.1,INSD:EL093903.1,INSD:EL296753.1,
                     INSD:BP622771.1,INSD:ES024358.1,INSD:ES120904.1,
                     INSD:EL996470.1,INSD:EL021706.1,INSD:EH953952.1,
                     INSD:F15431.1,INSD:EL242664.1,INSD:AV820757.1,
                     INSD:EL051308.1,INSD:EL131981.1,INSD:EH983818.1,
                     INSD:T41851.1,INSD:ES197077.1,INSD:BP830005.1,
                     INSD:EL992712.1,INSD:ES050096.1,INSD:EL110731.1,
                     INSD:ES169162.1,INSD:EL139181.1,INSD:ES059536.1,
                     INSD:EL118107.1,INSD:BP572864.1,INSD:EL329549.1,
                     INSD:EL295605.1,INSD:EH946996.1,INSD:EH941224.1,
                     INSD:ES086558.1,INSD:ES056694.1,INSD:EL147803.1,
                     INSD:EL090500.1,INSD:AV549235.1,INSD:ES005928.1,
                     INSD:EL242202.1,INSD:CB257943.1,INSD:ES163620.1,
                     INSD:ES169431.1,INSD:ES112376.1,INSD:EL260670.1,
                     INSD:EL082971.1,INSD:ES139405.1,INSD:ES060941.1,
                     INSD:EH888488.1,INSD:AI100207.1,INSD:EL983297.1,
                     INSD:EL977947.1,INSD:EL025200.1,INSD:EH952481.1,
                     INSD:EL228090.1,INSD:EL229611.1,INSD:ES127262.1,
                     INSD:EL288680.1,INSD:EL305990.1,INSD:BP570583.1,
                     INSD:EH954049.1,INSD:BE528335.1,INSD:ES037578.1,
                     INSD:ES077804.1,INSD:EL225181.1,INSD:ES056896.1,
                     INSD:EL035498.1,INSD:EH940001.1,INSD:EL068908.1,
                     INSD:ES080867.1,INSD:EL973534.1,INSD:EL037416.1,
                     INSD:ES168144.1,INSD:EL971478.1,INSD:ES133625.1,
                     INSD:EL984230.1,INSD:EG484005.1,INSD:EH928833.1,
                     INSD:EL138879.1,INSD:EL178189.1,INSD:EL051296.1,
                     INSD:ES080559.1,INSD:EL181465.1,INSD:EL987498.1,
                     INSD:EL212125.1,INSD:EL089436.1,INSD:EL217272.1,
                     INSD:EL315663.1,INSD:BP630535.1,INSD:EL243716.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY114730.1,INSD:BX825355.1,INSD:AJ005901.1"
                     /db_xref="TAIR:AT3G01390"
                     /db_xref="Araport:AT3G01390"
     CDS             complement(join(150265..150408,150496..150596,
                     150835..150922))
                     /gene="VMA10"
                     /locus_tag="AT3G01390"
                     /gene_synonym="AVMA10"
                     /gene_synonym="T13O15.3"
                     /gene_synonym="T13O15_3"
                     /gene_synonym="vacuolar membrane ATPase 10"
                     /gene_synonym="VACUOLAR MEMBRANE ATPASE SUBUNIT G"
                     /gene_synonym="VHA-G1"
                     /codon_start=1
                     /product="vacuolar membrane ATPase 10"
                     /protein_id="ANM65962.1"
                     /db_xref="Araport:AT3G01390"
                     /db_xref="TAIR:AT3G01390"
                     /translation="MESNRGQGSIQQLLAAEVEAQHIVNAARTAKMARLKQAKEEAEK
                     EIAEYKAQTEQDFQRKLEETSGDSGANVKRLEQETDTKIEQLKNEASRISKDVVEMLL
                     KHVTTVKN"
     CDS             complement(join(150265..150408,150496..150596,
                     150835..150922))
                     /gene="VMA10"
                     /locus_tag="AT3G01390"
                     /gene_synonym="AVMA10"
                     /gene_synonym="T13O15.3"
                     /gene_synonym="T13O15_3"
                     /gene_synonym="vacuolar membrane ATPase 10"
                     /gene_synonym="VACUOLAR MEMBRANE ATPASE SUBUNIT G"
                     /gene_synonym="VHA-G1"
                     /codon_start=1
                     /product="vacuolar membrane ATPase 10"
                     /protein_id="ANM65963.1"
                     /db_xref="Araport:AT3G01390"
                     /db_xref="TAIR:AT3G01390"
                     /translation="MESNRGQGSIQQLLAAEVEAQHIVNAARTAKMARLKQAKEEAEK
                     EIAEYKAQTEQDFQRKLEETSGDSGANVKRLEQETDTKIEQLKNEASRISKDVVEMLL
                     KHVTTVKN"
     CDS             complement(join(150265..150408,150496..150596,
                     150835..150922))
                     /gene="VMA10"
                     /locus_tag="AT3G01390"
                     /gene_synonym="AVMA10"
                     /gene_synonym="T13O15.3"
                     /gene_synonym="T13O15_3"
                     /gene_synonym="vacuolar membrane ATPase 10"
                     /gene_synonym="VACUOLAR MEMBRANE ATPASE SUBUNIT G"
                     /gene_synonym="VHA-G1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES175383.1,INSD:BP837169.1,INSD:ES161838.1,
                     INSD:EL093903.1,INSD:ES120904.1,INSD:EL021706.1,
                     INSD:F15431.1,INSD:EL242664.1,INSD:EL271042.1,
                     INSD:EL131981.1,INSD:EH983818.1,INSD:BP830005.1,
                     INSD:ES197766.1,INSD:EL992712.1,INSD:EL295605.1,
                     INSD:EH941224.1,INSD:ES086558.1,INSD:EH854807.1,
                     INSD:EL212929.1,INSD:DR259321.1,INSD:EL082971.1,
                     INSD:ES196690.1,INSD:EL068187.1,INSD:AI100207.1,
                     INSD:EL025200.1,INSD:EL977947.1,INSD:EL228090.1,
                     INSD:EL229611.1,INSD:EL305990.1,INSD:EH954049.1,
                     INSD:AV832339.1,INSD:ES077804.1,INSD:BP856581.1,
                     INSD:DR259315.1,INSD:EL035498.1,INSD:EL068908.1,
                     INSD:ES080867.1,INSD:EH807293.1,INSD:EL037416.1,
                     INSD:DR259316.1,INSD:ES168144.1,INSD:EL984230.1,
                     INSD:ES133625.1,INSD:EH928833.1,INSD:EL178189.1,
                     INSD:EL138879.1,INSD:EL181465.1,INSD:EL089436.1,
                     INSD:EL217272.1,INSD:EL243716.1,INSD:EL336543.1,
                     INSD:EL025887.1,INSD:EL143435.1,INSD:ES047164.1,
                     INSD:DR259314.1,INSD:EH866738.1,INSD:EH814169.1,
                     INSD:EL105015.1,INSD:EH917771.1,INSD:EL296753.1,
                     INSD:BP622771.1,INSD:ES024358.1,INSD:EL996470.1,
                     INSD:EH953952.1,INSD:AV820757.1,INSD:DR259318.1,
                     INSD:EL051308.1,INSD:ES197077.1,INSD:EL253872.1,
                     INSD:ES050096.1,INSD:EL110731.1,INSD:EL201098.1,
                     INSD:ES169162.1,INSD:DR259319.1,INSD:EL139181.1,
                     INSD:EL118107.1,INSD:ES059536.1,INSD:DR259320.1,
                     INSD:BP572864.1,INSD:EL329549.1,INSD:EH946996.1,
                     INSD:EL099600.1,INSD:ES056694.1,INSD:EL090500.1,
                     INSD:AV549235.1,INSD:EL242202.1,INSD:ES005928.1,
                     INSD:ES163620.1,INSD:EL141665.1,INSD:EL260670.1,
                     INSD:ES112376.1,INSD:EL069435.1,INSD:DR259317.1,
                     INSD:EH888488.1,INSD:ES060941.1,INSD:EL983297.1,
                     INSD:DR259312.1,INSD:EH952481.1,INSD:EL109133.1,
                     INSD:EL247119.1,INSD:EL288680.1,INSD:BP570583.1,
                     INSD:ES037578.1,INSD:EH825989.1,INSD:EL225181.1,
                     INSD:ES056896.1,INSD:EH940001.1,INSD:EG525517.1,
                     INSD:EL973534.1,INSD:EL336759.1,INSD:EL971478.1,
                     INSD:EG484005.1,INSD:AV549283.1,INSD:DR259313.1,
                     INSD:EL051296.1,INSD:EL987498.1,INSD:EL212125.1,
                     INSD:EL315663.1,INSD:BP630535.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY114730.1,INSD:AF181688.1,INSD:AY072365.1"
                     /note="vacuolar membrane ATPase 10 (VMA10); FUNCTIONS IN:
                     hydrogen ion transporting ATP synthase activity,
                     rotational mechanism; INVOLVED IN: ATP hydrolysis coupled
                     proton transport; LOCATED IN: plasma membrane,
                     proton-transporting two-sector ATPase complex, vacuole,
                     plant-type vacuole; EXPRESSED IN: 24 plant structures;
                     EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
                     DOMAIN/s: Vacuolar (H+)-ATPase G subunit
                     (InterPro:IPR005124); BEST Arabidopsis thaliana protein
                     match is: vacuolar ATP synthase subunit G2
                     (TAIR:AT4G23710.1); Has 617 Blast hits to 615 proteins in
                     206 species: Archae - 2; Bacteria - 17; Metazoa - 284;
                     Fungi - 124; Plants - 126; Viruses - 0; Other Eukaryotes -
                     64 (source: NCBI BLink)."
                     /codon_start=1
                     /product="vacuolar membrane ATPase 10"
                     /protein_id="AEE73659.1"
                     /db_xref="TAIR:AT3G01390"
                     /db_xref="Araport:AT3G01390"
                     /translation="MESNRGQGSIQQLLAAEVEAQHIVNAARTAKMARLKQAKEEAEK
                     EIAEYKAQTEQDFQRKLEETSGDSGANVKRLEQETDTKIEQLKNEASRISKDVVEMLL
                     KHVTTVKN"
     CDS             complement(join(150265..150408,150496..150596,
                     150835..150922))
                     /gene="VMA10"
                     /locus_tag="AT3G01390"
                     /gene_synonym="AVMA10"
                     /gene_synonym="T13O15.3"
                     /gene_synonym="T13O15_3"
                     /gene_synonym="vacuolar membrane ATPase 10"
                     /gene_synonym="VACUOLAR MEMBRANE ATPASE SUBUNIT G"
                     /gene_synonym="VHA-G1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES175383.1,INSD:EL025887.1,INSD:ES047164.1,
                     INSD:EL143435.1,INSD:EH814169.1,INSD:EH917771.1,
                     INSD:ES161838.1,INSD:EL093903.1,INSD:EL296753.1,
                     INSD:BP622771.1,INSD:ES024358.1,INSD:ES120904.1,
                     INSD:EL996470.1,INSD:EL021706.1,INSD:EH953952.1,
                     INSD:F15431.1,INSD:EL242664.1,INSD:AV820757.1,
                     INSD:EL051308.1,INSD:EL131981.1,INSD:EH983818.1,
                     INSD:T41851.1,INSD:ES197077.1,INSD:BP830005.1,
                     INSD:EL992712.1,INSD:ES050096.1,INSD:EL110731.1,
                     INSD:ES169162.1,INSD:EL139181.1,INSD:ES059536.1,
                     INSD:EL118107.1,INSD:BP572864.1,INSD:EL329549.1,
                     INSD:EL295605.1,INSD:EH946996.1,INSD:EH941224.1,
                     INSD:ES086558.1,INSD:ES056694.1,INSD:EL147803.1,
                     INSD:EL090500.1,INSD:AV549235.1,INSD:ES005928.1,
                     INSD:EL242202.1,INSD:CB257943.1,INSD:ES163620.1,
                     INSD:ES169431.1,INSD:ES112376.1,INSD:EL260670.1,
                     INSD:EL082971.1,INSD:ES139405.1,INSD:ES060941.1,
                     INSD:EH888488.1,INSD:AI100207.1,INSD:EL983297.1,
                     INSD:EL977947.1,INSD:EL025200.1,INSD:EH952481.1,
                     INSD:EL228090.1,INSD:EL229611.1,INSD:ES127262.1,
                     INSD:EL288680.1,INSD:EL305990.1,INSD:BP570583.1,
                     INSD:EH954049.1,INSD:BE528335.1,INSD:ES037578.1,
                     INSD:ES077804.1,INSD:EL225181.1,INSD:ES056896.1,
                     INSD:EL035498.1,INSD:EH940001.1,INSD:EL068908.1,
                     INSD:ES080867.1,INSD:EL973534.1,INSD:EL037416.1,
                     INSD:ES168144.1,INSD:EL971478.1,INSD:ES133625.1,
                     INSD:EL984230.1,INSD:EG484005.1,INSD:EH928833.1,
                     INSD:EL138879.1,INSD:EL178189.1,INSD:EL051296.1,
                     INSD:ES080559.1,INSD:EL181465.1,INSD:EL987498.1,
                     INSD:EL212125.1,INSD:EL089436.1,INSD:EL217272.1,
                     INSD:EL315663.1,INSD:BP630535.1,INSD:EL243716.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY114730.1,INSD:BX825355.1,INSD:AJ005901.1"
                     /note="vacuolar membrane ATPase 10 (VMA10); FUNCTIONS IN:
                     hydrogen ion transporting ATP synthase activity,
                     rotational mechanism; INVOLVED IN: ATP hydrolysis coupled
                     proton transport; LOCATED IN: plasma membrane,
                     proton-transporting two-sector ATPase complex, vacuole,
                     plant-type vacuole; EXPRESSED IN: 24 plant structures;
                     EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
                     DOMAIN/s: Vacuolar (H+)-ATPase G subunit
                     (InterPro:IPR005124); BEST Arabidopsis thaliana protein
                     match is: vacuolar ATP synthase subunit G2
                     (TAIR:AT4G23710.1); Has 621 Blast hits to 619 proteins in
                     206 species: Archae - 2; Bacteria - 17; Metazoa - 288;
                     Fungi - 124; Plants - 126; Viruses - 0; Other Eukaryotes -
                     64 (source: NCBI BLink)."
                     /codon_start=1
                     /product="vacuolar membrane ATPase 10"
                     /protein_id="AEE73660.1"
                     /db_xref="TAIR:AT3G01390"
                     /db_xref="Araport:AT3G01390"
                     /translation="MESNRGQGSIQQLLAAEVEAQHIVNAARTAKMARLKQAKEEAEK
                     EIAEYKAQTEQDFQRKLEETSGDSGANVKRLEQETDTKIEQLKNEASRISKDVVEMLL
                     KHVTTVKN"
     gene            151725..153263
                     /locus_tag="AT3G01400"
                     /gene_synonym="T13O15.4"
                     /gene_synonym="T13O15_4"
                     /db_xref="Araport:AT3G01400"
                     /db_xref="TAIR:AT3G01400"
     mRNA            151725..153263
                     /locus_tag="AT3G01400"
                     /gene_synonym="T13O15.4"
                     /gene_synonym="T13O15_4"
                     /product="ARM repeat superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL032922.1,INSD:DR227486.1,INSD:DR227489.1,
                     INSD:ES080376.1,INSD:DR227484.1,INSD:DR227485.1,
                     INSD:AA605414.1,INSD:ES182429.1,INSD:DR375364.1,
                     INSD:BP576838.1,INSD:R90117.1,INSD:EL073498.1,
                     INSD:R90013.1,INSD:EL073252.1,INSD:BP663502.1,
                     INSD:AV830521.1,INSD:EL266830.1,INSD:ES144561.1,
                     INSD:ES041967.1,INSD:DR227491.1,INSD:DR227487.1,
                     INSD:BP797247.1,INSD:AV561458.1,INSD:ES098337.1,
                     INSD:DR227488.1,INSD:AV812004.1,INSD:DR227490.1,
                     INSD:AV524477.1,INSD:ES113845.1,INSD:EL275949.1,
                     INSD:BX837618.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY125543.1,INSD:BX823206.1,INSD:AF428404.1,
                     INSD:BX824224.1,INSD:BX824140.1,INSD:AY087360.1"
                     /db_xref="TAIR:AT3G01400"
                     /db_xref="Araport:AT3G01400"
     CDS             151920..152987
                     /locus_tag="AT3G01400"
                     /gene_synonym="T13O15.4"
                     /gene_synonym="T13O15_4"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL032922.1,INSD:DR227486.1,INSD:DR227489.1,
                     INSD:ES080376.1,INSD:DR227484.1,INSD:DR227485.1,
                     INSD:AA605414.1,INSD:ES182429.1,INSD:DR375364.1,
                     INSD:BP576838.1,INSD:R90117.1,INSD:EL073498.1,
                     INSD:R90013.1,INSD:EL073252.1,INSD:BP663502.1,
                     INSD:AV830521.1,INSD:EL266830.1,INSD:ES144561.1,
                     INSD:ES041967.1,INSD:DR227491.1,INSD:DR227487.1,
                     INSD:BP797247.1,INSD:AV561458.1,INSD:ES098337.1,
                     INSD:DR227488.1,INSD:AV812004.1,INSD:DR227490.1,
                     INSD:AV524477.1,INSD:ES113845.1,INSD:EL275949.1,
                     INSD:BX837618.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY125543.1,INSD:BX823206.1,INSD:AF428404.1,
                     INSD:BX824224.1,INSD:BX824140.1,INSD:AY087360.1"
                     /note="ARM repeat superfamily protein; FUNCTIONS IN:
                     binding; INVOLVED IN: biological_process unknown; LOCATED
                     IN: cellular_component unknown; EXPRESSED IN: 21 plant
                     structures; EXPRESSED DURING: 13 growth stages; CONTAINS
                     InterPro DOMAIN/s: Armadillo-like helical
                     (InterPro:IPR011989), Armadillo (InterPro:IPR000225),
                     Armadillo-type fold (InterPro:IPR016024); BEST Arabidopsis
                     thaliana protein match is: ARM repeat superfamily protein
                     (TAIR:AT5G58680.1); Has 6122 Blast hits to 3580 proteins
                     in 271 species: Archae - 0; Bacteria - 2; Metazoa - 1843;
                     Fungi - 536; Plants - 3048; Viruses - 0; Other Eukaryotes
                     - 693 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ARM repeat superfamily protein"
                     /protein_id="AEE73661.1"
                     /db_xref="TAIR:AT3G01400"
                     /db_xref="Araport:AT3G01400"
                     /translation="MEMENHRPGSFTYMGRKFSDLSLNDDSSAFSDCNSDRSGEFPTA
                     SSESRRLLLSCASENSDDLINHLVSHLDSSYSIDEQKQAAMEIRLLSKNKPENRIKIA
                     KAGAIKPLISLISSSDLQLQEYGVTAILNLSLCDENKESIASSGAIKPLVRALKMGTP
                     TAKENAACALLRLSQIEENKVAIGRSGAIPLLVNLLETGGFRAKKDASTALYSLCSAK
                     ENKIRAVQSGIMKPLVELMADFGSNMVDKSAFVMSLLMSVPESKPAIVEEGGVPVLVE
                     IVEVGTQRQKEMAVSILLQLCEESVVYRTMVAREGAIPPLVALSQAGTSRAKQKAEAL
                     IELLRQPRSISNGGARSSSQL"
     gene            complement(153343..155657)
                     /locus_tag="AT3G01410"
                     /gene_synonym="T13O15.5"
                     /gene_synonym="T13O15_5"
                     /db_xref="Araport:AT3G01410"
                     /db_xref="TAIR:AT3G01410"
     mRNA            complement(join(153343..153681,153811..153862,
                     154052..154159,154257..154493,154582..154701,
                     154835..154900,155079..155237,155329..155657))
                     /locus_tag="AT3G01410"
                     /gene_synonym="T13O15.5"
                     /gene_synonym="T13O15_5"
                     /product="Polynucleotidyl transferase, ribonuclease H-like
                     superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR279001.1,INSD:AA720341.1,INSD:DR279003.1,
                     INSD:CB253833.1,INSD:EL187276.1,INSD:DR279004.1,
                     INSD:DR376814.1,INSD:BE038190.1,INSD:AV522253.1,
                     INSD:EL028529.1,INSD:BP806634.1,INSD:DR279002.1,
                     INSD:DR379148.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK176396.1,INSD:BT010430.1"
                     /db_xref="TAIR:AT3G01410"
                     /db_xref="Araport:AT3G01410"
     mRNA            complement(join(153357..153681,153811..153862,
                     154052..154159,154257..154493,154582..154701,
                     154835..154900,155079..155237,155329..155444,
                     155533..155639))
                     /locus_tag="AT3G01410"
                     /gene_synonym="T13O15.5"
                     /gene_synonym="T13O15_5"
                     /product="Polynucleotidyl transferase, ribonuclease H-like
                     superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR376814.1,INSD:AV522253.1,INSD:EL028529.1,
                     INSD:DR297735.1,INSD:DR379148.1,INSD:DR297734.1,
                     INSD:CB253833.1,INSD:EL187276.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:BT010430.1"
                     /db_xref="TAIR:AT3G01410"
                     /db_xref="Araport:AT3G01410"
     CDS             complement(join(153650..153681,153811..153862,
                     154052..154159,154257..154493,154582..154701,
                     154835..154900,155079..155237,155329..155439))
                     /locus_tag="AT3G01410"
                     /gene_synonym="T13O15.5"
                     /gene_synonym="T13O15_5"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR279001.1,INSD:AA720341.1,INSD:DR279003.1,
                     INSD:CB253833.1,INSD:EL187276.1,INSD:DR279004.1,
                     INSD:DR376814.1,INSD:BE038190.1,INSD:AV522253.1,
                     INSD:EL028529.1,INSD:BP806634.1,INSD:DR279002.1,
                     INSD:DR379148.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK176396.1,INSD:BT010430.1"
                     /note="Polynucleotidyl transferase, ribonuclease H-like
                     superfamily protein; FUNCTIONS IN: ribonuclease H
                     activity, nuclease activity, nucleic acid binding;
                     INVOLVED IN: biological_process unknown; LOCATED IN:
                     cellular_component unknown; EXPRESSED IN: 12 plant
                     structures; EXPRESSED DURING: 7 growth stages; CONTAINS
                     InterPro DOMAIN/s: Polynucleotidyl transferase,
                     ribonuclease H fold (InterPro:IPR012337), Ribonuclease H
                     (InterPro:IPR002156); BEST Arabidopsis thaliana protein
                     match is: RNase H family protein (TAIR:AT1G24090.1); Has
                     3179 Blast hits to 3179 proteins in 588 species: Archae -
                     77; Bacteria - 1109; Metazoa - 13; Fungi - 0; Plants -
                     1505; Viruses - 0; Other Eukaryotes - 475 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="Polynucleotidyl transferase, ribonuclease H-like
                     superfamily protein"
                     /protein_id="AEE73662.1"
                     /db_xref="TAIR:AT3G01410"
                     /db_xref="Araport:AT3G01410"
                     /translation="MGSTMEDEKDAFYIVRKGDIIGVYRSLSECQGQAGSSVSHPAMS
                     VYKGYGWPKGAEDLLSSFGIKNALFSVNASHVKDDAFGKLIPCPVQQPSSSQGESLNK
                     SSPSKRLQDMGSGESGSFSPSPPQKQLKIENDMLRRIPSSLLTRTPIRQNDSCTIEFD
                     GASKGNPGKAGAGAVLRASDNSVLFYLREGVGNATNNVAEYRALLLGLRSALDKGFKN
                     VHVLGDSMLVCMQVQGAWKTNHPKMAELCKQAKELMNSFKTFDIKHIAREKNSEADKQ
                     ANSAIFLADGQTQVISGG"
     CDS             complement(join(153650..153681,153811..153862,
                     154052..154159,154257..154493,154582..154701,
                     154835..154900,155079..155237,155329..155439))
                     /locus_tag="AT3G01410"
                     /gene_synonym="T13O15.5"
                     /gene_synonym="T13O15_5"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR376814.1,INSD:AV522253.1,INSD:EL028529.1,
                     INSD:DR297735.1,INSD:DR379148.1,INSD:DR297734.1,
                     INSD:CB253833.1,INSD:EL187276.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:BT010430.1"
                     /note="Polynucleotidyl transferase, ribonuclease H-like
                     superfamily protein; FUNCTIONS IN: ribonuclease H
                     activity, nuclease activity, nucleic acid binding;
                     INVOLVED IN: biological_process unknown; LOCATED IN:
                     cellular_component unknown; EXPRESSED IN: 12 plant
                     structures; EXPRESSED DURING: 7 growth stages; CONTAINS
                     InterPro DOMAIN/s: Polynucleotidyl transferase,
                     ribonuclease H fold (InterPro:IPR012337), Ribonuclease H
                     (InterPro:IPR002156); BEST Arabidopsis thaliana protein
                     match is: RNase H family protein (TAIR:AT1G24090.1); Has
                     3179 Blast hits to 3179 proteins in 588 species: Archae -
                     77; Bacteria - 1109; Metazoa - 13; Fungi - 0; Plants -
                     1505; Viruses - 0; Other Eukaryotes - 475 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="Polynucleotidyl transferase, ribonuclease H-like
                     superfamily protein"
                     /protein_id="AEE73663.1"
                     /db_xref="TAIR:AT3G01410"
                     /db_xref="Araport:AT3G01410"
                     /translation="MGSTMEDEKDAFYIVRKGDIIGVYRSLSECQGQAGSSVSHPAMS
                     VYKGYGWPKGAEDLLSSFGIKNALFSVNASHVKDDAFGKLIPCPVQQPSSSQGESLNK
                     SSPSKRLQDMGSGESGSFSPSPPQKQLKIENDMLRRIPSSLLTRTPIRQNDSCTIEFD
                     GASKGNPGKAGAGAVLRASDNSVLFYLREGVGNATNNVAEYRALLLGLRSALDKGFKN
                     VHVLGDSMLVCMQVQGAWKTNHPKMAELCKQAKELMNSFKTFDIKHIAREKNSEADKQ
                     ANSAIFLADGQTQVISGG"
     gene            complement(156148..156937)
                     /locus_tag="AT3G01415"
                     /db_xref="Araport:AT3G01415"
     mRNA            complement(join(156148..156716,156802..156937))
                     /locus_tag="AT3G01415"
                     /product="tubulin-tyrosine ligase"
                     /db_xref="Araport:AT3G01415"
     CDS             complement(join(156296..156716,156802..156932))
                     /locus_tag="AT3G01415"
                     /codon_start=1
                     /product="tubulin-tyrosine ligase"
                     /protein_id="ANM65559.1"
                     /db_xref="Araport:AT3G01415"
                     /translation="MKGEKRVKEVICLYSRGLYYFIALRVSLQILLDIEPPSYMPVYV
                     YTTLRAANIPYIGMVIWCLCKDVLVPRYQLGPEGRAFFFLAVMILMYCISYNVQGVMS
                     RVEGSIIGVCLILAGISIVQLSCPIKDFTVTHTLSTTYLGALFAILGWLGTSSWSYFI
                     GTLLCFPITLFIIYMLVDPLDDN"
     gene            158529..158772
                     /locus_tag="AT3G01025"
                     /db_xref="Araport:AT3G01025"
     ncRNA           158529..158772
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT3G01025"
                     /product="other RNA"
                     /db_xref="Araport:AT3G01025"
     gene            complement(159450..162905)
                     /gene="DOX1"
                     /locus_tag="AT3G01420"
                     /gene_synonym="alpha-dioxygenase 1"
                     /gene_synonym="ALPHA-DOX1"
                     /gene_synonym="DIOX1"
                     /gene_synonym="PADOX-1"
                     /gene_synonym="plant alpha dioxygenase 1"
                     /gene_synonym="T13O15.6"
                     /gene_synonym="T13O15_6"
                     /note="Encodes an alpha-dioxygenase involved in protection
                     against oxidative stress and cell death. Induced in
                     response to Salicylic acid and oxidative stress.
                     Independent of NPR1 in induction by salicylic acid."
                     /db_xref="Araport:AT3G01420"
                     /db_xref="TAIR:AT3G01420"
     mRNA            complement(join(159450..159914,160020..160263,
                     160342..160544,160637..160864,160960..161105,
                     161208..161424,161640..161773,161872..162021,
                     162191..162454,162619..162905))
                     /gene="DOX1"
                     /locus_tag="AT3G01420"
                     /gene_synonym="alpha-dioxygenase 1"
                     /gene_synonym="ALPHA-DOX1"
                     /gene_synonym="DIOX1"
                     /gene_synonym="PADOX-1"
                     /gene_synonym="plant alpha dioxygenase 1"
                     /gene_synonym="T13O15.6"
                     /gene_synonym="T13O15_6"
                     /product="Peroxidase superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP638339.1,INSD:R30347.1,INSD:BP616758.1,
                     INSD:BP799758.1,INSD:BP562394.2,INSD:CB257456.1,
                     INSD:BP595002.1,INSD:BP580914.1,INSD:BP581258.1,
                     INSD:AV832036.1,INSD:AV801372.1,INSD:CB185806.1,
                     INSD:BP574749.1,INSD:AV545510.1,INSD:AV537310.1,
                     INSD:R90630.1,INSD:BP801204.1,INSD:BP566872.1,
                     INSD:EL058157.1,INSD:CD533249.1,INSD:BP613368.1,
                     INSD:N38086.1,INSD:BP621079.1,INSD:AA042387.1,
                     INSD:BP799536.1,INSD:BP579659.1,INSD:BP801825.1,
                     INSD:AV813704.1,INSD:BE528266.1,INSD:BP643082.1,
                     INSD:AV815139.1,INSD:BP577652.1,INSD:BP830635.1,
                     INSD:AV812539.1,INSD:BP802949.1,INSD:AV548580.1,
                     INSD:BP568584.1,INSD:Z27291.1,INSD:BP800216.1,
                     INSD:AV816642.1,INSD:BP806409.2,INSD:AV805782.1,
                     INSD:BP804400.1,INSD:BP649890.1,INSD:BP619260.1,
                     INSD:BP583730.1,INSD:BP574005.1,INSD:H37095.1,
                     INSD:BE527988.1,INSD:AV548503.1,INSD:N38605.1,
                     INSD:BP569969.1,INSD:BP578622.1,INSD:AV814482.1,
                     INSD:Z27292.1,INSD:BP566997.1,INSD:BP571074.1,
                     INSD:BP572532.1,INSD:BP654683.1,INSD:CD530146.1,
                     INSD:CD530528.1,INSD:BE525718.1,INSD:AV828178.1,
                     INSD:DR381039.1,INSD:BP657346.1,INSD:AV820344.1,
                     INSD:AV812559.1,INSD:BP846098.1,INSD:BP646841.1,
                     INSD:AV560446.1,INSD:EL105609.1,INSD:BP582968.1,
                     INSD:BP819087.1,INSD:BP806100.1,INSD:AV812554.1,
                     INSD:BP615493.1,INSD:AV549056.1,INSD:DR257924.1,
                     INSD:AV810916.1,INSD:BP570303.1,INSD:BP590952.1,
                     INSD:CD530527.1,INSD:BP618587.1,INSD:BP577006.1,
                     INSD:BP618105.1,INSD:AV548296.1,INSD:EH994510.1,
                     INSD:AV819854.1,INSD:AV816923.1,INSD:BP645658.1,
                     INSD:CD530381.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY042787.1,INSD:AY064666.1"
                     /db_xref="TAIR:AT3G01420"
                     /db_xref="Araport:AT3G01420"
     CDS             complement(join(159689..159914,160020..160263,
                     160342..160544,160637..160864,160960..161105,
                     161208..161424,161640..161773,161872..162021,
                     162191..162454,162619..162726))
                     /gene="DOX1"
                     /locus_tag="AT3G01420"
                     /gene_synonym="alpha-dioxygenase 1"
                     /gene_synonym="ALPHA-DOX1"
                     /gene_synonym="DIOX1"
                     /gene_synonym="PADOX-1"
                     /gene_synonym="plant alpha dioxygenase 1"
                     /gene_synonym="T13O15.6"
                     /gene_synonym="T13O15_6"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP638339.1,INSD:R30347.1,INSD:BP616758.1,
                     INSD:BP799758.1,INSD:BP562394.2,INSD:CB257456.1,
                     INSD:BP595002.1,INSD:BP580914.1,INSD:BP581258.1,
                     INSD:AV832036.1,INSD:AV801372.1,INSD:CB185806.1,
                     INSD:BP574749.1,INSD:AV545510.1,INSD:AV537310.1,
                     INSD:R90630.1,INSD:BP801204.1,INSD:BP566872.1,
                     INSD:EL058157.1,INSD:CD533249.1,INSD:BP613368.1,
                     INSD:N38086.1,INSD:BP621079.1,INSD:AA042387.1,
                     INSD:BP799536.1,INSD:BP579659.1,INSD:BP801825.1,
                     INSD:AV813704.1,INSD:BE528266.1,INSD:BP643082.1,
                     INSD:AV815139.1,INSD:BP577652.1,INSD:BP830635.1,
                     INSD:AV812539.1,INSD:BP802949.1,INSD:AV548580.1,
                     INSD:BP568584.1,INSD:Z27291.1,INSD:BP800216.1,
                     INSD:AV816642.1,INSD:BP806409.2,INSD:AV805782.1,
                     INSD:BP804400.1,INSD:BP649890.1,INSD:BP619260.1,
                     INSD:BP583730.1,INSD:BP574005.1,INSD:H37095.1,
                     INSD:BE527988.1,INSD:AV548503.1,INSD:N38605.1,
                     INSD:BP569969.1,INSD:BP578622.1,INSD:AV814482.1,
                     INSD:Z27292.1,INSD:BP566997.1,INSD:BP571074.1,
                     INSD:BP572532.1,INSD:BP654683.1,INSD:CD530146.1,
                     INSD:CD530528.1,INSD:BE525718.1,INSD:AV828178.1,
                     INSD:DR381039.1,INSD:BP657346.1,INSD:AV820344.1,
                     INSD:AV812559.1,INSD:BP846098.1,INSD:BP646841.1,
                     INSD:AV560446.1,INSD:EL105609.1,INSD:BP582968.1,
                     INSD:BP819087.1,INSD:BP806100.1,INSD:AV812554.1,
                     INSD:BP615493.1,INSD:AV549056.1,INSD:DR257924.1,
                     INSD:AV810916.1,INSD:BP570303.1,INSD:BP590952.1,
                     INSD:CD530527.1,INSD:BP618587.1,INSD:BP577006.1,
                     INSD:BP618105.1,INSD:AV548296.1,INSD:EH994510.1,
                     INSD:AV819854.1,INSD:AV816923.1,INSD:BP645658.1,
                     INSD:CD530381.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY042787.1,INSD:AY064666.1"
                     /note="DOX1; FUNCTIONS IN: lipoxygenase activity; INVOLVED
                     IN: in 6 processes; LOCATED IN: endomembrane system;
                     EXPRESSED IN: 9 plant structures; EXPRESSED DURING: 4
                     anthesis; CONTAINS InterPro DOMAIN/s: Haem peroxidase
                     (InterPro:IPR010255), Haem peroxidase, animal
                     (InterPro:IPR002007); BEST Arabidopsis thaliana protein
                     match is: alpha dioxygenase (TAIR:AT1G73680.1); Has 1465
                     Blast hits to 1381 proteins in 214 species: Archae - 0;
                     Bacteria - 94; Metazoa - 1085; Fungi - 168; Plants - 70;
                     Viruses - 1; Other Eukaryotes - 47 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Peroxidase superfamily protein"
                     /protein_id="AEE73664.1"
                     /db_xref="TAIR:AT3G01420"
                     /db_xref="Araport:AT3G01420"
                     /translation="MKVITSLISSILLKFIHKDFHEIYARMSLLDRFLLLIVHGVDKM
                     VPWHKLPVFLGLTYLEVRRHLHQQYNLLNVGQTPTGIRFDPANYPYRTADGKFNDPFN
                     EGVGSQNSFFGRNCPPVDQKSKLRRPDPMVVATKLLGRKKFIDTGKQFNMIAASWIQF
                     MIHDWIDHLEDTHQIELVAPKEVASKCPLSSFRFLKTKEVPTGFFEIKTGSQNIRTPW
                     WDSSVIYGSNSKTLDRVRTYKDGKLKISEETGLLLHDEDGLAISGDIRNSWAGVSALQ
                     ALFIKEHNAVCDALKDEDDDLEDEDLYRYARLVTSAVVAKIHTIDWTVQLLKTDTLLA
                     GMRANWYGLLGKKFKDSFGHAGSSILGGVVGMKKPQNHGVPYSLTEDFTSVYRMHSLL
                     PDQLHILDIDDVPGTNKSLPLIQEISMRDLIGRKGEETMSHIGFTKLMVSMGHQASGA
                     LELMNYPMWLRDIVPHDPNGQARPDHVDLAALEIYRDRERSVPRYNEFRRSMFMIPIT
                     KWEDLTEDEEAIEVLDDVYDGDVEELDLLVGLMAEKKIKGFAISETAFYIFLIMATRR
                     LEADRFFTSDFNETIYTKKGLEWVNTTESLKDVIDRHYPDMTDKWMNSESAFSVWDSP
                     PLTKNPIPLYLRIPS"
     gene            complement(165392..166542)
                     /locus_tag="AT3G01430"
                     /gene_synonym="T13O15.7"
                     /gene_synonym="T13O15_7"
                     /db_xref="Araport:AT3G01430"
                     /db_xref="TAIR:AT3G01430"
     mRNA            complement(165392..166542)
                     /locus_tag="AT3G01430"
                     /gene_synonym="T13O15.7"
                     /gene_synonym="T13O15_7"
                     /product="NHL domain protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES103801.1,INSD:ES043989.1,INSD:AU231162.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK118933.1,INSD:BT005550.1"
                     /db_xref="TAIR:AT3G01430"
                     /db_xref="Araport:AT3G01430"
     CDS             complement(165595..166137)
                     /locus_tag="AT3G01430"
                     /gene_synonym="T13O15.7"
                     /gene_synonym="T13O15_7"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES103801.1,INSD:ES043989.1,INSD:AU231162.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK118933.1,INSD:BT005550.1"
                     /note="BEST Arabidopsis thaliana protein match is: NHL
                     domain-containing protein (TAIR:AT5G14890.1); Has 98 Blast
                     hits to 98 proteins in 12 species: Archae - 0; Bacteria -
                     0; Metazoa - 0; Fungi - 0; Plants - 98; Viruses - 0; Other
                     Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="NHL domain protein"
                     /protein_id="AEE73665.1"
                     /db_xref="TAIR:AT3G01430"
                     /db_xref="Araport:AT3G01430"
                     /translation="MSHQSPPIAEVDATDDMHEALFAKRGCCFLMPCLASSQPSTRGG
                     SVWWQRITTVDKLEPDERWWIRGWRRMREWSELVAGPRWKTYIRRFGRSNCCGGGGGR
                     VGNSSGGCGGGAMPNRSSDQGKFRYDQLSYSLNFDDGNQTGHFDDEFPYRDYSMRFAA
                     PSLPVSTKCSIDFDSDIDNK"
     gene            complement(166514..168288)
                     /locus_tag="AT3G01435"
                     /db_xref="Araport:AT3G01435"
                     /db_xref="TAIR:AT3G01435"
     mRNA            complement(join(166514..167029,167718..167834,
                     167931..168030,168106..168288))
                     /locus_tag="AT3G01435"
                     /product="Expressed protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP650668.1,INSD:EL993353.1,INSD:AU228917.1,
                     INSD:EL991127.1,INSD:EL971590.1,INSD:EL986196.1,
                     INSD:DR296766.1,INSD:AU237823.1,INSD:EL973161.1,
                     INSD:EL199073.1,INSD:EL989838.1,INSD:ES043988.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK229334.1,INSD:BX825895.1,INSD:BT015691.1,
                     INSD:BX825119.1,INSD:BT014796.1"
                     /db_xref="TAIR:AT3G01435"
                     /db_xref="Araport:AT3G01435"
     mRNA            complement(join(166514..167029,167718..168030,
                     168106..168288))
                     /locus_tag="AT3G01435"
                     /product="Expressed protein"
                     /db_xref="Araport:AT3G01435"
                     /db_xref="TAIR:AT3G01435"
     mRNA            complement(join(166555..167029,167718..167878))
                     /locus_tag="AT3G01435"
                     /product="Expressed protein"
                     /db_xref="Araport:AT3G01435"
                     /db_xref="TAIR:AT3G01435"
     mRNA            complement(join(166595..167029,167718..167834,
                     167931..168053))
                     /locus_tag="AT3G01435"
                     /product="Expressed protein"
                     /db_xref="Araport:AT3G01435"
                     /db_xref="TAIR:AT3G01435"
     CDS             complement(join(166853..167029,167718..167834,
                     167931..167984))
                     /locus_tag="AT3G01435"
                     /codon_start=1
                     /product="Expressed protein"
                     /protein_id="ANM65648.1"
                     /db_xref="Araport:AT3G01435"
                     /db_xref="TAIR:AT3G01435"
                     /translation="MDPQTQNTSLQRLQNVENRVVKVLELAGGVMEELASPSGPKKEF
                     VNSHCREFMQSMKDIQVTLREEIKSACEYRPFEKCDYNARIANEICFQKLEYVLTQLE
                     DLKQTADRYPSSD"
     CDS             complement(join(166853..167029,167718..167834,
                     167931..167984))
                     /locus_tag="AT3G01435"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP650668.1,INSD:EL993353.1,INSD:AU228917.1,
                     INSD:EL991127.1,INSD:EL971590.1,INSD:EL986196.1,
                     INSD:DR296766.1,INSD:AU237823.1,INSD:EL973161.1,
                     INSD:EL199073.1,INSD:EL989838.1,INSD:ES043988.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK229334.1,INSD:BX825895.1,INSD:BT015691.1,
                     INSD:BX825119.1,INSD:BT014796.1"
                     /note="Expressed protein; FUNCTIONS IN: RNA polymerase II
                     transcription mediator activity; INVOLVED IN: regulation
                     of transcription from RNA polymerase II promoter; LOCATED
                     IN: mediator complex; CONTAINS InterPro DOMAIN/s: Mediator
                     complex, subunit Med11 (InterPro:IPR019404); Has 35333
                     Blast hits to 34131 proteins in 2444 species: Archae -
                     798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants
                     - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="Expressed protein"
                     /protein_id="AEE73666.1"
                     /db_xref="TAIR:AT3G01435"
                     /db_xref="Araport:AT3G01435"
                     /translation="MDPQTQNTSLQRLQNVENRVVKVLELAGGVMEELASPSGPKKEF
                     VNSHCREFMQSMKDIQVTLREEIKSACEYRPFEKCDYNARIANEICFQKLEYVLTQLE
                     DLKQTADRYPSSD"
     CDS             complement(join(166853..167029,167718..167984))
                     /locus_tag="AT3G01435"
                     /codon_start=1
                     /product="Expressed protein"
                     /protein_id="ANM65650.1"
                     /db_xref="Araport:AT3G01435"
                     /db_xref="TAIR:AT3G01435"
                     /translation="MDPQTQNTSLQRLQNVENVKFWKTHSFLRDFIGRFDVNVFLCFY
                     FWFSGQRVVKVLELAGGVMEELASPSGPKKEFVNSHCREFMQSMKDIQVTLREEIKSA
                     CEYRPFEKCDYNARIANEICFQKLEYVLTQLEDLKQTADRYPSSD"
     CDS             complement(join(166853..167029,167718..167798))
                     /locus_tag="AT3G01435"
                     /codon_start=1
                     /product="Expressed protein"
                     /protein_id="ANM65649.1"
                     /db_xref="Araport:AT3G01435"
                     /db_xref="TAIR:AT3G01435"
                     /translation="MEELASPSGPKKEFVNSHCREFMQSMKDIQVTLREEIKSACEYR
                     PFEKCDYNARIANEICFQKLEYVLTQLEDLKQTADRYPSSD"
     gene            168408..169662
                     /gene="PnsL3"
                     /locus_tag="AT3G01440"
                     /gene_synonym="Photosynthetic NDH subcomplex L 3"
                     /gene_synonym="PQL1"
                     /gene_synonym="PQL2"
                     /gene_synonym="PsbQ-like 1"
                     /gene_synonym="PsbQ-like 2"
                     /gene_synonym="T13O15.8"
                     /gene_synonym="T13O15_8"
                     /note="Encodes a subunit of the NAD(P)H complex located in
                     the chloroplast thylakoid lumen."
                     /db_xref="Araport:AT3G01440"
                     /db_xref="TAIR:AT3G01440"
     mRNA            join(168408..168754,168899..169185,169309..169662)
                     /gene="PnsL3"
                     /locus_tag="AT3G01440"
                     /gene_synonym="Photosynthetic NDH subcomplex L 3"
                     /gene_synonym="PQL1"
                     /gene_synonym="PQL2"
                     /gene_synonym="PsbQ-like 1"
                     /gene_synonym="PsbQ-like 2"
                     /gene_synonym="T13O15.8"
                     /gene_synonym="T13O15_8"
                     /product="PsbQ-like 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL141093.1,INSD:EH957193.1,INSD:EL098563.1,
                     INSD:EL150375.1,INSD:DR215876.1,INSD:EL261673.1,
                     INSD:DR215875.1,INSD:AV824239.1,INSD:EL063105.1,
                     INSD:EL062351.1,INSD:EH916048.1,INSD:EL275749.1,
                     INSD:DR215877.1,INSD:EL174137.1,INSD:EH918330.1,
                     INSD:EL160343.1,INSD:EL334870.1,INSD:EH901553.1,
                     INSD:EL294622.1,INSD:DR215880.1,INSD:DR215881.1,
                     INSD:EH884659.1,INSD:DR215874.1,INSD:DR215878.1,
                     INSD:EL207700.1,INSD:EH844230.1,INSD:EG514902.1,
                     INSD:EL274416.1,INSD:EH836021.1,INSD:EL271606.1,
                     INSD:EL078932.1,INSD:EH942865.1,INSD:AV816604.1,
                     INSD:EL300448.1,INSD:EG514901.1,INSD:EL300794.1,
                     INSD:EL018936.1,INSD:EH926606.1,INSD:EL184529.1,
                     INSD:EL123480.1,INSD:EH911855.1,INSD:EL159866.1,
                     INSD:DR215879.1,INSD:AV785445.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY070745.1,INSD:AY085184.1,INSD:BX825651.1,
                     INSD:AY093737.1"
                     /db_xref="TAIR:AT3G01440"
                     /db_xref="Araport:AT3G01440"
     CDS             join(168478..168754,168899..169185,169309..169407)
                     /gene="PnsL3"
                     /locus_tag="AT3G01440"
                     /gene_synonym="Photosynthetic NDH subcomplex L 3"
                     /gene_synonym="PQL1"
                     /gene_synonym="PQL2"
                     /gene_synonym="PsbQ-like 1"
                     /gene_synonym="PsbQ-like 2"
                     /gene_synonym="T13O15.8"
                     /gene_synonym="T13O15_8"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL141093.1,INSD:EH957193.1,INSD:EL098563.1,
                     INSD:EL150375.1,INSD:DR215876.1,INSD:EL261673.1,
                     INSD:DR215875.1,INSD:AV824239.1,INSD:EL063105.1,
                     INSD:EL062351.1,INSD:EH916048.1,INSD:EL275749.1,
                     INSD:DR215877.1,INSD:EL174137.1,INSD:EH918330.1,
                     INSD:EL160343.1,INSD:EL334870.1,INSD:EH901553.1,
                     INSD:EL294622.1,INSD:DR215880.1,INSD:DR215881.1,
                     INSD:EH884659.1,INSD:DR215874.1,INSD:DR215878.1,
                     INSD:EL207700.1,INSD:EH844230.1,INSD:EG514902.1,
                     INSD:EL274416.1,INSD:EH836021.1,INSD:EL271606.1,
                     INSD:EL078932.1,INSD:EH942865.1,INSD:AV816604.1,
                     INSD:EL300448.1,INSD:EG514901.1,INSD:EL300794.1,
                     INSD:EL018936.1,INSD:EH926606.1,INSD:EL184529.1,
                     INSD:EL123480.1,INSD:EH911855.1,INSD:EL159866.1,
                     INSD:DR215879.1,INSD:AV785445.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY070745.1,INSD:AY085184.1,INSD:BX825651.1,
                     INSD:AY093737.1"
                     /note="PsbQ-like 1 (PQL1); FUNCTIONS IN: electron
                     transporter, transferring electrons within the cyclic
                     electron transport pathway of photosynthesis activity;
                     INVOLVED IN: photosynthesis, light reaction,
                     photosynthetic electron transport chain; LOCATED IN: in 7
                     components; EXPRESSED IN: 20 plant structures; EXPRESSED
                     DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
                     Photosystem II oxygen evolving complex protein PsbQ
                     (InterPro:IPR008797); BEST Arabidopsis thaliana protein
                     match is: photosystem II subunit QA (TAIR:AT4G21280.1);
                     Has 165 Blast hits to 165 proteins in 26 species: Archae -
                     0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 165;
                     Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="PsbQ-like 1"
                     /protein_id="AEE73667.1"
                     /db_xref="TAIR:AT3G01440"
                     /db_xref="Araport:AT3G01440"
                     /translation="MAHFIDLNSLTNTLPSLPKLPESRKTGKSSGFACRRTEEFQEPD
                     SVQITRRMTLGFAVSIGLTGILGENNVSLAQDNGFWIDGPLPIPPIYNNIVNEKTGTR
                     TFIKKGVYVADIGTKGRMYRVKKNAFDLLAMEDLIGPDTLNYVKKYLRLKSTFLFYDF
                     DNLISAAASEDKQPLTDLANRLFDNFEKLEDAAKTKNLAETESCYKDTKFLLQEVMTR
                     MA"
     gene            complement(169597..172045)
                     /locus_tag="AT3G01450"
                     /gene_synonym="T13O15.9"
                     /gene_synonym="T13O15_9"
                     /db_xref="Araport:AT3G01450"
                     /db_xref="TAIR:AT3G01450"
     mRNA            complement(join(169597..170190,170331..170525,
                     170620..170752,170851..170957,171122..171385,
                     171851..172045))
                     /locus_tag="AT3G01450"
                     /gene_synonym="T13O15.9"
                     /gene_synonym="T13O15_9"
                     /product="ARM repeat superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL066597.1,INSD:ES161570.1,INSD:BP843669.1,
                     INSD:EH949252.1,INSD:DR280319.1,INSD:AV561196.1,
                     INSD:EL996202.1,INSD:DR380583.1,INSD:T45306.1,
                     INSD:EL999022.1,INSD:ES181809.1,INSD:EH974923.1,
                     INSD:ES118382.1,INSD:EH848516.1,INSD:AI992814.1,
                     INSD:AV816604.1,INSD:T20508.1,INSD:BP858203.1,
                     INSD:ES116162.1,INSD:BP801471.1,INSD:EL148304.1,
                     INSD:ES160190.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK229809.1,INSD:AY085049.1,INSD:BT025879.1,
                     INSD:AK230429.1"
                     /db_xref="TAIR:AT3G01450"
                     /db_xref="Araport:AT3G01450"
     mRNA            complement(join(169597..170190,170331..170525,
                     170620..170752,170851..170957,171122..171385,
                     171659..172045))
                     /locus_tag="AT3G01450"
                     /gene_synonym="T13O15.9"
                     /gene_synonym="T13O15_9"
                     /product="ARM repeat superfamily protein"
                     /db_xref="Araport:AT3G01450"
                     /db_xref="TAIR:AT3G01450"
     CDS             complement(join(169903..170190,170331..170525,
                     170620..170752,170851..170957,171122..171379))
                     /locus_tag="AT3G01450"
                     /gene_synonym="T13O15.9"
                     /gene_synonym="T13O15_9"
                     /codon_start=1
                     /product="ARM repeat superfamily protein"
                     /protein_id="ANM65733.1"
                     /db_xref="Araport:AT3G01450"
                     /db_xref="TAIR:AT3G01450"
                     /translation="MAAKALKDLKNLPVSERNIDYKTKLLVGKMNGTAEDKPPQNSVP
                     FDHNHPKGDEIEKPEAERVIVEIEYIESKDLNNVTQVDAVLKSLVTELDSKDWVLVCD
                     ALNTIRRLSIFHKEEMLHMLEKVILFIVKSLKNPRSAVSKTACMTSADIFSSYNDHTI
                     DQLDLLLTQLLLKSSQDKRFVCEAAEKALVAMTAHVSPALLLPKLQPFLKNRNPRIRA
                     KASTCFSRCVPRLGIEGIREYGIEKLVQAASSQLSDQLPESREAARAVLLELQTVYKK
                     TTNVEPKEEHPEPVTWQIFCQSNLSPLSAQAVIRVTNVAGVAREGLVAGS"
     CDS             complement(join(169903..170190,170331..170525,
                     170620..170752,170851..170957,171122..171379))
                     /locus_tag="AT3G01450"
                     /gene_synonym="T13O15.9"
                     /gene_synonym="T13O15_9"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL066597.1,INSD:ES161570.1,INSD:BP843669.1,
                     INSD:EH949252.1,INSD:DR280319.1,INSD:AV561196.1,
                     INSD:EL996202.1,INSD:DR380583.1,INSD:T45306.1,
                     INSD:EL999022.1,INSD:ES181809.1,INSD:EH974923.1,
                     INSD:ES118382.1,INSD:EH848516.1,INSD:AI992814.1,
                     INSD:AV816604.1,INSD:T20508.1,INSD:BP858203.1,
                     INSD:ES116162.1,INSD:BP801471.1,INSD:EL148304.1,
                     INSD:ES160190.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK229809.1,INSD:AY085049.1,INSD:BT025879.1,
                     INSD:AK230429.1"
                     /note="ARM repeat superfamily protein; FUNCTIONS IN:
                     binding; INVOLVED IN: biological_process unknown; LOCATED
                     IN: cellular_component unknown; CONTAINS InterPro
                     DOMAIN/s: HEAT, type 2 (InterPro:IPR021133),
                     Armadillo-type fold (InterPro:IPR016024); BEST Arabidopsis
                     thaliana protein match is: ARM repeat superfamily protein
                     (TAIR:AT5G14790.1); Has 261 Blast hits to 260 proteins in
                     82 species: Archae - 0; Bacteria - 0; Metazoa - 99; Fungi
                     - 10; Plants - 111; Viruses - 0; Other Eukaryotes - 41
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="ARM repeat superfamily protein"
                     /protein_id="AEE73668.1"
                     /db_xref="TAIR:AT3G01450"
                     /db_xref="Araport:AT3G01450"
                     /translation="MAAKALKDLKNLPVSERNIDYKTKLLVGKMNGTAEDKPPQNSVP
                     FDHNHPKGDEIEKPEAERVIVEIEYIESKDLNNVTQVDAVLKSLVTELDSKDWVLVCD
                     ALNTIRRLSIFHKEEMLHMLEKVILFIVKSLKNPRSAVSKTACMTSADIFSSYNDHTI
                     DQLDLLLTQLLLKSSQDKRFVCEAAEKALVAMTAHVSPALLLPKLQPFLKNRNPRIRA
                     KASTCFSRCVPRLGIEGIREYGIEKLVQAASSQLSDQLPESREAARAVLLELQTVYKK
                     TTNVEPKEEHPEPVTWQIFCQSNLSPLSAQAVIRVTNVAGVAREGLVAGS"
     gene            173190..182454
                     /gene="MBD9"
                     /locus_tag="AT3G01460"
                     /gene_synonym="ATMBD9"
                     /gene_synonym="methyl-CPG-binding domain 9"
                     /gene_synonym="T13O15.10"
                     /gene_synonym="T13O15_10"
                     /note="Encodes a protein with a methyl-CpG-binding domain.
                     Has sequence similarity to human MBD proteins. Involved in
                     the modification of the FLC chromatin acetylation state to
                     affect FLC expression. Mutants show an early flowering,
                     and enhanced shoot branching phenotypes."
                     /db_xref="Araport:AT3G01460"
                     /db_xref="TAIR:AT3G01460"
     mRNA            join(173190..173830,174254..174941,175032..176144,
                     176250..176930,177318..177620,177821..178156,
                     178510..178608,178962..179396,179584..181635,
                     181730..182454)
                     /gene="MBD9"
                     /locus_tag="AT3G01460"
                     /gene_synonym="ATMBD9"
                     /gene_synonym="methyl-CPG-binding domain 9"
                     /gene_synonym="T13O15.10"
                     /gene_synonym="T13O15_10"
                     /product="methyl-CPG-binding domain 9"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AI995518.1,INSD:EL330329.1,INSD:AV529938.1,
                     INSD:CD533698.1,INSD:AV547756.1,INSD:CD534185.1,
                     INSD:BE526698.1,INSD:T43427.1,INSD:EH941628.1,
                     INSD:AV551791.1,INSD:EL980535.1,INSD:AV539612.1,
                     INSD:EL010738.1,INSD:BE524167.1,INSD:BE524168.1,
                     INSD:AV539367.1,INSD:CB518269.1,INSD:ES124976.1,
                     INSD:AV548906.1,INSD:AV546133.1,INSD:ES082180.1,
                     INSD:EH994125.1,INSD:AV530089.1,INSD:EH915085.1,
                     INSD:AV524103.1,INSD:ES155717.1,INSD:EL064697.1,
                     INSD:BU636361.1,INSD:BP822774.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:BX822537.1"
                     /db_xref="TAIR:AT3G01460"
                     /db_xref="Araport:AT3G01460"
     CDS             join(173316..173830,174254..174941,175032..176144,
                     176250..176930,177318..177620,177821..178156,
                     178510..178608,178962..179396,179584..181635,
                     181730..182038)
                     /gene="MBD9"
                     /locus_tag="AT3G01460"
                     /gene_synonym="ATMBD9"
                     /gene_synonym="methyl-CPG-binding domain 9"
                     /gene_synonym="T13O15.10"
                     /gene_synonym="T13O15_10"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AI995518.1,INSD:EL330329.1,INSD:AV529938.1,
                     INSD:CD533698.1,INSD:AV547756.1,INSD:CD534185.1,
                     INSD:BE526698.1,INSD:T43427.1,INSD:EH941628.1,
                     INSD:AV551791.1,INSD:EL980535.1,INSD:AV539612.1,
                     INSD:EL010738.1,INSD:BE524167.1,INSD:BE524168.1,
                     INSD:AV539367.1,INSD:CB518269.1,INSD:ES124976.1,
                     INSD:AV548906.1,INSD:AV546133.1,INSD:ES082180.1,
                     INSD:EH994125.1,INSD:AV530089.1,INSD:EH915085.1,
                     INSD:AV524103.1,INSD:ES155717.1,INSD:EL064697.1,
                     INSD:BU636361.1,INSD:BP822774.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:BX822537.1"
                     /note="methyl-CPG-binding domain 9 (MBD9); FUNCTIONS IN:
                     methyl-CpG binding, DNA binding; INVOLVED IN:
                     photoperiodism, flowering, secondary shoot formation,
                     regulation of transcription, DNA-dependent; LOCATED IN:
                     nucleus; EXPRESSED IN: 23 plant structures; EXPRESSED
                     DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Zinc
                     finger, PHD-type, conserved site (InterPro:IPR019786),
                     Zinc finger, RING-type (InterPro:IPR001841), FY-rich,
                     C-terminal (InterPro:IPR003889), Zinc finger, PHD-type
                     (InterPro:IPR001965), FY-rich, N-terminal
                     (InterPro:IPR003888), DNA-binding, integrase-type
                     (InterPro:IPR016177), Zinc finger, FYVE/PHD-type
                     (InterPro:IPR011011), Methyl-CpG DNA binding
                     (InterPro:IPR001739), Zinc finger, PHD-finger
                     (InterPro:IPR019787); BEST Arabidopsis thaliana protein
                     match is: RING/FYVE/PHD-type zinc finger family protein
                     (TAIR:AT1G77250.1); Has 6416 Blast hits to 3988 proteins
                     in 224 species: Archae - 0; Bacteria - 0; Metazoa - 4085;
                     Fungi - 602; Plants - 1260; Viruses - 0; Other Eukaryotes
                     - 469 (source: NCBI BLink)."
                     /codon_start=1
                     /product="methyl-CPG-binding domain 9"
                     /protein_id="AEE73669.1"
                     /db_xref="TAIR:AT3G01460"
                     /db_xref="Araport:AT3G01460"
                     /translation="MEPTDSTNEQLGDTKTAAVKEESRSFLGIDLNEIPTGATLGGGC
                     TAGQDDDGEYEPVEVVRSIHDNPDPAPGAPAEVPEPDRDASCGACGRPESIELVVVCD
                     ACERGFHMSCVNDGVEAAPSADWMCSDCRTGGERSKLWPLGVKSKLILDMNASPPSDA
                     EGYGAEETSDSRKHMLASSSCIGNSFDYAMMHSSFSSLGRGHASLEASGLMSRNTKMS
                     MDALGSHNLGFGFPLNLNNSSLPMRFPSLDPSELFLQNLRHFISERHGVLEDGWRVEF
                     RQPLNGYQLCAVYCAPNGKTFSSIQEVACYLGLAINGNYSCMDAEIRNENSLLQERLH
                     TPKRRKTSRWPNNGFPEQKGSSVSAQLRRFPFNGQTMSPFAVKSGTHFQAGGSLSSGN
                     NGCGCEEAKNGCPMQFEDFFVLSLGRIDIRQSYHNVNVIYPIGYKSCWHDKITGSLFT
                     CEVSDGNSGPIFKVTRSPCSKSFIPAGSTVFSCPKIDEMVEQNSDKLSNRRDSTQERD
                     DDASVEILLSEHCPPLGDDILSCLREKSFSKTVNSLRSEVDSSRVDFDKNLSYDQDHG
                     VEIGDIVVEEDSLSDAWKKVSQKLVDACSIVLKQKGTLNFLCKHVDRETSEINWDTMN
                     EKDNVILSLSKFCCSLAPCSVTCGEKDKSEFAAVVDALSRWLDQNRFGLDADFVQEMI
                     EHMPGAESCTNYRTLKSRSSSSVPITVAEGALVVKPKGGENVKDEVFGEISRKAKKPK
                     LNGGHGVRNLHPPPGRPMCLRLPPGLVGDFLQVSEVFWRFHEILGFEEAFSPENLEQE
                     LINPVFDGLFLDKPGKDDKRSEINFTDKDSTATKLFSLFDESRQPFPAKNTSASELKE
                     KKAGDSSDFKISDSSRGSCVGALLTRAHISLLQVLICELQSKVAAFVDPNFDSGESRS
                     RRGRKKDDSTLSAKRNKLHMLPVNEFTWPELARRYILSLLSMDGNLESAEIAARESGK
                     VFRCLQGDGGLLCGSLTGVAGMEADSMLLAEAIKKISGSLTSENDVLSVEDDDSDGLD
                     ATETNTCSGDIPEWAQVLEPVKKLPTNVGTRIRKCVYEALERNPPEWAKKILEHSISK
                     EIYKGNASGPTKKAVLSLLADIRGGDLVQRSIKGTKKRTYISVSDVIMKKCRAVLRGV
                     AAADEDKVLCTLLGRKLLNSSDNDDDGLLGSPAMVSRPLDFRTIDLRLAAGAYDGSTE
                     AFLEDVLELWSSIRVMYADQPDCVDLVATLSEKFKSLYEAEVVPLVQKLKDYRKLECL
                     SAEMKKEIKDIVVSVNKLPKAPWDEGVCKVCGVDKDDDSVLLCDTCDAEYHTYCLNPP
                     LIRIPDGNWYCPSCVIAKRMAQEALESYKLVRRRKGRKYQGELTRASMELTAHLADVM
                     EEKDYWEFSAEERILLLKLLCDELLSSSLVHQHLEQCAEAIIEMQQKLRSLSSEWKNA
                     KMRQEFLTAKLAKVEPSILKEVGEPHNSSYFADQMGCDPQPQEGVGDGVTRDDETSST
                     AYLNKNQGKSPLETDTQPGESHVNFGESKISSPETISSPGRHELPIADTSPLVTDNLP
                     EKDTSETLLKSVGRNHETHSPNSNAVELPTAHDASSQASQELQACQQDLSATSNEIQN
                     LQQSIRSIESQLLKQSIRRDFLGTDASGRLYWGCCFPDENPRILVDGSISLQKPVQAD
                     LIGSKVPSPFLHTVDHGRLRLSPWTYYETETEISELVQWLHDDDLKERDLRESILWWK
                     RLRYGDVQKEKKQAQNLSAPVFATGLETKAAMSMEKRYGPCIKLEMETLKKRGKKTKV
                     AEREKLCRCECLESILPSMIHCLICHKTFASDDEFEDHTESKCIPYSLATEEGKDISD
                     SSKAKESLKSDYLNVKSSAGKDVAEISNVSELDSGLIRYQEEESISPYHFEEICSKFV
                     TKDCNRDLVKEIGLISSNGIPTFLPSSSTHLNDSVLISAKSNKPDGGDSGDQVIFAGP
                     ETNVEGLNSESNMSFDRSVTDSHGGPLDKPSGLGFGFSEQKNKKSSGSGLKSCCVVPQ
                     AALKRVTGKALPGFRFLKTNLLDMDVALPEEALRPSKSHPNRRRAWRVFVKSSQSIYE
                     LVQATIVVEDMIKTEYLKNEWWYWSSLSAAAKISTLSALSVRIFSLDAAIIYDKPITP
                     SNPIDETKPIISLPDQKSQPVSDSQERSSRVRRSGKKRKEPEGS"
     gene            complement(182396..184403)
                     /gene="HB-1"
                     /locus_tag="AT3G01470"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 1"
                     /gene_synonym="ATHB-1"
                     /gene_synonym="ATHB1"
                     /gene_synonym="F4P13.2"
                     /gene_synonym="F4P13_2"
                     /gene_synonym="HAT5"
                     /gene_synonym="HD-ZIP-1"
                     /gene_synonym="homeobox 1"
                     /gene_synonym="HOMEODOMAIN PROTEIN FROM ARABIDOIPSIS
                     THALIANA 5"
                     /note="Encodes a homeodomain leucine zipper class I
                     (HD-Zip I) transcriptional activator involved in leaf
                     development."
                     /db_xref="Araport:AT3G01470"
                     /db_xref="TAIR:AT3G01470"
     mRNA            complement(join(182396..182998,183301..183540,
                     183628..183767,183947..184403))
                     /gene="HB-1"
                     /locus_tag="AT3G01470"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 1"
                     /gene_synonym="ATHB-1"
                     /gene_synonym="ATHB1"
                     /gene_synonym="F4P13.2"
                     /gene_synonym="F4P13_2"
                     /gene_synonym="HAT5"
                     /gene_synonym="HD-ZIP-1"
                     /gene_synonym="homeobox 1"
                     /gene_synonym="HOMEODOMAIN PROTEIN FROM ARABIDOIPSIS
                     THALIANA 5"
                     /product="homeobox 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL231664.1,INSD:AV519756.1,INSD:EL312439.1,
                     INSD:AV552349.1,INSD:CD531827.1,INSD:EH972323.1,
                     INSD:EH892020.1,INSD:EG467919.1,INSD:EL261428.1,
                     INSD:AV795885.1,INSD:EG467920.1,INSD:EH856621.1,
                     INSD:EL053174.1,INSD:BP632451.1,INSD:CD534515.1,
                     INSD:BP609161.1,INSD:EL289109.1,INSD:CD533700.1,
                     INSD:AV439953.1,INSD:AV539075.1,INSD:EH846345.1,
                     INSD:BP574544.1,INSD:AV548906.1,INSD:EL048261.1,
                     INSD:EL033456.1,INSD:EL052565.1,INSD:EH881900.1,
                     INSD:BP800357.1,INSD:BP634249.1,INSD:AV558145.1,
                     INSD:EH856770.1,INSD:BP599794.1,INSD:EL301364.1,
                     INSD:N37129.1,INSD:EL089084.1,INSD:EH902634.1,
                     INSD:H37532.1,INSD:AV441876.1,INSD:BP602688.1,
                     INSD:EL305125.1,INSD:CK119587.1,INSD:DR751603.1,
                     INSD:BP610019.1,INSD:AV547756.1,INSD:CD534185.1,
                     INSD:BP843921.1,INSD:EL333214.1,INSD:BP613699.1,
                     INSD:BP608313.1,INSD:BP789497.1,INSD:EH985153.1,
                     INSD:EL001953.1,INSD:BP569833.1,INSD:EL172361.1,
                     INSD:EL323783.1,INSD:BP600575.1,INSD:EL043243.1,
                     INSD:BP852598.1,INSD:EH873870.1,INSD:EL227848.1,
                     INSD:EH859321.1,INSD:AV546133.1,INSD:AI997961.1,
                     INSD:BP788785.1,INSD:BX840984.1,INSD:DR751610.1,
                     INSD:AA713131.1,INSD:EL166363.1,INSD:BP605611.1,
                     INSD:AV797096.1,INSD:BU636361.1,INSD:AV815371.1,
                     INSD:EL013676.1,INSD:EL252257.1,INSD:BP634248.1,
                     INSD:N65401.1,INSD:T42311.1,INSD:AV551422.1,
                     INSD:BP852220.1,INSD:AV521515.1,INSD:BP614211.1,
                     INSD:T88663.1,INSD:EH944013.1,INSD:EL030681.1,
                     INSD:AV813420.1,INSD:DR278241.1,INSD:BP601037.1,
                     INSD:CD533698.1,INSD:BP615266.1,INSD:EL208966.1,
                     INSD:BP620441.1,INSD:BP576742.1,INSD:CD532303.1,
                     INSD:EL330120.1,INSD:EL192623.1,INSD:EL161153.1,
                     INSD:EG457822.1,INSD:DR278240.1,INSD:BP603040.1,
                     INSD:BP803921.1,INSD:BP610073.1,INSD:EH897075.1,
                     INSD:EL172868.1,INSD:AA395012.1,INSD:EL261107.1,
                     INSD:EL075913.1,INSD:AV524103.1,INSD:EL112787.1,
                     INSD:EG458038.1,INSD:DR382911.1,INSD:BP798732.1,
                     INSD:EL025857.1,INSD:EL245643.1,INSD:CB254248.1,
                     INSD:BP617675.1,INSD:EL133100.1,INSD:EL160387.1,
                     INSD:T42837.1,INSD:DR751611.1,INSD:AV564536.1,
                     INSD:AV539612.1,INSD:BP583928.1,INSD:EH869561.1,
                     INSD:EL339416.1,INSD:AV519253.1,INSD:EL192506.1,
                     INSD:AV819290.1,INSD:T23024.1,INSD:AI099655.1,
                     INSD:EL019347.1,INSD:EH798720.1,INSD:H37330.1,
                     INSD:CD528958.1,INSD:AV519469.1,INSD:EL080180.1,
                     INSD:BP613231.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX823491.1,INSD:AY098972.1,INSD:BX822367.1,
                     INSD:BX823237.1,INSD:AY058188.1,INSD:X58821.1,
                     INSD:M90416.1"
                     /db_xref="TAIR:AT3G01470"
                     /db_xref="Araport:AT3G01470"
     CDS             complement(join(182648..182998,183301..183540,
                     183628..183767,183947..184034))
                     /gene="HB-1"
                     /locus_tag="AT3G01470"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 1"
                     /gene_synonym="ATHB-1"
                     /gene_synonym="ATHB1"
                     /gene_synonym="F4P13.2"
                     /gene_synonym="F4P13_2"
                     /gene_synonym="HAT5"
                     /gene_synonym="HD-ZIP-1"
                     /gene_synonym="homeobox 1"
                     /gene_synonym="HOMEODOMAIN PROTEIN FROM ARABIDOIPSIS
                     THALIANA 5"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL231664.1,INSD:AV519756.1,INSD:EL312439.1,
                     INSD:AV552349.1,INSD:CD531827.1,INSD:EH972323.1,
                     INSD:EH892020.1,INSD:EG467919.1,INSD:EL261428.1,
                     INSD:AV795885.1,INSD:EG467920.1,INSD:EH856621.1,
                     INSD:EL053174.1,INSD:BP632451.1,INSD:CD534515.1,
                     INSD:BP609161.1,INSD:EL289109.1,INSD:CD533700.1,
                     INSD:AV439953.1,INSD:AV539075.1,INSD:EH846345.1,
                     INSD:BP574544.1,INSD:AV548906.1,INSD:EL048261.1,
                     INSD:EL033456.1,INSD:EL052565.1,INSD:EH881900.1,
                     INSD:BP800357.1,INSD:BP634249.1,INSD:AV558145.1,
                     INSD:EH856770.1,INSD:BP599794.1,INSD:EL301364.1,
                     INSD:N37129.1,INSD:EL089084.1,INSD:EH902634.1,
                     INSD:H37532.1,INSD:AV441876.1,INSD:BP602688.1,
                     INSD:EL305125.1,INSD:CK119587.1,INSD:DR751603.1,
                     INSD:BP610019.1,INSD:AV547756.1,INSD:CD534185.1,
                     INSD:BP843921.1,INSD:EL333214.1,INSD:BP613699.1,
                     INSD:BP608313.1,INSD:BP789497.1,INSD:EH985153.1,
                     INSD:EL001953.1,INSD:BP569833.1,INSD:EL172361.1,
                     INSD:EL323783.1,INSD:BP600575.1,INSD:EL043243.1,
                     INSD:BP852598.1,INSD:EH873870.1,INSD:EL227848.1,
                     INSD:EH859321.1,INSD:AV546133.1,INSD:AI997961.1,
                     INSD:BP788785.1,INSD:BX840984.1,INSD:DR751610.1,
                     INSD:AA713131.1,INSD:EL166363.1,INSD:BP605611.1,
                     INSD:AV797096.1,INSD:BU636361.1,INSD:AV815371.1,
                     INSD:EL013676.1,INSD:EL252257.1,INSD:BP634248.1,
                     INSD:N65401.1,INSD:T42311.1,INSD:AV551422.1,
                     INSD:BP852220.1,INSD:AV521515.1,INSD:BP614211.1,
                     INSD:T88663.1,INSD:EH944013.1,INSD:EL030681.1,
                     INSD:AV813420.1,INSD:DR278241.1,INSD:BP601037.1,
                     INSD:CD533698.1,INSD:BP615266.1,INSD:EL208966.1,
                     INSD:BP620441.1,INSD:BP576742.1,INSD:CD532303.1,
                     INSD:EL330120.1,INSD:EL192623.1,INSD:EL161153.1,
                     INSD:EG457822.1,INSD:DR278240.1,INSD:BP603040.1,
                     INSD:BP803921.1,INSD:BP610073.1,INSD:EH897075.1,
                     INSD:EL172868.1,INSD:AA395012.1,INSD:EL261107.1,
                     INSD:EL075913.1,INSD:AV524103.1,INSD:EL112787.1,
                     INSD:EG458038.1,INSD:DR382911.1,INSD:BP798732.1,
                     INSD:EL025857.1,INSD:EL245643.1,INSD:CB254248.1,
                     INSD:BP617675.1,INSD:EL133100.1,INSD:EL160387.1,
                     INSD:T42837.1,INSD:DR751611.1,INSD:AV564536.1,
                     INSD:AV539612.1,INSD:BP583928.1,INSD:EH869561.1,
                     INSD:EL339416.1,INSD:AV519253.1,INSD:EL192506.1,
                     INSD:AV819290.1,INSD:T23024.1,INSD:AI099655.1,
                     INSD:EL019347.1,INSD:EH798720.1,INSD:H37330.1,
                     INSD:CD528958.1,INSD:AV519469.1,INSD:EL080180.1,
                     INSD:BP613231.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX823491.1,INSD:AY098972.1,INSD:BX822367.1,
                     INSD:BX823237.1,INSD:AY058188.1,INSD:X58821.1,
                     INSD:M90416.1"
                     /note="homeobox 1 (HB-1); FUNCTIONS IN: sequence-specific
                     DNA binding, DNA binding, transcription activator
                     activity, protein homodimerization activity,
                     sequence-specific DNA binding transcription factor
                     activity; INVOLVED IN: response to salt stress, response
                     to blue light, positive regulation of transcription,
                     regulation of transcription, DNA-dependent, leaf
                     morphogenesis; LOCATED IN: nucleus; EXPRESSED IN: stem,
                     fruit, root, flower, leaf; CONTAINS InterPro DOMAIN/s:
                     Homeobox, conserved site (InterPro:IPR017970), Homeobox
                     (InterPro:IPR001356), Homeodomain-like
                     (InterPro:IPR009057), Helix-turn-helix motif, lambda-like
                     repressor (InterPro:IPR000047), Leucine zipper,
                     homeobox-associated (InterPro:IPR003106),
                     Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis
                     thaliana protein match is: homeobox protein 16
                     (TAIR:AT4G40060.1); Has 12515 Blast hits to 12478 proteins
                     in 547 species: Archae - 0; Bacteria - 0; Metazoa - 9969;
                     Fungi - 258; Plants - 2039; Viruses - 5; Other Eukaryotes
                     - 244 (source: NCBI BLink)."
                     /codon_start=1
                     /product="homeobox 1"
                     /protein_id="AEE73670.1"
                     /db_xref="TAIR:AT3G01470"
                     /db_xref="Araport:AT3G01470"
                     /translation="MESNSFFFDPSASHGNSMFFLGNLNPVVQGGGARSMMNMEETSK
                     RRPFFSSPEDLYDDDFYDDQLPEKKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKL
                     GLQPRQVAVWFQNRRARWKTKQLERDYDLLKSTYDQLLSNYDSIVMDNDKLRSEVTSL
                     TEKLQGKQETANEPPGQVPEPNQLDPVYINAAAIKTEDRLSSGSVGSAVLDDDAPQLL
                     DSCDSYFPSIVPIQDNSNASDHDNDRSCFADVFVPTTSPSHDHHGESLAFWGWP"
     gene            182977..183321
                     /locus_tag="AT3G01035"
                     /note="Natural antisense transcript overlaps with
                     AT3G01470"
                     /db_xref="Araport:AT3G01035"
     ncRNA           182977..183321
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT3G01035"
                     /product="other RNA"
                     /db_xref="Araport:AT3G01035"
     gene            183289..183900
                     /locus_tag="AT3G01475"
                     /db_xref="Araport:AT3G01475"
     mRNA            join(183289..183455,183615..183741,183880..183900)
                     /locus_tag="AT3G01475"
                     /product="hypothetical protein"
                     /db_xref="Araport:AT3G01475"
     CDS             join(183289..183455,183615..183741,183880..183900)
                     /locus_tag="AT3G01475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="ANM65834.1"
                     /db_xref="Araport:AT3G01475"
                     /translation="MYKYLGSELIVVHDDGVVVRKKLVVSGLEKIVVSLKLFCFPTSS
                     AILKPDSHLPWLERIYLFGSEATLLFRQLVVVKVIVVEILRGAKEGPSLRSFLHGKFT
                     EK"
     misc_feature    complement(184155..184241)
                     /gene="HB-1"
                     /locus_tag="AT3G01470"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 1"
                     /gene_synonym="ATHB-1"
                     /gene_synonym="ATHB1"
                     /gene_synonym="F4P13.2"
                     /gene_synonym="F4P13_2"
                     /gene_synonym="HAT5"
                     /gene_synonym="HD-ZIP-1"
                     /gene_synonym="homeobox 1"
                     /gene_synonym="HOMEODOMAIN PROTEIN FROM ARABIDOIPSIS
                     THALIANA 5"
                     /note="AT3G01470.uORF1"
     gene            188321..190892
                     /gene="CYP38"
                     /locus_tag="AT3G01480"
                     /gene_synonym="ARABIDOPSIS CYCLOPHILIN 38"
                     /gene_synonym="ATCYP38"
                     /gene_synonym="cyclophilin 38"
                     /gene_synonym="F4P13.3"
                     /gene_synonym="F4P13_3"
                     /note="Encodes a chloroplast cyclophilin functioning in
                     the assembly and maintenance of photosystem II (PSII)
                     supercomplexes."
                     /db_xref="Araport:AT3G01480"
                     /db_xref="TAIR:AT3G01480"
     mRNA            join(188321..188709,189005..189298,189428..189627,
                     189741..189976,190056..190198,190285..190356,
                     190447..190892)
                     /gene="CYP38"
                     /locus_tag="AT3G01480"
                     /gene_synonym="ARABIDOPSIS CYCLOPHILIN 38"
                     /gene_synonym="ATCYP38"
                     /gene_synonym="cyclophilin 38"
                     /gene_synonym="F4P13.3"
                     /gene_synonym="F4P13_3"
                     /product="cyclophilin 38"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL136117.1,INSD:EH929089.1,INSD:EH842928.1,
                     INSD:AV441755.1,INSD:EG508836.1,INSD:BP781373.1,
                     INSD:EH830332.1,INSD:DR296556.1,INSD:ES086828.1,
                     INSD:CB262450.1,INSD:EL044295.1,INSD:ES118927.1,
                     INSD:EL116974.1,INSD:EL337440.1,INSD:DR296552.1,
                     INSD:EH880894.1,INSD:EL314360.1,INSD:EL989854.1,
                     INSD:EH967894.1,INSD:AV802274.1,INSD:EH801975.1,
                     INSD:EL014489.1,INSD:EL136489.1,INSD:EL289943.1,
                     INSD:EH875653.1,INSD:EL228570.1,INSD:EH823149.1,
                     INSD:EL259087.1,INSD:BP856616.1,INSD:EG508846.1,
                     INSD:EH859187.1,INSD:BP623389.1,INSD:BP650126.1,
                     INSD:EL139450.1,INSD:EH965253.1,INSD:EL030369.1,
                     INSD:ES007607.1,INSD:EH909802.1,INSD:AV822201.1,
                     INSD:EL197895.1,INSD:ES004018.1,INSD:DR296555.1,
                     INSD:EH872768.1,INSD:DR296553.1,INSD:EL082147.1,
                     INSD:EH838245.1,INSD:BP600218.1,INSD:EH994601.1,
                     INSD:EH800180.1,INSD:EL073939.1,INSD:EH881752.1,
                     INSD:EL209686.1,INSD:EL261162.1,INSD:AA395048.1,
                     INSD:EH855175.1,INSD:EH821110.1,INSD:EL293490.1,
                     INSD:EL228316.1,INSD:EH890113.1,INSD:EH872196.1,
                     INSD:EH973450.1,INSD:EH818220.1,INSD:EL282815.1,
                     INSD:EH950816.1,INSD:BP864914.1,INSD:EL204783.1,
                     INSD:EH802063.1,INSD:EL235209.1,INSD:EL092155.1,
                     INSD:BP847954.1,INSD:F14183.1,INSD:EH991050.1,
                     INSD:EH939816.1,INSD:EL151175.1,INSD:EH847658.1,
                     INSD:EL124633.1,INSD:EH856522.1,INSD:EL275164.1,
                     INSD:EL313606.1,INSD:ES142119.1,INSD:AA712374.1,
                     INSD:EL168661.1,INSD:BP790067.1,INSD:EL021497.1,
                     INSD:BP843868.1,INSD:EH892003.1,INSD:EL055550.1,
                     INSD:EL179318.1,INSD:EL242019.1,INSD:DR296554.1,
                     INSD:EL121815.1,INSD:EL220917.1,INSD:DR296551.1,
                     INSD:EL281942.1,INSD:BP834025.1,INSD:EL179303.1,
                     INSD:ES070132.1,INSD:BP807815.1,INSD:EH821014.1,
                     INSD:EL177777.1,INSD:EH959446.1,INSD:BP638504.1,
                     INSD:EL134457.1,INSD:AV797246.1,INSD:EL250938.1,
                     INSD:AV797448.1,INSD:EL063287.1,INSD:DR347998.1,
                     INSD:ES014923.1,INSD:EH799866.1,INSD:EL168548.1,
                     INSD:EL246315.1,INSD:EL111865.1,INSD:EH954078.1,
                     INSD:AV817020.1,INSD:EH901845.1,INSD:BP844903.1,
                     INSD:DR376400.1,INSD:BP782830.1,INSD:DR296550.1,
                     INSD:EL111983.1,INSD:EL335102.1,INSD:BP862711.1,
                     INSD:EL295772.1,INSD:EH900367.1,INSD:DR296549.1"
                     /db_xref="TAIR:AT3G01480"
                     /db_xref="Araport:AT3G01480"
     mRNA            join(188384..188709,189005..189298,189428..189627,
                     189741..189976,190056..190356,190447..190851)
                     /gene="CYP38"
                     /locus_tag="AT3G01480"
                     /gene_synonym="ARABIDOPSIS CYCLOPHILIN 38"
                     /gene_synonym="ATCYP38"
                     /gene_synonym="cyclophilin 38"
                     /gene_synonym="F4P13.3"
                     /gene_synonym="F4P13_3"
                     /product="cyclophilin 38"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AI992965.1,INSD:EL136117.1,INSD:EH929089.1,
                     INSD:EH842928.1,INSD:AV441755.1,INSD:EG508836.1,
                     INSD:BP781373.1,INSD:BP624614.1,INSD:EH830332.1,
                     INSD:DR296556.1,INSD:AV439942.1,INSD:ES086828.1,
                     INSD:CB262450.1,INSD:EL044295.1,INSD:ES118927.1,
                     INSD:EL116974.1,INSD:EL337440.1,INSD:DR296552.1,
                     INSD:AV789352.1,INSD:EL314360.1,INSD:EL989854.1,
                     INSD:AV802274.1,INSD:EH967894.1,INSD:EH801975.1,
                     INSD:EL014489.1,INSD:EL136489.1,INSD:EL289943.1,
                     INSD:EH875653.1,INSD:EL228570.1,INSD:EH823149.1,
                     INSD:EL259087.1,INSD:BP856616.1,INSD:ES158738.1,
                     INSD:EH859187.1,INSD:BP623389.1,INSD:BP650126.1,
                     INSD:EL139450.1,INSD:EH965253.1,INSD:EL030369.1,
                     INSD:ES007607.1,INSD:EH909802.1,INSD:AV822201.1,
                     INSD:EL197895.1,INSD:ES004018.1,INSD:DR296555.1,
                     INSD:EH872768.1,INSD:AV791225.1,INSD:DR296553.1,
                     INSD:EL082147.1,INSD:EH838245.1,INSD:BP600218.1,
                     INSD:EH994601.1,INSD:EH800180.1,INSD:EL073939.1,
                     INSD:EH881752.1,INSD:EL209686.1,INSD:EL261162.1,
                     INSD:AA395048.1,INSD:EH855175.1,INSD:EH821110.1,
                     INSD:EL293490.1,INSD:EL228316.1,INSD:EH890113.1,
                     INSD:EL063024.1,INSD:EH872196.1,INSD:EH973450.1,
                     INSD:EH818220.1,INSD:EL282815.1,INSD:EH950816.1,
                     INSD:BP864914.1,INSD:EL204783.1,INSD:EH802063.1,
                     INSD:EL235209.1,INSD:EL092155.1,INSD:BP847954.1,
                     INSD:F14183.1,INSD:EH991050.1,INSD:EH939816.1,
                     INSD:EL151175.1,INSD:EH847658.1,INSD:EL124633.1,
                     INSD:EH856522.1,INSD:EL275164.1,INSD:EL313606.1,
                     INSD:ES142119.1,INSD:AA712374.1,INSD:DR376199.1,
                     INSD:EL168661.1,INSD:BP790067.1,INSD:EL021497.1,
                     INSD:BP843868.1,INSD:EH892003.1,INSD:EL055550.1,
                     INSD:EL179318.1,INSD:EL242019.1,INSD:DR296554.1,
                     INSD:EL121815.1,INSD:EL220917.1,INSD:DR296551.1,
                     INSD:EL281942.1,INSD:BP790282.1,INSD:BP834025.1,
                     INSD:EL179303.1,INSD:ES070132.1,INSD:BP807815.1,
                     INSD:EH821014.1,INSD:EL177777.1,INSD:EH959446.1,
                     INSD:BP638504.1,INSD:AV797246.1,INSD:EL134457.1,
                     INSD:EL250938.1,INSD:AV797448.1,INSD:AV782892.1,
                     INSD:EL063287.1,INSD:DR347998.1,INSD:ES014923.1,
                     INSD:EH799866.1,INSD:EL168548.1,INSD:DR296557.1,
                     INSD:EL246315.1,INSD:T43100.1,INSD:AV817020.1,
                     INSD:EH954078.1,INSD:EL111865.1,INSD:EH901845.1,
                     INSD:BP844903.1,INSD:DR376400.1,INSD:BP782830.1,
                     INSD:DR296550.1,INSD:EL111983.1,INSD:EL335102.1,
                     INSD:BP862711.1,INSD:EL295772.1,INSD:EH900367.1,
                     INSD:DR296549.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY568524.1,INSD:BX823215.1,INSD:AY087781.1,
                     INSD:AY039843.1,INSD:AY113168.1"
                     /db_xref="TAIR:AT3G01480"
                     /db_xref="Araport:AT3G01480"
     CDS             join(188569..188709,189005..189298,189428..189627,
                     189741..189976,190056..190198,190285..190356,
                     190447..190674)
                     /gene="CYP38"
                     /locus_tag="AT3G01480"
                     /gene_synonym="ARABIDOPSIS CYCLOPHILIN 38"
                     /gene_synonym="ATCYP38"
                     /gene_synonym="cyclophilin 38"
                     /gene_synonym="F4P13.3"
                     /gene_synonym="F4P13_3"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AI992965.1,INSD:EL136117.1,INSD:EH929089.1,
                     INSD:EH842928.1,INSD:AV441755.1,INSD:EG508836.1,
                     INSD:BP781373.1,INSD:BP624614.1,INSD:EH830332.1,
                     INSD:DR296556.1,INSD:AV439942.1,INSD:ES086828.1,
                     INSD:CB262450.1,INSD:EL044295.1,INSD:ES118927.1,
                     INSD:EL116974.1,INSD:EL337440.1,INSD:DR296552.1,
                     INSD:AV789352.1,INSD:EL314360.1,INSD:EL989854.1,
                     INSD:AV802274.1,INSD:EH967894.1,INSD:EH801975.1,
                     INSD:EL014489.1,INSD:EL136489.1,INSD:EL289943.1,
                     INSD:EH875653.1,INSD:EL228570.1,INSD:EH823149.1,
                     INSD:EL259087.1,INSD:BP856616.1,INSD:ES158738.1,
                     INSD:EH859187.1,INSD:BP623389.1,INSD:BP650126.1,
                     INSD:EL139450.1,INSD:EH965253.1,INSD:EL030369.1,
                     INSD:ES007607.1,INSD:EH909802.1,INSD:AV822201.1,
                     INSD:EL197895.1,INSD:ES004018.1,INSD:DR296555.1,
                     INSD:EH872768.1,INSD:AV791225.1,INSD:DR296553.1,
                     INSD:EL082147.1,INSD:EH838245.1,INSD:BP600218.1,
                     INSD:EH994601.1,INSD:EH800180.1,INSD:EL073939.1,
                     INSD:EH881752.1,INSD:EL209686.1,INSD:EL261162.1,
                     INSD:AA395048.1,INSD:EH855175.1,INSD:EH821110.1,
                     INSD:EL293490.1,INSD:EL228316.1,INSD:EH890113.1,
                     INSD:EL063024.1,INSD:EH872196.1,INSD:EH973450.1,
                     INSD:EH818220.1,INSD:EL282815.1,INSD:EH950816.1,
                     INSD:BP864914.1,INSD:EL204783.1,INSD:EH802063.1,
                     INSD:EL235209.1,INSD:EL092155.1,INSD:BP847954.1,
                     INSD:F14183.1,INSD:EH991050.1,INSD:EH939816.1,
                     INSD:EL151175.1,INSD:EH847658.1,INSD:EL124633.1,
                     INSD:EH856522.1,INSD:EL275164.1,INSD:EL313606.1,
                     INSD:ES142119.1,INSD:AA712374.1,INSD:DR376199.1,
                     INSD:EL168661.1,INSD:BP790067.1,INSD:EL021497.1,
                     INSD:BP843868.1,INSD:EH892003.1,INSD:EL055550.1,
                     INSD:EL179318.1,INSD:EL242019.1,INSD:DR296554.1,
                     INSD:EL121815.1,INSD:EL220917.1,INSD:DR296551.1,
                     INSD:EL281942.1,INSD:BP790282.1,INSD:BP834025.1,
                     INSD:EL179303.1,INSD:ES070132.1,INSD:BP807815.1,
                     INSD:EH821014.1,INSD:EL177777.1,INSD:EH959446.1,
                     INSD:BP638504.1,INSD:AV797246.1,INSD:EL134457.1,
                     INSD:EL250938.1,INSD:AV797448.1,INSD:AV782892.1,
                     INSD:EL063287.1,INSD:DR347998.1,INSD:ES014923.1,
                     INSD:EH799866.1,INSD:EL168548.1,INSD:DR296557.1,
                     INSD:EL246315.1,INSD:T43100.1,INSD:AV817020.1,
                     INSD:EH954078.1,INSD:EL111865.1,INSD:EH901845.1,
                     INSD:BP844903.1,INSD:DR376400.1,INSD:BP782830.1,
                     INSD:DR296550.1,INSD:EL111983.1,INSD:EL335102.1,
                     INSD:BP862711.1,INSD:EL295772.1,INSD:EH900367.1,
                     INSD:DR296549.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY568524.1,INSD:BX823215.1,INSD:AY087781.1,
                     INSD:AY039843.1,INSD:AY113168.1"
                     /note="cyclophilin 38 (CYP38); FUNCTIONS IN:
                     peptidyl-prolyl cis-trans isomerase activity; INVOLVED IN:
                     protein folding, photosystem II assembly, photosystem II
                     stabilization, defense response to bacterium; LOCATED IN:
                     in 6 components; EXPRESSED IN: 25 plant structures;
                     EXPRESSED DURING: 14 growth stages; CONTAINS InterPro
                     DOMAIN/s: Cyclophilin-like (InterPro:IPR015891),
                     Peptidyl-prolyl cis-trans isomerase, cyclophilin-type
                     (InterPro:IPR002130); BEST Arabidopsis thaliana protein
                     match is: Cyclophilin-like peptidyl-prolyl cis-trans
                     isomerase family protein (TAIR:AT3G15520.1); Has 2157
                     Blast hits to 2154 proteins in 676 species: Archae - 40;
                     Bacteria - 1435; Metazoa - 59; Fungi - 19; Plants - 86;
                     Viruses - 0; Other Eukaryotes - 518 (source: NCBI BLink)."
                     /codon_start=1
                     /product="cyclophilin 38"
                     /protein_id="AEE73672.1"
                     /db_xref="TAIR:AT3G01480"
                     /db_xref="Araport:AT3G01480"
                     /translation="MAAAFASLPTFSVVNSSRFPRRRIGFSCSKKPLEVRCSSGNTRY
                     TKQRGAFTSLKECAISLALSVGLMVSVPSIALPPNAHAVANPVIPDVSVLISGPPIKD
                     PEALLRYALPIDNKAIREVQKPLEDITDSLKIAGVKALDSVERNVRQASRTLQQGKSI
                     IVAGFAESKKDHGNEMIEKLEAGMQDMLKIVEDRKRDAVAPKQKEILKYVGGIEEDMV
                     DGFPYEVPEEYRNMPLLKGRASVDMKVKIKDNPNIEDCVFRIVLDGYNAPVTAGNFVD
                     LVERHFYDGMEIQRSDGFVVQTGDPEGPAEGFIDPSTEKTRTVPLEIMVTGEKTPFYG
                     STLEELGLYKAQVVIPFNAFGTMAMAREEFENDSGSSQVFWLLKESELTPSNSNILDG
                     RYAVFGYVTDNEDFLADLKVGDVIESIQVVSGLENLANPSYKIAG"
     CDS             join(188569..188709,189005..189298,189428..189627,
                     189741..189976,190056..190252)
                     /gene="CYP38"
                     /locus_tag="AT3G01480"
                     /gene_synonym="ARABIDOPSIS CYCLOPHILIN 38"
                     /gene_synonym="ATCYP38"
                     /gene_synonym="cyclophilin 38"
                     /gene_synonym="F4P13.3"
                     /gene_synonym="F4P13_3"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL136117.1,INSD:EH929089.1,INSD:EH842928.1,
                     INSD:AV441755.1,INSD:EG508836.1,INSD:BP781373.1,
                     INSD:EH830332.1,INSD:DR296556.1,INSD:ES086828.1,
                     INSD:CB262450.1,INSD:EL044295.1,INSD:ES118927.1,
                     INSD:EL116974.1,INSD:EL337440.1,INSD:DR296552.1,
                     INSD:EH880894.1,INSD:EL314360.1,INSD:EL989854.1,
                     INSD:EH967894.1,INSD:AV802274.1,INSD:EH801975.1,
                     INSD:EL014489.1,INSD:EL136489.1,INSD:EL289943.1,
                     INSD:EH875653.1,INSD:EL228570.1,INSD:EH823149.1,
                     INSD:EL259087.1,INSD:BP856616.1,INSD:EG508846.1,
                     INSD:EH859187.1,INSD:BP623389.1,INSD:BP650126.1,
                     INSD:EL139450.1,INSD:EH965253.1,INSD:EL030369.1,
                     INSD:ES007607.1,INSD:EH909802.1,INSD:AV822201.1,
                     INSD:EL197895.1,INSD:ES004018.1,INSD:DR296555.1,
                     INSD:EH872768.1,INSD:DR296553.1,INSD:EL082147.1,
                     INSD:EH838245.1,INSD:BP600218.1,INSD:EH994601.1,
                     INSD:EH800180.1,INSD:EL073939.1,INSD:EH881752.1,
                     INSD:EL209686.1,INSD:EL261162.1,INSD:AA395048.1,
                     INSD:EH855175.1,INSD:EH821110.1,INSD:EL293490.1,
                     INSD:EL228316.1,INSD:EH890113.1,INSD:EH872196.1,
                     INSD:EH973450.1,INSD:EH818220.1,INSD:EL282815.1,
                     INSD:EH950816.1,INSD:BP864914.1,INSD:EL204783.1,
                     INSD:EH802063.1,INSD:EL235209.1,INSD:EL092155.1,
                     INSD:BP847954.1,INSD:F14183.1,INSD:EH991050.1,
                     INSD:EH939816.1,INSD:EL151175.1,INSD:EH847658.1,
                     INSD:EL124633.1,INSD:EH856522.1,INSD:EL275164.1,
                     INSD:EL313606.1,INSD:ES142119.1,INSD:AA712374.1,
                     INSD:EL168661.1,INSD:BP790067.1,INSD:EL021497.1,
                     INSD:BP843868.1,INSD:EH892003.1,INSD:EL055550.1,
                     INSD:EL179318.1,INSD:EL242019.1,INSD:DR296554.1,
                     INSD:EL121815.1,INSD:EL220917.1,INSD:DR296551.1,
                     INSD:EL281942.1,INSD:BP834025.1,INSD:EL179303.1,
                     INSD:ES070132.1,INSD:BP807815.1,INSD:EH821014.1,
                     INSD:EL177777.1,INSD:EH959446.1,INSD:BP638504.1,
                     INSD:EL134457.1,INSD:AV797246.1,INSD:EL250938.1,
                     INSD:AV797448.1,INSD:EL063287.1,INSD:DR347998.1,
                     INSD:ES014923.1,INSD:EH799866.1,INSD:EL168548.1,
                     INSD:EL246315.1,INSD:EL111865.1,INSD:EH954078.1,
                     INSD:AV817020.1,INSD:EH901845.1,INSD:BP844903.1,
                     INSD:DR376400.1,INSD:BP782830.1,INSD:DR296550.1,
                     INSD:EL111983.1,INSD:EL335102.1,INSD:BP862711.1,
                     INSD:EL295772.1,INSD:EH900367.1,INSD:DR296549.1"
                     /note="cyclophilin 38 (CYP38); FUNCTIONS IN:
                     peptidyl-prolyl cis-trans isomerase activity; INVOLVED IN:
                     protein folding, photosystem II assembly, photosystem II
                     stabilization, defense response to bacterium; LOCATED IN:
                     thylakoid, chloroplast thylakoid membrane, chloroplast
                     thylakoid lumen, chloroplast; EXPRESSED IN: 24 plant
                     structures; EXPRESSED DURING: 13 growth stages; CONTAINS
                     InterPro DOMAIN/s: Cyclophilin-like (InterPro:IPR015891),
                     Peptidyl-prolyl cis-trans isomerase, cyclophilin-type
                     (InterPro:IPR002130); BEST Arabidopsis thaliana protein
                     match is: Cyclophilin-like peptidyl-prolyl cis-trans
                     isomerase family protein (TAIR:AT3G15520.1); Has 30201
                     Blast hits to 17322 proteins in 780 species: Archae - 12;
                     Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants -
                     5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="cyclophilin 38"
                     /protein_id="AEE73673.1"
                     /db_xref="TAIR:AT3G01480"
                     /db_xref="Araport:AT3G01480"
                     /translation="MAAAFASLPTFSVVNSSRFPRRRIGFSCSKKPLEVRCSSGNTRY
                     TKQRGAFTSLKECAISLALSVGLMVSVPSIALPPNAHAVANPVIPDVSVLISGPPIKD
                     PEALLRYALPIDNKAIREVQKPLEDITDSLKIAGVKALDSVERNVRQASRTLQQGKSI
                     IVAGFAESKKDHGNEMIEKLEAGMQDMLKIVEDRKRDAVAPKQKEILKYVGGIEEDMV
                     DGFPYEVPEEYRNMPLLKGRASVDMKVKIKDNPNIEDCVFRIVLDGYNAPVTAGNFVD
                     LVERHFYDGMEIQRSDGFVVQTGDPEGPAEGFIDPSTEKTRTVPLEIMVTGEKTPFYG
                     STLEVSLSKSLLVRDLYYIVF"
     gene            complement(190831..193721)
                     /locus_tag="AT3G01490"
                     /gene_synonym="F4P13.4"
                     /gene_synonym="F4P13_4"
                     /db_xref="Araport:AT3G01490"
                     /db_xref="TAIR:AT3G01490"
     mRNA            complement(join(190831..191301,191405..191714,
                     191800..191996,192261..192382,192859..193721))
                     /locus_tag="AT3G01490"
                     /gene_synonym="F4P13.4"
                     /gene_synonym="F4P13_4"
                     /product="Protein kinase superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP791895.1,INSD:AV806573.1,INSD:DR381604.1,
                     INSD:EL295441.1,INSD:ES087859.1,INSD:EL046216.1,
                     INSD:AV805263.1,INSD:AV527768.1,INSD:EG480691.1,
                     INSD:ES035774.1,INSD:EL325057.1,INSD:EL228614.1,
                     INSD:BX836733.1,INSD:EL273048.1,INSD:EL001714.1,
                     INSD:BP630037.1,INSD:EH834218.1,INSD:CB074174.1,
                     INSD:EH807313.1,INSD:BP562405.2,INSD:AV829275.1,
                     INSD:AV439584.1,INSD:AV813872.1,INSD:EG480690.1,
                     INSD:EH960160.1,INSD:EL179978.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY136392.1,INSD:BX823719.1,INSD:AK227129.1,
                     INSD:AY057647.1,INSD:BT000206.1,INSD:BX824070.1"
                     /db_xref="TAIR:AT3G01490"
                     /db_xref="Araport:AT3G01490"
     mRNA            complement(join(190839..191714,191800..191996,
                     192261..192382,192859..193537))
                     /locus_tag="AT3G01490"
                     /gene_synonym="F4P13.4"
                     /gene_synonym="F4P13_4"
                     /product="Protein kinase superfamily protein"
                     /db_xref="Araport:AT3G01490"
                     /db_xref="TAIR:AT3G01490"
     CDS             complement(join(191095..191301,191405..191714,
                     191800..191996,192261..192382,192859..193258))
                     /locus_tag="AT3G01490"
                     /gene_synonym="F4P13.4"
                     /gene_synonym="F4P13_4"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP791895.1,INSD:AV806573.1,INSD:DR381604.1,
                     INSD:EL295441.1,INSD:ES087859.1,INSD:EL046216.1,
                     INSD:AV805263.1,INSD:AV527768.1,INSD:EG480691.1,
                     INSD:ES035774.1,INSD:EL325057.1,INSD:EL228614.1,
                     INSD:BX836733.1,INSD:EL273048.1,INSD:EL001714.1,
                     INSD:BP630037.1,INSD:EH834218.1,INSD:CB074174.1,
                     INSD:EH807313.1,INSD:BP562405.2,INSD:AV829275.1,
                     INSD:AV439584.1,INSD:AV813872.1,INSD:EG480690.1,
                     INSD:EH960160.1,INSD:EL179978.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY136392.1,INSD:BX823719.1,INSD:AK227129.1,
                     INSD:AY057647.1,INSD:BT000206.1,INSD:BX824070.1"
                     /note="Protein kinase superfamily protein; FUNCTIONS IN:
                     protein serine/threonine/tyrosine kinase activity, kinase
                     activity; INVOLVED IN: protein amino acid phosphorylation;
                     LOCATED IN: cellular_component unknown; EXPRESSED IN: 8
                     plant structures; EXPRESSED DURING: LP.06 six leaves
                     visible, 4 anthesis, petal differentiation and expansion
                     stage; CONTAINS InterPro DOMAIN/s: Protein kinase,
                     catalytic domain (InterPro:IPR000719),
                     Serine-threonine/tyrosine-protein kinase
                     (InterPro:IPR001245), Serine/threonine protein
                     kinase-like, ATMRK (InterPro:IPR015783), Protein
                     kinase-like domain (InterPro:IPR011009),
                     Serine/threonine-protein kinase, active site
                     (InterPro:IPR008271); BEST Arabidopsis thaliana protein
                     match is: Protein kinase superfamily protein
                     (TAIR:AT5G50000.1); Has 129107 Blast hits to 127633
                     proteins in 4815 species: Archae - 144; Bacteria - 13952;
                     Metazoa - 48674; Fungi - 11933; Plants - 33456; Viruses -
                     637; Other Eukaryotes - 20311 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Protein kinase superfamily protein"
                     /protein_id="AEE73674.1"
                     /db_xref="TAIR:AT3G01490"
                     /db_xref="Araport:AT3G01490"
                     /translation="MKEKAESGGGVGYVRADQIDLKSLDEQLQRHLSKAWTMEKRKSL
                     SDGEDNVNNTRHNQNNFGHRQLVFQRPLLGGGYSNNNNSSKNDIIRSTEVEKSRREWE
                     IDPSKLIIKSVIARGTFGTVHRGIYDGQDVAVKLLDWGEEGHRSDAEIASLRAAFTQE
                     VAVWHKLDHPNVTKFIGAAMGTSEMSIQTENGQMGMPSNVCCVVVEYCPGGALKSFLI
                     KTRRRKLAFKVVIQLSLDLARGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVAR
                     LEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFS
                     EVTSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPEKRPEMEEVVAMLEAIDTSKGGG
                     MIPPDQQQGCFCFRRHRGP"
     CDS             complement(join(191363..191714,191800..191996,
                     192261..192382,192859..193258))
                     /locus_tag="AT3G01490"
                     /gene_synonym="F4P13.4"
                     /gene_synonym="F4P13_4"
                     /codon_start=1
                     /product="Protein kinase superfamily protein"
                     /protein_id="ANM65914.1"
                     /db_xref="Araport:AT3G01490"
                     /db_xref="TAIR:AT3G01490"
                     /translation="MKEKAESGGGVGYVRADQIDLKSLDEQLQRHLSKAWTMEKRKSL
                     SDGEDNVNNTRHNQNNFGHRQLVFQRPLLGGGYSNNNNSSKNDIIRSTEVEKSRREWE
                     IDPSKLIIKSVIARGTFGTVHRGIYDGQDVAVKLLDWGEEGHRSDAEIASLRAAFTQE
                     VAVWHKLDHPNVTKFIGAAMGTSEMSIQTENGQMGMPSNVCCVVVEYCPGGALKSFLI
                     KTRRRKLAFKVVIQLSLDLARGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVAR
                     LEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFS
                     EVTSAVVRQVFQNDLFNYPFRN"
     gene            complement(194426..198664)
                     /gene="CA1"
                     /locus_tag="AT3G01500"
                     /gene_synonym="ARABIDOPSIS THALIANA SALICYLIC ACID-BINDING
                     PROTEIN 3"
                     /gene_synonym="ATBCA1"
                     /gene_synonym="ATSABP3"
                     /gene_synonym="BETA CARBONIC ANHYDRASE 1"
                     /gene_synonym="carbonic anhydrase 1"
                     /gene_synonym="F4P13.5"
                     /gene_synonym="F4P13_5"
                     /gene_synonym="SABP3"
                     /gene_synonym="SALICYLIC ACID-BINDING PROTEIN 3"
                     /note="Encodes a putative beta-carbonic anhydrase betaCA1.
                     Together with betaCA4 (At1g70410) regulates CO2-controlled
                     stomatal movements in guard cells."
                     /db_xref="Araport:AT3G01500"
                     /db_xref="TAIR:AT3G01500"
     mRNA            complement(join(194426..194891,195179..195337,
                     195406..195511,195609..195694,195788..195841,
                     195982..196098,196207..196255,196356..196505,
                     196664..196725,197652..198160))
                     /gene="CA1"
                     /locus_tag="AT3G01500"
                     /gene_synonym="ARABIDOPSIS THALIANA SALICYLIC ACID-BINDING
                     PROTEIN 3"
                     /gene_synonym="ATBCA1"
                     /gene_synonym="ATSABP3"
                     /gene_synonym="BETA CARBONIC ANHYDRASE 1"
                     /gene_synonym="carbonic anhydrase 1"
                     /gene_synonym="F4P13.5"
                     /gene_synonym="F4P13_5"
                     /gene_synonym="SABP3"
                     /gene_synonym="SALICYLIC ACID-BINDING PROTEIN 3"
                     /product="carbonic anhydrase 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH877822.1,INSD:CA781483.1,INSD:EL198701.1,
                     INSD:EH982739.1,INSD:EH911214.1,INSD:DR368361.1,
                     INSD:EL056800.1,INSD:EH962288.1,INSD:EL079355.1,
                     INSD:BP858265.1,INSD:EL011797.1,INSD:EL032259.1,
                     INSD:EH872580.1,INSD:EL121465.1,INSD:EH948009.1,
                     INSD:EL082089.1,INSD:BP562138.2,INSD:EL010210.1,
                     INSD:EL091376.1,INSD:EH888426.1,INSD:EL277525.1,
                     INSD:DR354004.1,INSD:EL207497.1,INSD:EH922462.1,
                     INSD:EL012073.1,INSD:EL139308.1,INSD:EL096183.1,
                     INSD:DR368378.1,INSD:EL119348.1,INSD:EH921988.1,
                     INSD:EL019222.1,INSD:EL056726.1,INSD:DR237093.1,
                     INSD:AV524984.1,INSD:BP844708.1,INSD:EL033160.1,
                     INSD:EL229927.1,INSD:EL327521.1,INSD:EL041326.1,
                     INSD:EL105063.1,INSD:EH849588.1,INSD:EH907791.1,
                     INSD:EL157916.1,INSD:EL235476.1,INSD:EH795756.1,
                     INSD:EH982576.1,INSD:EL060799.1,INSD:AV788483.1,
                     INSD:BP839745.1,INSD:DR353934.1,INSD:EH972484.1,
                     INSD:EH993014.1,INSD:EL336227.1,INSD:DR353963.1,
                     INSD:EH894111.1,INSD:EL329424.1,INSD:EL334421.1,
                     INSD:EL336630.1,INSD:EL085881.1,INSD:EL054010.1,
                     INSD:EL229590.1,INSD:EL119340.1,INSD:EL043030.1,
                     INSD:DR353947.1,INSD:EH908023.1,INSD:AV830449.1,
                     INSD:EL023735.1,INSD:EH821634.1,INSD:EL021451.1,
                     INSD:EL175064.1,INSD:EL293606.1,INSD:EL072194.1,
                     INSD:EL313510.1,INSD:EG502497.1,INSD:AV791944.1,
                     INSD:DR353991.1,INSD:EH900802.1,INSD:EL129532.1,
                     INSD:DR354007.1,INSD:EL002778.1,INSD:EL170583.1,
                     INSD:EL133462.1,INSD:AV524397.1,INSD:EH826567.1,
                     INSD:EH929777.1,INSD:EL286775.1,INSD:EL264621.1,
                     INSD:EL255580.1,INSD:DR368350.1,INSD:EL063861.1,
                     INSD:DR353927.1,INSD:EH882286.1,INSD:EL230044.1,
                     INSD:EL216030.1,INSD:EL246415.1,INSD:EL039545.1,
                     INSD:EL180394.1,INSD:EL250520.1,INSD:EH839471.1,
                     INSD:AV442587.1,INSD:EL178606.1,INSD:DR353996.1,
                     INSD:DR354008.1,INSD:EL092318.1,INSD:EH901351.1,
                     INSD:EH960159.1,INSD:EL021449.1,INSD:EL020306.1,
                     INSD:BP636078.1,INSD:EL334062.1,INSD:EG494411.1,
                     INSD:EH859170.1,INSD:EL041942.1,INSD:EL229077.1,
                     INSD:EL261720.1,INSD:EL073841.1,INSD:EL037105.1,
                     INSD:EH993291.1,INSD:DR353951.1,INSD:DR353981.1,
                     INSD:EL238833.1,INSD:EL213435.1,INSD:EH890408.1,
                     INSD:EH883739.1,INSD:EH836040.1,INSD:EL241775.1,
                     INSD:EL339867.1,INSD:EL323601.1,INSD:DR353952.1,
                     INSD:EL228119.1,INSD:DR353979.1,INSD:EL009039.1,
                     INSD:CB255829.1,INSD:DR368358.1,INSD:EL234350.1,
                     INSD:EL128492.1,INSD:EH978506.1,INSD:EL190055.1,
                     INSD:EL242804.1,INSD:EL236861.1,INSD:EL134316.1,
                     INSD:EL089775.1,INSD:EL228808.1,INSD:DR353994.1,
                     INSD:EL035548.1,INSD:T04367.1,INSD:BP779705.1,
                     INSD:EL081692.1,INSD:DR353977.1,INSD:EL035147.1,
                     INSD:EL297563.1,INSD:BP821131.1,INSD:EH886010.1,
                     INSD:EH875658.1,INSD:CK118268.1,INSD:EH966158.1,
                     INSD:EH957068.1,INSD:EL249301.1,INSD:EL319689.1,
                     INSD:DR353985.1,INSD:EH879293.1,INSD:EL241679.1,
                     INSD:EH835290.1,INSD:EL225685.1,INSD:EH812392.1,
                     INSD:EL336947.1,INSD:EH902058.1,INSD:DR368377.1,
                     INSD:EL223764.1,INSD:EL241537.1,INSD:DR354000.1,
                     INSD:EH992126.1,INSD:EL198664.1,INSD:EL180032.1,
                     INSD:EL040329.1,INSD:EL149665.1,INSD:BU636478.1,
                     INSD:EL080687.1,INSD:EH906425.1,INSD:DR354003.1,
                     INSD:EL321633.1,INSD:BP781562.1,INSD:DR353995.1,
                     INSD:EH842248.1,INSD:EH889209.1,INSD:BP850795.1,
                     INSD:EH965220.1,INSD:EH836329.1,INSD:DR368370.1,
                     INSD:EL318395.1,INSD:EL142738.1,INSD:EL209111.1,
                     INSD:EL269408.1,INSD:EL309589.1,INSD:DR353993.1,
                     INSD:H37128.1,INSD:EH943661.1,INSD:EL178749.1,
                     INSD:EL043805.1,INSD:EL142767.1,INSD:EL325850.1,
                     INSD:DR353939.1,INSD:EH903286.1,INSD:EL324188.1,
                     INSD:AV525589.1,INSD:EL060821.1,INSD:EL257025.1,
                     INSD:EL227092.1,INSD:EH956076.1,INSD:EL122061.1,
                     INSD:EL027848.1,INSD:EL019350.1,INSD:N37186.1,
                     INSD:DR353965.1,INSD:AV525700.1,INSD:EL132933.1,
                     INSD:EL289856.1,INSD:EH966085.1,INSD:EL282033.1,
                     INSD:EL338457.1,INSD:BP842380.1,INSD:AV441642.1,
                     INSD:EH944030.1,INSD:EH873287.1,INSD:EH808400.1,
                     INSD:EL261392.1,INSD:BP851865.1,INSD:DR353966.1,
                     INSD:BP560716.1,INSD:EL118568.1,INSD:BP665282.1,
                     INSD:EL282810.1,INSD:DR353943.1,INSD:DR366647.1,
                     INSD:EG502499.1,INSD:EL289646.1,INSD:EL176335.1,
                     INSD:EL064706.1,INSD:EL309958.1,INSD:EH828703.1,
                     INSD:EL275499.1,INSD:EH797257.1,INSD:EH852094.1,
                     INSD:DR353980.1,INSD:EH902283.1,INSD:EH964378.1,
                     INSD:EH905381.1,INSD:DR354005.1,INSD:DR353930.1,
                     INSD:EH850026.1,INSD:EH799322.1,INSD:EH951000.1,
                     INSD:EH850168.1,INSD:EL114525.1,INSD:EL163899.1,
                     INSD:EL326902.1,INSD:EH969208.1,INSD:EH902380.1,
                     INSD:EL144945.1,INSD:AV441815.1,INSD:EL070040.1,
                     INSD:EL046080.1,INSD:EL018514.1,INSD:EL029947.1,
                     INSD:EL304361.1,INSD:DR353929.1,INSD:EL316096.1,
                     INSD:EH983185.1,INSD:EL086364.1,INSD:EL146459.1,
                     INSD:EH917715.1,INSD:EH939392.1,INSD:EL089448.1,
                     INSD:EL016621.1,INSD:EH933760.1,INSD:EH839967.1,
                     INSD:EH925483.1,INSD:EL188362.1,INSD:EL312804.1,
                     INSD:EL241542.1,INSD:EL190732.1,INSD:EL206976.1,
                     INSD:EL058581.1,INSD:EL311459.1,INSD:DR354011.1,
                     INSD:EL312355.1,INSD:EH819767.1,INSD:EL111783.1,
                     INSD:EH861309.1,INSD:EH820736.1,INSD:EL003943.1,
                     INSD:DR368379.1,INSD:EL275697.1,INSD:DR353992.1,
                     INSD:EL191613.1,INSD:BP779298.1,INSD:EH976815.1,
                     INSD:DR353971.1,INSD:EH957457.1,INSD:EL239529.1,
                     INSD:EL084597.1,INSD:EH870826.1,INSD:EL313842.1,
                     INSD:EL211369.1,INSD:EH927481.1,INSD:EL140361.1,
                     INSD:EL290140.1,INSD:EL326753.1,INSD:EH978402.1,
                     INSD:EH837776.1,INSD:N38247.1,INSD:EL149092.1,
                     INSD:EL139347.1,INSD:EL006879.1,INSD:EL272114.1,
                     INSD:EL310335.1,INSD:AV809142.1,INSD:DR353956.1,
                     INSD:EL277302.1,INSD:EL335277.1,INSD:EL259790.1,
                     INSD:EL074142.1,INSD:EL082333.1,INSD:EL245551.1,
                     INSD:BP855891.1,INSD:EL191063.1,INSD:EL292759.1,
                     INSD:EL134702.1,INSD:EL234793.1,INSD:EH944572.1,
                     INSD:EL220868.1,INSD:AV525295.1,INSD:BP784456.1,
                     INSD:EL093187.1,INSD:DR353959.1,INSD:EH798422.1,
                     INSD:EL153029.1,INSD:EH893299.1,INSD:EL134136.1,
                     INSD:EL231120.1,INSD:EG463640.1,INSD:EL210719.1,
                     INSD:EL235578.1,INSD:EL323064.1,INSD:EL021483.1,
                     INSD:EH807726.1,INSD:EL121790.1,INSD:EH808038.1,
                     INSD:EL181160.1,INSD:EL129547.1,INSD:AV525304.1,
                     INSD:EL097053.1,INSD:EH992045.1,INSD:EH925201.1,
                     INSD:EH800062.1,INSD:EL217146.1,INSD:EL124888.1,
                     INSD:EL060271.1,INSD:EL285067.1,INSD:EL170070.1,
                     INSD:EL038496.1,INSD:EH972916.1,INSD:EH833142.1,
                     INSD:EL273197.1,INSD:AV824068.1,INSD:EL210402.1,
                     INSD:EL081004.1,INSD:EL126211.1,INSD:EH846359.1,
                     INSD:EH899881.1,INSD:BP787716.1,INSD:EL181807.1,
                     INSD:EH898905.1,INSD:EL252123.1,INSD:BP814295.1,
                     INSD:DR368375.1,INSD:EH927388.1,INSD:EL326638.1,
                     INSD:EL276544.1,INSD:EH987645.1,INSD:EH867854.1,
                     INSD:EL279124.1,INSD:EH820272.1,INSD:EL101464.1,
                     INSD:EH886300.1,INSD:DR368354.1,INSD:EL157482.1,
                     INSD:EL235663.1,INSD:EH802114.1,INSD:EL326508.1,
                     INSD:EL027087.1,INSD:EL236518.1,INSD:EH814689.1,
                     INSD:EH802786.1,INSD:R29976.1,INSD:EL092467.1,
                     INSD:EL330993.1,INSD:EL304588.1,INSD:EH832601.1,
                     INSD:EG453840.1,INSD:AV525742.1,INSD:DR353978.1,
                     INSD:EL207211.1,INSD:EL061554.1,INSD:EL111401.1,
                     INSD:EL125615.1,INSD:EL159618.1,INSD:EL047370.1,
                     INSD:EH980977.1,INSD:EL262275.1,INSD:EH831988.1,
                     INSD:AV522157.1,INSD:EH848065.1,INSD:EL303198.1,
                     INSD:EL033121.1,INSD:EL271877.1,INSD:EL067502.1,
                     INSD:EL047970.1,INSD:EL340223.1,INSD:EH795614.1,
                     INSD:EH800862.1,INSD:EL264238.1,INSD:EH806115.1,
                     INSD:DR353948.1,INSD:DR368364.1,INSD:EL184338.1,
                     INSD:EL329353.1,INSD:DR353967.1,INSD:EH976116.1,
                     INSD:EL259415.1,INSD:DR353938.1,INSD:EL133468.1,
                     INSD:EL200403.1,INSD:EL178480.1,INSD:EH891769.1,
                     INSD:EH910165.1,INSD:BP635674.1,INSD:AV792965.1,
                     INSD:EL111093.1,INSD:CB258030.1,INSD:DR353987.1,
                     INSD:EG526458.1,INSD:EH832300.1,INSD:DR353969.1,
                     INSD:EH900871.1,INSD:EH947153.1,INSD:EH867567.1,
                     INSD:EH962094.1,INSD:BP846698.1,INSD:DR368353.1,
                     INSD:EL141434.1,INSD:EL145715.1,INSD:EL291446.1,
                     INSD:EH992902.1,INSD:DR368376.1,INSD:EL089759.1,
                     INSD:EH941059.1,INSD:EH820414.1,INSD:BP827222.1,
                     INSD:EL314398.1,INSD:EL127990.1,INSD:EL098256.1,
                     INSD:CB263866.1,INSD:EL280262.1,INSD:EH957247.1,
                     INSD:EH807453.1,INSD:EH944330.1,INSD:EL200766.1,
                     INSD:DR353976.1,INSD:EH955461.1,INSD:DR354010.1,
                     INSD:EH853905.1,INSD:EL145145.1,INSD:DR368371.1,
                     INSD:EL225769.1,INSD:EH827723.1,INSD:EL258057.1,
                     INSD:EH882383.1,INSD:EL217809.1,INSD:EL273405.1,
                     INSD:EH953361.1,INSD:EL155356.1,INSD:EG526474.1,
                     INSD:DR353982.1,INSD:EH941238.1,INSD:EH837252.1,
                     INSD:EH934519.1,INSD:CB260831.1,INSD:EL298739.1,
                     INSD:EH848831.1,INSD:BP789742.1,INSD:EH904137.1,
                     INSD:EL066869.1,INSD:EH935666.1,INSD:EL214228.1,
                     INSD:AV828183.1,INSD:EL131550.1,INSD:EL295778.1,
                     INSD:CB262358.1,INSD:EL311592.1,INSD:EL174419.1,
                     INSD:DR353988.1,INSD:EL340201.1,INSD:DR353932.1,
                     INSD:EL146288.1,INSD:DR353955.1,INSD:EH870904.1,
                     INSD:DR353962.1,INSD:DR353990.1,INSD:EL042564.1,
                     INSD:EL181468.1,INSD:BU635473.1,INSD:EL118425.1,
                     INSD:EL171368.1,INSD:DR368360.1,INSD:BP788239.1,
                     INSD:EL119285.1,INSD:DR353983.1,INSD:EL153446.1,
                     INSD:EL105377.1,INSD:AV527171.1,INSD:EL330043.1,
                     INSD:EL310202.1,INSD:EL077709.1,INSD:EL142482.1,
                     INSD:EL062740.1,INSD:DR368365.1,INSD:EH908176.1,
                     INSD:EL063201.1,INSD:EH798087.1,INSD:EL294824.1,
                     INSD:EH873001.1,INSD:EH818939.1,INSD:DR353958.1,
                     INSD:EL175075.1,INSD:EL079437.1,INSD:EH968573.1,
                     INSD:AV531553.1,INSD:EH985954.1,INSD:EH873397.1,
                     INSD:DR353998.1,INSD:EH984453.1,INSD:EL014900.1,
                     INSD:BP852093.1,INSD:EH853104.1,INSD:EH925019.1,
                     INSD:EL321638.1,INSD:DR353926.1,INSD:EL074189.1,
                     INSD:EL182492.1,INSD:EH879680.1,INSD:AV526159.1,
                     INSD:EL091641.1,INSD:EL033343.1,INSD:EL233351.1,
                     INSD:DR368352.1,INSD:EL009298.1,INSD:EL339430.1,
                     INSD:DR353924.1,INSD:EL091153.1,INSD:EL002377.1,
                     INSD:EH804967.1,INSD:EL278122.1,INSD:DR353970.1,
                     INSD:DR353950.1,INSD:DR368348.1,INSD:EL171652.1,
                     INSD:EH915898.1,INSD:EH940776.1,INSD:EH940479.1,
                     INSD:EL130668.1,INSD:EL105638.1,INSD:EL124561.1,
                     INSD:DR353961.1,INSD:EH969242.1,INSD:EH822141.1,
                     INSD:EL187726.1,INSD:DR368355.1,INSD:DR353928.1,
                     INSD:EL092744.1,INSD:EH821442.1,INSD:DR353936.1,
                     INSD:AV805466.1,INSD:BU636815.1,INSD:EL275714.1,
                     INSD:EH894775.1,INSD:EH857708.1,INSD:EL056911.1,
                     INSD:EL311766.1,INSD:EL066333.1,INSD:BP854451.1,
                     INSD:EL265765.1,INSD:EL307618.1,INSD:EH816013.1,
                     INSD:EL273624.1,INSD:EL319745.1,INSD:EL189454.1,
                     INSD:EL340401.1,INSD:EL123433.1,INSD:DR353931.1,
                     INSD:DR353960.1,INSD:EL209670.1,INSD:EL259010.1,
                     INSD:EH959594.1,INSD:EL167439.1,INSD:EL222901.1,
                     INSD:EH964409.1,INSD:DR368369.1,INSD:EL183174.1,
                     INSD:EL000636.1,INSD:BP827986.1,INSD:AV525223.1,
                     INSD:EL107427.1,INSD:EL138297.1,INSD:DR353949.1,
                     INSD:EL078134.1,INSD:DR354012.1,INSD:DR353935.1,
                     INSD:EL146439.1,INSD:AV807291.1,INSD:EL306284.1,
                     INSD:BP848289.1,INSD:AV823995.1,INSD:EH834573.1,
                     INSD:DR353973.1,INSD:EH971737.1,INSD:EL051038.1,
                     INSD:EL021891.1,INSD:EL280097.1,INSD:AV793153.1,
                     INSD:DR368373.1,INSD:BP626144.1,INSD:EL139795.1,
                     INSD:EH962374.1,INSD:EL188225.1,INSD:EL169700.1,
                     INSD:EL227146.1,INSD:EH817724.1,INSD:AV830611.1,
                     INSD:DR353986.1,INSD:DR353974.1,INSD:EH842914.1,
                     INSD:EL242791.1,INSD:EL188317.1,INSD:EL124403.1,
                     INSD:BP560537.2,INSD:EG526473.1,INSD:DR368374.1,
                     INSD:EH808992.1,INSD:AV527272.1,INSD:AV528017.1,
                     INSD:EH948395.1,INSD:EL189844.1,INSD:EH828013.1,
                     INSD:EH916673.1,INSD:EL164182.1,INSD:DR353945.1,
                     INSD:R90528.1,INSD:EL079815.1,INSD:EL220374.1,
                     INSD:EH874912.1,INSD:EH964352.1,INSD:EL103130.1,
                     INSD:EH897776.1,INSD:EL061980.1,INSD:EH960073.1,
                     INSD:EH914136.1,INSD:EL027457.1,INSD:EH827478.1,
                     INSD:EH899843.1,INSD:EL273549.1,INSD:EL280545.1,
                     INSD:EL243919.1,INSD:BP866324.1,INSD:DR354006.1,
                     INSD:EL008479.1,INSD:EH911887.1,INSD:EL095272.1,
                     INSD:EL255181.1,INSD:EL023313.1,INSD:EL033098.1,
                     INSD:EH823607.1,INSD:EL113047.1,INSD:DR353933.1,
                     INSD:EL312491.1,INSD:EL087445.1,INSD:EH982384.1,
                     INSD:EL222649.1,INSD:EL279577.1,INSD:EH915697.1,
                     INSD:EH925400.1,INSD:EL139617.1,INSD:DR368347.1,
                     INSD:DR368366.1,INSD:EH804169.1,INSD:EL176444.1,
                     INSD:AV526964.1,INSD:EL226438.1,INSD:EH846237.1,
                     INSD:EH877614.1,INSD:EL072067.1,INSD:EH948550.1,
                     INSD:EH869503.1,INSD:DR353957.1,INSD:EH895643.1,
                     INSD:EL030157.1,INSD:EH958324.1,INSD:EL119857.1,
                     INSD:EH802291.1,INSD:DR368351.1,INSD:AV810582.1,
                     INSD:EH931485.1,INSD:EG521717.1,INSD:DR353941.1,
                     INSD:EG526459.1,INSD:EL219044.1,INSD:CB264633.1,
                     INSD:EH838695.1,INSD:EL120856.1,INSD:EH836658.1,
                     INSD:EH976891.1,INSD:EH960045.1,INSD:EL131048.1,
                     INSD:EL110979.1,INSD:EH796529.1,INSD:EH909819.1,
                     INSD:DR354002.1,INSD:EL309427.1,INSD:EL223923.1,
                     INSD:DR359427.1,INSD:EL114639.1,INSD:EL114551.1,
                     INSD:EL326674.1,INSD:EL207857.1,INSD:EH962692.1,
                     INSD:EL162806.1,INSD:EL235594.1,INSD:EL072162.1,
                     INSD:DR353964.1,INSD:EL102366.1,INSD:EL108921.1,
                     INSD:EH974481.1,INSD:DR368359.1,INSD:EL270626.1,
                     INSD:EH798865.1,INSD:EH987527.1,INSD:EH944126.1,
                     INSD:EL065591.1,INSD:EL157541.1,INSD:EL179612.1,
                     INSD:EL319444.1,INSD:EL185050.1,INSD:EH903511.1,
                     INSD:DR353942.1,INSD:EL067086.1,INSD:EL065043.1,
                     INSD:AV440467.1,INSD:EH822805.1,INSD:EH894322.1,
                     INSD:EL301549.1,INSD:EH938756.1,INSD:EL122286.1,
                     INSD:EH887348.1,INSD:EL308286.1,INSD:DR353984.1,
                     INSD:EL150971.1,INSD:EH985009.1,INSD:EH949221.1,
                     INSD:BP861914.1,INSD:AV829899.1,INSD:EL178873.1,
                     INSD:EH989152.1,INSD:CK117793.1,INSD:DR353997.1,
                     INSD:DR368372.1,INSD:EH875996.1,INSD:EL274502.1,
                     INSD:DR368357.1,INSD:EH888165.1,INSD:EH802259.1,
                     INSD:EL338552.1,INSD:EL063890.1,INSD:EL006442.1,
                     INSD:EL275470.1,INSD:EL109636.1,INSD:EH980540.1,
                     INSD:EH919305.1,INSD:EL219382.1,INSD:EH840797.1,
                     INSD:EL232443.1,INSD:EL114381.1,INSD:EH816313.1,
                     INSD:EL318661.1,INSD:EL179596.1,INSD:EL205840.1,
                     INSD:EL024001.1,INSD:EL154645.1,INSD:DR353968.1,
                     INSD:EL038121.1,INSD:EL280151.1,INSD:EL300286.1,
                     INSD:EL249040.1,INSD:EH981609.1,INSD:EH849402.1,
                     INSD:EL228359.1,INSD:EL031397.1,INSD:EH932674.1,
                     INSD:EL203762.1,INSD:EH867695.1,INSD:EL188600.1,
                     INSD:EL284742.1,INSD:CA781515.1,INSD:EL123950.1,
                     INSD:EL018566.1,INSD:EH925619.1,INSD:EL085593.1,
                     INSD:EL025506.1,INSD:EL055670.1,INSD:EL320469.1,
                     INSD:EL147107.1,INSD:BP842106.1,INSD:DR353989.1,
                     INSD:EH833149.1,INSD:EL117570.1,INSD:EL224410.1,
                     INSD:EL196146.1,INSD:DR353999.1,INSD:EL248727.1,
                     INSD:EH988523.1,INSD:EH838812.1,INSD:EH963669.1,
                     INSD:EH834226.1,INSD:EL178411.1,INSD:EL169027.1,
                     INSD:DR353937.1,INSD:BP847578.1,INSD:EL310490.1,
                     INSD:EL249901.1,INSD:EL242016.1,INSD:EL247357.1,
                     INSD:BP859963.1,INSD:CB258027.1,INSD:EL012300.1,
                     INSD:EL210864.1,INSD:EL164204.1,INSD:EH817049.1,
                     INSD:EL083591.1,INSD:EH822489.1,INSD:EL248321.1,
                     INSD:EH870533.1,INSD:EH856059.1,INSD:EL337527.1,
                     INSD:EH822750.1,INSD:EH826161.1,INSD:DR353940.1,
                     INSD:DR353925.1,INSD:EL073027.1,INSD:EL236185.1,
                     INSD:EL054833.1,INSD:EH847743.1,INSD:EL029397.1,
                     INSD:EL185826.1,INSD:EL072059.1,INSD:EL234392.1,
                     INSD:EH827054.1,INSD:DR354009.1,INSD:DR353953.1,
                     INSD:DR353946.1,INSD:DR354001.1,INSD:DR363457.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AF428459.1,INSD:AF428284.1"
                     /db_xref="TAIR:AT3G01500"
                     /db_xref="Araport:AT3G01500"
     mRNA            complement(join(194708..195337,195406..195511,
                     195609..195694,195788..195841,195982..196098,
                     196207..196255,196356..196505,196664..196725,
                     196848..197564))
                     /gene="CA1"
                     /locus_tag="AT3G01500"
                     /gene_synonym="ARABIDOPSIS THALIANA SALICYLIC ACID-BINDING
                     PROTEIN 3"
                     /gene_synonym="ATBCA1"
                     /gene_synonym="ATSABP3"
                     /gene_synonym="BETA CARBONIC ANHYDRASE 1"
                     /gene_synonym="carbonic anhydrase 1"
                     /gene_synonym="F4P13.5"
                     /gene_synonym="F4P13_5"
                     /gene_synonym="SABP3"
                     /gene_synonym="SALICYLIC ACID-BINDING PROTEIN 3"
                     /product="carbonic anhydrase 1"
                     /db_xref="Araport:AT3G01500"
                     /db_xref="TAIR:AT3G01500"
     mRNA            complement(join(194724..195337,195406..195511,
                     195609..195694,195788..195841,195982..196098,
                     196207..196255,196356..196505,196664..196725,
                     197652..198664))
                     /gene="CA1"
                     /locus_tag="AT3G01500"
                     /gene_synonym="ARABIDOPSIS THALIANA SALICYLIC ACID-BINDING
                     PROTEIN 3"
                     /gene_synonym="ATBCA1"
                     /gene_synonym="ATSABP3"
                     /gene_synonym="BETA CARBONIC ANHYDRASE 1"
                     /gene_synonym="carbonic anhydrase 1"
                     /gene_synonym="F4P13.5"
                     /gene_synonym="F4P13_5"
                     /gene_synonym="SABP3"
                     /gene_synonym="SALICYLIC ACID-BINDING PROTEIN 3"
                     /product="carbonic anhydrase 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH877822.1,INSD:CA781483.1,INSD:AV792086.1,
                     INSD:EL198701.1,INSD:EL161524.1,INSD:EL059042.1,
                     INSD:EH982739.1,INSD:EH911214.1,INSD:BP781326.1,
                     INSD:DR229078.1,INSD:DR368361.1,INSD:BP662998.1,
                     INSD:EL264654.1,INSD:EH962288.1,INSD:EL056800.1,
                     INSD:EL079355.1,INSD:EL280160.1,INSD:BP858265.1,
                     INSD:EL011797.1,INSD:EL032259.1,INSD:EH872580.1,
                     INSD:EL121465.1,INSD:BP785706.1,INSD:EH948009.1,
                     INSD:EL082089.1,INSD:BP562138.2,INSD:EL010210.1,
                     INSD:EL091376.1,INSD:BP783221.1,INSD:EH860579.1,
                     INSD:EH888426.1,INSD:EH954815.1,INSD:EL277525.1,
                     INSD:DR354004.1,INSD:EL319439.1,INSD:EG424819.1,
                     INSD:AV802704.1,INSD:EL207497.1,INSD:EH922462.1,
                     INSD:AV818289.1,INSD:EL012073.1,INSD:EL139308.1,
                     INSD:EL096183.1,INSD:DR368378.1,INSD:DR368356.1,
                     INSD:EH921988.1,INSD:EL119348.1,INSD:EL019222.1,
                     INSD:EL056726.1,INSD:DR237093.1,INSD:CB261984.1,
                     INSD:AV524984.1,INSD:BP844708.1,INSD:EL327521.1,
                     INSD:EL033160.1,INSD:EL229927.1,INSD:EL041326.1,
                     INSD:EL105063.1,INSD:EH907791.1,INSD:EH906596.1,
                     INSD:EH849588.1,INSD:EL157916.1,INSD:EL235476.1,
                     INSD:EH795756.1,INSD:EL289308.1,INSD:EH982576.1,
                     INSD:EL060799.1,INSD:BP839745.1,INSD:AV788483.1,
                     INSD:DR353934.1,INSD:EL263497.1,INSD:AV819061.1,
                     INSD:EL225195.1,INSD:EH972484.1,INSD:EH993014.1,
                     INSD:BP590248.1,INSD:EL336227.1,INSD:DR353963.1,
                     INSD:EH894111.1,INSD:EH919612.1,INSD:EL174397.1,
                     INSD:EL077850.1,INSD:EL329424.1,INSD:EL334421.1,
                     INSD:EH858371.1,INSD:BP784643.1,INSD:EL336630.1,
                     INSD:EL085881.1,INSD:EL054010.1,INSD:EL229590.1,
                     INSD:BP779940.1,INSD:EL119340.1,INSD:EH939939.1,
                     INSD:AV813835.1,INSD:AV789072.1,INSD:AV791912.1,
                     INSD:EL043030.1,INSD:EL252313.1,INSD:DR353947.1,
                     INSD:EL167037.1,INSD:BP651660.1,INSD:EH833049.1,
                     INSD:CB262646.1,INSD:AV830449.1,INSD:EH908023.1,
                     INSD:EL023735.1,INSD:EH821634.1,INSD:EL293606.1,
                     INSD:EL021451.1,INSD:EL175064.1,INSD:EL313510.1,
                     INSD:EL072194.1,INSD:T46803.1,INSD:EL279262.1,
                     INSD:EG502497.1,INSD:EL004474.1,INSD:DR353991.1,
                     INSD:BP777665.1,INSD:EH900802.1,INSD:EL129532.1,
                     INSD:DR354007.1,INSD:EL002778.1,INSD:EL170583.1,
                     INSD:EL133462.1,INSD:AV524397.1,INSD:EH826567.1,
                     INSD:BP641936.1,INSD:BP650597.1,INSD:EL286775.1,
                     INSD:EL264621.1,INSD:EL255580.1,INSD:EL241691.1,
                     INSD:DR368350.1,INSD:EL063861.1,INSD:DR353927.1,
                     INSD:EH882286.1,INSD:EL230044.1,INSD:EL216030.1,
                     INSD:EL246415.1,INSD:EH880957.1,INSD:EL039545.1,
                     INSD:EL180394.1,INSD:EL250520.1,INSD:EH839471.1,
                     INSD:AV442587.1,INSD:DR353996.1,INSD:EL178606.1,
                     INSD:DR354008.1,INSD:EL092318.1,INSD:EG480091.1,
                     INSD:EL243608.1,INSD:EL225965.1,INSD:EH960159.1,
                     INSD:EH901351.1,INSD:EL021449.1,INSD:EL020306.1,
                     INSD:AV795971.1,INSD:EL334062.1,INSD:EG494411.1,
                     INSD:EH859170.1,INSD:BP788041.1,INSD:EL041942.1,
                     INSD:BP593582.1,INSD:EL204061.1,INSD:AV801138.1,
                     INSD:EL229077.1,INSD:EL261720.1,INSD:EL073841.1,
                     INSD:BP585520.1,INSD:EH928740.1,INSD:EL037105.1,
                     INSD:BP780681.1,INSD:EH993291.1,INSD:DR353951.1,
                     INSD:DR353981.1,INSD:AV561791.1,INSD:EL238833.1,
                     INSD:BP594785.1,INSD:EL213435.1,INSD:EH890408.1,
                     INSD:EH883739.1,INSD:BP790583.1,INSD:EH836040.1,
                     INSD:EL323601.1,INSD:EL339867.1,INSD:EL241775.1,
                     INSD:EL250818.1,INSD:DR353952.1,INSD:CB260553.1,
                     INSD:EL228119.1,INSD:DR353979.1,INSD:CB255829.1,
                     INSD:EL009039.1,INSD:BP623910.1,INSD:DR368358.1,
                     INSD:EL234350.1,INSD:EL128492.1,INSD:EL046784.1,
                     INSD:EH978506.1,INSD:EL190055.1,INSD:EL242804.1,
                     INSD:EL236861.1,INSD:BP778039.1,INSD:AV809545.1,
                     INSD:EL134316.1,INSD:DR353994.1,INSD:EL089775.1,
                     INSD:EL228808.1,INSD:EL035548.1,INSD:T04367.1,
                     INSD:EL081692.1,INSD:DR353977.1,INSD:EL035147.1,
                     INSD:EL056886.1,INSD:EL297563.1,INSD:BP821131.1,
                     INSD:EH886010.1,INSD:EH875658.1,INSD:EG513510.1,
                     INSD:CK118268.1,INSD:EH966158.1,INSD:EH914261.1,
                     INSD:EH957068.1,INSD:BP659716.1,INSD:EL319689.1,
                     INSD:EL249301.1,INSD:DR353985.1,INSD:AV790292.1,
                     INSD:EH879293.1,INSD:EL241679.1,INSD:AV807670.1,
                     INSD:EH875874.1,INSD:EL298536.1,INSD:EH812392.1,
                     INSD:BP789461.1,INSD:EL336947.1,INSD:EH902058.1,
                     INSD:EL220886.1,INSD:DR368377.1,INSD:BP670804.1,
                     INSD:EH943624.1,INSD:EH874545.1,INSD:EL226270.1,
                     INSD:AV802888.1,INSD:EL223764.1,INSD:DR354000.1,
                     INSD:EL241537.1,INSD:EH992126.1,INSD:EL198664.1,
                     INSD:EH850006.1,INSD:EL180032.1,INSD:AV519423.1,
                     INSD:EL040329.1,INSD:BU636478.1,INSD:EL149665.1,
                     INSD:EL080687.1,INSD:EH851625.1,INSD:EH986979.1,
                     INSD:BP791202.1,INSD:EH906425.1,INSD:BP781116.1,
                     INSD:AV800880.1,INSD:DR354003.1,INSD:DR353995.1,
                     INSD:EL321633.1,INSD:AV796327.1,INSD:EH842248.1,
                     INSD:EH967070.1,INSD:EH897311.1,INSD:EH889209.1,
                     INSD:EL170370.1,INSD:BP850795.1,INSD:EH965220.1,
                     INSD:AV790339.1,INSD:EH836329.1,INSD:DR368370.1,
                     INSD:EL318395.1,INSD:EL142738.1,INSD:EH957640.1,
                     INSD:EL209111.1,INSD:EL269408.1,INSD:EH881044.1,
                     INSD:BP588209.1,INSD:AV439737.1,INSD:EL309589.1,
                     INSD:DR353993.1,INSD:AV519944.1,INSD:BP790852.1,
                     INSD:H37128.1,INSD:EH918221.1,INSD:EL015068.1,
                     INSD:EL184266.1,INSD:EH887122.1,INSD:EH943661.1,
                     INSD:EL178749.1,INSD:EL325850.1,INSD:EL043805.1,
                     INSD:EL142767.1,INSD:BP596837.1,INSD:BP631711.1,
                     INSD:DR353939.1,INSD:EH903286.1,INSD:EL324188.1,
                     INSD:EL106535.1,INSD:EL149222.1,INSD:BP585067.1,
                     INSD:AV525589.1,INSD:BP669570.1,INSD:EH968394.1,
                     INSD:EL060821.1,INSD:EL257025.1,INSD:EL227092.1,
                     INSD:EL012285.1,INSD:AV520074.1,INSD:EH956076.1,
                     INSD:EL122061.1,INSD:EL027848.1,INSD:EL019350.1,
                     INSD:N37186.1,INSD:BP785911.1,INSD:BP669016.1,
                     INSD:DR353965.1,INSD:AV525700.1,INSD:EL289856.1,
                     INSD:EL132933.1,INSD:AV441642.1,INSD:BP842380.1,
                     INSD:EL338457.1,INSD:EH966085.1,INSD:EL282033.1,
                     INSD:EH808400.1,INSD:EH873287.1,INSD:EL261392.1,
                     INSD:BP851865.1,INSD:DR353966.1,INSD:AV803068.1,
                     INSD:AV782771.1,INSD:BP560716.1,INSD:EH862273.1,
                     INSD:EL118568.1,INSD:EL150825.1,INSD:AV792563.1,
                     INSD:EL282810.1,INSD:DR353943.1,INSD:AV797335.1,
                     INSD:DR366647.1,INSD:AV796908.1,INSD:EG502499.1,
                     INSD:EL289646.1,INSD:EL176335.1,INSD:EL064706.1,
                     INSD:AA597896.1,INSD:EL309958.1,INSD:AI099882.1,
                     INSD:EH828703.1,INSD:AV820588.1,INSD:EH926639.1,
                     INSD:EL275499.1,INSD:AV793804.1,INSD:EG480090.1,
                     INSD:EH797257.1,INSD:EH852094.1,INSD:DR353980.1,
                     INSD:EH902283.1,INSD:EH964378.1,INSD:EH905381.1,
                     INSD:DR354005.1,INSD:BP594233.1,INSD:DR353930.1,
                     INSD:EH850026.1,INSD:EH799322.1,INSD:EH951000.1,
                     INSD:EL326902.1,INSD:EH850168.1,INSD:EL114525.1,
                     INSD:AV790999.1,INSD:EH969208.1,INSD:BP781381.1,
                     INSD:EH930368.1,INSD:EH902380.1,INSD:AV441815.1,
                     INSD:EL144945.1,INSD:EL046080.1,INSD:EL018514.1,
                     INSD:EL029947.1,INSD:EL304361.1,INSD:EL135884.1,
                     INSD:AV819477.1,INSD:EH845600.1,INSD:DR353929.1,
                     INSD:EH852563.1,INSD:EH898056.1,INSD:EL316096.1,
                     INSD:EH983185.1,INSD:EH913324.1,INSD:EH901033.1,
                     INSD:EL086364.1,INSD:AV558141.1,INSD:EL193675.1,
                     INSD:AV820814.1,INSD:EL146459.1,INSD:EH917715.1,
                     INSD:EL303857.1,INSD:EH977470.1,INSD:EH820567.1,
                     INSD:EH939392.1,INSD:EL089448.1,INSD:EL229223.1,
                     INSD:EL016621.1,INSD:EH933760.1,INSD:EH812825.1,
                     INSD:EL032774.1,INSD:EH983752.1,INSD:EH925483.1,
                     INSD:EH839967.1,INSD:EL188362.1,INSD:EL143405.1,
                     INSD:AV531073.1,INSD:EL312804.1,INSD:EL241542.1,
                     INSD:EL190732.1,INSD:EL034409.1,INSD:EL206976.1,
                     INSD:EH927646.1,INSD:EL058581.1,INSD:CB256227.1,
                     INSD:DR354011.1,INSD:EL311459.1,INSD:EL312355.1,
                     INSD:BP594601.1,INSD:AV813544.1,INSD:EL111783.1,
                     INSD:BP790851.1,INSD:BP658630.1,INSD:EG513471.1,
                     INSD:EH820736.1,INSD:EH861309.1,INSD:EL003943.1,
                     INSD:DR368379.1,INSD:BP781047.1,INSD:EL275697.1,
                     INSD:DR353992.1,INSD:CB261591.1,INSD:EH835256.1,
                     INSD:AV794200.1,INSD:EL191613.1,INSD:EH976815.1,
                     INSD:EH872750.1,INSD:DR353971.1,INSD:EH957457.1,
                     INSD:EL239529.1,INSD:BP636471.1,INSD:EH870826.1,
                     INSD:EL084597.1,INSD:EL313842.1,INSD:EL261216.1,
                     INSD:EL211369.1,INSD:EH927481.1,INSD:EL025667.1,
                     INSD:EL290140.1,INSD:EL140361.1,INSD:EH838976.1,
                     INSD:EL065715.1,INSD:AV792187.1,INSD:EL326753.1,
                     INSD:BP605042.1,INSD:EH978402.1,INSD:EH837776.1,
                     INSD:N38247.1,INSD:EL149092.1,INSD:EL139347.1,
                     INSD:EG513511.1,INSD:EL006879.1,INSD:EL272114.1,
                     INSD:EL310335.1,INSD:DR353956.1,INSD:EL277302.1,
                     INSD:BP655073.1,INSD:EL335277.1,INSD:EL259790.1,
                     INSD:EL082333.1,INSD:EL074142.1,INSD:EL245551.1,
                     INSD:BP855891.1,INSD:BP785840.1,INSD:EL191063.1,
                     INSD:AV804745.1,INSD:EL292759.1,INSD:EL134702.1,
                     INSD:EL234793.1,INSD:AV801011.1,INSD:EH944572.1,
                     INSD:EL220868.1,INSD:AV525295.1,INSD:EL093187.1,
                     INSD:DR353959.1,INSD:EH798422.1,INSD:EH810512.1,
                     INSD:EL153029.1,INSD:EH910990.1,INSD:EH868392.1,
                     INSD:BP789922.1,INSD:BP794617.1,INSD:BX838914.1,
                     INSD:EH893299.1,INSD:EL134136.1,INSD:EL231120.1,
                     INSD:AV795400.1,INSD:BP671735.1,INSD:EG463640.1,
                     INSD:AV534314.1,INSD:EL210719.1,INSD:EH892451.1,
                     INSD:EL323064.1,INSD:EL235578.1,INSD:EL021483.1,
                     INSD:EL316685.1,INSD:EH807726.1,INSD:EH808038.1,
                     INSD:EL181160.1,INSD:EL129547.1,INSD:AV525304.1,
                     INSD:BP659943.1,INSD:EL097053.1,INSD:EH992045.1,
                     INSD:EH925201.1,INSD:AV810517.1,INSD:EH800062.1,
                     INSD:BP795054.1,INSD:EL217146.1,INSD:EH976936.1,
                     INSD:EL124888.1,INSD:EL060271.1,INSD:EL285067.1,
                     INSD:EL054471.1,INSD:BP588373.1,INSD:AV796893.1,
                     INSD:EL170070.1,INSD:AV518425.1,INSD:EL328724.1,
                     INSD:EH972916.1,INSD:EH833142.1,INSD:EL038496.1,
                     INSD:BP787525.1,INSD:EL273197.1,INSD:AV531460.1,
                     INSD:AV518362.1,INSD:AV824068.1,INSD:EL295232.1,
                     INSD:EH923138.1,INSD:EL269047.1,INSD:EL210402.1,
                     INSD:BP645533.1,INSD:EL081004.1,INSD:EL114922.1,
                     INSD:AI099969.1,INSD:EH846359.1,INSD:EL126211.1,
                     INSD:EH899881.1,INSD:EL181807.1,INSD:EH898905.1,
                     INSD:BP814295.1,INSD:AV789249.1,INSD:EL252123.1,
                     INSD:DR368375.1,INSD:EH927388.1,INSD:EL326638.1,
                     INSD:BP786073.1,INSD:EH889723.1,INSD:EL276544.1,
                     INSD:EH987645.1,INSD:AV806041.1,INSD:AV803124.1,
                     INSD:BP590045.1,INSD:EH867854.1,INSD:EL279124.1,
                     INSD:EH820272.1,INSD:EH856790.1,INSD:EL101464.1,
                     INSD:BP794107.1,INSD:AV556571.1,INSD:EH886300.1,
                     INSD:BP782671.1,INSD:DR368354.1,INSD:EL157482.1,
                     INSD:BP794116.1,INSD:EL123141.1,INSD:EL235663.1,
                     INSD:DR378063.1,INSD:BP592816.1,INSD:EH802114.1,
                     INSD:EL326508.1,INSD:EL236518.1,INSD:EH814689.1,
                     INSD:EH802786.1,INSD:R29976.1,INSD:AV812940.1,
                     INSD:EL092467.1,INSD:EL330993.1,INSD:EL304588.1,
                     INSD:EH832601.1,INSD:EG453840.1,INSD:AV525742.1,
                     INSD:DR353978.1,INSD:EL207211.1,INSD:EL061554.1,
                     INSD:AV558879.1,INSD:EL111401.1,INSD:EL125615.1,
                     INSD:EL241119.1,INSD:BP784542.1,INSD:EL159618.1,
                     INSD:EL047370.1,INSD:EH980977.1,INSD:EL262275.1,
                     INSD:EH810716.1,INSD:EH831988.1,INSD:EH848065.1,
                     INSD:EL303198.1,INSD:EL033121.1,INSD:EL271877.1,
                     INSD:EL067502.1,INSD:EL340223.1,INSD:EL047970.1,
                     INSD:EL185364.1,INSD:AV808819.1,INSD:EH800862.1,
                     INSD:EH795614.1,INSD:EL264238.1,INSD:EH806115.1,
                     INSD:DR353948.1,INSD:DR368364.1,INSD:DR373401.1,
                     INSD:BP784105.1,INSD:EL329353.1,INSD:EL184338.1,
                     INSD:DR353967.1,INSD:EH976116.1,INSD:EH896008.1,
                     INSD:EL259415.1,INSD:DR353938.1,INSD:EL133468.1,
                     INSD:EL200403.1,INSD:EH907435.1,INSD:EH842657.1,
                     INSD:EL178480.1,INSD:EH891769.1,INSD:EH910165.1,
                     INSD:EL111093.1,INSD:CB258030.1,INSD:DR353987.1,
                     INSD:EG526458.1,INSD:EH832300.1,INSD:BP782954.1,
                     INSD:EL334819.1,INSD:BP781000.1,INSD:DR353969.1,
                     INSD:EH900871.1,INSD:EH947153.1,INSD:BP783241.1,
                     INSD:BP635617.1,INSD:AV558989.1,INSD:EL029493.1,
                     INSD:EH962094.1,INSD:EH867567.1,INSD:BP846698.1,
                     INSD:DR368353.1,INSD:EL141434.1,INSD:EL145715.1,
                     INSD:EL291446.1,INSD:EH992902.1,INSD:DR368376.1,
                     INSD:EL089759.1,INSD:EL003942.1,INSD:EH941059.1,
                     INSD:BP827222.1,INSD:EH820414.1,INSD:EL314398.1,
                     INSD:EL127990.1,INSD:EL098256.1,INSD:AV809027.1,
                     INSD:CB263866.1,INSD:BP779598.1,INSD:EL280262.1,
                     INSD:EH957247.1,INSD:BP786275.1,INSD:EH807453.1,
                     INSD:EH944330.1,INSD:BP779241.1,INSD:EL189568.1,
                     INSD:EL200766.1,INSD:DR353976.1,INSD:EH955461.1,
                     INSD:DR354010.1,INSD:EH853905.1,INSD:EL145145.1,
                     INSD:DR368371.1,INSD:EL225769.1,INSD:EL065970.1,
                     INSD:EH827723.1,INSD:EH916787.1,INSD:EL108651.1,
                     INSD:EL258057.1,INSD:AV798282.1,INSD:EH882383.1,
                     INSD:EL217809.1,INSD:EL273405.1,INSD:EH953361.1,
                     INSD:EL155356.1,INSD:EG526474.1,INSD:DR353982.1,
                     INSD:BP626653.1,INSD:CB262166.1,INSD:EH941238.1,
                     INSD:EH837252.1,INSD:EH934519.1,INSD:CB260831.1,
                     INSD:EL298739.1,INSD:EH848831.1,INSD:EH904137.1,
                     INSD:EL066869.1,INSD:BP627517.1,INSD:BP794323.1,
                     INSD:EL214228.1,INSD:AV828183.1,INSD:AV804621.1,
                     INSD:EL131550.1,INSD:EH991760.1,INSD:EL295778.1,
                     INSD:CB262358.1,INSD:AV808425.1,INSD:EL311592.1,
                     INSD:AV819033.1,INSD:EL174419.1,INSD:EL337610.1,
                     INSD:EH927936.1,INSD:AV815156.1,INSD:DR353988.1,
                     INSD:EL340201.1,INSD:DR353932.1,INSD:BP784904.1,
                     INSD:AV819687.1,INSD:DR353955.1,INSD:EH870904.1,
                     INSD:BP791708.1,INSD:AV810700.1,INSD:AV518455.1,
                     INSD:DR353962.1,INSD:DR353990.1,INSD:BP636327.1,
                     INSD:BP629303.1,INSD:EL042564.1,INSD:BU635473.1,
                     INSD:EH797107.1,INSD:EL181468.1,INSD:EL238607.1,
                     INSD:EL118425.1,INSD:EL171368.1,INSD:EL036498.1,
                     INSD:DR368360.1,INSD:AV561437.1,INSD:BP793719.1,
                     INSD:AV804229.1,INSD:DR353983.1,INSD:EH861842.1,
                     INSD:EL096080.1,INSD:BP789423.1,INSD:EL153446.1,
                     INSD:EL256366.1,INSD:EH948702.1,INSD:AV792689.1,
                     INSD:EL105377.1,INSD:AV527171.1,INSD:BP784991.1,
                     INSD:EL330043.1,INSD:EL310202.1,INSD:EH877169.1,
                     INSD:EL077709.1,INSD:EL142482.1,INSD:EH975662.1,
                     INSD:EL198414.1,INSD:DR368365.1,INSD:EH908176.1,
                     INSD:EL063201.1,INSD:EH798087.1,INSD:EL294824.1,
                     INSD:EH873001.1,INSD:EH818939.1,INSD:EL070274.1,
                     INSD:EH881791.1,INSD:DR353958.1,INSD:BP791528.1,
                     INSD:BP791252.1,INSD:EH983679.1,INSD:EL175075.1,
                     INSD:AV814240.1,INSD:EL079437.1,INSD:EH968573.1,
                     INSD:AV811238.1,INSD:EH939861.1,INSD:EH985954.1,
                     INSD:AV789894.1,INSD:AV791573.1,INSD:EH873397.1,
                     INSD:DR353998.1,INSD:EH984453.1,INSD:EL162234.1,
                     INSD:EL014900.1,INSD:BP852093.1,INSD:AV817383.1,
                     INSD:EH853104.1,INSD:EH925019.1,INSD:EL321638.1,
                     INSD:DR353926.1,INSD:EL074189.1,INSD:EL182492.1,
                     INSD:EH879680.1,INSD:EL006140.1,INSD:AV526159.1,
                     INSD:AV520729.1,INSD:EL091641.1,INSD:EL033343.1,
                     INSD:BP787554.1,INSD:EL233351.1,INSD:DR368352.1,
                     INSD:EL339430.1,INSD:EL009298.1,INSD:DR353924.1,
                     INSD:EL091153.1,INSD:EL002377.1,INSD:EH804967.1,
                     INSD:EH896994.1,INSD:EL278122.1,INSD:BP794073.1,
                     INSD:AA712757.1,INSD:DR353970.1,INSD:DR353950.1,
                     INSD:EL084470.1,INSD:AV785533.1,INSD:DR368348.1,
                     INSD:EL171652.1,INSD:EL039536.1,INSD:EH915898.1,
                     INSD:BP792253.1,INSD:EH940776.1,INSD:AV810726.1,
                     INSD:AV440364.1,INSD:EH940479.1,INSD:EL130668.1,
                     INSD:EL105638.1,INSD:AV792010.1,INSD:EL124561.1,
                     INSD:EL278777.1,INSD:EL276569.1,INSD:DR353961.1,
                     INSD:EH923444.1,INSD:EH969242.1,INSD:EH822141.1,
                     INSD:EL187726.1,INSD:BP587043.1,INSD:DR368355.1,
                     INSD:AV792897.1,INSD:EH919180.1,INSD:DR353928.1,
                     INSD:EH821442.1,INSD:EL092744.1,INSD:DR353936.1,
                     INSD:BU636815.1,INSD:EL275714.1,INSD:EH954289.1,
                     INSD:EH894775.1,INSD:BP794295.1,INSD:BP667840.1,
                     INSD:EH857708.1,INSD:EL056911.1,INSD:EL311766.1,
                     INSD:BP854451.1,INSD:BP661614.1,INSD:EL066333.1,
                     INSD:AV519032.1,INSD:BP781896.1,INSD:EL307618.1,
                     INSD:EL265765.1,INSD:EH816013.1,INSD:EL273624.1,
                     INSD:EL319745.1,INSD:EL189454.1,INSD:EL340401.1,
                     INSD:EL123433.1,INSD:DR353931.1,INSD:DR353960.1,
                     INSD:EL209670.1,INSD:EL259010.1,INSD:BP782107.1,
                     INSD:EH959594.1,INSD:EL167439.1,INSD:EL222901.1,
                     INSD:BP790476.1,INSD:EH964409.1,INSD:EL238213.1,
                     INSD:DR368369.1,INSD:EL183174.1,INSD:EL000636.1,
                     INSD:BP827986.1,INSD:AV525223.1,INSD:EL107427.1,
                     INSD:EL138297.1,INSD:DR353949.1,INSD:EL078134.1,
                     INSD:DR354012.1,INSD:EL007440.1,INSD:EH856863.1,
                     INSD:DR353935.1,INSD:EL146439.1,INSD:AV800641.1,
                     INSD:EL257177.1,INSD:BP848289.1,INSD:EL306284.1,
                     INSD:AV823995.1,INSD:EH834573.1,INSD:DR353973.1,
                     INSD:EL243494.1,INSD:AV518531.1,INSD:EH971737.1,
                     INSD:EL051038.1,INSD:EL021891.1,INSD:EL280097.1,
                     INSD:EL021970.1,INSD:AV530948.1,INSD:BP788904.1,
                     INSD:DR368373.1,INSD:EL209002.1,INSD:EL139795.1,
                     INSD:EL087055.1,INSD:EH962374.1,INSD:EH940170.1,
                     INSD:EL188225.1,INSD:EL169700.1,INSD:EL227146.1,
                     INSD:EH817724.1,INSD:DR353986.1,INSD:AV830611.1,
                     INSD:DR353974.1,INSD:EH842914.1,INSD:EL242791.1,
                     INSD:BP608061.1,INSD:AV807363.1,INSD:EL331002.1,
                     INSD:EL188317.1,INSD:EL058327.1,INSD:EL124403.1,
                     INSD:BP662106.1,INSD:BP560537.2,INSD:EH926220.1,
                     INSD:EG526473.1,INSD:DR368374.1,INSD:EH808992.1,
                     INSD:AV527272.1,INSD:AV528017.1,INSD:EL218527.1,
                     INSD:BP780091.1,INSD:EH948395.1,INSD:EL189844.1,
                     INSD:EH828013.1,INSD:EH916673.1,INSD:EL078683.1,
                     INSD:EL164182.1,INSD:DR353945.1,INSD:R90528.1,
                     INSD:EL079815.1,INSD:EL220374.1,INSD:EH874912.1,
                     INSD:AV531477.1,INSD:AV786323.1,INSD:EH970872.1,
                     INSD:EL103130.1,INSD:EH897776.1,INSD:BP613285.1,
                     INSD:EL061980.1,INSD:EL185805.1,INSD:AV560672.1,
                     INSD:EH960073.1,INSD:EH914136.1,INSD:EL027457.1,
                     INSD:BP624314.1,INSD:AV533979.1,INSD:AV786691.1,
                     INSD:EH827478.1,INSD:EH899843.1,INSD:EL066855.1,
                     INSD:EH852746.1,INSD:BP781717.1,INSD:AV811206.1,
                     INSD:EL273549.1,INSD:AV798905.1,INSD:EL280545.1,
                     INSD:DR354006.1,INSD:BP866324.1,INSD:EL243919.1,
                     INSD:EL328312.1,INSD:BP635204.1,INSD:EL008479.1,
                     INSD:EH911887.1,INSD:EL095272.1,INSD:EL255181.1,
                     INSD:EL023313.1,INSD:EL033098.1,INSD:EH823607.1,
                     INSD:EL113047.1,INSD:DR353933.1,INSD:AV519856.1,
                     INSD:AV793087.1,INSD:EL312491.1,INSD:EL087445.1,
                     INSD:EH982384.1,INSD:EH959317.1,INSD:EL222649.1,
                     INSD:EL279577.1,INSD:BP792510.1,INSD:EH915697.1,
                     INSD:EH925400.1,INSD:EL139617.1,INSD:DR368347.1,
                     INSD:EL230004.1,INSD:EL003620.1,INSD:BP777879.1,
                     INSD:DR368366.1,INSD:EH804169.1,INSD:EL176444.1,
                     INSD:EL146164.1,INSD:EH834989.1,INSD:AV787676.1,
                     INSD:AV526964.1,INSD:EL226438.1,INSD:EH846237.1,
                     INSD:EH877614.1,INSD:EL072067.1,INSD:EH948550.1,
                     INSD:EH869503.1,INSD:EL012902.1,INSD:EL191175.1,
                     INSD:DR353957.1,INSD:EH895643.1,INSD:EL030157.1,
                     INSD:AV785102.1,INSD:EH958324.1,INSD:EL119857.1,
                     INSD:EH802291.1,INSD:EH818681.1,INSD:DR368351.1,
                     INSD:AV781760.1,INSD:EH931485.1,INSD:AV522146.1,
                     INSD:EG521717.1,INSD:DR353941.1,INSD:EG526459.1,
                     INSD:BP780059.1,INSD:CB264633.1,INSD:EL219044.1,
                     INSD:AV814713.1,INSD:EL336163.1,INSD:EH838695.1,
                     INSD:EL058500.1,INSD:BP590959.1,INSD:EH986970.1,
                     INSD:EL120856.1,INSD:EH836658.1,INSD:EH976891.1,
                     INSD:EL233328.1,INSD:EH960045.1,INSD:EL131048.1,
                     INSD:DR354002.1,INSD:EH909819.1,INSD:EH796529.1,
                     INSD:EL110979.1,INSD:EL309427.1,INSD:EL223923.1,
                     INSD:BP794756.1,INSD:EL072874.1,INSD:DR359427.1,
                     INSD:EL326674.1,INSD:EL114639.1,INSD:EL114551.1,
                     INSD:EL207857.1,INSD:EH962692.1,INSD:EL144570.1,
                     INSD:EL162806.1,INSD:EL235594.1,INSD:EH979582.1,
                     INSD:CB262783.1,INSD:EL072162.1,INSD:DR353964.1,
                     INSD:EL102366.1,INSD:AV533885.1,INSD:EL108921.1,
                     INSD:EL133785.1,INSD:EH974481.1,INSD:EG423041.1,
                     INSD:DR368359.1,INSD:EL270626.1,INSD:BP791485.1,
                     INSD:EH798865.1,INSD:EH987527.1,INSD:EL036548.1,
                     INSD:AV532147.1,INSD:EH944126.1,INSD:EH880672.1,
                     INSD:EL068666.1,INSD:EL085323.1,INSD:EL157541.1,
                     INSD:EL319444.1,INSD:EL179612.1,INSD:EL309982.1,
                     INSD:EL185050.1,INSD:EH934839.1,INSD:EH903511.1,
                     INSD:EL074527.1,INSD:DR353942.1,INSD:EL067086.1,
                     INSD:AV440467.1,INSD:EH894743.1,INSD:EL065043.1,
                     INSD:BP635895.1,INSD:EH822805.1,INSD:EH894322.1,
                     INSD:EL301549.1,INSD:AV792145.1,INSD:EH938756.1,
                     INSD:EL122286.1,INSD:EL326682.1,INSD:EH887348.1,
                     INSD:DR353984.1,INSD:EL308286.1,INSD:EL306216.1,
                     INSD:EL150971.1,INSD:EH985009.1,INSD:AV793040.1,
                     INSD:EH949221.1,INSD:BP861914.1,INSD:AV802677.1,
                     INSD:AV829899.1,INSD:AV533530.1,INSD:EL178873.1,
                     INSD:EH989152.1,INSD:CK117793.1,INSD:DR353997.1,
                     INSD:DR368372.1,INSD:BP668979.1,INSD:EH875996.1,
                     INSD:AV819021.1,INSD:EL110100.1,INSD:EL274502.1,
                     INSD:DR368357.1,INSD:EH888165.1,INSD:CB258014.1,
                     INSD:EL055265.1,INSD:EL338552.1,INSD:EH802259.1,
                     INSD:BP789882.1,INSD:EL006442.1,INSD:EL063890.1,
                     INSD:EL109636.1,INSD:BP786116.1,INSD:EH980540.1,
                     INSD:EH919305.1,INSD:EL219382.1,INSD:EH840797.1,
                     INSD:EL232443.1,INSD:EL114381.1,INSD:EH816313.1,
                     INSD:EL318661.1,INSD:EL179596.1,INSD:EL205840.1,
                     INSD:EL024001.1,INSD:EL154645.1,INSD:DR353968.1,
                     INSD:EL038121.1,INSD:BP792887.1,INSD:EL280151.1,
                     INSD:EL300286.1,INSD:EH892329.1,INSD:EL249040.1,
                     INSD:BP785047.1,INSD:EL253139.1,INSD:EH981609.1,
                     INSD:EH849402.1,INSD:BP786494.1,INSD:EL228359.1,
                     INSD:EL031397.1,INSD:EH932674.1,INSD:EL203762.1,
                     INSD:EH867695.1,INSD:AV820660.1,INSD:EL188600.1,
                     INSD:EL284742.1,INSD:AA597472.1,INSD:CA781515.1,
                     INSD:EL018566.1,INSD:EH994023.1,INSD:EL123950.1,
                     INSD:EH925619.1,INSD:EL025506.1,INSD:EL085593.1,
                     INSD:EL055670.1,INSD:EL147107.1,INSD:DR353989.1,
                     INSD:BP842106.1,INSD:EH833149.1,INSD:EL117570.1,
                     INSD:BP782882.1,INSD:EL224410.1,INSD:EL196146.1,
                     INSD:DR353999.1,INSD:EL248727.1,INSD:EH988523.1,
                     INSD:EH838812.1,INSD:EH963669.1,INSD:EH834226.1,
                     INSD:EH869828.1,INSD:EL178411.1,INSD:EL169027.1,
                     INSD:AV518131.1,INSD:DR353937.1,INSD:BP847578.1,
                     INSD:EL310490.1,INSD:EL249901.1,INSD:BP859963.1,
                     INSD:EL131211.1,INSD:EL242016.1,INSD:EL247357.1,
                     INSD:CB258027.1,INSD:EL012300.1,INSD:EL210864.1,
                     INSD:BP622188.1,INSD:EL058307.1,INSD:EL164204.1,
                     INSD:EH905662.1,INSD:EH817049.1,INSD:EL083591.1,
                     INSD:BP780515.1,INSD:EH822489.1,INSD:AV815958.1,
                     INSD:EL248321.1,INSD:AA597399.1,INSD:EH870533.1,
                     INSD:EH856059.1,INSD:BP662860.1,INSD:EL337527.1,
                     INSD:EH822750.1,INSD:EH855270.1,INSD:CB262094.1,
                     INSD:AV815373.1,INSD:EL158658.1,INSD:EH826161.1,
                     INSD:EL308794.1,INSD:DR353940.1,INSD:DR353925.1,
                     INSD:EL073027.1,INSD:EL236185.1,INSD:EL054833.1,
                     INSD:BP791466.1,INSD:EH873593.1,INSD:BP590856.1,
                     INSD:EH847743.1,INSD:EL029397.1,INSD:BP585960.1,
                     INSD:EH957734.1,INSD:EL027974.1,INSD:EL185826.1,
                     INSD:AV781765.1,INSD:BP788354.1,INSD:EL072059.1,
                     INSD:EL234392.1,INSD:DR354009.1,INSD:EH827054.1,
                     INSD:BP786724.1,INSD:BP784230.1,INSD:DR353953.1,
                     INSD:EL151307.1,INSD:AV802861.1,INSD:DR353946.1,
                     INSD:DR354001.1,INSD:DR363457.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY056175.1,INSD:AK226447.1,INSD:AY081658.1,
                     INSD:AK222039.1,INSD:AY062785.1,INSD:X65541.1"
                     /db_xref="TAIR:AT3G01500"
                     /db_xref="Araport:AT3G01500"
     mRNA            complement(join(194724..194891,195179..195337,
                     195406..195511,195609..195694,195788..195841,
                     195982..196098,196207..196255,196356..196505,
                     196664..196723,197652..197974))
                     /gene="CA1"
                     /locus_tag="AT3G01500"
                     /gene_synonym="ARABIDOPSIS THALIANA SALICYLIC ACID-BINDING
                     PROTEIN 3"
                     /gene_synonym="ATBCA1"
                     /gene_synonym="ATSABP3"
                     /gene_synonym="BETA CARBONIC ANHYDRASE 1"
                     /gene_synonym="carbonic anhydrase 1"
                     /gene_synonym="F4P13.5"
                     /gene_synonym="F4P13_5"
                     /gene_synonym="SABP3"
                     /gene_synonym="SALICYLIC ACID-BINDING PROTEIN 3"
                     /product="carbonic anhydrase 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH877822.1,INSD:EH910165.1,INSD:BP635674.1,
                     INSD:AV792965.1,INSD:EL198701.1,INSD:EL111093.1,
                     INSD:EH982739.1,INSD:EH911214.1,INSD:EG526458.1,
                     INSD:EH832300.1,INSD:EH962288.1,INSD:EH900871.1,
                     INSD:EL056800.1,INSD:EL079355.1,INSD:EH947153.1,
                     INSD:EH872580.1,INSD:EL032259.1,INSD:EL011797.1,
                     INSD:EH962094.1,INSD:EH867567.1,INSD:EL121465.1,
                     INSD:EH948009.1,INSD:EL145715.1,INSD:EL141434.1,
                     INSD:EL082089.1,INSD:EL291446.1,INSD:EH992902.1,
                     INSD:EL010210.1,INSD:EL091376.1,INSD:EH941059.1,
                     INSD:BP827222.1,INSD:EH820414.1,INSD:EL314398.1,
                     INSD:EH888426.1,INSD:EL127990.1,INSD:EL098256.1,
                     INSD:CB263866.1,INSD:EL277525.1,INSD:EL280262.1,
                     INSD:EH957247.1,INSD:EL207497.1,INSD:EH922462.1,
                     INSD:EH807453.1,INSD:EH944330.1,INSD:EL139308.1,
                     INSD:EL012073.1,INSD:EL200766.1,INSD:EL096183.1,
                     INSD:EH955461.1,INSD:EH921988.1,INSD:EL119348.1,
                     INSD:EL019222.1,INSD:EL056726.1,INSD:AV524984.1,
                     INSD:EL327521.1,INSD:EL229927.1,INSD:EH853905.1,
                     INSD:EL033160.1,INSD:EL041326.1,INSD:EL145145.1,
                     INSD:DR368371.1,INSD:EL225769.1,INSD:EL105063.1,
                     INSD:EH907791.1,INSD:EH849588.1,INSD:EH827723.1,
                     INSD:EL235476.1,INSD:EL157916.1,INSD:EH982576.1,
                     INSD:EL258057.1,INSD:EL060799.1,INSD:AV788483.1,
                     INSD:EL273405.1,INSD:EL217809.1,INSD:EH972484.1,
                     INSD:EH953361.1,INSD:EH993014.1,INSD:EL155356.1,
                     INSD:EG526474.1,INSD:EL336227.1,INSD:EH894111.1,
                     INSD:EH941238.1,INSD:EH837252.1,INSD:EH934519.1,
                     INSD:CB260831.1,INSD:EL298739.1,INSD:EL329424.1,
                     INSD:EL334421.1,INSD:EH848831.1,INSD:BP789742.1,
                     INSD:EL336630.1,INSD:EL085881.1,INSD:EL054010.1,
                     INSD:EH904137.1,INSD:EL066869.1,INSD:EL229590.1,
                     INSD:EH935666.1,INSD:EL119340.1,INSD:EL214228.1,
                     INSD:EL131550.1,INSD:EL295778.1,INSD:EL043030.1,
                     INSD:EL311592.1,INSD:EL174419.1,INSD:EH908023.1,
                     INSD:EL340201.1,INSD:EH821634.1,INSD:EL023735.1,
                     INSD:EL293606.1,INSD:EL175064.1,INSD:EL021451.1,
                     INSD:EL313510.1,INSD:EL072194.1,INSD:EL146288.1,
                     INSD:AV791944.1,INSD:EH870904.1,INSD:EH900802.1,
                     INSD:EL129532.1,INSD:EL170583.1,INSD:EL002778.1,
                     INSD:EL133462.1,INSD:EL042564.1,INSD:EL181468.1,
                     INSD:EH826567.1,INSD:EL171368.1,INSD:EH929777.1,
                     INSD:EL264621.1,INSD:EL286775.1,INSD:DR368350.1,
                     INSD:EL063861.1,INSD:BP788239.1,INSD:EH882286.1,
                     INSD:EL230044.1,INSD:EL246415.1,INSD:EL216030.1,
                     INSD:EL119285.1,INSD:EL039545.1,INSD:EL250520.1,
                     INSD:EL180394.1,INSD:EH839471.1,INSD:EL153446.1,
                     INSD:EL178606.1,INSD:EL105377.1,INSD:EL092318.1,
                     INSD:EL330043.1,INSD:EL310202.1,INSD:EL142482.1,
                     INSD:EL077709.1,INSD:EH960159.1,INSD:EL021449.1,
                     INSD:EL062740.1,INSD:BP636078.1,INSD:DR368365.1,
                     INSD:EL334062.1,INSD:EH908176.1,INSD:EH859170.1,
                     INSD:EL063201.1,INSD:EL041942.1,INSD:EL261720.1,
                     INSD:EL229077.1,INSD:EH798087.1,INSD:EL073841.1,
                     INSD:EL294824.1,INSD:EH873001.1,INSD:EH818939.1,
                     INSD:EL037105.1,INSD:EH993291.1,INSD:EL238833.1,
                     INSD:EL213435.1,INSD:EH883739.1,INSD:EH890408.1,
                     INSD:EL175075.1,INSD:EH836040.1,INSD:EL323601.1,
                     INSD:EL339867.1,INSD:EL241775.1,INSD:EL079437.1,
                     INSD:EH968573.1,INSD:AV531553.1,INSD:EL228119.1,
                     INSD:EH873397.1,INSD:EL009039.1,INSD:DR368358.1,
                     INSD:EL234350.1,INSD:EL128492.1,INSD:EH978506.1,
                     INSD:EL190055.1,INSD:EL242804.1,INSD:EH984453.1,
                     INSD:EL236861.1,INSD:EL014900.1,INSD:EH853104.1,
                     INSD:EL134316.1,INSD:EL228808.1,INSD:EL089775.1,
                     INSD:EH925019.1,INSD:EL035548.1,INSD:EL321638.1,
                     INSD:BP779705.1,INSD:EL081692.1,INSD:EL074189.1,
                     INSD:EL182492.1,INSD:EH879680.1,INSD:EL035147.1,
                     INSD:EL297563.1,INSD:BP821131.1,INSD:EH886010.1,
                     INSD:EL091641.1,INSD:EH875658.1,INSD:EL033343.1,
                     INSD:CK118268.1,INSD:EH966158.1,INSD:EL233351.1,
                     INSD:EH957068.1,INSD:EL319689.1,INSD:EL339430.1,
                     INSD:EL009298.1,INSD:EL091153.1,INSD:EH879293.1,
                     INSD:EL002377.1,INSD:EL241679.1,INSD:EH804967.1,
                     INSD:EH835290.1,INSD:EL225685.1,INSD:DR353970.1,
                     INSD:EH812392.1,INSD:DR368348.1,INSD:EL336947.1,
                     INSD:EL171652.1,INSD:EH915898.1,INSD:EH902058.1,
                     INSD:DR368377.1,INSD:EH940776.1,INSD:EH940479.1,
                     INSD:EL130668.1,INSD:EL105638.1,INSD:EL124561.1,
                     INSD:EL223764.1,INSD:EL241537.1,INSD:EH992126.1,
                     INSD:EL198664.1,INSD:EL180032.1,INSD:EH969242.1,
                     INSD:EL040329.1,INSD:EL149665.1,INSD:EH822141.1,
                     INSD:EL187726.1,INSD:EL080687.1,INSD:EH906425.1,
                     INSD:EH821442.1,INSD:BP781562.1,INSD:EL321633.1,
                     INSD:AV805466.1,INSD:EH842248.1,INSD:EL275714.1,
                     INSD:EH889209.1,INSD:EH965220.1,INSD:EH894775.1,
                     INSD:EH836329.1,INSD:EH857708.1,INSD:EL311766.1,
                     INSD:EL318395.1,INSD:EL066333.1,INSD:EL307618.1,
                     INSD:EL265765.1,INSD:EL142738.1,INSD:EL269408.1,
                     INSD:EL209111.1,INSD:EH816013.1,INSD:EL273624.1,
                     INSD:EL319745.1,INSD:EL309589.1,INSD:EL189454.1,
                     INSD:EL340401.1,INSD:EL259010.1,INSD:EL209670.1,
                     INSD:EL167439.1,INSD:EH959594.1,INSD:H37128.1,
                     INSD:EL222901.1,INSD:EL178749.1,INSD:EL325850.1,
                     INSD:EH964409.1,INSD:EL043805.1,INSD:EL142767.1,
                     INSD:EL183174.1,INSD:EL000636.1,INSD:EH903286.1,
                     INSD:EL324188.1,INSD:EL107427.1,INSD:EL138297.1,
                     INSD:EL060821.1,INSD:EL078134.1,INSD:DR354012.1,
                     INSD:AV807291.1,INSD:EL146439.1,INSD:EL257025.1,
                     INSD:EL227092.1,INSD:EL306284.1,INSD:EH956076.1,
                     INSD:EL122061.1,INSD:EH834573.1,INSD:EL027848.1,
                     INSD:DR353973.1,INSD:EL019350.1,INSD:N37186.1,
                     INSD:EL289856.1,INSD:EL132933.1,INSD:EH971737.1,
                     INSD:EL338457.1,INSD:EL282033.1,INSD:EH966085.1,
                     INSD:EL051038.1,INSD:EL280097.1,INSD:EH944030.1,
                     INSD:EH808400.1,INSD:EH873287.1,INSD:EL021891.1,
                     INSD:AV793153.1,INSD:EL261392.1,INSD:DR368373.1,
                     INSD:BP626144.1,INSD:EL139795.1,INSD:BP665282.1,
                     INSD:EL118568.1,INSD:EL282810.1,INSD:EH962374.1,
                     INSD:EL188225.1,INSD:EL169700.1,INSD:EH817724.1,
                     INSD:EL289646.1,INSD:EL176335.1,INSD:EH842914.1,
                     INSD:EL064706.1,INSD:EL309958.1,INSD:EL242791.1,
                     INSD:EL188317.1,INSD:EH828703.1,INSD:EL124403.1,
                     INSD:EL275499.1,INSD:EG526473.1,INSD:EH797257.1,
                     INSD:DR368374.1,INSD:EH808992.1,INSD:EH852094.1,
                     INSD:EH902283.1,INSD:EH964378.1,INSD:EH905381.1,
                     INSD:EH948395.1,INSD:EL189844.1,INSD:EH828013.1,
                     INSD:EH850026.1,INSD:EH916673.1,INSD:EL164182.1,
                     INSD:EH799322.1,INSD:R90528.1,INSD:EH951000.1,
                     INSD:EL079815.1,INSD:EL326902.1,INSD:EL163899.1,
                     INSD:EH850168.1,INSD:EL114525.1,INSD:EL220374.1,
                     INSD:EH874912.1,INSD:EH969208.1,INSD:EH964352.1,
                     INSD:EL103130.1,INSD:EH902380.1,INSD:EL144945.1,
                     INSD:EH897776.1,INSD:EL046080.1,INSD:EL070040.1,
                     INSD:EL061980.1,INSD:EL018514.1,INSD:EH914136.1,
                     INSD:EL027457.1,INSD:EL029947.1,INSD:EL304361.1,
                     INSD:EH899843.1,INSD:EH827478.1,INSD:EL273549.1,
                     INSD:EL316096.1,INSD:EL280545.1,INSD:EH983185.1,
                     INSD:EL243919.1,INSD:EL086364.1,INSD:EH911887.1,
                     INSD:EL008479.1,INSD:EL255181.1,INSD:EL095272.1,
                     INSD:EL146459.1,INSD:EH823607.1,INSD:EL033098.1,
                     INSD:EL023313.1,INSD:EH917715.1,INSD:EL113047.1,
                     INSD:EH939392.1,INSD:EL089448.1,INSD:EL016621.1,
                     INSD:EL312491.1,INSD:EH933760.1,INSD:EL222649.1,
                     INSD:EH982384.1,INSD:EL279577.1,INSD:EH915697.1,
                     INSD:EL139617.1,INSD:EH925400.1,INSD:EH925483.1,
                     INSD:EH839967.1,INSD:DR368347.1,INSD:EL188362.1,
                     INSD:DR368366.1,INSD:EH804169.1,INSD:EL312804.1,
                     INSD:EL176444.1,INSD:EL241542.1,INSD:EL190732.1,
                     INSD:EL206976.1,INSD:EL058581.1,INSD:EL311459.1,
                     INSD:EL226438.1,INSD:EH846237.1,INSD:EH877614.1,
                     INSD:EL072067.1,INSD:EH869503.1,INSD:EH948550.1,
                     INSD:EH819767.1,INSD:EL111783.1,INSD:EH895643.1,
                     INSD:EH820736.1,INSD:EH861309.1,INSD:EL003943.1,
                     INSD:EL030157.1,INSD:EL275697.1,INSD:EH958324.1,
                     INSD:EL119857.1,INSD:EH802291.1,INSD:DR368351.1,
                     INSD:AV810582.1,INSD:BP779298.1,INSD:EL191613.1,
                     INSD:EH931485.1,INSD:EG521717.1,INSD:EH976815.1,
                     INSD:EG526459.1,INSD:EH957457.1,INSD:EL239529.1,
                     INSD:EL219044.1,INSD:EH870826.1,INSD:EL084597.1,
                     INSD:EL120856.1,INSD:EL313842.1,INSD:EL211369.1,
                     INSD:EH836658.1,INSD:EH927481.1,INSD:EL290140.1,
                     INSD:EH976891.1,INSD:EL140361.1,INSD:EL131048.1,
                     INSD:EL326753.1,INSD:EH909819.1,INSD:EH796529.1,
                     INSD:EL110979.1,INSD:EL309427.1,INSD:EH837776.1,
                     INSD:EH978402.1,INSD:EL223923.1,INSD:DR359427.1,
                     INSD:EL326674.1,INSD:EL114639.1,INSD:EL114551.1,
                     INSD:EL207857.1,INSD:EL139347.1,INSD:EL149092.1,
                     INSD:EH962692.1,INSD:EL162806.1,INSD:EL235594.1,
                     INSD:EL006879.1,INSD:EL072162.1,INSD:EL272114.1,
                     INSD:AV809142.1,INSD:EL310335.1,INSD:EL277302.1,
                     INSD:EL108921.1,INSD:EL335277.1,INSD:EH974481.1,
                     INSD:EL259790.1,INSD:DR368359.1,INSD:EL082333.1,
                     INSD:EL074142.1,INSD:EL245551.1,INSD:EH798865.1,
                     INSD:EH987527.1,INSD:BP855891.1,INSD:EH944126.1,
                     INSD:EL191063.1,INSD:EL292759.1,INSD:EL134702.1,
                     INSD:EL234793.1,INSD:EL065591.1,INSD:EL220868.1,
                     INSD:EH944572.1,INSD:EL157541.1,INSD:AV525295.1,
                     INSD:BP784456.1,INSD:EL319444.1,INSD:EL179612.1,
                     INSD:EL185050.1,INSD:EL093187.1,INSD:EH903511.1,
                     INSD:EH798422.1,INSD:EL153029.1,INSD:EL067086.1,
                     INSD:EL065043.1,INSD:EH894322.1,INSD:EH822805.1,
                     INSD:EL301549.1,INSD:EH938756.1,INSD:EL122286.1,
                     INSD:EH893299.1,INSD:EL231120.1,INSD:EL134136.1,
                     INSD:EL308286.1,INSD:EL150971.1,INSD:EH985009.1,
                     INSD:EH949221.1,INSD:EL178873.1,INSD:EL210719.1,
                     INSD:EH989152.1,INSD:EL323064.1,INSD:EL235578.1,
                     INSD:EL021483.1,INSD:EH875996.1,INSD:EH807726.1,
                     INSD:EL121790.1,INSD:EH808038.1,INSD:EL181160.1,
                     INSD:EL129547.1,INSD:AV525304.1,INSD:EL274502.1,
                     INSD:DR368357.1,INSD:EH888165.1,INSD:EH992045.1,
                     INSD:EL338552.1,INSD:EH925201.1,INSD:EH802259.1,
                     INSD:EH800062.1,INSD:EL275470.1,INSD:EL006442.1,
                     INSD:EL063890.1,INSD:EL217146.1,INSD:EL109636.1,
                     INSD:EH980540.1,INSD:EL219382.1,INSD:EL124888.1,
                     INSD:EL232443.1,INSD:EH840797.1,INSD:EL060271.1,
                     INSD:EL285067.1,INSD:EL114381.1,INSD:EH816313.1,
                     INSD:EL318661.1,INSD:EL179596.1,INSD:EL170070.1,
                     INSD:EL205840.1,INSD:EL024001.1,INSD:EL154645.1,
                     INSD:EH833142.1,INSD:EH972916.1,INSD:EL038496.1,
                     INSD:EL038121.1,INSD:EL273197.1,INSD:EL280151.1,
                     INSD:EL300286.1,INSD:EL249040.1,INSD:EL210402.1,
                     INSD:EH849402.1,INSD:EH981609.1,INSD:EL081004.1,
                     INSD:EL228359.1,INSD:EL203762.1,INSD:EH932674.1,
                     INSD:EL031397.1,INSD:EH846359.1,INSD:EH867695.1,
                     INSD:EL126211.1,INSD:BP787716.1,INSD:EL188600.1,
                     INSD:EH899881.1,INSD:EL181807.1,INSD:EH898905.1,
                     INSD:EL284742.1,INSD:EL252123.1,INSD:DR368375.1,
                     INSD:EH927388.1,INSD:EL326638.1,INSD:EL018566.1,
                     INSD:EL123950.1,INSD:EH925619.1,INSD:EL276544.1,
                     INSD:EL025506.1,INSD:EL085593.1,INSD:EL055670.1,
                     INSD:EL320469.1,INSD:EL279124.1,INSD:EL147107.1,
                     INSD:EH867854.1,INSD:EH820272.1,INSD:EH833149.1,
                     INSD:EL101464.1,INSD:EL117570.1,INSD:EL224410.1,
                     INSD:EL196146.1,INSD:EH886300.1,INSD:EL248727.1,
                     INSD:EL157482.1,INSD:EH838812.1,INSD:EH988523.1,
                     INSD:EH963669.1,INSD:EH834226.1,INSD:EL169027.1,
                     INSD:EL178411.1,INSD:EL235663.1,INSD:EL310490.1,
                     INSD:EL249901.1,INSD:EL247357.1,INSD:EL242016.1,
                     INSD:EH802114.1,INSD:EL210864.1,INSD:EL012300.1,
                     INSD:EL326508.1,INSD:EL027087.1,INSD:EL236518.1,
                     INSD:EH814689.1,INSD:EH802786.1,INSD:EL092467.1,
                     INSD:EH817049.1,INSD:EL083591.1,INSD:EH832601.1,
                     INSD:EG453840.1,INSD:EH822489.1,INSD:EL248321.1,
                     INSD:EH856059.1,INSD:EL207211.1,INSD:EL337527.1,
                     INSD:EL061554.1,INSD:EH822750.1,INSD:EL111401.1,
                     INSD:EH826161.1,INSD:EL125615.1,INSD:EL159618.1,
                     INSD:EL047370.1,INSD:EL073027.1,INSD:EH980977.1,
                     INSD:EL054833.1,INSD:AV522157.1,INSD:EH848065.1,
                     INSD:EL303198.1,INSD:EH847743.1,INSD:EL033121.1,
                     INSD:EL029397.1,INSD:EL271877.1,INSD:EL185826.1,
                     INSD:EL067502.1,INSD:EL340223.1,INSD:EL047970.1,
                     INSD:EL264238.1,INSD:EH795614.1,INSD:EH800862.1,
                     INSD:EL072059.1,INSD:EH827054.1,INSD:EL329353.1,
                     INSD:EL184338.1,INSD:EH976116.1,INSD:EL259415.1,
                     INSD:EL200403.1,INSD:EL133468.1,INSD:DR363457.1,
                     INSD:EL178480.1,INSD:EH891769.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:AY091066.1"
                     /db_xref="TAIR:AT3G01500"
                     /db_xref="Araport:AT3G01500"
     CDS             complement(join(194853..194891,195179..195337,
                     195406..195511,195609..195694,195788..195841,
                     195982..196098,196207..196255,196356..196505,
                     196664..196725,197652..197873))
                     /gene="CA1"
                     /locus_tag="AT3G01500"
                     /gene_synonym="ARABIDOPSIS THALIANA SALICYLIC ACID-BINDING
                     PROTEIN 3"
                     /gene_synonym="ATBCA1"
                     /gene_synonym="ATSABP3"
                     /gene_synonym="BETA CARBONIC ANHYDRASE 1"
                     /gene_synonym="carbonic anhydrase 1"
                     /gene_synonym="F4P13.5"
                     /gene_synonym="F4P13_5"
                     /gene_synonym="SABP3"
                     /gene_synonym="SALICYLIC ACID-BINDING PROTEIN 3"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH877822.1,INSD:CA781483.1,INSD:EL198701.1,
                     INSD:EH982739.1,INSD:EH911214.1,INSD:DR368361.1,
                     INSD:EL056800.1,INSD:EH962288.1,INSD:EL079355.1,
                     INSD:BP858265.1,INSD:EL011797.1,INSD:EL032259.1,
                     INSD:EH872580.1,INSD:EL121465.1,INSD:EH948009.1,
                     INSD:EL082089.1,INSD:BP562138.2,INSD:EL010210.1,
                     INSD:EL091376.1,INSD:EH888426.1,INSD:EL277525.1,
                     INSD:DR354004.1,INSD:EL207497.1,INSD:EH922462.1,
                     INSD:EL012073.1,INSD:EL139308.1,INSD:EL096183.1,
                     INSD:DR368378.1,INSD:EL119348.1,INSD:EH921988.1,
                     INSD:EL019222.1,INSD:EL056726.1,INSD:DR237093.1,
                     INSD:AV524984.1,INSD:BP844708.1,INSD:EL033160.1,
                     INSD:EL229927.1,INSD:EL327521.1,INSD:EL041326.1,
                     INSD:EL105063.1,INSD:EH849588.1,INSD:EH907791.1,
                     INSD:EL157916.1,INSD:EL235476.1,INSD:EH795756.1,
                     INSD:EH982576.1,INSD:EL060799.1,INSD:AV788483.1,
                     INSD:BP839745.1,INSD:DR353934.1,INSD:EH972484.1,
                     INSD:EH993014.1,INSD:EL336227.1,INSD:DR353963.1,
                     INSD:EH894111.1,INSD:EL329424.1,INSD:EL334421.1,
                     INSD:EL336630.1,INSD:EL085881.1,INSD:EL054010.1,
                     INSD:EL229590.1,INSD:EL119340.1,INSD:EL043030.1,
                     INSD:DR353947.1,INSD:EH908023.1,INSD:AV830449.1,
                     INSD:EL023735.1,INSD:EH821634.1,INSD:EL021451.1,
                     INSD:EL175064.1,INSD:EL293606.1,INSD:EL072194.1,
                     INSD:EL313510.1,INSD:EG502497.1,INSD:AV791944.1,
                     INSD:DR353991.1,INSD:EH900802.1,INSD:EL129532.1,
                     INSD:DR354007.1,INSD:EL002778.1,INSD:EL170583.1,
                     INSD:EL133462.1,INSD:AV524397.1,INSD:EH826567.1,
                     INSD:EH929777.1,INSD:EL286775.1,INSD:EL264621.1,
                     INSD:EL255580.1,INSD:DR368350.1,INSD:EL063861.1,
                     INSD:DR353927.1,INSD:EH882286.1,INSD:EL230044.1,
                     INSD:EL216030.1,INSD:EL246415.1,INSD:EL039545.1,
                     INSD:EL180394.1,INSD:EL250520.1,INSD:EH839471.1,
                     INSD:AV442587.1,INSD:EL178606.1,INSD:DR353996.1,
                     INSD:DR354008.1,INSD:EL092318.1,INSD:EH901351.1,
                     INSD:EH960159.1,INSD:EL021449.1,INSD:EL020306.1,
                     INSD:BP636078.1,INSD:EL334062.1,INSD:EG494411.1,
                     INSD:EH859170.1,INSD:EL041942.1,INSD:EL229077.1,
                     INSD:EL261720.1,INSD:EL073841.1,INSD:EL037105.1,
                     INSD:EH993291.1,INSD:DR353951.1,INSD:DR353981.1,
                     INSD:EL238833.1,INSD:EL213435.1,INSD:EH890408.1,
                     INSD:EH883739.1,INSD:EH836040.1,INSD:EL241775.1,
                     INSD:EL339867.1,INSD:EL323601.1,INSD:DR353952.1,
                     INSD:EL228119.1,INSD:DR353979.1,INSD:EL009039.1,
                     INSD:CB255829.1,INSD:DR368358.1,INSD:EL234350.1,
                     INSD:EL128492.1,INSD:EH978506.1,INSD:EL190055.1,
                     INSD:EL242804.1,INSD:EL236861.1,INSD:EL134316.1,
                     INSD:EL089775.1,INSD:EL228808.1,INSD:DR353994.1,
                     INSD:EL035548.1,INSD:T04367.1,INSD:BP779705.1,
                     INSD:EL081692.1,INSD:DR353977.1,INSD:EL035147.1,
                     INSD:EL297563.1,INSD:BP821131.1,INSD:EH886010.1,
                     INSD:EH875658.1,INSD:CK118268.1,INSD:EH966158.1,
                     INSD:EH957068.1,INSD:EL249301.1,INSD:EL319689.1,
                     INSD:DR353985.1,INSD:EH879293.1,INSD:EL241679.1,
                     INSD:EH835290.1,INSD:EL225685.1,INSD:EH812392.1,
                     INSD:EL336947.1,INSD:EH902058.1,INSD:DR368377.1,
                     INSD:EL223764.1,INSD:EL241537.1,INSD:DR354000.1,
                     INSD:EH992126.1,INSD:EL198664.1,INSD:EL180032.1,
                     INSD:EL040329.1,INSD:EL149665.1,INSD:BU636478.1,
                     INSD:EL080687.1,INSD:EH906425.1,INSD:DR354003.1,
                     INSD:EL321633.1,INSD:BP781562.1,INSD:DR353995.1,
                     INSD:EH842248.1,INSD:EH889209.1,INSD:BP850795.1,
                     INSD:EH965220.1,INSD:EH836329.1,INSD:DR368370.1,
                     INSD:EL318395.1,INSD:EL142738.1,INSD:EL209111.1,
                     INSD:EL269408.1,INSD:EL309589.1,INSD:DR353993.1,
                     INSD:H37128.1,INSD:EH943661.1,INSD:EL178749.1,
                     INSD:EL043805.1,INSD:EL142767.1,INSD:EL325850.1,
                     INSD:DR353939.1,INSD:EH903286.1,INSD:EL324188.1,
                     INSD:AV525589.1,INSD:EL060821.1,INSD:EL257025.1,
                     INSD:EL227092.1,INSD:EH956076.1,INSD:EL122061.1,
                     INSD:EL027848.1,INSD:EL019350.1,INSD:N37186.1,
                     INSD:DR353965.1,INSD:AV525700.1,INSD:EL132933.1,
                     INSD:EL289856.1,INSD:EH966085.1,INSD:EL282033.1,
                     INSD:EL338457.1,INSD:BP842380.1,INSD:AV441642.1,
                     INSD:EH944030.1,INSD:EH873287.1,INSD:EH808400.1,
                     INSD:EL261392.1,INSD:BP851865.1,INSD:DR353966.1,
                     INSD:BP560716.1,INSD:EL118568.1,INSD:BP665282.1,
                     INSD:EL282810.1,INSD:DR353943.1,INSD:DR366647.1,
                     INSD:EG502499.1,INSD:EL289646.1,INSD:EL176335.1,
                     INSD:EL064706.1,INSD:EL309958.1,INSD:EH828703.1,
                     INSD:EL275499.1,INSD:EH797257.1,INSD:EH852094.1,
                     INSD:DR353980.1,INSD:EH902283.1,INSD:EH964378.1,
                     INSD:EH905381.1,INSD:DR354005.1,INSD:DR353930.1,
                     INSD:EH850026.1,INSD:EH799322.1,INSD:EH951000.1,
                     INSD:EH850168.1,INSD:EL114525.1,INSD:EL163899.1,
                     INSD:EL326902.1,INSD:EH969208.1,INSD:EH902380.1,
                     INSD:EL144945.1,INSD:AV441815.1,INSD:EL070040.1,
                     INSD:EL046080.1,INSD:EL018514.1,INSD:EL029947.1,
                     INSD:EL304361.1,INSD:DR353929.1,INSD:EL316096.1,
                     INSD:EH983185.1,INSD:EL086364.1,INSD:EL146459.1,
                     INSD:EH917715.1,INSD:EH939392.1,INSD:EL089448.1,
                     INSD:EL016621.1,INSD:EH933760.1,INSD:EH839967.1,
                     INSD:EH925483.1,INSD:EL188362.1,INSD:EL312804.1,
                     INSD:EL241542.1,INSD:EL190732.1,INSD:EL206976.1,
                     INSD:EL058581.1,INSD:EL311459.1,INSD:DR354011.1,
                     INSD:EL312355.1,INSD:EH819767.1,INSD:EL111783.1,
                     INSD:EH861309.1,INSD:EH820736.1,INSD:EL003943.1,
                     INSD:DR368379.1,INSD:EL275697.1,INSD:DR353992.1,
                     INSD:EL191613.1,INSD:BP779298.1,INSD:EH976815.1,
                     INSD:DR353971.1,INSD:EH957457.1,INSD:EL239529.1,
                     INSD:EL084597.1,INSD:EH870826.1,INSD:EL313842.1,
                     INSD:EL211369.1,INSD:EH927481.1,INSD:EL140361.1,
                     INSD:EL290140.1,INSD:EL326753.1,INSD:EH978402.1,
                     INSD:EH837776.1,INSD:N38247.1,INSD:EL149092.1,
                     INSD:EL139347.1,INSD:EL006879.1,INSD:EL272114.1,
                     INSD:EL310335.1,INSD:AV809142.1,INSD:DR353956.1,
                     INSD:EL277302.1,INSD:EL335277.1,INSD:EL259790.1,
                     INSD:EL074142.1,INSD:EL082333.1,INSD:EL245551.1,
                     INSD:BP855891.1,INSD:EL191063.1,INSD:EL292759.1,
                     INSD:EL134702.1,INSD:EL234793.1,INSD:EH944572.1,
                     INSD:EL220868.1,INSD:AV525295.1,INSD:BP784456.1,
                     INSD:EL093187.1,INSD:DR353959.1,INSD:EH798422.1,
                     INSD:EL153029.1,INSD:EH893299.1,INSD:EL134136.1,
                     INSD:EL231120.1,INSD:EG463640.1,INSD:EL210719.1,
                     INSD:EL235578.1,INSD:EL323064.1,INSD:EL021483.1,
                     INSD:EH807726.1,INSD:EL121790.1,INSD:EH808038.1,
                     INSD:EL181160.1,INSD:EL129547.1,INSD:AV525304.1,
                     INSD:EL097053.1,INSD:EH992045.1,INSD:EH925201.1,
                     INSD:EH800062.1,INSD:EL217146.1,INSD:EL124888.1,
                     INSD:EL060271.1,INSD:EL285067.1,INSD:EL170070.1,
                     INSD:EL038496.1,INSD:EH972916.1,INSD:EH833142.1,
                     INSD:EL273197.1,INSD:AV824068.1,INSD:EL210402.1,
                     INSD:EL081004.1,INSD:EL126211.1,INSD:EH846359.1,
                     INSD:EH899881.1,INSD:BP787716.1,INSD:EL181807.1,
                     INSD:EH898905.1,INSD:EL252123.1,INSD:BP814295.1,
                     INSD:DR368375.1,INSD:EH927388.1,INSD:EL326638.1,
                     INSD:EL276544.1,INSD:EH987645.1,INSD:EH867854.1,
                     INSD:EL279124.1,INSD:EH820272.1,INSD:EL101464.1,
                     INSD:EH886300.1,INSD:DR368354.1,INSD:EL157482.1,
                     INSD:EL235663.1,INSD:EH802114.1,INSD:EL326508.1,
                     INSD:EL027087.1,INSD:EL236518.1,INSD:EH814689.1,
                     INSD:EH802786.1,INSD:R29976.1,INSD:EL092467.1,
                     INSD:EL330993.1,INSD:EL304588.1,INSD:EH832601.1,
                     INSD:EG453840.1,INSD:AV525742.1,INSD:DR353978.1,
                     INSD:EL207211.1,INSD:EL061554.1,INSD:EL111401.1,
                     INSD:EL125615.1,INSD:EL159618.1,INSD:EL047370.1,
                     INSD:EH980977.1,INSD:EL262275.1,INSD:EH831988.1,
                     INSD:AV522157.1,INSD:EH848065.1,INSD:EL303198.1,
                     INSD:EL033121.1,INSD:EL271877.1,INSD:EL067502.1,
                     INSD:EL047970.1,INSD:EL340223.1,INSD:EH795614.1,
                     INSD:EH800862.1,INSD:EL264238.1,INSD:EH806115.1,
                     INSD:DR353948.1,INSD:DR368364.1,INSD:EL184338.1,
                     INSD:EL329353.1,INSD:DR353967.1,INSD:EH976116.1,
                     INSD:EL259415.1,INSD:DR353938.1,INSD:EL133468.1,
                     INSD:EL200403.1,INSD:EL178480.1,INSD:EH891769.1,
                     INSD:EH910165.1,INSD:BP635674.1,INSD:AV792965.1,
                     INSD:EL111093.1,INSD:CB258030.1,INSD:DR353987.1,
                     INSD:EG526458.1,INSD:EH832300.1,INSD:DR353969.1,
                     INSD:EH900871.1,INSD:EH947153.1,INSD:EH867567.1,
                     INSD:EH962094.1,INSD:BP846698.1,INSD:DR368353.1,
                     INSD:EL141434.1,INSD:EL145715.1,INSD:EL291446.1,
                     INSD:EH992902.1,INSD:DR368376.1,INSD:EL089759.1,
                     INSD:EH941059.1,INSD:EH820414.1,INSD:BP827222.1,
                     INSD:EL314398.1,INSD:EL127990.1,INSD:EL098256.1,
                     INSD:CB263866.1,INSD:EL280262.1,INSD:EH957247.1,
                     INSD:EH807453.1,INSD:EH944330.1,INSD:EL200766.1,
                     INSD:DR353976.1,INSD:EH955461.1,INSD:DR354010.1,
                     INSD:EH853905.1,INSD:EL145145.1,INSD:DR368371.1,
                     INSD:EL225769.1,INSD:EH827723.1,INSD:EL258057.1,
                     INSD:EH882383.1,INSD:EL217809.1,INSD:EL273405.1,
                     INSD:EH953361.1,INSD:EL155356.1,INSD:EG526474.1,
                     INSD:DR353982.1,INSD:EH941238.1,INSD:EH837252.1,
                     INSD:EH934519.1,INSD:CB260831.1,INSD:EL298739.1,
                     INSD:EH848831.1,INSD:BP789742.1,INSD:EH904137.1,
                     INSD:EL066869.1,INSD:EH935666.1,INSD:EL214228.1,
                     INSD:AV828183.1,INSD:EL131550.1,INSD:EL295778.1,
                     INSD:CB262358.1,INSD:EL311592.1,INSD:EL174419.1,
                     INSD:DR353988.1,INSD:EL340201.1,INSD:DR353932.1,
                     INSD:EL146288.1,INSD:DR353955.1,INSD:EH870904.1,
                     INSD:DR353962.1,INSD:DR353990.1,INSD:EL042564.1,
                     INSD:EL181468.1,INSD:BU635473.1,INSD:EL118425.1,
                     INSD:EL171368.1,INSD:DR368360.1,INSD:BP788239.1,
                     INSD:EL119285.1,INSD:DR353983.1,INSD:EL153446.1,
                     INSD:EL105377.1,INSD:AV527171.1,INSD:EL330043.1,
                     INSD:EL310202.1,INSD:EL077709.1,INSD:EL142482.1,
                     INSD:EL062740.1,INSD:DR368365.1,INSD:EH908176.1,
                     INSD:EL063201.1,INSD:EH798087.1,INSD:EL294824.1,
                     INSD:EH873001.1,INSD:EH818939.1,INSD:DR353958.1,
                     INSD:EL175075.1,INSD:EL079437.1,INSD:EH968573.1,
                     INSD:AV531553.1,INSD:EH985954.1,INSD:EH873397.1,
                     INSD:DR353998.1,INSD:EH984453.1,INSD:EL014900.1,
                     INSD:BP852093.1,INSD:EH853104.1,INSD:EH925019.1,
                     INSD:EL321638.1,INSD:DR353926.1,INSD:EL074189.1,
                     INSD:EL182492.1,INSD:EH879680.1,INSD:AV526159.1,
                     INSD:EL091641.1,INSD:EL033343.1,INSD:EL233351.1,
                     INSD:DR368352.1,INSD:EL009298.1,INSD:EL339430.1,
                     INSD:DR353924.1,INSD:EL091153.1,INSD:EL002377.1,
                     INSD:EH804967.1,INSD:EL278122.1,INSD:DR353970.1,
                     INSD:DR353950.1,INSD:DR368348.1,INSD:EL171652.1,
                     INSD:EH915898.1,INSD:EH940776.1,INSD:EH940479.1,
                     INSD:EL130668.1,INSD:EL105638.1,INSD:EL124561.1,
                     INSD:DR353961.1,INSD:EH969242.1,INSD:EH822141.1,
                     INSD:EL187726.1,INSD:DR368355.1,INSD:DR353928.1,
                     INSD:EL092744.1,INSD:EH821442.1,INSD:DR353936.1,
                     INSD:AV805466.1,INSD:BU636815.1,INSD:EL275714.1,
                     INSD:EH894775.1,INSD:EH857708.1,INSD:EL056911.1,
                     INSD:EL311766.1,INSD:EL066333.1,INSD:BP854451.1,
                     INSD:EL265765.1,INSD:EL307618.1,INSD:EH816013.1,
                     INSD:EL273624.1,INSD:EL319745.1,INSD:EL189454.1,
                     INSD:EL340401.1,INSD:EL123433.1,INSD:DR353931.1,
                     INSD:DR353960.1,INSD:EL209670.1,INSD:EL259010.1,
                     INSD:EH959594.1,INSD:EL167439.1,INSD:EL222901.1,
                     INSD:EH964409.1,INSD:DR368369.1,INSD:EL183174.1,
                     INSD:EL000636.1,INSD:BP827986.1,INSD:AV525223.1,
                     INSD:EL107427.1,INSD:EL138297.1,INSD:DR353949.1,
                     INSD:EL078134.1,INSD:DR354012.1,INSD:DR353935.1,
                     INSD:EL146439.1,INSD:AV807291.1,INSD:EL306284.1,
                     INSD:BP848289.1,INSD:AV823995.1,INSD:EH834573.1,
                     INSD:DR353973.1,INSD:EH971737.1,INSD:EL051038.1,
                     INSD:EL021891.1,INSD:EL280097.1,INSD:AV793153.1,
                     INSD:DR368373.1,INSD:BP626144.1,INSD:EL139795.1,
                     INSD:EH962374.1,INSD:EL188225.1,INSD:EL169700.1,
                     INSD:EL227146.1,INSD:EH817724.1,INSD:AV830611.1,
                     INSD:DR353986.1,INSD:DR353974.1,INSD:EH842914.1,
                     INSD:EL242791.1,INSD:EL188317.1,INSD:EL124403.1,
                     INSD:BP560537.2,INSD:EG526473.1,INSD:DR368374.1,
                     INSD:EH808992.1,INSD:AV527272.1,INSD:AV528017.1,
                     INSD:EH948395.1,INSD:EL189844.1,INSD:EH828013.1,
                     INSD:EH916673.1,INSD:EL164182.1,INSD:DR353945.1,
                     INSD:R90528.1,INSD:EL079815.1,INSD:EL220374.1,
                     INSD:EH874912.1,INSD:EH964352.1,INSD:EL103130.1,
                     INSD:EH897776.1,INSD:EL061980.1,INSD:EH960073.1,
                     INSD:EH914136.1,INSD:EL027457.1,INSD:EH827478.1,
                     INSD:EH899843.1,INSD:EL273549.1,INSD:EL280545.1,
                     INSD:EL243919.1,INSD:BP866324.1,INSD:DR354006.1,
                     INSD:EL008479.1,INSD:EH911887.1,INSD:EL095272.1,
                     INSD:EL255181.1,INSD:EL023313.1,INSD:EL033098.1,
                     INSD:EH823607.1,INSD:EL113047.1,INSD:DR353933.1,
                     INSD:EL312491.1,INSD:EL087445.1,INSD:EH982384.1,
                     INSD:EL222649.1,INSD:EL279577.1,INSD:EH915697.1,
                     INSD:EH925400.1,INSD:EL139617.1,INSD:DR368347.1,
                     INSD:DR368366.1,INSD:EH804169.1,INSD:EL176444.1,
                     INSD:AV526964.1,INSD:EL226438.1,INSD:EH846237.1,
                     INSD:EH877614.1,INSD:EL072067.1,INSD:EH948550.1,
                     INSD:EH869503.1,INSD:DR353957.1,INSD:EH895643.1,
                     INSD:EL030157.1,INSD:EH958324.1,INSD:EL119857.1,
                     INSD:EH802291.1,INSD:DR368351.1,INSD:AV810582.1,
                     INSD:EH931485.1,INSD:EG521717.1,INSD:DR353941.1,
                     INSD:EG526459.1,INSD:EL219044.1,INSD:CB264633.1,
                     INSD:EH838695.1,INSD:EL120856.1,INSD:EH836658.1,
                     INSD:EH976891.1,INSD:EH960045.1,INSD:EL131048.1,
                     INSD:EL110979.1,INSD:EH796529.1,INSD:EH909819.1,
                     INSD:DR354002.1,INSD:EL309427.1,INSD:EL223923.1,
                     INSD:DR359427.1,INSD:EL114639.1,INSD:EL114551.1,
                     INSD:EL326674.1,INSD:EL207857.1,INSD:EH962692.1,
                     INSD:EL162806.1,INSD:EL235594.1,INSD:EL072162.1,
                     INSD:DR353964.1,INSD:EL102366.1,INSD:EL108921.1,
                     INSD:EH974481.1,INSD:DR368359.1,INSD:EL270626.1,
                     INSD:EH798865.1,INSD:EH987527.1,INSD:EH944126.1,
                     INSD:EL065591.1,INSD:EL157541.1,INSD:EL179612.1,
                     INSD:EL319444.1,INSD:EL185050.1,INSD:EH903511.1,
                     INSD:DR353942.1,INSD:EL067086.1,INSD:EL065043.1,
                     INSD:AV440467.1,INSD:EH822805.1,INSD:EH894322.1,
                     INSD:EL301549.1,INSD:EH938756.1,INSD:EL122286.1,
                     INSD:EH887348.1,INSD:EL308286.1,INSD:DR353984.1,
                     INSD:EL150971.1,INSD:EH985009.1,INSD:EH949221.1,
                     INSD:BP861914.1,INSD:AV829899.1,INSD:EL178873.1,
                     INSD:EH989152.1,INSD:CK117793.1,INSD:DR353997.1,
                     INSD:DR368372.1,INSD:EH875996.1,INSD:EL274502.1,
                     INSD:DR368357.1,INSD:EH888165.1,INSD:EH802259.1,
                     INSD:EL338552.1,INSD:EL063890.1,INSD:EL006442.1,
                     INSD:EL275470.1,INSD:EL109636.1,INSD:EH980540.1,
                     INSD:EH919305.1,INSD:EL219382.1,INSD:EH840797.1,
                     INSD:EL232443.1,INSD:EL114381.1,INSD:EH816313.1,
                     INSD:EL318661.1,INSD:EL179596.1,INSD:EL205840.1,
                     INSD:EL024001.1,INSD:EL154645.1,INSD:DR353968.1,
                     INSD:EL038121.1,INSD:EL280151.1,INSD:EL300286.1,
                     INSD:EL249040.1,INSD:EH981609.1,INSD:EH849402.1,
                     INSD:EL228359.1,INSD:EL031397.1,INSD:EH932674.1,
                     INSD:EL203762.1,INSD:EH867695.1,INSD:EL188600.1,
                     INSD:EL284742.1,INSD:CA781515.1,INSD:EL123950.1,
                     INSD:EL018566.1,INSD:EH925619.1,INSD:EL085593.1,
                     INSD:EL025506.1,INSD:EL055670.1,INSD:EL320469.1,
                     INSD:EL147107.1,INSD:BP842106.1,INSD:DR353989.1,
                     INSD:EH833149.1,INSD:EL117570.1,INSD:EL224410.1,
                     INSD:EL196146.1,INSD:DR353999.1,INSD:EL248727.1,
                     INSD:EH988523.1,INSD:EH838812.1,INSD:EH963669.1,
                     INSD:EH834226.1,INSD:EL178411.1,INSD:EL169027.1,
                     INSD:DR353937.1,INSD:BP847578.1,INSD:EL310490.1,
                     INSD:EL249901.1,INSD:EL242016.1,INSD:EL247357.1,
                     INSD:BP859963.1,INSD:CB258027.1,INSD:EL012300.1,
                     INSD:EL210864.1,INSD:EL164204.1,INSD:EH817049.1,
                     INSD:EL083591.1,INSD:EH822489.1,INSD:EL248321.1,
                     INSD:EH870533.1,INSD:EH856059.1,INSD:EL337527.1,
                     INSD:EH822750.1,INSD:EH826161.1,INSD:DR353940.1,
                     INSD:DR353925.1,INSD:EL073027.1,INSD:EL236185.1,
                     INSD:EL054833.1,INSD:EH847743.1,INSD:EL029397.1,
                     INSD:EL185826.1,INSD:EL072059.1,INSD:EL234392.1,
                     INSD:EH827054.1,INSD:DR354009.1,INSD:DR353953.1,
                     INSD:DR353946.1,INSD:DR354001.1,INSD:DR363457.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AF428459.1,INSD:AF428284.1"
                     /note="carbonic anhydrase 1 (CA1); FUNCTIONS IN: carbonate
                     dehydratase activity, zinc ion binding; INVOLVED IN: in 6
                     processes; LOCATED IN: in 8 components; EXPRESSED IN: 23
                     plant structures; EXPRESSED DURING: 14 growth stages;
                     CONTAINS InterPro DOMAIN/s: Carbonic anhydrase,
                     prokaryotic-like, conserved site (InterPro:IPR015892),
                     Carbonic anhydrase (InterPro:IPR001765); BEST Arabidopsis
                     thaliana protein match is: carbonic anhydrase 2
                     (TAIR:AT5G14740.1); Has 5061 Blast hits to 5044 proteins
                     in 1509 species: Archae - 36; Bacteria - 3893; Metazoa -
                     59; Fungi - 207; Plants - 363; Viruses - 0; Other
                     Eukaryotes - 503 (source: NCBI BLink)."
                     /codon_start=1
                     /product="carbonic anhydrase 1"
                     /protein_id="AEE73675.1"
                     /db_xref="TAIR:AT3G01500"
                     /db_xref="Araport:AT3G01500"
                     /translation="MSTAPLSGFFLTSLSPSQSSLQKLSLRTSSTVACLPPASSSSSS
                     SSSSSSRSVPTLIRNEPVFAAPAPIIAPYWSEEMGTEAYDEAIEALKKLLIEKEELKT
                     VAAAKVEQITAALQTGTSSDKKAFDPVETIKQGFIKFKKEKYETNPALYGELAKGQSP
                     KYMVFACSDSRVCPSHVLDFQPGDAFVVRNIANMVPPFDKVKYGGVGAAIEYAVLHLK
                     VENIVVIGHSACGGIKGLMSFPLDGNNSTDFIEDWVKICLPAKSKVISELGDSAFEDQ
                     CGRCEREAVNVSLANLLTYPFVREGLVKGTLALKGGYYDFVKGAFELWGLEFGLSETS
                     SVKDVATILHWKL"
     CDS             complement(join(194853..194891,195179..195337,
                     195406..195511,195609..195694,195788..195841,
                     195982..196098,196207..196255,196356..196505,
                     196664..196716))
                     /gene="CA1"
                     /locus_tag="AT3G01500"
                     /gene_synonym="ARABIDOPSIS THALIANA SALICYLIC ACID-BINDING
                     PROTEIN 3"
                     /gene_synonym="ATBCA1"
                     /gene_synonym="ATSABP3"
                     /gene_synonym="BETA CARBONIC ANHYDRASE 1"
                     /gene_synonym="carbonic anhydrase 1"
                     /gene_synonym="F4P13.5"
                     /gene_synonym="F4P13_5"
                     /gene_synonym="SABP3"
                     /gene_synonym="SALICYLIC ACID-BINDING PROTEIN 3"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH877822.1,INSD:EH910165.1,INSD:BP635674.1,
                     INSD:AV792965.1,INSD:EL198701.1,INSD:EL111093.1,
                     INSD:EH982739.1,INSD:EH911214.1,INSD:EG526458.1,
                     INSD:EH832300.1,INSD:EH962288.1,INSD:EH900871.1,
                     INSD:EL056800.1,INSD:EL079355.1,INSD:EH947153.1,
                     INSD:EH872580.1,INSD:EL032259.1,INSD:EL011797.1,
                     INSD:EH962094.1,INSD:EH867567.1,INSD:EL121465.1,
                     INSD:EH948009.1,INSD:EL145715.1,INSD:EL141434.1,
                     INSD:EL082089.1,INSD:EL291446.1,INSD:EH992902.1,
                     INSD:EL010210.1,INSD:EL091376.1,INSD:EH941059.1,
                     INSD:BP827222.1,INSD:EH820414.1,INSD:EL314398.1,
                     INSD:EH888426.1,INSD:EL127990.1,INSD:EL098256.1,
                     INSD:CB263866.1,INSD:EL277525.1,INSD:EL280262.1,
                     INSD:EH957247.1,INSD:EL207497.1,INSD:EH922462.1,
                     INSD:EH807453.1,INSD:EH944330.1,INSD:EL139308.1,
                     INSD:EL012073.1,INSD:EL200766.1,INSD:EL096183.1,
                     INSD:EH955461.1,INSD:EH921988.1,INSD:EL119348.1,
                     INSD:EL019222.1,INSD:EL056726.1,INSD:AV524984.1,
                     INSD:EL327521.1,INSD:EL229927.1,INSD:EH853905.1,
                     INSD:EL033160.1,INSD:EL041326.1,INSD:EL145145.1,
                     INSD:DR368371.1,INSD:EL225769.1,INSD:EL105063.1,
                     INSD:EH907791.1,INSD:EH849588.1,INSD:EH827723.1,
                     INSD:EL235476.1,INSD:EL157916.1,INSD:EH982576.1,
                     INSD:EL258057.1,INSD:EL060799.1,INSD:AV788483.1,
                     INSD:EL273405.1,INSD:EL217809.1,INSD:EH972484.1,
                     INSD:EH953361.1,INSD:EH993014.1,INSD:EL155356.1,
                     INSD:EG526474.1,INSD:EL336227.1,INSD:EH894111.1,
                     INSD:EH941238.1,INSD:EH837252.1,INSD:EH934519.1,
                     INSD:CB260831.1,INSD:EL298739.1,INSD:EL329424.1,
                     INSD:EL334421.1,INSD:EH848831.1,INSD:BP789742.1,
                     INSD:EL336630.1,INSD:EL085881.1,INSD:EL054010.1,
                     INSD:EH904137.1,INSD:EL066869.1,INSD:EL229590.1,
                     INSD:EH935666.1,INSD:EL119340.1,INSD:EL214228.1,
                     INSD:EL131550.1,INSD:EL295778.1,INSD:EL043030.1,
                     INSD:EL311592.1,INSD:EL174419.1,INSD:EH908023.1,
                     INSD:EL340201.1,INSD:EH821634.1,INSD:EL023735.1,
                     INSD:EL293606.1,INSD:EL175064.1,INSD:EL021451.1,
                     INSD:EL313510.1,INSD:EL072194.1,INSD:EL146288.1,
                     INSD:AV791944.1,INSD:EH870904.1,INSD:EH900802.1,
                     INSD:EL129532.1,INSD:EL170583.1,INSD:EL002778.1,
                     INSD:EL133462.1,INSD:EL042564.1,INSD:EL181468.1,
                     INSD:EH826567.1,INSD:EL171368.1,INSD:EH929777.1,
                     INSD:EL264621.1,INSD:EL286775.1,INSD:DR368350.1,
                     INSD:EL063861.1,INSD:BP788239.1,INSD:EH882286.1,
                     INSD:EL230044.1,INSD:EL246415.1,INSD:EL216030.1,
                     INSD:EL119285.1,INSD:EL039545.1,INSD:EL250520.1,
                     INSD:EL180394.1,INSD:EH839471.1,INSD:EL153446.1,
                     INSD:EL178606.1,INSD:EL105377.1,INSD:EL092318.1,
                     INSD:EL330043.1,INSD:EL310202.1,INSD:EL142482.1,
                     INSD:EL077709.1,INSD:EH960159.1,INSD:EL021449.1,
                     INSD:EL062740.1,INSD:BP636078.1,INSD:DR368365.1,
                     INSD:EL334062.1,INSD:EH908176.1,INSD:EH859170.1,
                     INSD:EL063201.1,INSD:EL041942.1,INSD:EL261720.1,
                     INSD:EL229077.1,INSD:EH798087.1,INSD:EL073841.1,
                     INSD:EL294824.1,INSD:EH873001.1,INSD:EH818939.1,
                     INSD:EL037105.1,INSD:EH993291.1,INSD:EL238833.1,
                     INSD:EL213435.1,INSD:EH883739.1,INSD:EH890408.1,
                     INSD:EL175075.1,INSD:EH836040.1,INSD:EL323601.1,
                     INSD:EL339867.1,INSD:EL241775.1,INSD:EL079437.1,
                     INSD:EH968573.1,INSD:AV531553.1,INSD:EL228119.1,
                     INSD:EH873397.1,INSD:EL009039.1,INSD:DR368358.1,
                     INSD:EL234350.1,INSD:EL128492.1,INSD:EH978506.1,
                     INSD:EL190055.1,INSD:EL242804.1,INSD:EH984453.1,
                     INSD:EL236861.1,INSD:EL014900.1,INSD:EH853104.1,
                     INSD:EL134316.1,INSD:EL228808.1,INSD:EL089775.1,
                     INSD:EH925019.1,INSD:EL035548.1,INSD:EL321638.1,
                     INSD:BP779705.1,INSD:EL081692.1,INSD:EL074189.1,
                     INSD:EL182492.1,INSD:EH879680.1,INSD:EL035147.1,
                     INSD:EL297563.1,INSD:BP821131.1,INSD:EH886010.1,
                     INSD:EL091641.1,INSD:EH875658.1,INSD:EL033343.1,
                     INSD:CK118268.1,INSD:EH966158.1,INSD:EL233351.1,
                     INSD:EH957068.1,INSD:EL319689.1,INSD:EL339430.1,
                     INSD:EL009298.1,INSD:EL091153.1,INSD:EH879293.1,
                     INSD:EL002377.1,INSD:EL241679.1,INSD:EH804967.1,
                     INSD:EH835290.1,INSD:EL225685.1,INSD:DR353970.1,
                     INSD:EH812392.1,INSD:DR368348.1,INSD:EL336947.1,
                     INSD:EL171652.1,INSD:EH915898.1,INSD:EH902058.1,
                     INSD:DR368377.1,INSD:EH940776.1,INSD:EH940479.1,
                     INSD:EL130668.1,INSD:EL105638.1,INSD:EL124561.1,
                     INSD:EL223764.1,INSD:EL241537.1,INSD:EH992126.1,
                     INSD:EL198664.1,INSD:EL180032.1,INSD:EH969242.1,
                     INSD:EL040329.1,INSD:EL149665.1,INSD:EH822141.1,
                     INSD:EL187726.1,INSD:EL080687.1,INSD:EH906425.1,
                     INSD:EH821442.1,INSD:BP781562.1,INSD:EL321633.1,
                     INSD:AV805466.1,INSD:EH842248.1,INSD:EL275714.1,
                     INSD:EH889209.1,INSD:EH965220.1,INSD:EH894775.1,
                     INSD:EH836329.1,INSD:EH857708.1,INSD:EL311766.1,
                     INSD:EL318395.1,INSD:EL066333.1,INSD:EL307618.1,
                     INSD:EL265765.1,INSD:EL142738.1,INSD:EL269408.1,
                     INSD:EL209111.1,INSD:EH816013.1,INSD:EL273624.1,
                     INSD:EL319745.1,INSD:EL309589.1,INSD:EL189454.1,
                     INSD:EL340401.1,INSD:EL259010.1,INSD:EL209670.1,
                     INSD:EL167439.1,INSD:EH959594.1,INSD:H37128.1,
                     INSD:EL222901.1,INSD:EL178749.1,INSD:EL325850.1,
                     INSD:EH964409.1,INSD:EL043805.1,INSD:EL142767.1,
                     INSD:EL183174.1,INSD:EL000636.1,INSD:EH903286.1,
                     INSD:EL324188.1,INSD:EL107427.1,INSD:EL138297.1,
                     INSD:EL060821.1,INSD:EL078134.1,INSD:DR354012.1,
                     INSD:AV807291.1,INSD:EL146439.1,INSD:EL257025.1,
                     INSD:EL227092.1,INSD:EL306284.1,INSD:EH956076.1,
                     INSD:EL122061.1,INSD:EH834573.1,INSD:EL027848.1,
                     INSD:DR353973.1,INSD:EL019350.1,INSD:N37186.1,
                     INSD:EL289856.1,INSD:EL132933.1,INSD:EH971737.1,
                     INSD:EL338457.1,INSD:EL282033.1,INSD:EH966085.1,
                     INSD:EL051038.1,INSD:EL280097.1,INSD:EH944030.1,
                     INSD:EH808400.1,INSD:EH873287.1,INSD:EL021891.1,
                     INSD:AV793153.1,INSD:EL261392.1,INSD:DR368373.1,
                     INSD:BP626144.1,INSD:EL139795.1,INSD:BP665282.1,
                     INSD:EL118568.1,INSD:EL282810.1,INSD:EH962374.1,
                     INSD:EL188225.1,INSD:EL169700.1,INSD:EH817724.1,
                     INSD:EL289646.1,INSD:EL176335.1,INSD:EH842914.1,
                     INSD:EL064706.1,INSD:EL309958.1,INSD:EL242791.1,
                     INSD:EL188317.1,INSD:EH828703.1,INSD:EL124403.1,
                     INSD:EL275499.1,INSD:EG526473.1,INSD:EH797257.1,
                     INSD:DR368374.1,INSD:EH808992.1,INSD:EH852094.1,
                     INSD:EH902283.1,INSD:EH964378.1,INSD:EH905381.1,
                     INSD:EH948395.1,INSD:EL189844.1,INSD:EH828013.1,
                     INSD:EH850026.1,INSD:EH916673.1,INSD:EL164182.1,
                     INSD:EH799322.1,INSD:R90528.1,INSD:EH951000.1,
                     INSD:EL079815.1,INSD:EL326902.1,INSD:EL163899.1,
                     INSD:EH850168.1,INSD:EL114525.1,INSD:EL220374.1,
                     INSD:EH874912.1,INSD:EH969208.1,INSD:EH964352.1,
                     INSD:EL103130.1,INSD:EH902380.1,INSD:EL144945.1,
                     INSD:EH897776.1,INSD:EL046080.1,INSD:EL070040.1,
                     INSD:EL061980.1,INSD:EL018514.1,INSD:EH914136.1,
                     INSD:EL027457.1,INSD:EL029947.1,INSD:EL304361.1,
                     INSD:EH899843.1,INSD:EH827478.1,INSD:EL273549.1,
                     INSD:EL316096.1,INSD:EL280545.1,INSD:EH983185.1,
                     INSD:EL243919.1,INSD:EL086364.1,INSD:EH911887.1,
                     INSD:EL008479.1,INSD:EL255181.1,INSD:EL095272.1,
                     INSD:EL146459.1,INSD:EH823607.1,INSD:EL033098.1,
                     INSD:EL023313.1,INSD:EH917715.1,INSD:EL113047.1,
                     INSD:EH939392.1,INSD:EL089448.1,INSD:EL016621.1,
                     INSD:EL312491.1,INSD:EH933760.1,INSD:EL222649.1,
                     INSD:EH982384.1,INSD:EL279577.1,INSD:EH915697.1,
                     INSD:EL139617.1,INSD:EH925400.1,INSD:EH925483.1,
                     INSD:EH839967.1,INSD:DR368347.1,INSD:EL188362.1,
                     INSD:DR368366.1,INSD:EH804169.1,INSD:EL312804.1,
                     INSD:EL176444.1,INSD:EL241542.1,INSD:EL190732.1,
                     INSD:EL206976.1,INSD:EL058581.1,INSD:EL311459.1,
                     INSD:EL226438.1,INSD:EH846237.1,INSD:EH877614.1,
                     INSD:EL072067.1,INSD:EH869503.1,INSD:EH948550.1,
                     INSD:EH819767.1,INSD:EL111783.1,INSD:EH895643.1,
                     INSD:EH820736.1,INSD:EH861309.1,INSD:EL003943.1,
                     INSD:EL030157.1,INSD:EL275697.1,INSD:EH958324.1,
                     INSD:EL119857.1,INSD:EH802291.1,INSD:DR368351.1,
                     INSD:AV810582.1,INSD:BP779298.1,INSD:EL191613.1,
                     INSD:EH931485.1,INSD:EG521717.1,INSD:EH976815.1,
                     INSD:EG526459.1,INSD:EH957457.1,INSD:EL239529.1,
                     INSD:EL219044.1,INSD:EH870826.1,INSD:EL084597.1,
                     INSD:EL120856.1,INSD:EL313842.1,INSD:EL211369.1,
                     INSD:EH836658.1,INSD:EH927481.1,INSD:EL290140.1,
                     INSD:EH976891.1,INSD:EL140361.1,INSD:EL131048.1,
                     INSD:EL326753.1,INSD:EH909819.1,INSD:EH796529.1,
                     INSD:EL110979.1,INSD:EL309427.1,INSD:EH837776.1,
                     INSD:EH978402.1,INSD:EL223923.1,INSD:DR359427.1,
                     INSD:EL326674.1,INSD:EL114639.1,INSD:EL114551.1,
                     INSD:EL207857.1,INSD:EL139347.1,INSD:EL149092.1,
                     INSD:EH962692.1,INSD:EL162806.1,INSD:EL235594.1,
                     INSD:EL006879.1,INSD:EL072162.1,INSD:EL272114.1,
                     INSD:AV809142.1,INSD:EL310335.1,INSD:EL277302.1,
                     INSD:EL108921.1,INSD:EL335277.1,INSD:EH974481.1,
                     INSD:EL259790.1,INSD:DR368359.1,INSD:EL082333.1,
                     INSD:EL074142.1,INSD:EL245551.1,INSD:EH798865.1,
                     INSD:EH987527.1,INSD:BP855891.1,INSD:EH944126.1,
                     INSD:EL191063.1,INSD:EL292759.1,INSD:EL134702.1,
                     INSD:EL234793.1,INSD:EL065591.1,INSD:EL220868.1,
                     INSD:EH944572.1,INSD:EL157541.1,INSD:AV525295.1,
                     INSD:BP784456.1,INSD:EL319444.1,INSD:EL179612.1,
                     INSD:EL185050.1,INSD:EL093187.1,INSD:EH903511.1,
                     INSD:EH798422.1,INSD:EL153029.1,INSD:EL067086.1,
                     INSD:EL065043.1,INSD:EH894322.1,INSD:EH822805.1,
                     INSD:EL301549.1,INSD:EH938756.1,INSD:EL122286.1,
                     INSD:EH893299.1,INSD:EL231120.1,INSD:EL134136.1,
                     INSD:EL308286.1,INSD:EL150971.1,INSD:EH985009.1,
                     INSD:EH949221.1,INSD:EL178873.1,INSD:EL210719.1,
                     INSD:EH989152.1,INSD:EL323064.1,INSD:EL235578.1,
                     INSD:EL021483.1,INSD:EH875996.1,INSD:EH807726.1,
                     INSD:EL121790.1,INSD:EH808038.1,INSD:EL181160.1,
                     INSD:EL129547.1,INSD:AV525304.1,INSD:EL274502.1,
                     INSD:DR368357.1,INSD:EH888165.1,INSD:EH992045.1,
                     INSD:EL338552.1,INSD:EH925201.1,INSD:EH802259.1,
                     INSD:EH800062.1,INSD:EL275470.1,INSD:EL006442.1,
                     INSD:EL063890.1,INSD:EL217146.1,INSD:EL109636.1,
                     INSD:EH980540.1,INSD:EL219382.1,INSD:EL124888.1,
                     INSD:EL232443.1,INSD:EH840797.1,INSD:EL060271.1,
                     INSD:EL285067.1,INSD:EL114381.1,INSD:EH816313.1,
                     INSD:EL318661.1,INSD:EL179596.1,INSD:EL170070.1,
                     INSD:EL205840.1,INSD:EL024001.1,INSD:EL154645.1,
                     INSD:EH833142.1,INSD:EH972916.1,INSD:EL038496.1,
                     INSD:EL038121.1,INSD:EL273197.1,INSD:EL280151.1,
                     INSD:EL300286.1,INSD:EL249040.1,INSD:EL210402.1,
                     INSD:EH849402.1,INSD:EH981609.1,INSD:EL081004.1,
                     INSD:EL228359.1,INSD:EL203762.1,INSD:EH932674.1,
                     INSD:EL031397.1,INSD:EH846359.1,INSD:EH867695.1,
                     INSD:EL126211.1,INSD:BP787716.1,INSD:EL188600.1,
                     INSD:EH899881.1,INSD:EL181807.1,INSD:EH898905.1,
                     INSD:EL284742.1,INSD:EL252123.1,INSD:DR368375.1,
                     INSD:EH927388.1,INSD:EL326638.1,INSD:EL018566.1,
                     INSD:EL123950.1,INSD:EH925619.1,INSD:EL276544.1,
                     INSD:EL025506.1,INSD:EL085593.1,INSD:EL055670.1,
                     INSD:EL320469.1,INSD:EL279124.1,INSD:EL147107.1,
                     INSD:EH867854.1,INSD:EH820272.1,INSD:EH833149.1,
                     INSD:EL101464.1,INSD:EL117570.1,INSD:EL224410.1,
                     INSD:EL196146.1,INSD:EH886300.1,INSD:EL248727.1,
                     INSD:EL157482.1,INSD:EH838812.1,INSD:EH988523.1,
                     INSD:EH963669.1,INSD:EH834226.1,INSD:EL169027.1,
                     INSD:EL178411.1,INSD:EL235663.1,INSD:EL310490.1,
                     INSD:EL249901.1,INSD:EL247357.1,INSD:EL242016.1,
                     INSD:EH802114.1,INSD:EL210864.1,INSD:EL012300.1,
                     INSD:EL326508.1,INSD:EL027087.1,INSD:EL236518.1,
                     INSD:EH814689.1,INSD:EH802786.1,INSD:EL092467.1,
                     INSD:EH817049.1,INSD:EL083591.1,INSD:EH832601.1,
                     INSD:EG453840.1,INSD:EH822489.1,INSD:EL248321.1,
                     INSD:EH856059.1,INSD:EL207211.1,INSD:EL337527.1,
                     INSD:EL061554.1,INSD:EH822750.1,INSD:EL111401.1,
                     INSD:EH826161.1,INSD:EL125615.1,INSD:EL159618.1,
                     INSD:EL047370.1,INSD:EL073027.1,INSD:EH980977.1,
                     INSD:EL054833.1,INSD:AV522157.1,INSD:EH848065.1,
                     INSD:EL303198.1,INSD:EH847743.1,INSD:EL033121.1,
                     INSD:EL029397.1,INSD:EL271877.1,INSD:EL185826.1,
                     INSD:EL067502.1,INSD:EL340223.1,INSD:EL047970.1,
                     INSD:EL264238.1,INSD:EH795614.1,INSD:EH800862.1,
                     INSD:EL072059.1,INSD:EH827054.1,INSD:EL329353.1,
                     INSD:EL184338.1,INSD:EH976116.1,INSD:EL259415.1,
                     INSD:EL200403.1,INSD:EL133468.1,INSD:DR363457.1,
                     INSD:EL178480.1,INSD:EH891769.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:AY091066.1"
                     /note="carbonic anhydrase 1 (CA1); FUNCTIONS IN: carbonate
                     dehydratase activity, zinc ion binding; INVOLVED IN: in 6
                     processes; LOCATED IN: in 8 components; EXPRESSED IN: 22
                     plant structures; EXPRESSED DURING: 14 growth stages;
                     CONTAINS InterPro DOMAIN/s: Carbonic anhydrase,
                     prokaryotic-like, conserved site (InterPro:IPR015892),
                     Carbonic anhydrase (InterPro:IPR001765); BEST Arabidopsis
                     thaliana protein match is: carbonic anhydrase 2
                     (TAIR:AT5G14740.1); Has 5133 Blast hits to 5116 proteins
                     in 1526 species: Archae - 36; Bacteria - 3970; Metazoa -
                     59; Fungi - 207; Plants - 361; Viruses - 0; Other
                     Eukaryotes - 500 (source: NCBI BLink)."
                     /codon_start=1
                     /product="carbonic anhydrase 1"
                     /protein_id="AEE73676.1"
                     /db_xref="TAIR:AT3G01500"
                     /db_xref="Araport:AT3G01500"
                     /translation="MGTEAYDEAIEALKKLLIEKEELKTVAAAKVEQITAALQTGTSS
                     DKKAFDPVETIKQGFIKFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLD
                     FQPGDAFVVRNIANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLM
                     SFPLDGNNSTDFIEDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTY
                     PFVREGLVKGTLALKGGYYDFVKGAFELWGLEFGLSETSSVKDVATILHWKL"
     CDS             complement(join(195173..195337,195406..195511,
                     195609..195694,195788..195841,195982..196098,
                     196207..196255,196356..196505,196664..196725,
                     197652..197873))
                     /gene="CA1"
                     /locus_tag="AT3G01500"
                     /gene_synonym="ARABIDOPSIS THALIANA SALICYLIC ACID-BINDING
                     PROTEIN 3"
                     /gene_synonym="ATBCA1"
                     /gene_synonym="ATSABP3"
                     /gene_synonym="BETA CARBONIC ANHYDRASE 1"
                     /gene_synonym="carbonic anhydrase 1"
                     /gene_synonym="F4P13.5"
                     /gene_synonym="F4P13_5"
                     /gene_synonym="SABP3"
                     /gene_synonym="SALICYLIC ACID-BINDING PROTEIN 3"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH877822.1,INSD:CA781483.1,INSD:AV792086.1,
                     INSD:EL198701.1,INSD:EL161524.1,INSD:EL059042.1,
                     INSD:EH982739.1,INSD:EH911214.1,INSD:BP781326.1,
                     INSD:DR229078.1,INSD:DR368361.1,INSD:BP662998.1,
                     INSD:EL264654.1,INSD:EH962288.1,INSD:EL056800.1,
                     INSD:EL079355.1,INSD:EL280160.1,INSD:BP858265.1,
                     INSD:EL011797.1,INSD:EL032259.1,INSD:EH872580.1,
                     INSD:EL121465.1,INSD:BP785706.1,INSD:EH948009.1,
                     INSD:EL082089.1,INSD:BP562138.2,INSD:EL010210.1,
                     INSD:EL091376.1,INSD:BP783221.1,INSD:EH860579.1,
                     INSD:EH888426.1,INSD:EH954815.1,INSD:EL277525.1,
                     INSD:DR354004.1,INSD:EL319439.1,INSD:EG424819.1,
                     INSD:AV802704.1,INSD:EL207497.1,INSD:EH922462.1,
                     INSD:AV818289.1,INSD:EL012073.1,INSD:EL139308.1,
                     INSD:EL096183.1,INSD:DR368378.1,INSD:DR368356.1,
                     INSD:EH921988.1,INSD:EL119348.1,INSD:EL019222.1,
                     INSD:EL056726.1,INSD:DR237093.1,INSD:CB261984.1,
                     INSD:AV524984.1,INSD:BP844708.1,INSD:EL327521.1,
                     INSD:EL033160.1,INSD:EL229927.1,INSD:EL041326.1,
                     INSD:EL105063.1,INSD:EH907791.1,INSD:EH906596.1,
                     INSD:EH849588.1,INSD:EL157916.1,INSD:EL235476.1,
                     INSD:EH795756.1,INSD:EL289308.1,INSD:EH982576.1,
                     INSD:EL060799.1,INSD:BP839745.1,INSD:AV788483.1,
                     INSD:DR353934.1,INSD:EL263497.1,INSD:AV819061.1,
                     INSD:EL225195.1,INSD:EH972484.1,INSD:EH993014.1,
                     INSD:BP590248.1,INSD:EL336227.1,INSD:DR353963.1,
                     INSD:EH894111.1,INSD:EH919612.1,INSD:EL174397.1,
                     INSD:EL077850.1,INSD:EL329424.1,INSD:EL334421.1,
                     INSD:EH858371.1,INSD:BP784643.1,INSD:EL336630.1,
                     INSD:EL085881.1,INSD:EL054010.1,INSD:EL229590.1,
                     INSD:BP779940.1,INSD:EL119340.1,INSD:EH939939.1,
                     INSD:AV813835.1,INSD:AV789072.1,INSD:AV791912.1,
                     INSD:EL043030.1,INSD:EL252313.1,INSD:DR353947.1,
                     INSD:EL167037.1,INSD:BP651660.1,INSD:EH833049.1,
                     INSD:CB262646.1,INSD:AV830449.1,INSD:EH908023.1,
                     INSD:EL023735.1,INSD:EH821634.1,INSD:EL293606.1,
                     INSD:EL021451.1,INSD:EL175064.1,INSD:EL313510.1,
                     INSD:EL072194.1,INSD:T46803.1,INSD:EL279262.1,
                     INSD:EG502497.1,INSD:EL004474.1,INSD:DR353991.1,
                     INSD:BP777665.1,INSD:EH900802.1,INSD:EL129532.1,
                     INSD:DR354007.1,INSD:EL002778.1,INSD:EL170583.1,
                     INSD:EL133462.1,INSD:AV524397.1,INSD:EH826567.1,
                     INSD:BP641936.1,INSD:BP650597.1,INSD:EL286775.1,
                     INSD:EL264621.1,INSD:EL255580.1,INSD:EL241691.1,
                     INSD:DR368350.1,INSD:EL063861.1,INSD:DR353927.1,
                     INSD:EH882286.1,INSD:EL230044.1,INSD:EL216030.1,
                     INSD:EL246415.1,INSD:EH880957.1,INSD:EL039545.1,
                     INSD:EL180394.1,INSD:EL250520.1,INSD:EH839471.1,
                     INSD:AV442587.1,INSD:DR353996.1,INSD:EL178606.1,
                     INSD:DR354008.1,INSD:EL092318.1,INSD:EG480091.1,
                     INSD:EL243608.1,INSD:EL225965.1,INSD:EH960159.1,
                     INSD:EH901351.1,INSD:EL021449.1,INSD:EL020306.1,
                     INSD:AV795971.1,INSD:EL334062.1,INSD:EG494411.1,
                     INSD:EH859170.1,INSD:BP788041.1,INSD:EL041942.1,
                     INSD:BP593582.1,INSD:EL204061.1,INSD:AV801138.1,
                     INSD:EL229077.1,INSD:EL261720.1,INSD:EL073841.1,
                     INSD:BP585520.1,INSD:EH928740.1,INSD:EL037105.1,
                     INSD:BP780681.1,INSD:EH993291.1,INSD:DR353951.1,
                     INSD:DR353981.1,INSD:AV561791.1,INSD:EL238833.1,
                     INSD:BP594785.1,INSD:EL213435.1,INSD:EH890408.1,
                     INSD:EH883739.1,INSD:BP790583.1,INSD:EH836040.1,
                     INSD:EL323601.1,INSD:EL339867.1,INSD:EL241775.1,
                     INSD:EL250818.1,INSD:DR353952.1,INSD:CB260553.1,
                     INSD:EL228119.1,INSD:DR353979.1,INSD:CB255829.1,
                     INSD:EL009039.1,INSD:BP623910.1,INSD:DR368358.1,
                     INSD:EL234350.1,INSD:EL128492.1,INSD:EL046784.1,
                     INSD:EH978506.1,INSD:EL190055.1,INSD:EL242804.1,
                     INSD:EL236861.1,INSD:BP778039.1,INSD:AV809545.1,
                     INSD:EL134316.1,INSD:DR353994.1,INSD:EL089775.1,
                     INSD:EL228808.1,INSD:EL035548.1,INSD:T04367.1,
                     INSD:EL081692.1,INSD:DR353977.1,INSD:EL035147.1,
                     INSD:EL056886.1,INSD:EL297563.1,INSD:BP821131.1,
                     INSD:EH886010.1,INSD:EH875658.1,INSD:EG513510.1,
                     INSD:CK118268.1,INSD:EH966158.1,INSD:EH914261.1,
                     INSD:EH957068.1,INSD:BP659716.1,INSD:EL319689.1,
                     INSD:EL249301.1,INSD:DR353985.1,INSD:AV790292.1,
                     INSD:EH879293.1,INSD:EL241679.1,INSD:AV807670.1,
                     INSD:EH875874.1,INSD:EL298536.1,INSD:EH812392.1,
                     INSD:BP789461.1,INSD:EL336947.1,INSD:EH902058.1,
                     INSD:EL220886.1,INSD:DR368377.1,INSD:BP670804.1,
                     INSD:EH943624.1,INSD:EH874545.1,INSD:EL226270.1,
                     INSD:AV802888.1,INSD:EL223764.1,INSD:DR354000.1,
                     INSD:EL241537.1,INSD:EH992126.1,INSD:EL198664.1,
                     INSD:EH850006.1,INSD:EL180032.1,INSD:AV519423.1,
                     INSD:EL040329.1,INSD:BU636478.1,INSD:EL149665.1,
                     INSD:EL080687.1,INSD:EH851625.1,INSD:EH986979.1,
                     INSD:BP791202.1,INSD:EH906425.1,INSD:BP781116.1,
                     INSD:AV800880.1,INSD:DR354003.1,INSD:DR353995.1,
                     INSD:EL321633.1,INSD:AV796327.1,INSD:EH842248.1,
                     INSD:EH967070.1,INSD:EH897311.1,INSD:EH889209.1,
                     INSD:EL170370.1,INSD:BP850795.1,INSD:EH965220.1,
                     INSD:AV790339.1,INSD:EH836329.1,INSD:DR368370.1,
                     INSD:EL318395.1,INSD:EL142738.1,INSD:EH957640.1,
                     INSD:EL209111.1,INSD:EL269408.1,INSD:EH881044.1,
                     INSD:BP588209.1,INSD:AV439737.1,INSD:EL309589.1,
                     INSD:DR353993.1,INSD:AV519944.1,INSD:BP790852.1,
                     INSD:H37128.1,INSD:EH918221.1,INSD:EL015068.1,
                     INSD:EL184266.1,INSD:EH887122.1,INSD:EH943661.1,
                     INSD:EL178749.1,INSD:EL325850.1,INSD:EL043805.1,
                     INSD:EL142767.1,INSD:BP596837.1,INSD:BP631711.1,
                     INSD:DR353939.1,INSD:EH903286.1,INSD:EL324188.1,
                     INSD:EL106535.1,INSD:EL149222.1,INSD:BP585067.1,
                     INSD:AV525589.1,INSD:BP669570.1,INSD:EH968394.1,
                     INSD:EL060821.1,INSD:EL257025.1,INSD:EL227092.1,
                     INSD:EL012285.1,INSD:AV520074.1,INSD:EH956076.1,
                     INSD:EL122061.1,INSD:EL027848.1,INSD:EL019350.1,
                     INSD:N37186.1,INSD:BP785911.1,INSD:BP669016.1,
                     INSD:DR353965.1,INSD:AV525700.1,INSD:EL289856.1,
                     INSD:EL132933.1,INSD:AV441642.1,INSD:BP842380.1,
                     INSD:EL338457.1,INSD:EH966085.1,INSD:EL282033.1,
                     INSD:EH808400.1,INSD:EH873287.1,INSD:EL261392.1,
                     INSD:BP851865.1,INSD:DR353966.1,INSD:AV803068.1,
                     INSD:AV782771.1,INSD:BP560716.1,INSD:EH862273.1,
                     INSD:EL118568.1,INSD:EL150825.1,INSD:AV792563.1,
                     INSD:EL282810.1,INSD:DR353943.1,INSD:AV797335.1,
                     INSD:DR366647.1,INSD:AV796908.1,INSD:EG502499.1,
                     INSD:EL289646.1,INSD:EL176335.1,INSD:EL064706.1,
                     INSD:AA597896.1,INSD:EL309958.1,INSD:AI099882.1,
                     INSD:EH828703.1,INSD:AV820588.1,INSD:EH926639.1,
                     INSD:EL275499.1,INSD:AV793804.1,INSD:EG480090.1,
                     INSD:EH797257.1,INSD:EH852094.1,INSD:DR353980.1,
                     INSD:EH902283.1,INSD:EH964378.1,INSD:EH905381.1,
                     INSD:DR354005.1,INSD:BP594233.1,INSD:DR353930.1,
                     INSD:EH850026.1,INSD:EH799322.1,INSD:EH951000.1,
                     INSD:EL326902.1,INSD:EH850168.1,INSD:EL114525.1,
                     INSD:AV790999.1,INSD:EH969208.1,INSD:BP781381.1,
                     INSD:EH930368.1,INSD:EH902380.1,INSD:AV441815.1,
                     INSD:EL144945.1,INSD:EL046080.1,INSD:EL018514.1,
                     INSD:EL029947.1,INSD:EL304361.1,INSD:EL135884.1,
                     INSD:AV819477.1,INSD:EH845600.1,INSD:DR353929.1,
                     INSD:EH852563.1,INSD:EH898056.1,INSD:EL316096.1,
                     INSD:EH983185.1,INSD:EH913324.1,INSD:EH901033.1,
                     INSD:EL086364.1,INSD:AV558141.1,INSD:EL193675.1,
                     INSD:AV820814.1,INSD:EL146459.1,INSD:EH917715.1,
                     INSD:EL303857.1,INSD:EH977470.1,INSD:EH820567.1,
                     INSD:EH939392.1,INSD:EL089448.1,INSD:EL229223.1,
                     INSD:EL016621.1,INSD:EH933760.1,INSD:EH812825.1,
                     INSD:EL032774.1,INSD:EH983752.1,INSD:EH925483.1,
                     INSD:EH839967.1,INSD:EL188362.1,INSD:EL143405.1,
                     INSD:AV531073.1,INSD:EL312804.1,INSD:EL241542.1,
                     INSD:EL190732.1,INSD:EL034409.1,INSD:EL206976.1,
                     INSD:EH927646.1,INSD:EL058581.1,INSD:CB256227.1,
                     INSD:DR354011.1,INSD:EL311459.1,INSD:EL312355.1,
                     INSD:BP594601.1,INSD:AV813544.1,INSD:EL111783.1,
                     INSD:BP790851.1,INSD:BP658630.1,INSD:EG513471.1,
                     INSD:EH820736.1,INSD:EH861309.1,INSD:EL003943.1,
                     INSD:DR368379.1,INSD:BP781047.1,INSD:EL275697.1,
                     INSD:DR353992.1,INSD:CB261591.1,INSD:EH835256.1,
                     INSD:AV794200.1,INSD:EL191613.1,INSD:EH976815.1,
                     INSD:EH872750.1,INSD:DR353971.1,INSD:EH957457.1,
                     INSD:EL239529.1,INSD:BP636471.1,INSD:EH870826.1,
                     INSD:EL084597.1,INSD:EL313842.1,INSD:EL261216.1,
                     INSD:EL211369.1,INSD:EH927481.1,INSD:EL025667.1,
                     INSD:EL290140.1,INSD:EL140361.1,INSD:EH838976.1,
                     INSD:EL065715.1,INSD:AV792187.1,INSD:EL326753.1,
                     INSD:BP605042.1,INSD:EH978402.1,INSD:EH837776.1,
                     INSD:N38247.1,INSD:EL149092.1,INSD:EL139347.1,
                     INSD:EG513511.1,INSD:EL006879.1,INSD:EL272114.1,
                     INSD:EL310335.1,INSD:DR353956.1,INSD:EL277302.1,
                     INSD:BP655073.1,INSD:EL335277.1,INSD:EL259790.1,
                     INSD:EL082333.1,INSD:EL074142.1,INSD:EL245551.1,
                     INSD:BP855891.1,INSD:BP785840.1,INSD:EL191063.1,
                     INSD:AV804745.1,INSD:EL292759.1,INSD:EL134702.1,
                     INSD:EL234793.1,INSD:AV801011.1,INSD:EH944572.1,
                     INSD:EL220868.1,INSD:AV525295.1,INSD:EL093187.1,
                     INSD:DR353959.1,INSD:EH798422.1,INSD:EH810512.1,
                     INSD:EL153029.1,INSD:EH910990.1,INSD:EH868392.1,
                     INSD:BP789922.1,INSD:BP794617.1,INSD:BX838914.1,
                     INSD:EH893299.1,INSD:EL134136.1,INSD:EL231120.1,
                     INSD:AV795400.1,INSD:BP671735.1,INSD:EG463640.1,
                     INSD:AV534314.1,INSD:EL210719.1,INSD:EH892451.1,
                     INSD:EL323064.1,INSD:EL235578.1,INSD:EL021483.1,
                     INSD:EL316685.1,INSD:EH807726.1,INSD:EH808038.1,
                     INSD:EL181160.1,INSD:EL129547.1,INSD:AV525304.1,
                     INSD:BP659943.1,INSD:EL097053.1,INSD:EH992045.1,
                     INSD:EH925201.1,INSD:AV810517.1,INSD:EH800062.1,
                     INSD:BP795054.1,INSD:EL217146.1,INSD:EH976936.1,
                     INSD:EL124888.1,INSD:EL060271.1,INSD:EL285067.1,
                     INSD:EL054471.1,INSD:BP588373.1,INSD:AV796893.1,
                     INSD:EL170070.1,INSD:AV518425.1,INSD:EL328724.1,
                     INSD:EH972916.1,INSD:EH833142.1,INSD:EL038496.1,
                     INSD:BP787525.1,INSD:EL273197.1,INSD:AV531460.1,
                     INSD:AV518362.1,INSD:AV824068.1,INSD:EL295232.1,
                     INSD:EH923138.1,INSD:EL269047.1,INSD:EL210402.1,
                     INSD:BP645533.1,INSD:EL081004.1,INSD:EL114922.1,
                     INSD:AI099969.1,INSD:EH846359.1,INSD:EL126211.1,
                     INSD:EH899881.1,INSD:EL181807.1,INSD:EH898905.1,
                     INSD:BP814295.1,INSD:AV789249.1,INSD:EL252123.1,
                     INSD:DR368375.1,INSD:EH927388.1,INSD:EL326638.1,
                     INSD:BP786073.1,INSD:EH889723.1,INSD:EL276544.1,
                     INSD:EH987645.1,INSD:AV806041.1,INSD:AV803124.1,
                     INSD:BP590045.1,INSD:EH867854.1,INSD:EL279124.1,
                     INSD:EH820272.1,INSD:EH856790.1,INSD:EL101464.1,
                     INSD:BP794107.1,INSD:AV556571.1,INSD:EH886300.1,
                     INSD:BP782671.1,INSD:DR368354.1,INSD:EL157482.1,
                     INSD:BP794116.1,INSD:EL123141.1,INSD:EL235663.1,
                     INSD:DR378063.1,INSD:BP592816.1,INSD:EH802114.1,
                     INSD:EL326508.1,INSD:EL236518.1,INSD:EH814689.1,
                     INSD:EH802786.1,INSD:R29976.1,INSD:AV812940.1,
                     INSD:EL092467.1,INSD:EL330993.1,INSD:EL304588.1,
                     INSD:EH832601.1,INSD:EG453840.1,INSD:AV525742.1,
                     INSD:DR353978.1,INSD:EL207211.1,INSD:EL061554.1,
                     INSD:AV558879.1,INSD:EL111401.1,INSD:EL125615.1,
                     INSD:EL241119.1,INSD:BP784542.1,INSD:EL159618.1,
                     INSD:EL047370.1,INSD:EH980977.1,INSD:EL262275.1,
                     INSD:EH810716.1,INSD:EH831988.1,INSD:EH848065.1,
                     INSD:EL303198.1,INSD:EL033121.1,INSD:EL271877.1,
                     INSD:EL067502.1,INSD:EL340223.1,INSD:EL047970.1,
                     INSD:EL185364.1,INSD:AV808819.1,INSD:EH800862.1,
                     INSD:EH795614.1,INSD:EL264238.1,INSD:EH806115.1,
                     INSD:DR353948.1,INSD:DR368364.1,INSD:DR373401.1,
                     INSD:BP784105.1,INSD:EL329353.1,INSD:EL184338.1,
                     INSD:DR353967.1,INSD:EH976116.1,INSD:EH896008.1,
                     INSD:EL259415.1,INSD:DR353938.1,INSD:EL133468.1,
                     INSD:EL200403.1,INSD:EH907435.1,INSD:EH842657.1,
                     INSD:EL178480.1,INSD:EH891769.1,INSD:EH910165.1,
                     INSD:EL111093.1,INSD:CB258030.1,INSD:DR353987.1,
                     INSD:EG526458.1,INSD:EH832300.1,INSD:BP782954.1,
                     INSD:EL334819.1,INSD:BP781000.1,INSD:DR353969.1,
                     INSD:EH900871.1,INSD:EH947153.1,INSD:BP783241.1,
                     INSD:BP635617.1,INSD:AV558989.1,INSD:EL029493.1,
                     INSD:EH962094.1,INSD:EH867567.1,INSD:BP846698.1,
                     INSD:DR368353.1,INSD:EL141434.1,INSD:EL145715.1,
                     INSD:EL291446.1,INSD:EH992902.1,INSD:DR368376.1,
                     INSD:EL089759.1,INSD:EL003942.1,INSD:EH941059.1,
                     INSD:BP827222.1,INSD:EH820414.1,INSD:EL314398.1,
                     INSD:EL127990.1,INSD:EL098256.1,INSD:AV809027.1,
                     INSD:CB263866.1,INSD:BP779598.1,INSD:EL280262.1,
                     INSD:EH957247.1,INSD:BP786275.1,INSD:EH807453.1,
                     INSD:EH944330.1,INSD:BP779241.1,INSD:EL189568.1,
                     INSD:EL200766.1,INSD:DR353976.1,INSD:EH955461.1,
                     INSD:DR354010.1,INSD:EH853905.1,INSD:EL145145.1,
                     INSD:DR368371.1,INSD:EL225769.1,INSD:EL065970.1,
                     INSD:EH827723.1,INSD:EH916787.1,INSD:EL108651.1,
                     INSD:EL258057.1,INSD:AV798282.1,INSD:EH882383.1,
                     INSD:EL217809.1,INSD:EL273405.1,INSD:EH953361.1,
                     INSD:EL155356.1,INSD:EG526474.1,INSD:DR353982.1,
                     INSD:BP626653.1,INSD:CB262166.1,INSD:EH941238.1,
                     INSD:EH837252.1,INSD:EH934519.1,INSD:CB260831.1,
                     INSD:EL298739.1,INSD:EH848831.1,INSD:EH904137.1,
                     INSD:EL066869.1,INSD:BP627517.1,INSD:BP794323.1,
                     INSD:EL214228.1,INSD:AV828183.1,INSD:AV804621.1,
                     INSD:EL131550.1,INSD:EH991760.1,INSD:EL295778.1,
                     INSD:CB262358.1,INSD:AV808425.1,INSD:EL311592.1,
                     INSD:AV819033.1,INSD:EL174419.1,INSD:EL337610.1,
                     INSD:EH927936.1,INSD:AV815156.1,INSD:DR353988.1,
                     INSD:EL340201.1,INSD:DR353932.1,INSD:BP784904.1,
                     INSD:AV819687.1,INSD:DR353955.1,INSD:EH870904.1,
                     INSD:BP791708.1,INSD:AV810700.1,INSD:AV518455.1,
                     INSD:DR353962.1,INSD:DR353990.1,INSD:BP636327.1,
                     INSD:BP629303.1,INSD:EL042564.1,INSD:BU635473.1,
                     INSD:EH797107.1,INSD:EL181468.1,INSD:EL238607.1,
                     INSD:EL118425.1,INSD:EL171368.1,INSD:EL036498.1,
                     INSD:DR368360.1,INSD:AV561437.1,INSD:BP793719.1,
                     INSD:AV804229.1,INSD:DR353983.1,INSD:EH861842.1,
                     INSD:EL096080.1,INSD:BP789423.1,INSD:EL153446.1,
                     INSD:EL256366.1,INSD:EH948702.1,INSD:AV792689.1,
                     INSD:EL105377.1,INSD:AV527171.1,INSD:BP784991.1,
                     INSD:EL330043.1,INSD:EL310202.1,INSD:EH877169.1,
                     INSD:EL077709.1,INSD:EL142482.1,INSD:EH975662.1,
                     INSD:EL198414.1,INSD:DR368365.1,INSD:EH908176.1,
                     INSD:EL063201.1,INSD:EH798087.1,INSD:EL294824.1,
                     INSD:EH873001.1,INSD:EH818939.1,INSD:EL070274.1,
                     INSD:EH881791.1,INSD:DR353958.1,INSD:BP791528.1,
                     INSD:BP791252.1,INSD:EH983679.1,INSD:EL175075.1,
                     INSD:AV814240.1,INSD:EL079437.1,INSD:EH968573.1,
                     INSD:AV811238.1,INSD:EH939861.1,INSD:EH985954.1,
                     INSD:AV789894.1,INSD:AV791573.1,INSD:EH873397.1,
                     INSD:DR353998.1,INSD:EH984453.1,INSD:EL162234.1,
                     INSD:EL014900.1,INSD:BP852093.1,INSD:AV817383.1,
                     INSD:EH853104.1,INSD:EH925019.1,INSD:EL321638.1,
                     INSD:DR353926.1,INSD:EL074189.1,INSD:EL182492.1,
                     INSD:EH879680.1,INSD:EL006140.1,INSD:AV526159.1,
                     INSD:AV520729.1,INSD:EL091641.1,INSD:EL033343.1,
                     INSD:BP787554.1,INSD:EL233351.1,INSD:DR368352.1,
                     INSD:EL339430.1,INSD:EL009298.1,INSD:DR353924.1,
                     INSD:EL091153.1,INSD:EL002377.1,INSD:EH804967.1,
                     INSD:EH896994.1,INSD:EL278122.1,INSD:BP794073.1,
                     INSD:AA712757.1,INSD:DR353970.1,INSD:DR353950.1,
                     INSD:EL084470.1,INSD:AV785533.1,INSD:DR368348.1,
                     INSD:EL171652.1,INSD:EL039536.1,INSD:EH915898.1,
                     INSD:BP792253.1,INSD:EH940776.1,INSD:AV810726.1,
                     INSD:AV440364.1,INSD:EH940479.1,INSD:EL130668.1,
                     INSD:EL105638.1,INSD:AV792010.1,INSD:EL124561.1,
                     INSD:EL278777.1,INSD:EL276569.1,INSD:DR353961.1,
                     INSD:EH923444.1,INSD:EH969242.1,INSD:EH822141.1,
                     INSD:EL187726.1,INSD:BP587043.1,INSD:DR368355.1,
                     INSD:AV792897.1,INSD:EH919180.1,INSD:DR353928.1,
                     INSD:EH821442.1,INSD:EL092744.1,INSD:DR353936.1,
                     INSD:BU636815.1,INSD:EL275714.1,INSD:EH954289.1,
                     INSD:EH894775.1,INSD:BP794295.1,INSD:BP667840.1,
                     INSD:EH857708.1,INSD:EL056911.1,INSD:EL311766.1,
                     INSD:BP854451.1,INSD:BP661614.1,INSD:EL066333.1,
                     INSD:AV519032.1,INSD:BP781896.1,INSD:EL307618.1,
                     INSD:EL265765.1,INSD:EH816013.1,INSD:EL273624.1,
                     INSD:EL319745.1,INSD:EL189454.1,INSD:EL340401.1,
                     INSD:EL123433.1,INSD:DR353931.1,INSD:DR353960.1,
                     INSD:EL209670.1,INSD:EL259010.1,INSD:BP782107.1,
                     INSD:EH959594.1,INSD:EL167439.1,INSD:EL222901.1,
                     INSD:BP790476.1,INSD:EH964409.1,INSD:EL238213.1,
                     INSD:DR368369.1,INSD:EL183174.1,INSD:EL000636.1,
                     INSD:BP827986.1,INSD:AV525223.1,INSD:EL107427.1,
                     INSD:EL138297.1,INSD:DR353949.1,INSD:EL078134.1,
                     INSD:DR354012.1,INSD:EL007440.1,INSD:EH856863.1,
                     INSD:DR353935.1,INSD:EL146439.1,INSD:AV800641.1,
                     INSD:EL257177.1,INSD:BP848289.1,INSD:EL306284.1,
                     INSD:AV823995.1,INSD:EH834573.1,INSD:DR353973.1,
                     INSD:EL243494.1,INSD:AV518531.1,INSD:EH971737.1,
                     INSD:EL051038.1,INSD:EL021891.1,INSD:EL280097.1,
                     INSD:EL021970.1,INSD:AV530948.1,INSD:BP788904.1,
                     INSD:DR368373.1,INSD:EL209002.1,INSD:EL139795.1,
                     INSD:EL087055.1,INSD:EH962374.1,INSD:EH940170.1,
                     INSD:EL188225.1,INSD:EL169700.1,INSD:EL227146.1,
                     INSD:EH817724.1,INSD:DR353986.1,INSD:AV830611.1,
                     INSD:DR353974.1,INSD:EH842914.1,INSD:EL242791.1,
                     INSD:BP608061.1,INSD:AV807363.1,INSD:EL331002.1,
                     INSD:EL188317.1,INSD:EL058327.1,INSD:EL124403.1,
                     INSD:BP662106.1,INSD:BP560537.2,INSD:EH926220.1,
                     INSD:EG526473.1,INSD:DR368374.1,INSD:EH808992.1,
                     INSD:AV527272.1,INSD:AV528017.1,INSD:EL218527.1,
                     INSD:BP780091.1,INSD:EH948395.1,INSD:EL189844.1,
                     INSD:EH828013.1,INSD:EH916673.1,INSD:EL078683.1,
                     INSD:EL164182.1,INSD:DR353945.1,INSD:R90528.1,
                     INSD:EL079815.1,INSD:EL220374.1,INSD:EH874912.1,
                     INSD:AV531477.1,INSD:AV786323.1,INSD:EH970872.1,
                     INSD:EL103130.1,INSD:EH897776.1,INSD:BP613285.1,
                     INSD:EL061980.1,INSD:EL185805.1,INSD:AV560672.1,
                     INSD:EH960073.1,INSD:EH914136.1,INSD:EL027457.1,
                     INSD:BP624314.1,INSD:AV533979.1,INSD:AV786691.1,
                     INSD:EH827478.1,INSD:EH899843.1,INSD:EL066855.1,
                     INSD:EH852746.1,INSD:BP781717.1,INSD:AV811206.1,
                     INSD:EL273549.1,INSD:AV798905.1,INSD:EL280545.1,
                     INSD:DR354006.1,INSD:BP866324.1,INSD:EL243919.1,
                     INSD:EL328312.1,INSD:BP635204.1,INSD:EL008479.1,
                     INSD:EH911887.1,INSD:EL095272.1,INSD:EL255181.1,
                     INSD:EL023313.1,INSD:EL033098.1,INSD:EH823607.1,
                     INSD:EL113047.1,INSD:DR353933.1,INSD:AV519856.1,
                     INSD:AV793087.1,INSD:EL312491.1,INSD:EL087445.1,
                     INSD:EH982384.1,INSD:EH959317.1,INSD:EL222649.1,
                     INSD:EL279577.1,INSD:BP792510.1,INSD:EH915697.1,
                     INSD:EH925400.1,INSD:EL139617.1,INSD:DR368347.1,
                     INSD:EL230004.1,INSD:EL003620.1,INSD:BP777879.1,
                     INSD:DR368366.1,INSD:EH804169.1,INSD:EL176444.1,
                     INSD:EL146164.1,INSD:EH834989.1,INSD:AV787676.1,
                     INSD:AV526964.1,INSD:EL226438.1,INSD:EH846237.1,
                     INSD:EH877614.1,INSD:EL072067.1,INSD:EH948550.1,
                     INSD:EH869503.1,INSD:EL012902.1,INSD:EL191175.1,
                     INSD:DR353957.1,INSD:EH895643.1,INSD:EL030157.1,
                     INSD:AV785102.1,INSD:EH958324.1,INSD:EL119857.1,
                     INSD:EH802291.1,INSD:EH818681.1,INSD:DR368351.1,
                     INSD:AV781760.1,INSD:EH931485.1,INSD:AV522146.1,
                     INSD:EG521717.1,INSD:DR353941.1,INSD:EG526459.1,
                     INSD:BP780059.1,INSD:CB264633.1,INSD:EL219044.1,
                     INSD:AV814713.1,INSD:EL336163.1,INSD:EH838695.1,
                     INSD:EL058500.1,INSD:BP590959.1,INSD:EH986970.1,
                     INSD:EL120856.1,INSD:EH836658.1,INSD:EH976891.1,
                     INSD:EL233328.1,INSD:EH960045.1,INSD:EL131048.1,
                     INSD:DR354002.1,INSD:EH909819.1,INSD:EH796529.1,
                     INSD:EL110979.1,INSD:EL309427.1,INSD:EL223923.1,
                     INSD:BP794756.1,INSD:EL072874.1,INSD:DR359427.1,
                     INSD:EL326674.1,INSD:EL114639.1,INSD:EL114551.1,
                     INSD:EL207857.1,INSD:EH962692.1,INSD:EL144570.1,
                     INSD:EL162806.1,INSD:EL235594.1,INSD:EH979582.1,
                     INSD:CB262783.1,INSD:EL072162.1,INSD:DR353964.1,
                     INSD:EL102366.1,INSD:AV533885.1,INSD:EL108921.1,
                     INSD:EL133785.1,INSD:EH974481.1,INSD:EG423041.1,
                     INSD:DR368359.1,INSD:EL270626.1,INSD:BP791485.1,
                     INSD:EH798865.1,INSD:EH987527.1,INSD:EL036548.1,
                     INSD:AV532147.1,INSD:EH944126.1,INSD:EH880672.1,
                     INSD:EL068666.1,INSD:EL085323.1,INSD:EL157541.1,
                     INSD:EL319444.1,INSD:EL179612.1,INSD:EL309982.1,
                     INSD:EL185050.1,INSD:EH934839.1,INSD:EH903511.1,
                     INSD:EL074527.1,INSD:DR353942.1,INSD:EL067086.1,
                     INSD:AV440467.1,INSD:EH894743.1,INSD:EL065043.1,
                     INSD:BP635895.1,INSD:EH822805.1,INSD:EH894322.1,
                     INSD:EL301549.1,INSD:AV792145.1,INSD:EH938756.1,
                     INSD:EL122286.1,INSD:EL326682.1,INSD:EH887348.1,
                     INSD:DR353984.1,INSD:EL308286.1,INSD:EL306216.1,
                     INSD:EL150971.1,INSD:EH985009.1,INSD:AV793040.1,
                     INSD:EH949221.1,INSD:BP861914.1,INSD:AV802677.1,
                     INSD:AV829899.1,INSD:AV533530.1,INSD:EL178873.1,
                     INSD:EH989152.1,INSD:CK117793.1,INSD:DR353997.1,
                     INSD:DR368372.1,INSD:BP668979.1,INSD:EH875996.1,
                     INSD:AV819021.1,INSD:EL110100.1,INSD:EL274502.1,
                     INSD:DR368357.1,INSD:EH888165.1,INSD:CB258014.1,
                     INSD:EL055265.1,INSD:EL338552.1,INSD:EH802259.1,
                     INSD:BP789882.1,INSD:EL006442.1,INSD:EL063890.1,
                     INSD:EL109636.1,INSD:BP786116.1,INSD:EH980540.1,
                     INSD:EH919305.1,INSD:EL219382.1,INSD:EH840797.1,
                     INSD:EL232443.1,INSD:EL114381.1,INSD:EH816313.1,
                     INSD:EL318661.1,INSD:EL179596.1,INSD:EL205840.1,
                     INSD:EL024001.1,INSD:EL154645.1,INSD:DR353968.1,
                     INSD:EL038121.1,INSD:BP792887.1,INSD:EL280151.1,
                     INSD:EL300286.1,INSD:EH892329.1,INSD:EL249040.1,
                     INSD:BP785047.1,INSD:EL253139.1,INSD:EH981609.1,
                     INSD:EH849402.1,INSD:BP786494.1,INSD:EL228359.1,
                     INSD:EL031397.1,INSD:EH932674.1,INSD:EL203762.1,
                     INSD:EH867695.1,INSD:AV820660.1,INSD:EL188600.1,
                     INSD:EL284742.1,INSD:AA597472.1,INSD:CA781515.1,
                     INSD:EL018566.1,INSD:EH994023.1,INSD:EL123950.1,
                     INSD:EH925619.1,INSD:EL025506.1,INSD:EL085593.1,
                     INSD:EL055670.1,INSD:EL147107.1,INSD:DR353989.1,
                     INSD:BP842106.1,INSD:EH833149.1,INSD:EL117570.1,
                     INSD:BP782882.1,INSD:EL224410.1,INSD:EL196146.1,
                     INSD:DR353999.1,INSD:EL248727.1,INSD:EH988523.1,
                     INSD:EH838812.1,INSD:EH963669.1,INSD:EH834226.1,
                     INSD:EH869828.1,INSD:EL178411.1,INSD:EL169027.1,
                     INSD:AV518131.1,INSD:DR353937.1,INSD:BP847578.1,
                     INSD:EL310490.1,INSD:EL249901.1,INSD:BP859963.1,
                     INSD:EL131211.1,INSD:EL242016.1,INSD:EL247357.1,
                     INSD:CB258027.1,INSD:EL012300.1,INSD:EL210864.1,
                     INSD:BP622188.1,INSD:EL058307.1,INSD:EL164204.1,
                     INSD:EH905662.1,INSD:EH817049.1,INSD:EL083591.1,
                     INSD:BP780515.1,INSD:EH822489.1,INSD:AV815958.1,
                     INSD:EL248321.1,INSD:AA597399.1,INSD:EH870533.1,
                     INSD:EH856059.1,INSD:BP662860.1,INSD:EL337527.1,
                     INSD:EH822750.1,INSD:EH855270.1,INSD:CB262094.1,
                     INSD:AV815373.1,INSD:EL158658.1,INSD:EH826161.1,
                     INSD:EL308794.1,INSD:DR353940.1,INSD:DR353925.1,
                     INSD:EL073027.1,INSD:EL236185.1,INSD:EL054833.1,
                     INSD:BP791466.1,INSD:EH873593.1,INSD:BP590856.1,
                     INSD:EH847743.1,INSD:EL029397.1,INSD:BP585960.1,
                     INSD:EH957734.1,INSD:EL027974.1,INSD:EL185826.1,
                     INSD:AV781765.1,INSD:BP788354.1,INSD:EL072059.1,
                     INSD:EL234392.1,INSD:DR354009.1,INSD:EH827054.1,
                     INSD:BP786724.1,INSD:BP784230.1,INSD:DR353953.1,
                     INSD:EL151307.1,INSD:AV802861.1,INSD:DR353946.1,
                     INSD:DR354001.1,INSD:DR363457.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY056175.1,INSD:AK226447.1,INSD:AY081658.1,
                     INSD:AK222039.1,INSD:AY062785.1,INSD:X65541.1"
                     /note="carbonic anhydrase 1 (CA1); FUNCTIONS IN: carbonate
                     dehydratase activity, zinc ion binding; INVOLVED IN: in 6
                     processes; LOCATED IN: in 7 components; EXPRESSED IN: 22
                     plant structures; EXPRESSED DURING: 14 growth stages;
                     CONTAINS InterPro DOMAIN/s: Carbonic anhydrase,
                     prokaryotic-like, conserved site (InterPro:IPR015892),
                     Carbonic anhydrase (InterPro:IPR001765); BEST Arabidopsis
                     thaliana protein match is: carbonic anhydrase 2
                     (TAIR:AT5G14740.1); Has 5138 Blast hits to 5121 proteins
                     in 1526 species: Archae - 36; Bacteria - 3970; Metazoa -
                     59; Fungi - 207; Plants - 363; Viruses - 0; Other
                     Eukaryotes - 503 (source: NCBI BLink)."
                     /codon_start=1
                     /product="carbonic anhydrase 1"
                     /protein_id="AEE73677.1"
                     /db_xref="TAIR:AT3G01500"
                     /db_xref="Araport:AT3G01500"
                     /translation="MSTAPLSGFFLTSLSPSQSSLQKLSLRTSSTVACLPPASSSSSS
                     SSSSSSRSVPTLIRNEPVFAAPAPIIAPYWSEEMGTEAYDEAIEALKKLLIEKEELKT
                     VAAAKVEQITAALQTGTSSDKKAFDPVETIKQGFIKFKKEKYETNPALYGELAKGQSP
                     KYMVFACSDSRVCPSHVLDFQPGDAFVVRNIANMVPPFDKVKYGGVGAAIEYAVLHLK
                     VENIVVIGHSACGGIKGLMSFPLDGNNSTDFIEDWVKICLPAKSKVISELGDSAFEDQ
                     CGRCEREAVNVSLANLLTYPFVREGLVKGTLALKGGYYDFVKGAFELWGLEFGLSETS
                     SV"
     CDS             complement(join(195173..195337,195406..195511,
                     195609..195694,195788..195841,195982..196098,
                     196207..196255,196356..196505,196664..196716))
                     /gene="CA1"
                     /locus_tag="AT3G01500"
                     /gene_synonym="ARABIDOPSIS THALIANA SALICYLIC ACID-BINDING
                     PROTEIN 3"
                     /gene_synonym="ATBCA1"
                     /gene_synonym="ATSABP3"
                     /gene_synonym="BETA CARBONIC ANHYDRASE 1"
                     /gene_synonym="carbonic anhydrase 1"
                     /gene_synonym="F4P13.5"
                     /gene_synonym="F4P13_5"
                     /gene_synonym="SABP3"
                     /gene_synonym="SALICYLIC ACID-BINDING PROTEIN 3"
                     /codon_start=1
                     /product="carbonic anhydrase 1"
                     /protein_id="ANM64771.1"
                     /db_xref="Araport:AT3G01500"
                     /db_xref="TAIR:AT3G01500"
                     /translation="MGTEAYDEAIEALKKLLIEKEELKTVAAAKVEQITAALQTGTSS
                     DKKAFDPVETIKQGFIKFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLD
                     FQPGDAFVVRNIANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLM
                     SFPLDGNNSTDFIEDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTY
                     PFVREGLVKGTLALKGGYYDFVKGAFELWGLEFGLSETSSV"
     gene            complement(198322..201810)
                     /gene="LSF1"
                     /locus_tag="AT3G01510"
                     /gene_synonym="F4P13.6"
                     /gene_synonym="F4P13_6"
                     /gene_synonym="like SEX4 1"
                     /note="Encodes a putative phosphatase, LSF1, required for
                     normal starch turnover in leaves."
                     /db_xref="Araport:AT3G01510"
                     /db_xref="TAIR:AT3G01510"
     mRNA            complement(join(198322..198977,199104..199248,
                     199424..199536,199649..199754,199859..200074,
                     200166..200287,200383..200451,200552..201011,
                     201174..201280,201368..201742))
                     /gene="LSF1"
                     /locus_tag="AT3G01510"
                     /gene_synonym="F4P13.6"
                     /gene_synonym="F4P13_6"
                     /gene_synonym="like SEX4 1"
                     /product="like SEX4 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV556182.1,INSD:ES104588.1,INSD:DR349916.1,
                     INSD:EL209275.1,INSD:EH925360.1,INSD:BX840724.1,
                     INSD:EH882493.1,INSD:BE528801.1,INSD:AV525376.1,
                     INSD:BE526414.1,INSD:ES107419.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:AY086403.1"
                     /db_xref="TAIR:AT3G01510"
                     /db_xref="Araport:AT3G01510"
     mRNA            complement(join(198653..198977,199104..199248,
                     199424..199536,199649..199754,199859..200074,
                     200166..200287,200383..200451,200552..201027,
                     201174..201311))
                     /gene="LSF1"
                     /locus_tag="AT3G01510"
                     /gene_synonym="F4P13.6"
                     /gene_synonym="F4P13_6"
                     /gene_synonym="like SEX4 1"
                     /product="like SEX4 1"
                     /db_xref="Araport:AT3G01510"
                     /db_xref="TAIR:AT3G01510"
     mRNA            complement(join(198667..198977,199104..199248,
                     199424..199536,199649..199754,199859..200074,
                     200166..200287,200383..200451,200552..201027,
                     201174..201280,201368..201810))
                     /gene="LSF1"
                     /locus_tag="AT3G01510"
                     /gene_synonym="F4P13.6"
                     /gene_synonym="F4P13_6"
                     /gene_synonym="like SEX4 1"
                     /product="like SEX4 1"
                     /db_xref="Araport:AT3G01510"
                     /db_xref="TAIR:AT3G01510"
     CDS             complement(join(198855..198977,199104..199248,
                     199424..199536,199649..199754,199859..200074,
                     200166..200287,200383..200451,200552..201011,
                     201174..201280,201368..201682))
                     /gene="LSF1"
                     /locus_tag="AT3G01510"
                     /gene_synonym="F4P13.6"
                     /gene_synonym="F4P13_6"
                     /gene_synonym="like SEX4 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV556182.1,INSD:ES104588.1,INSD:DR349916.1,
                     INSD:EL209275.1,INSD:EH925360.1,INSD:BX840724.1,
                     INSD:EH882493.1,INSD:BE528801.1,INSD:AV525376.1,
                     INSD:BE526414.1,INSD:ES107419.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:AY086403.1"
                     /note="like SEX4 1 (LSF1); FUNCTIONS IN: protein
                     tyrosine/serine/threonine phosphatase activity; INVOLVED
                     IN: starch catabolic process; LOCATED IN: starch grain,
                     chloroplast, chloroplast stroma; EXPRESSED IN: 23 plant
                     structures; EXPRESSED DURING: 13 growth stages; CONTAINS
                     InterPro DOMAIN/s: Dual specificity phosphatase, catalytic
                     domain (InterPro:IPR000340), PDZ/DHR/GLGF
                     (InterPro:IPR001478), Dual specificity phosphatase,
                     subgroup, catalytic domain (InterPro:IPR020422); BEST
                     Arabidopsis thaliana protein match is: dual specificity
                     protein phosphatase (DsPTP1) family protein
                     (TAIR:AT3G52180.1); Has 834 Blast hits to 834 proteins in
                     152 species: Archae - 0; Bacteria - 14; Metazoa - 310;
                     Fungi - 61; Plants - 322; Viruses - 12; Other Eukaryotes -
                     115 (source: NCBI BLink)."
                     /codon_start=1
                     /product="like SEX4 1"
                     /protein_id="AEE73678.1"
                     /db_xref="TAIR:AT3G01510"
                     /db_xref="Araport:AT3G01510"
                     /translation="MAFLQQISGLGALERSCPSIMIGSSFRSGNGRVFDGRGIAYLGS
                     REKFGFNRRRRVVLRVVAMSSSSTPFKMNLNEYMVTLEKPLGIRFALSADGKIFVHAI
                     KKGSNAEKARIIMVGDTLKKASDSSGGTLVEIKDFGDTKKMLVEKTGSFSLVLERPFS
                     PFPIQYLLHLSDLDLLYNRGRVSFVTWNKNLLSSNLRASSQGSGNSGYAAFSSKFFTP
                     QGWKLLNRQSNSFQSGTKKNILSPPISPLVSVFSEDVPGDGEWGYGNFPLEEYIKALD
                     RSKGELSYNHALGMRYSKITEQIYVGSCIQTEEDVENLSEAGITAILNFQGGTEAQNW
                     GIDSQSINDACQKSEVLMINYPIKDADSFDLRKKLPLCVGLLLRLLKKNHRVFVTCTT
                     GFDRSSACVIAYLHWMTDTSLHAAYSFVTGLHACKPDRPAIAWATWDLIAMVDDGKHD
                     GTPTHSVTFVWNGHEGEEVLLVGDFTGNWKEPIKATHKGGPRFETEVRLTQGKYYYKY
                     IINGDWRHSATSPTERDDRGNTNNIIVVGDVANVRPTIQQPRKDANIIKVIERVLTES
                     ERFRLAKAARCIAFSVCPIRLCPKS"
     CDS             complement(join(198855..198977,199104..199248,
                     199424..199536,199649..199754,199859..200074,
                     200166..200287,200383..200451,200552..201007))
                     /gene="LSF1"
                     /locus_tag="AT3G01510"
                     /gene_synonym="F4P13.6"
                     /gene_synonym="F4P13_6"
                     /gene_synonym="like SEX4 1"
                     /codon_start=1
                     /product="like SEX4 1"
                     /protein_id="ANM63331.1"
                     /db_xref="Araport:AT3G01510"
                     /db_xref="TAIR:AT3G01510"
                     /translation="MLVEKTGSFSLVLERPFSPFPIQYLLHLSDLDLLYNRGRVSFVT
                     WNKNLLSSNLRASSQGSGNSGYAAFSSKFFTPQGWKLLNRQSNSFQSGTKKNILSPPI
                     SPLVSVFSEDVPGDGEWGYGNFPLEEYIKALDRSKGELSYNHALGMRYSKITEQIYVG
                     SCIQTEEDVENLSEAGITAILNFQGGTEAQNWGIDSQSINDACQKSEVLMINYPIKDA
                     DSFDLRKKLPLCVGLLLRLLKKNHRVFVTCTTGFDRSSACVIAYLHWMTDTSLHAAYS
                     FVTGLHACKPDRPAIAWATWDLIAMVDDGKHDGTPTHSVTFVWNGHEGEEVLLVGDFT
                     GNWKEPIKATHKGGPRFETEVRLTQGKYYYKYIINGDWRHSATSPTERDDRGNTNNII
                     VVGDVANVRPTIQQPRKDANIIKVIERVLTESERFRLAKAARCIAFSVCPIRLCPKS"
     CDS             complement(join(198855..198977,199104..199248,
                     199424..199536,199649..199754,199859..200074,
                     200166..200287,200383..200451,200552..201007))
                     /gene="LSF1"
                     /locus_tag="AT3G01510"
                     /gene_synonym="F4P13.6"
                     /gene_synonym="F4P13_6"
                     /gene_synonym="like SEX4 1"
                     /codon_start=1
                     /product="like SEX4 1"
                     /protein_id="ANM63332.1"
                     /db_xref="Araport:AT3G01510"
                     /db_xref="TAIR:AT3G01510"
                     /translation="MLVEKTGSFSLVLERPFSPFPIQYLLHLSDLDLLYNRGRVSFVT
                     WNKNLLSSNLRASSQGSGNSGYAAFSSKFFTPQGWKLLNRQSNSFQSGTKKNILSPPI
                     SPLVSVFSEDVPGDGEWGYGNFPLEEYIKALDRSKGELSYNHALGMRYSKITEQIYVG
                     SCIQTEEDVENLSEAGITAILNFQGGTEAQNWGIDSQSINDACQKSEVLMINYPIKDA
                     DSFDLRKKLPLCVGLLLRLLKKNHRVFVTCTTGFDRSSACVIAYLHWMTDTSLHAAYS
                     FVTGLHACKPDRPAIAWATWDLIAMVDDGKHDGTPTHSVTFVWNGHEGEEVLLVGDFT
                     GNWKEPIKATHKGGPRFETEVRLTQGKYYYKYIINGDWRHSATSPTERDDRGNTNNII
                     VVGDVANVRPTIQQPRKDANIIKVIERVLTESERFRLAKAARCIAFSVCPIRLCPKS"
     gene            complement(201887..202754)
                     /locus_tag="AT3G01513"
                     /db_xref="Araport:AT3G01513"
                     /db_xref="TAIR:AT3G01513"
     mRNA            complement(201887..202754)
                     /locus_tag="AT3G01513"
                     /product="hypothetical protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG429895.1,INSD:EG429888.1,INSD:EG429884.1,
                     INSD:EG429894.1,INSD:EG429892.1,INSD:AY649285.1,
                     INSD:EG429893.1,INSD:EG429787.1,INSD:EG429887.1,
                     INSD:EG429886.1,INSD:EG429889.1,INSD:EG429795.1,
                     INSD:EG429891.1,INSD:EG429890.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:AY600557.1"
                     /db_xref="TAIR:AT3G01513"
                     /db_xref="Araport:AT3G01513"
     CDS             complement(202068..202718)
                     /locus_tag="AT3G01513"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG429895.1,INSD:EG429888.1,INSD:EG429884.1,
                     INSD:EG429894.1,INSD:EG429892.1,INSD:AY649285.1,
                     INSD:EG429893.1,INSD:EG429787.1,INSD:EG429887.1,
                     INSD:EG429886.1,INSD:EG429889.1,INSD:EG429795.1,
                     INSD:EG429891.1,INSD:EG429890.1"
                     /inference="Similar to RNA sequence, mRNA:INSD:AY600557.1"
                     /note="unknown protein; CONTAINS InterPro DOMAIN/s:
                     Protein of unknown function DUF1645 (InterPro:IPR012442);
                     BEST Arabidopsis thaliana protein match is: unknown
                     protein (TAIR:AT5G14730.1); Has 69 Blast hits to 69
                     proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa -
                     0; Fungi - 0; Plants - 69; Viruses - 0; Other Eukaryotes -
                     0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEE73679.1"
                     /db_xref="TAIR:AT3G01513"
                     /db_xref="Araport:AT3G01513"
                     /translation="MQDFSSTVSYSPSFSYYASGEFAAAAVKVSRENESYNIRDHESV
                     KVNSVNDEDVDFEFETSPLHEETFVHFPTFKTNVVSTTNKTDKEAAAEKISERFPGNC
                     LWSPLRSPAASKHSESSTSTPKRCRLKKFLTRSHSDGGVLPSSASKRCYTFKDLKRRS
                     HSDGGGDTSKRSSPTVKVKNKTVSYKVGEGDKRRKSYLPYRQDLIGVFAVIRGLRR"
     gene            205314..208220
                     /locus_tag="AT3G01516"
                     /db_xref="Araport:AT3G01516"
                     /db_xref="TAIR:AT3G01516"
     mRNA            join(205314..205744,207409..208220)
                     /locus_tag="AT3G01516"
                     /product="transmembrane protein"
                     /inference="Similar to RNA sequence, EST:INSD:AV531480.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT012206.1,INSD:BT012389.1"
                     /db_xref="TAIR:AT3G01516"
                     /db_xref="Araport:AT3G01516"
     mRNA            206496..208086
                     /locus_tag="AT3G01516"
                     /product="transmembrane protein"
                     /db_xref="Araport:AT3G01516"
                     /db_xref="TAIR:AT3G01516"
     CDS             207426..207989
                     /locus_tag="AT3G01516"
                     /codon_start=1
                     /product="transmembrane protein"
                     /protein_id="ANM63330.1"
                     /db_xref="Araport:AT3G01516"
                     /db_xref="TAIR:AT3G01516"
                     /translation="MEEENQKSHRVSRKDQSGSHWSQGADEEPRARCSGKRCRSWAAA
                     AIADCVALCCCPCAVVNIFTLAFVKVPWMIGRKCIGRGGPSKKRMKKINREDRFHHHH
                     HHRRSAEMVSGGCCGGGDGDGEFDDHRFVVERDGSLTKEEAKTASLKEEEETRISARV
                     EAERVWLELYQIGHLGFGRVSFTGIHQ"
     CDS             207426..207989
                     /locus_tag="AT3G01516"
                     /inference="Similar to RNA sequence, EST:INSD:AV531480.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT012206.1,INSD:BT012389.1"
                     /note="unknown protein; BEST Arabidopsis thaliana protein
                     match is: unknown protein (TAIR:AT5G14690.1); Has 67 Blast
                     hits to 67 proteins in 14 species: Archae - 0; Bacteria -
                     0; Metazoa - 0; Fungi - 0; Plants - 67; Viruses - 0; Other
                     Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="transmembrane protein"
                     /protein_id="AEE73680.1"
                     /db_xref="TAIR:AT3G01516"
                     /db_xref="Araport:AT3G01516"
                     /translation="MEEENQKSHRVSRKDQSGSHWSQGADEEPRARCSGKRCRSWAAA
                     AIADCVALCCCPCAVVNIFTLAFVKVPWMIGRKCIGRGGPSKKRMKKINREDRFHHHH
                     HHRRSAEMVSGGCCGGGDGDGEFDDHRFVVERDGSLTKEEAKTASLKEEEETRISARV
                     EAERVWLELYQIGHLGFGRVSFTGIHQ"
     gene            208250..210161
                     /locus_tag="AT3G01520"
                     /gene_synonym="F4P13.7"
                     /gene_synonym="F4P13_7"
                     /db_xref="Araport:AT3G01520"
                     /db_xref="TAIR:AT3G01520"
     mRNA            join(208250..208683,209100..209221,209360..209478,
                     209813..210161)
                     /locus_tag="AT3G01520"
                     /gene_synonym="F4P13.7"
                     /gene_synonym="F4P13_7"
                     /product="Adenine nucleotide alpha hydrolases-like
                     superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL245494.1,INSD:EL246663.1,INSD:BP571421.1,
                     INSD:EL316962.1,INSD:EH968142.1,INSD:EH943225.1,
                     INSD:BP626882.1,INSD:ES055156.1,INSD:EL224866.1,
                     INSD:EL333307.1,INSD:EG520395.1,INSD:EL152947.1,
                     INSD:EL010165.1,INSD:AV824687.1,INSD:EL212534.1,
                     INSD:EL182049.1,INSD:ES066019.1,INSD:AI995628.1,
                     INSD:EL313966.1,INSD:EH973915.1,INSD:CF652143.1,
                     INSD:EH853370.1,INSD:BP567675.1,INSD:BP573752.1,
                     INSD:EL173293.1,INSD:DR378378.1,INSD:EH948502.1,
                     INSD:DR211889.1,INSD:EL271717.1,INSD:EL128270.1,
                     INSD:EL018000.1,INSD:EH917091.1,INSD:EH923901.1,
                     INSD:BP820828.1,INSD:BP663223.1,INSD:EL265162.1,
                     INSD:EL228823.1,INSD:EH914360.1,INSD:EL077655.1,
                     INSD:EL186138.1,INSD:EL123712.1,INSD:EL297313.1,
                     INSD:BP598123.1,INSD:EH958354.1,INSD:EL271072.1,
                     INSD:EH924221.1,INSD:DR378883.1,INSD:EL108476.1,
                     INSD:EH970182.1,INSD:EH818464.1,INSD:EH972353.1,
                     INSD:BP634924.1,INSD:EL180365.1,INSD:EH984692.1,
                     INSD:EH808935.1,INSD:EL015816.1,INSD:EH825167.1,
                     INSD:EH955112.1,INSD:EL303729.1,INSD:EL308759.1,
                     INSD:EL300982.1,INSD:AV787259.1,INSD:BP845728.1,
                     INSD:EL094832.1,INSD:BP586528.1,INSD:BP662614.1,
                     INSD:BP614032.1,INSD:EH947499.1,INSD:EH835879.1,
                     INSD:BP866998.1,INSD:EH899703.1,INSD:EH824794.1,
                     INSD:EL263486.1,INSD:BP565157.1,INSD:EL265463.1,
                     INSD:EL020828.1,INSD:DR211886.1,INSD:DR211888.1,
                     INSD:BP839922.1,INSD:BP797565.1,INSD:EL115147.1,
                     INSD:EH822600.1,INSD:EH867338.1,INSD:BP565339.1,
                     INSD:EL089429.1,INSD:ES097234.1,INSD:EL147091.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY052696.1,INSD:AF446878.1,INSD:AY084275.1,
                     INSD:BX822490.1"
                     /db_xref="TAIR:AT3G01520"
                     /db_xref="Araport:AT3G01520"
     CDS             join(208506..208683,209100..209221,209360..209478,
                     209813..209921)
                     /locus_tag="AT3G01520"
                     /gene_synonym="F4P13.7"
                     /gene_synonym="F4P13_7"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL245494.1,INSD:EL246663.1,INSD:BP571421.1,
                     INSD:EL316962.1,INSD:EH968142.1,INSD:EH943225.1,
                     INSD:BP626882.1,INSD:ES055156.1,INSD:EL224866.1,
                     INSD:EL333307.1,INSD:EG520395.1,INSD:EL152947.1,
                     INSD:EL010165.1,INSD:AV824687.1,INSD:EL212534.1,
                     INSD:EL182049.1,INSD:ES066019.1,INSD:AI995628.1,
                     INSD:EL313966.1,INSD:EH973915.1,INSD:CF652143.1,
                     INSD:EH853370.1,INSD:BP567675.1,INSD:BP573752.1,
                     INSD:EL173293.1,INSD:DR378378.1,INSD:EH948502.1,
                     INSD:DR211889.1,INSD:EL271717.1,INSD:EL128270.1,
                     INSD:EL018000.1,INSD:EH917091.1,INSD:EH923901.1,
                     INSD:BP820828.1,INSD:BP663223.1,INSD:EL265162.1,
                     INSD:EL228823.1,INSD:EH914360.1,INSD:EL077655.1,
                     INSD:EL186138.1,INSD:EL123712.1,INSD:EL297313.1,
                     INSD:BP598123.1,INSD:EH958354.1,INSD:EL271072.1,
                     INSD:EH924221.1,INSD:DR378883.1,INSD:EL108476.1,
                     INSD:EH970182.1,INSD:EH818464.1,INSD:EH972353.1,
                     INSD:BP634924.1,INSD:EL180365.1,INSD:EH984692.1,
                     INSD:EH808935.1,INSD:EL015816.1,INSD:EH825167.1,
                     INSD:EH955112.1,INSD:EL303729.1,INSD:EL308759.1,
                     INSD:EL300982.1,INSD:AV787259.1,INSD:BP845728.1,
                     INSD:EL094832.1,INSD:BP586528.1,INSD:BP662614.1,
                     INSD:BP614032.1,INSD:EH947499.1,INSD:EH835879.1,
                     INSD:BP866998.1,INSD:EH899703.1,INSD:EH824794.1,
                     INSD:EL263486.1,INSD:BP565157.1,INSD:EL265463.1,
                     INSD:EL020828.1,INSD:DR211886.1,INSD:DR211888.1,
                     INSD:BP839922.1,INSD:BP797565.1,INSD:EL115147.1,
                     INSD:EH822600.1,INSD:EH867338.1,INSD:BP565339.1,
                     INSD:EL089429.1,INSD:ES097234.1,INSD:EL147091.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY052696.1,INSD:AF446878.1,INSD:AY084275.1,
                     INSD:BX822490.1"
                     /note="Adenine nucleotide alpha hydrolases-like
                     superfamily protein; FUNCTIONS IN: molecular_function
                     unknown; INVOLVED IN: N-terminal protein myristoylation,
                     response to stress; LOCATED IN: plasma membrane; EXPRESSED
                     IN: 24 plant structures; EXPRESSED DURING: 15 growth
                     stages; CONTAINS InterPro DOMAIN/s: UspA
                     (InterPro:IPR006016), Rossmann-like alpha/beta/alpha
                     sandwich fold (InterPro:IPR014729), Universal stress
                     protein A (InterPro:IPR006015); BEST Arabidopsis thaliana
                     protein match is: Adenine nucleotide alpha hydrolases-like
                     superfamily protein (TAIR:AT5G14680.1); Has 2506 Blast
                     hits to 2501 proteins in 678 species: Archae - 111;
                     Bacteria - 1598; Metazoa - 89; Fungi - 33; Plants - 646;
                     Viruses - 0; Other Eukaryotes - 29 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Adenine nucleotide alpha hydrolases-like
                     superfamily protein"
                     /protein_id="AEE73681.1"
                     /db_xref="TAIR:AT3G01520"
                     /db_xref="Araport:AT3G01520"
                     /translation="MGSEPTKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTS
                     DFKILLLHVQVVDEDGFDDVDSIYASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVG
                     CEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMT
                     IKRNADETPSDPADD"
     gene            complement(210119..211804)
                     /gene="MYB57"
                     /locus_tag="AT3G01530"
                     /gene_synonym="ATMYB57"
                     /gene_synonym="F4P13.8"
                     /gene_synonym="F4P13_8"
                     /gene_synonym="myb domain protein 57"
                     /note="Member of the R2R3 factor gene family."
                     /db_xref="Araport:AT3G01530"
                     /db_xref="TAIR:AT3G01530"
     mRNA            complement(join(210119..210670,210764..210893,
                     210980..211804))
                     /gene="MYB57"
                     /locus_tag="AT3G01530"
                     /gene_synonym="ATMYB57"
                     /gene_synonym="F4P13.8"
                     /gene_synonym="F4P13_8"
                     /gene_synonym="myb domain protein 57"
                     /product="myb domain protein 57"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP571421.1,INSD:AU230197.1,INSD:DR270682.1,
                     INSD:EG520395.1,INSD:AU238946.1,INSD:DR270683.1,
                     INSD:DR270681.1,INSD:DR270684.1,INSD:BP573752.1,
                     INSD:DR270680.1,INSD:DR378378.1,INSD:DR270685.1,
                     INSD:BP618302.1,INSD:BP565157.1,INSD:DN604577.1,
                     INSD:DR270687.1,INSD:ES066198.1,INSD:DR270686.1,
                     INSD:BP598123.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX822161.1,INSD:Z95779.1,INSD:AK118091.1,
                     INSD:AY088761.1,INSD:BT005574.1,INSD:AY519582.1,
                     INSD:AF062892.1,INSD:BX822381.1"
                     /db_xref="TAIR:AT3G01530"
                     /db_xref="Araport:AT3G01530"
     CDS             complement(join(210352..210670,210764..210893,
                     210980..211151))
                     /gene="MYB57"
                     /locus_tag="AT3G01530"
                     /gene_synonym="ATMYB57"
                     /gene_synonym="F4P13.8"
                     /gene_synonym="F4P13_8"
                     /gene_synonym="myb domain protein 57"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP571421.1,INSD:AU230197.1,INSD:DR270682.1,
                     INSD:EG520395.1,INSD:AU238946.1,INSD:DR270683.1,
                     INSD:DR270681.1,INSD:DR270684.1,INSD:BP573752.1,
                     INSD:DR270680.1,INSD:DR378378.1,INSD:DR270685.1,
                     INSD:BP618302.1,INSD:BP565157.1,INSD:DN604577.1,
                     INSD:DR270687.1,INSD:ES066198.1,INSD:DR270686.1,
                     INSD:BP598123.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX822161.1,INSD:Z95779.1,INSD:AK118091.1,
                     INSD:AY088761.1,INSD:BT005574.1,INSD:AY519582.1,
                     INSD:AF062892.1,INSD:BX822381.1"
                     /note="myb domain protein 57 (MYB57); CONTAINS InterPro
                     DOMAIN/s: SANT, DNA-binding (InterPro:IPR001005),
                     Homeodomain-like (InterPro:IPR009057), Myb, DNA-binding
                     (InterPro:IPR014778), HTH transcriptional regulator,
                     Myb-type, DNA-binding (InterPro:IPR017930),
                     Homeodomain-related (InterPro:IPR012287), Myb
                     transcription factor (InterPro:IPR015495); BEST
                     Arabidopsis thaliana protein match is: myb domain protein
                     21 (TAIR:AT3G27810.1); Has 8770 Blast hits to 8117
                     proteins in 470 species: Archae - 0; Bacteria - 0; Metazoa
                     - 723; Fungi - 481; Plants - 5812; Viruses - 4; Other
                     Eukaryotes - 1750 (source: NCBI BLink)."
                     /codon_start=1
                     /product="myb domain protein 57"
                     /protein_id="AEE73682.1"
                     /db_xref="TAIR:AT3G01530"
                     /db_xref="Araport:AT3G01530"
                     /translation="METTMKKKGRVKATITSQKEEEGTVRKGPWTMEEDFILFNYILN
                     HGEGLWNSVAKASGLKRTGKSCRLRWLNYLRPDVRRGNITEEEQLLIIQLHAKLGNRW
                     SKIAKHLPGRTDNEIKNFWRTKIQRHMKVSSENMMNHQHHCSGNSQSSGMTTQGSSGK
                     AIDTAESFSQAKTTTFNVVEQQSNENYWNVEDLWPVHLLNGDHHVI"
     gene            complement(212518..216736)
                     /gene="DRH1"
                     /locus_tag="AT3G01540"
                     /gene_synonym="ARABIDOPSIS THALIANA DEAD BOX RNA HELICASE
                     1"
                     /gene_synonym="ATDRH1"
                     /gene_synonym="DEAD box RNA helicase 1"
                     /gene_synonym="F4P13.9"
                     /gene_synonym="F4P13_9"
                     /gene_synonym="RNA HELICASE DRH1"
                     /db_xref="Araport:AT3G01540"
                     /db_xref="TAIR:AT3G01540"
     mRNA            complement(join(212518..212523,212863..213212,
                     213311..213619,213716..213993,214070..214420,
                     214520..214789,215401..215469,215615..215773,
                     215855..216153,216474..216671))
                     /gene="DRH1"
                     /locus_tag="AT3G01540"
                     /gene_synonym="ARABIDOPSIS THALIANA DEAD BOX RNA HELICASE
                     1"
                     /gene_synonym="ATDRH1"
                     /gene_synonym="DEAD box RNA helicase 1"
                     /gene_synonym="F4P13.9"
                     /gene_synonym="F4P13_9"
                     /gene_synonym="RNA HELICASE DRH1"
                     /product="DEAD box RNA helicase 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH841870.1,INSD:BP787749.1,INSD:BP615182.1,
                     INSD:BP785012.1,INSD:T43848.1,INSD:EL102123.1,
                     INSD:BP786282.1,INSD:BP626750.1,INSD:EL203917.1,
                     INSD:EL315405.1,INSD:EL103123.1,INSD:AV815750.1,
                     INSD:ES077655.1,INSD:EL121792.1,INSD:ES110153.1,
                     INSD:BP590736.1,INSD:EH826560.1,INSD:EL194383.1,
                     INSD:CD529771.1,INSD:BP613015.1,INSD:EL056695.1,
                     INSD:BP790577.1,INSD:AV548589.1,INSD:DR258993.1,
                     INSD:AV815251.1,INSD:EH967163.1,INSD:EL987048.1,
                     INSD:ES005188.1,INSD:BP640556.1,INSD:BP781196.1,
                     INSD:BP648768.1,INSD:EL995166.1,INSD:BP784810.1,
                     INSD:EG508681.1,INSD:EH974242.1,INSD:EL312291.1,
                     INSD:EL290987.1,INSD:EG508667.1,INSD:BP597666.1,
                     INSD:BP631225.1,INSD:ES191490.1,INSD:BP787955.1,
                     INSD:EL266730.1,INSD:EG440291.1,INSD:AV794320.1,
                     INSD:EL258947.1,INSD:BP628779.1,INSD:CB260959.1,
                     INSD:AV783685.1,INSD:EH862708.1,INSD:EL183981.1,
                     INSD:EL264886.1,INSD:EL004778.1,INSD:AV801696.1,
                     INSD:BP660264.1,INSD:EL169086.1,INSD:EL150370.1,
                     INSD:N65298.1,INSD:BP652300.1,INSD:DR258988.1,
                     INSD:BP636219.1,INSD:BP637762.1,INSD:BP782276.1,
                     INSD:AV541922.1,INSD:EL154395.1,INSD:AV540998.1,
                     INSD:AV795629.1,INSD:EL318816.1,INSD:BP607275.1,
                     INSD:BP787726.1,INSD:BP593828.1,INSD:BP635440.1,
                     INSD:BP777708.1,INSD:AV816951.1,INSD:ES032057.1,
                     INSD:BP582351.1,INSD:AV794753.1,INSD:AA651159.1,
                     INSD:BP794281.1,INSD:ES095301.1,INSD:EG461059.1,
                     INSD:BP647968.1,INSD:DR227828.1,INSD:BP608240.1,
                     INSD:AV794317.1,INSD:EL306999.1,INSD:EL046430.1,
                     INSD:EG461060.1,INSD:EH829663.1,INSD:BP658261.1,
                     INSD:AV541894.1,INSD:BP651452.1,INSD:CD532456.1,
                     INSD:BP643610.1,INSD:BP658771.1,INSD:ES176986.1,
                     INSD:BP613443.1,INSD:AV792941.1,INSD:CD534425.1,
                     INSD:CB253438.1,INSD:BP786896.1,INSD:ES101558.1,
                     INSD:BP651930.1,INSD:ES158017.1,INSD:AV813943.1,
                     INSD:BP657319.1,INSD:AV540879.1,INSD:AV820980.1,
                     INSD:EL191738.1,INSD:EG508680.1,INSD:DR258990.1,
                     INSD:ES102566.1,INSD:EH850728.1,INSD:ES141651.1,
                     INSD:AV821082.1,INSD:BP614404.1,INSD:EH913596.1,
                     INSD:BP650353.1,INSD:BP786322.1,INSD:EL285033.1,
                     INSD:EH976461.1,INSD:ES100550.1,INSD:BP651060.1,
                     INSD:EL227974.1,INSD:ES030481.1,INSD:EG440290.1,
                     INSD:BP658509.1,INSD:BP578578.1,INSD:BP607576.1,
                     INSD:DR258981.1,INSD:EL216670.1,INSD:EL138511.1,
                     INSD:AV824478.1,INSD:BP639154.1,INSD:DR259443.1,
                     INSD:DR258982.1,INSD:EL194872.1,INSD:EL980051.1,
                     INSD:BP781715.1,INSD:EL159122.1,INSD:EL214274.1,
                     INSD:EL009939.1,INSD:BP642668.1,INSD:H36043.1,
                     INSD:EL975580.1,INSD:EL245278.1,INSD:BE522709.1,
                     INSD:EL042297.1,INSD:EL190879.1,INSD:EL056743.1,
                     INSD:BP566314.1,INSD:DR258991.1,INSD:BP632240.1,
                     INSD:AV806531.1,INSD:AA395076.1,INSD:EL297599.1,
                     INSD:EL112614.1,INSD:CD531694.1,INSD:BP616349.1,
                     INSD:EG464311.1,INSD:BP628978.1,INSD:AV810595.1,
                     INSD:EL302142.1,INSD:BP790171.1,INSD:BP619883.1,
                     INSD:EH856340.1,INSD:BP662973.1,INSD:BP585512.1,
                     INSD:EH916983.1,INSD:AB050574.1,INSD:DR258983.1,
                     INSD:EH960243.1,INSD:ES026683.1,INSD:EH857328.1,
                     INSD:AV802449.1,INSD:EG464310.1,INSD:BP601164.1,
                     INSD:BP652381.1,INSD:EH986257.1,INSD:BP579376.1,
                     INSD:BP786097.1,INSD:BP609469.1,INSD:BP633052.1,
                     INSD:DR258986.1,INSD:BP786023.1,INSD:EL265422.1,
                     INSD:AV814893.1,INSD:BP779427.1,INSD:AV792279.1,
                     INSD:BP576030.1,INSD:EH880862.1,INSD:BP605267.1,
                     INSD:ES115791.1,INSD:EH906579.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX823517.1,INSD:AB010259.1"
                     /db_xref="TAIR:AT3G01540"
                     /db_xref="Araport:AT3G01540"
     mRNA            complement(join(212671..213212,213311..213619,
                     213716..213993,214070..214420,214520..214789,
                     215401..215469,215615..215773,215855..216153,
                     216474..216736))
                     /gene="DRH1"
                     /locus_tag="AT3G01540"
                     /gene_synonym="ARABIDOPSIS THALIANA DEAD BOX RNA HELICASE
                     1"
                     /gene_synonym="ATDRH1"
                     /gene_synonym="DEAD box RNA helicase 1"
                     /gene_synonym="F4P13.9"
                     /gene_synonym="F4P13_9"
                     /gene_synonym="RNA HELICASE DRH1"
                     /product="DEAD box RNA helicase 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP833916.1,INSD:EH841870.1,INSD:DR258998.1,
                     INSD:BP787749.1,INSD:AV802153.1,INSD:CB253423.1,
                     INSD:BP785012.1,INSD:T43848.1,INSD:EL102123.1,
                     INSD:BP833022.1,INSD:BP786282.1,INSD:BP821492.1,
                     INSD:BP626750.1,INSD:EL203917.1,INSD:EL315405.1,
                     INSD:EL103123.1,INSD:ES077655.1,INSD:EL121792.1,
                     INSD:ES110153.1,INSD:EL124603.1,INSD:BP590736.1,
                     INSD:DR258997.1,INSD:BP635419.1,INSD:EH826560.1,
                     INSD:EL194383.1,INSD:EL056695.1,INSD:AV548589.1,
                     INSD:BP823963.1,INSD:BP838802.1,INSD:EH967163.1,
                     INSD:BP812597.1,INSD:EL987048.1,INSD:DR258994.1,
                     INSD:BP851000.2,INSD:EG481774.1,INSD:BP838847.1,
                     INSD:ES005188.1,INSD:EG480925.1,INSD:BP640556.1,
                     INSD:BP648768.1,INSD:AV546113.1,INSD:BP838761.1,
                     INSD:EL995166.1,INSD:DR258985.1,INSD:EG480924.1,
                     INSD:BP803132.1,INSD:EG508681.1,INSD:EH974242.1,
                     INSD:DR227824.1,INSD:EL312291.1,INSD:BP840101.1,
                     INSD:EL290987.1,INSD:EG513945.1,INSD:EG508667.1,
                     INSD:BP597666.1,INSD:DR258996.1,INSD:BP631225.1,
                     INSD:AV810818.1,INSD:AV786327.1,INSD:EG481773.1,
                     INSD:ES191490.1,INSD:AV790446.1,INSD:EL266730.1,
                     INSD:EG440291.1,INSD:BP779887.1,INSD:BP809019.1,
                     INSD:BP820094.1,INSD:EL258947.1,INSD:BP628779.1,
                     INSD:EG513921.1,INSD:AV813274.1,INSD:CB260959.1,
                     INSD:AV783685.1,INSD:EH862708.1,INSD:AV792772.1,
                     INSD:EL183981.1,INSD:EL264886.1,INSD:BP823295.1,
                     INSD:BP643327.1,INSD:EL004778.1,INSD:AV801696.1,
                     INSD:BP607782.1,INSD:BP660264.1,INSD:EL169086.1,
                     INSD:BP844580.1,INSD:EL150370.1,INSD:BP669397.1,
                     INSD:BP784947.1,INSD:N65298.1,INSD:BP652300.1,
                     INSD:BP637762.1,INSD:BP782276.1,INSD:EL154395.1,
                     INSD:CK121333.1,INSD:BP850731.1,INSD:BP840202.1,
                     INSD:EL318816.1,INSD:BP607275.1,INSD:BP787726.1,
                     INSD:BP588655.1,INSD:ES032057.1,INSD:AV822831.1,
                     INSD:BP582351.1,INSD:DR258992.1,INSD:AA651159.1,
                     INSD:BP794281.1,INSD:ES095301.1,INSD:EG461059.1,
                     INSD:CB258604.1,INSD:BP647968.1,INSD:DR258989.1,
                     INSD:BP608240.1,INSD:EG490851.1,INSD:BP815661.1,
                     INSD:EL306999.1,INSD:EL046430.1,INSD:CB253858.1,
                     INSD:BP832706.1,INSD:EG461060.1,INSD:BP811823.1,
                     INSD:EH829663.1,INSD:AV808476.1,INSD:BP658261.1,
                     INSD:AV807543.1,INSD:AV541894.1,INSD:BP651452.1,
                     INSD:BP643610.1,INSD:BP842399.1,INSD:BP658771.1,
                     INSD:ES176986.1,INSD:BP805469.1,INSD:CD534434.1,
                     INSD:CB253438.1,INSD:ES101558.1,INSD:AV529980.1,
                     INSD:BP651930.1,INSD:BP839068.1,INSD:ES158017.1,
                     INSD:BP831700.1,INSD:AV813943.1,INSD:BP657319.1,
                     INSD:EL191738.1,INSD:AV820980.1,INSD:EG508680.1,
                     INSD:AV826586.1,INSD:ES102566.1,INSD:EH850728.1,
                     INSD:BP817839.1,INSD:ES141651.1,INSD:AV821082.1,
                     INSD:EH913596.1,INSD:BP650353.1,INSD:BP786322.1,
                     INSD:EL285033.1,INSD:EH976461.1,INSD:AV829498.1,
                     INSD:ES100550.1,INSD:DR258987.1,INSD:BP651060.1,
                     INSD:BP799271.1,INSD:EL227974.1,INSD:BP813321.1,
                     INSD:BP848609.1,INSD:BP819128.1,INSD:DR227826.1,
                     INSD:BP816102.1,INSD:ES030481.1,INSD:EG440290.1,
                     INSD:BP658509.1,INSD:BP578578.1,INSD:AI998826.1,
                     INSD:AV829722.1,INSD:BP808020.1,INSD:EL216670.1,
                     INSD:AV812971.1,INSD:EL138511.1,INSD:AV824478.1,
                     INSD:BP639154.1,INSD:DR259443.1,INSD:EL194872.1,
                     INSD:EL980051.1,INSD:BP781715.1,INSD:EL159122.1,
                     INSD:EL214274.1,INSD:EL009939.1,INSD:AV537360.1,
                     INSD:H36043.1,INSD:BP837153.1,INSD:BP831417.1,
                     INSD:BP651592.1,INSD:BP809232.1,INSD:EL975580.1,
                     INSD:EL245278.1,INSD:EL042297.1,INSD:EL190879.1,
                     INSD:EL056743.1,INSD:BP632240.1,INSD:BP806426.1,
                     INSD:BP614854.1,INSD:AA395076.1,INSD:EL297599.1,
                     INSD:BP808931.1,INSD:EL112614.1,INSD:CD531694.1,
                     INSD:BP616349.1,INSD:DR227829.1,INSD:BP851738.1,
                     INSD:BP628978.1,INSD:EL302142.1,INSD:AV810595.1,
                     INSD:BP790171.1,INSD:AV795516.1,INSD:EH856340.1,
                     INSD:EH982666.1,INSD:AV825877.1,INSD:DR258995.1,
                     INSD:BP798545.1,INSD:DR258984.1,INSD:BP662973.1,
                     INSD:AV814306.1,INSD:EH916983.1,INSD:AV792539.1,
                     INSD:BP842101.1,INSD:BP866091.1,INSD:EH960243.1,
                     INSD:ES026683.1,INSD:EH857328.1,INSD:BP831605.1,
                     INSD:AV802449.1,INSD:BP652381.1,INSD:EH986257.1,
                     INSD:DR227825.1,INSD:BP835713.1,INSD:BP579376.1,
                     INSD:BP633052.1,INSD:EL008010.1,INSD:BP786023.1,
                     INSD:EL265422.1,INSD:AV814893.1,INSD:BP779427.1,
                     INSD:BP810804.1,INSD:AV792279.1,INSD:EH880862.1,
                     INSD:BP815297.1,INSD:ES115791.1,INSD:EH906579.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT009670.1,INSD:AF428313.1,INSD:BT000795.1,
                     INSD:AY050375.1"
                     /db_xref="TAIR:AT3G01540"
                     /db_xref="Araport:AT3G01540"
     mRNA            complement(join(212679..213209,213311..213619,
                     213716..213993,214070..214420,214520..214789,
                     215401..215469,215615..215773,215855..216153,
                     216474..216714))
                     /gene="DRH1"
                     /locus_tag="AT3G01540"
                     /gene_synonym="ARABIDOPSIS THALIANA DEAD BOX RNA HELICASE
                     1"
                     /gene_synonym="ATDRH1"
                     /gene_synonym="DEAD box RNA helicase 1"
                     /gene_synonym="F4P13.9"
                     /gene_synonym="F4P13_9"
                     /gene_synonym="RNA HELICASE DRH1"
                     /product="DEAD box RNA helicase 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP833916.1,INSD:CD532456.1,INSD:EH841870.1,
                     INSD:DR258998.1,INSD:BP842399.1,INSD:ES176986.1,
                     INSD:T43848.1,INSD:EL102123.1,INSD:AV792941.1,
                     INSD:BP833022.1,INSD:BP805469.1,INSD:CD534425.1,
                     INSD:BP786896.1,INSD:CB253438.1,INSD:BP821492.1,
                     INSD:ES101558.1,INSD:EL203917.1,INSD:AV529980.1,
                     INSD:EL103123.1,INSD:EL315405.1,INSD:AV815750.1,
                     INSD:EL121792.1,INSD:ES077655.1,INSD:BP839068.1,
                     INSD:ES110153.1,INSD:ES158017.1,INSD:BP831700.1,
                     INSD:AV540879.1,INSD:EL191738.1,INSD:EG508680.1,
                     INSD:AV826586.1,INSD:ES102566.1,INSD:DR258997.1,
                     INSD:EH850728.1,INSD:EH826560.1,INSD:BP817839.1,
                     INSD:EL194383.1,INSD:EL056695.1,INSD:BP790577.1,
                     INSD:ES141651.1,INSD:EH913596.1,INSD:EH976461.1,
                     INSD:AV829498.1,INSD:BP823963.1,INSD:ES100550.1,
                     INSD:BP838802.1,INSD:EH967163.1,INSD:BP812597.1,
                     INSD:DR258987.1,INSD:EL987048.1,INSD:DR258994.1,
                     INSD:EG481774.1,INSD:BP851000.2,INSD:BP799271.1,
                     INSD:EL227974.1,INSD:BP813321.1,INSD:BP848609.1,
                     INSD:BP838847.1,INSD:BP819128.1,INSD:ES005188.1,
                     INSD:DR227826.1,INSD:BP781196.1,INSD:BP838761.1,
                     INSD:BP816102.1,INSD:ES030481.1,INSD:EL995166.1,
                     INSD:DR258985.1,INSD:EG480924.1,INSD:AV829722.1,
                     INSD:BP808020.1,INSD:BP784810.1,INSD:BP803132.1,
                     INSD:EL216670.1,INSD:EG508681.1,INSD:EH974242.1,
                     INSD:DR227824.1,INSD:EL138511.1,INSD:EL312291.1,
                     INSD:AV824478.1,INSD:DR259443.1,INSD:EL194872.1,
                     INSD:BP840101.1,INSD:EL290987.1,INSD:EL980051.1,
                     INSD:EG508667.1,INSD:EG513945.1,INSD:EL159122.1,
                     INSD:DR258996.1,INSD:EL214274.1,INSD:EL009939.1,
                     INSD:EG481773.1,INSD:ES191490.1,INSD:EL266730.1,
                     INSD:AV794320.1,INSD:BP809019.1,INSD:BP642668.1,
                     INSD:BP820094.1,INSD:H36043.1,INSD:BP837153.1,
                     INSD:BP831417.1,INSD:EL258947.1,INSD:BP809232.1,
                     INSD:EG513921.1,INSD:EL245278.1,INSD:EL975580.1,
                     INSD:CB260959.1,INSD:EH862708.1,INSD:EL183981.1,
                     INSD:EL042297.1,INSD:EL264886.1,INSD:EL190879.1,
                     INSD:EL056743.1,INSD:BP823295.1,INSD:EL004778.1,
                     INSD:BP566314.1,INSD:BP806426.1,INSD:EL169086.1,
                     INSD:BP844580.1,INSD:N65298.1,INSD:AV806531.1,
                     INSD:BP808931.1,INSD:EL112614.1,INSD:DR227829.1,
                     INSD:EG464311.1,INSD:BP851738.1,INSD:BP636219.1,
                     INSD:EL302142.1,INSD:EL154395.1,INSD:BP850731.1,
                     INSD:AV540998.1,INSD:BP840202.1,INSD:EH982666.1,
                     INSD:EH856340.1,INSD:AV825877.1,INSD:DR258995.1,
                     INSD:BP798545.1,INSD:DR258984.1,INSD:EH916983.1,
                     INSD:EL318816.1,INSD:AV795629.1,INSD:BP842101.1,
                     INSD:AB050574.1,INSD:BP593828.1,INSD:BP777708.1,
                     INSD:BP866091.1,INSD:AV816951.1,INSD:EH960243.1,
                     INSD:ES032057.1,INSD:ES026683.1,INSD:EH857328.1,
                     INSD:AV822831.1,INSD:BP831605.1,INSD:DR258992.1,
                     INSD:AV794753.1,INSD:EG464310.1,INSD:EH986257.1,
                     INSD:DR227825.1,INSD:BP835713.1,INSD:ES095301.1,
                     INSD:EG461059.1,INSD:CB258604.1,INSD:BP786097.1,
                     INSD:DR258989.1,INSD:BP810804.1,INSD:EL265422.1,
                     INSD:BP815661.1,INSD:BP576030.1,INSD:EH880862.1,
                     INSD:CB253858.1,INSD:EL046430.1,INSD:EL306999.1,
                     INSD:BP832706.1,INSD:EG461060.1,INSD:BP811823.1,
                     INSD:EH829663.1,INSD:BP815297.1,INSD:EH906579.1,
                     INSD:ES115791.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY062591.1,INSD:AB010259.1"
                     /db_xref="TAIR:AT3G01540"
                     /db_xref="Araport:AT3G01540"
     mRNA            complement(join(212751..213212,213311..213619,
                     213716..213993,214070..214420,214520..214789,
                     215401..215469,215615..215773,215855..216150,
                     216474..216666))
                     /gene="DRH1"
                     /locus_tag="AT3G01540"
                     /gene_synonym="ARABIDOPSIS THALIANA DEAD BOX RNA HELICASE
                     1"
                     /gene_synonym="ATDRH1"
                     /gene_synonym="DEAD box RNA helicase 1"
                     /gene_synonym="F4P13.9"
                     /gene_synonym="F4P13_9"
                     /gene_synonym="RNA HELICASE DRH1"
                     /product="DEAD box RNA helicase 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP833916.1,INSD:EH841870.1,INSD:DR258998.1,
                     INSD:BP787749.1,INSD:BP615182.1,INSD:BP785012.1,
                     INSD:T43848.1,INSD:EL102123.1,INSD:BP833022.1,
                     INSD:BP786282.1,INSD:BP821492.1,INSD:BP626750.1,
                     INSD:EL203917.1,INSD:EL315405.1,INSD:EL103123.1,
                     INSD:AV815750.1,INSD:ES077655.1,INSD:EL121792.1,
                     INSD:ES110153.1,INSD:BP590736.1,INSD:DR258997.1,
                     INSD:EH826560.1,INSD:EL194383.1,INSD:CD529771.1,
                     INSD:BP613015.1,INSD:EL056695.1,INSD:BP790577.1,
                     INSD:AV548589.1,INSD:AV815251.1,INSD:BP823963.1,
                     INSD:BP838802.1,INSD:EH967163.1,INSD:BP812597.1,
                     INSD:EL987048.1,INSD:DR258994.1,INSD:BP851000.2,
                     INSD:EG481774.1,INSD:BP838847.1,INSD:ES005188.1,
                     INSD:BP640556.1,INSD:BP781196.1,INSD:BP648768.1,
                     INSD:BP838761.1,INSD:EL995166.1,INSD:DR258985.1,
                     INSD:EG480924.1,INSD:BP784810.1,INSD:BP803132.1,
                     INSD:EG508681.1,INSD:EH974242.1,INSD:DR227824.1,
                     INSD:EL312291.1,INSD:BP840101.1,INSD:EL290987.1,
                     INSD:EG513945.1,INSD:EG508667.1,INSD:BP597666.1,
                     INSD:DR258996.1,INSD:BP631225.1,INSD:EG481773.1,
                     INSD:ES191490.1,INSD:BP787955.1,INSD:EL266730.1,
                     INSD:EG440291.1,INSD:AV794320.1,INSD:BP809019.1,
                     INSD:BP820094.1,INSD:EL258947.1,INSD:BP628779.1,
                     INSD:EG513921.1,INSD:CB260959.1,INSD:AV783685.1,
                     INSD:EH862708.1,INSD:EL183981.1,INSD:EL264886.1,
                     INSD:BP823295.1,INSD:EL004778.1,INSD:AV801696.1,
                     INSD:BP660264.1,INSD:EL169086.1,INSD:BP844580.1,
                     INSD:EL150370.1,INSD:N65298.1,INSD:BP652300.1,
                     INSD:BP636219.1,INSD:BP637762.1,INSD:BP782276.1,
                     INSD:AV541922.1,INSD:EL154395.1,INSD:BP850731.1,
                     INSD:AV540998.1,INSD:BP840202.1,INSD:AV795629.1,
                     INSD:EL318816.1,INSD:BP607275.1,INSD:BP787726.1,
                     INSD:BP593828.1,INSD:BP635440.1,INSD:BP777708.1,
                     INSD:AV816951.1,INSD:ES032057.1,INSD:AV822831.1,
                     INSD:BP582351.1,INSD:DR258992.1,INSD:AV794753.1,
                     INSD:AA651159.1,INSD:BP794281.1,INSD:ES095301.1,
                     INSD:EG461059.1,INSD:CB258604.1,INSD:BP647968.1,
                     INSD:DR258989.1,INSD:BP608240.1,INSD:BP815661.1,
                     INSD:AV794317.1,INSD:EL306999.1,INSD:EL046430.1,
                     INSD:CB253858.1,INSD:BP832706.1,INSD:EG461060.1,
                     INSD:BP811823.1,INSD:EH829663.1,INSD:BP658261.1,
                     INSD:AV541894.1,INSD:BP651452.1,INSD:CD532456.1,
                     INSD:BP643610.1,INSD:BP842399.1,INSD:BP658771.1,
                     INSD:ES176986.1,INSD:BP613443.1,INSD:AV792941.1,
                     INSD:BP805469.1,INSD:CD534425.1,INSD:CB253438.1,
                     INSD:BP786896.1,INSD:ES101558.1,INSD:AV529980.1,
                     INSD:BP651930.1,INSD:BP839068.1,INSD:ES158017.1,
                     INSD:BP831700.1,INSD:AV540879.1,INSD:AV813943.1,
                     INSD:BP657319.1,INSD:EL191738.1,INSD:AV820980.1,
                     INSD:EG508680.1,INSD:AV826586.1,INSD:ES102566.1,
                     INSD:EH850728.1,INSD:BP817839.1,INSD:ES141651.1,
                     INSD:AV821082.1,INSD:BP614404.1,INSD:EH913596.1,
                     INSD:BP650353.1,INSD:BP786322.1,INSD:EL285033.1,
                     INSD:EH976461.1,INSD:AV829498.1,INSD:ES100550.1,
                     INSD:DR258987.1,INSD:BP651060.1,INSD:BP799271.1,
                     INSD:EL227974.1,INSD:BP813321.1,INSD:BP848609.1,
                     INSD:BP819128.1,INSD:DR227826.1,INSD:BP816102.1,
                     INSD:ES030481.1,INSD:EG440290.1,INSD:BP658509.1,
                     INSD:BP578578.1,INSD:BP607576.1,INSD:AV829722.1,
                     INSD:BP808020.1,INSD:EL216670.1,INSD:EL138511.1,
                     INSD:AV824478.1,INSD:BP639154.1,INSD:DR259443.1,
                     INSD:EL194872.1,INSD:EL980051.1,INSD:BP781715.1,
                     INSD:EL159122.1,INSD:EL214274.1,INSD:EL009939.1,
                     INSD:BP642668.1,INSD:H36043.1,INSD:BP837153.1,
                     INSD:BP831417.1,INSD:BP809232.1,INSD:EL975580.1,
                     INSD:EL245278.1,INSD:BE522709.1,INSD:EL042297.1,
                     INSD:EL190879.1,INSD:EL056743.1,INSD:BP566314.1,
                     INSD:BP806426.1,INSD:BP632240.1,INSD:AV806531.1,
                     INSD:AA395076.1,INSD:BP808931.1,INSD:EL297599.1,
                     INSD:EL112614.1,INSD:CD531694.1,INSD:BP616349.1,
                     INSD:DR227829.1,INSD:EG464311.1,INSD:BP851738.1,
                     INSD:BP628978.1,INSD:EL302142.1,INSD:AV810595.1,
                     INSD:BP790171.1,INSD:BP619883.1,INSD:EH856340.1,
                     INSD:EH982666.1,INSD:AV825877.1,INSD:DR258995.1,
                     INSD:BP798545.1,INSD:DR258984.1,INSD:BP662973.1,
                     INSD:BP585512.1,INSD:EH916983.1,INSD:BP842101.1,
                     INSD:AB050574.1,INSD:BP866091.1,INSD:EH960243.1,
                     INSD:ES026683.1,INSD:EH857328.1,INSD:BP831605.1,
                     INSD:AV802449.1,INSD:EG464310.1,INSD:BP601164.1,
                     INSD:BP652381.1,INSD:EH986257.1,INSD:DR227825.1,
                     INSD:BP835713.1,INSD:BP579376.1,INSD:BP786097.1,
                     INSD:BP609469.1,INSD:BP633052.1,INSD:BP786023.1,
                     INSD:BP810804.1,INSD:EL265422.1,INSD:AV814893.1,
                     INSD:BP779427.1,INSD:AV792279.1,INSD:BP576030.1,
                     INSD:EH880862.1,INSD:BP605267.1,INSD:BP815297.1,
                     INSD:ES115791.1,INSD:EH906579.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY062591.1,INSD:AB010259.1"
                     /db_xref="TAIR:AT3G01540"
                     /db_xref="Araport:AT3G01540"
     CDS             complement(join(213077..213209,213311..213619,
                     213716..213993,214070..214420,214520..214789,
                     215401..215469,215615..215773,215855..216142))
                     /gene="DRH1"
                     /locus_tag="AT3G01540"
                     /gene_synonym="ARABIDOPSIS THALIANA DEAD BOX RNA HELICASE
                     1"
                     /gene_synonym="ATDRH1"
                     /gene_synonym="DEAD box RNA helicase 1"
                     /gene_synonym="F4P13.9"
                     /gene_synonym="F4P13_9"
                     /gene_synonym="RNA HELICASE DRH1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP833916.1,INSD:EH841870.1,INSD:DR258998.1,
                     INSD:BP787749.1,INSD:AV802153.1,INSD:CB253423.1,
                     INSD:BP785012.1,INSD:T43848.1,INSD:EL102123.1,
                     INSD:BP833022.1,INSD:BP786282.1,INSD:BP821492.1,
                     INSD:BP626750.1,INSD:EL203917.1,INSD:EL315405.1,
                     INSD:EL103123.1,INSD:ES077655.1,INSD:EL121792.1,
                     INSD:ES110153.1,INSD:EL124603.1,INSD:BP590736.1,
                     INSD:DR258997.1,INSD:BP635419.1,INSD:EH826560.1,
                     INSD:EL194383.1,INSD:EL056695.1,INSD:AV548589.1,
                     INSD:BP823963.1,INSD:BP838802.1,INSD:EH967163.1,
                     INSD:BP812597.1,INSD:EL987048.1,INSD:DR258994.1,
                     INSD:BP851000.2,INSD:EG481774.1,INSD:BP838847.1,
                     INSD:ES005188.1,INSD:EG480925.1,INSD:BP640556.1,
                     INSD:BP648768.1,INSD:AV546113.1,INSD:BP838761.1,
                     INSD:EL995166.1,INSD:DR258985.1,INSD:EG480924.1,
                     INSD:BP803132.1,INSD:EG508681.1,INSD:EH974242.1,
                     INSD:DR227824.1,INSD:EL312291.1,INSD:BP840101.1,
                     INSD:EL290987.1,INSD:EG513945.1,INSD:EG508667.1,
                     INSD:BP597666.1,INSD:DR258996.1,INSD:BP631225.1,
                     INSD:AV810818.1,INSD:AV786327.1,INSD:EG481773.1,
                     INSD:ES191490.1,INSD:AV790446.1,INSD:EL266730.1,
                     INSD:EG440291.1,INSD:BP779887.1,INSD:BP809019.1,
                     INSD:BP820094.1,INSD:EL258947.1,INSD:BP628779.1,
                     INSD:EG513921.1,INSD:AV813274.1,INSD:CB260959.1,
                     INSD:AV783685.1,INSD:EH862708.1,INSD:AV792772.1,
                     INSD:EL183981.1,INSD:EL264886.1,INSD:BP823295.1,
                     INSD:BP643327.1,INSD:EL004778.1,INSD:AV801696.1,
                     INSD:BP607782.1,INSD:BP660264.1,INSD:EL169086.1,
                     INSD:BP844580.1,INSD:EL150370.1,INSD:BP669397.1,
                     INSD:BP784947.1,INSD:N65298.1,INSD:BP652300.1,
                     INSD:BP637762.1,INSD:BP782276.1,INSD:EL154395.1,
                     INSD:CK121333.1,INSD:BP850731.1,INSD:BP840202.1,
                     INSD:EL318816.1,INSD:BP607275.1,INSD:BP787726.1,
                     INSD:BP588655.1,INSD:ES032057.1,INSD:AV822831.1,
                     INSD:BP582351.1,INSD:DR258992.1,INSD:AA651159.1,
                     INSD:BP794281.1,INSD:ES095301.1,INSD:EG461059.1,
                     INSD:CB258604.1,INSD:BP647968.1,INSD:DR258989.1,
                     INSD:BP608240.1,INSD:EG490851.1,INSD:BP815661.1,
                     INSD:EL306999.1,INSD:EL046430.1,INSD:CB253858.1,
                     INSD:BP832706.1,INSD:EG461060.1,INSD:BP811823.1,
                     INSD:EH829663.1,INSD:AV808476.1,INSD:BP658261.1,
                     INSD:AV807543.1,INSD:AV541894.1,INSD:BP651452.1,
                     INSD:BP643610.1,INSD:BP842399.1,INSD:BP658771.1,
                     INSD:ES176986.1,INSD:BP805469.1,INSD:CD534434.1,
                     INSD:CB253438.1,INSD:ES101558.1,INSD:AV529980.1,
                     INSD:BP651930.1,INSD:BP839068.1,INSD:ES158017.1,
                     INSD:BP831700.1,INSD:AV813943.1,INSD:BP657319.1,
                     INSD:EL191738.1,INSD:AV820980.1,INSD:EG508680.1,
                     INSD:AV826586.1,INSD:ES102566.1,INSD:EH850728.1,
                     INSD:BP817839.1,INSD:ES141651.1,INSD:AV821082.1,
                     INSD:EH913596.1,INSD:BP650353.1,INSD:BP786322.1,
                     INSD:EL285033.1,INSD:EH976461.1,INSD:AV829498.1,
                     INSD:ES100550.1,INSD:DR258987.1,INSD:BP651060.1,
                     INSD:BP799271.1,INSD:EL227974.1,INSD:BP813321.1,
                     INSD:BP848609.1,INSD:BP819128.1,INSD:DR227826.1,
                     INSD:BP816102.1,INSD:ES030481.1,INSD:EG440290.1,
                     INSD:BP658509.1,INSD:BP578578.1,INSD:AI998826.1,
                     INSD:AV829722.1,INSD:BP808020.1,INSD:EL216670.1,
                     INSD:AV812971.1,INSD:EL138511.1,INSD:AV824478.1,
                     INSD:BP639154.1,INSD:DR259443.1,INSD:EL194872.1,
                     INSD:EL980051.1,INSD:BP781715.1,INSD:EL159122.1,
                     INSD:EL214274.1,INSD:EL009939.1,INSD:AV537360.1,
                     INSD:H36043.1,INSD:BP837153.1,INSD:BP831417.1,
                     INSD:BP651592.1,INSD:BP809232.1,INSD:EL975580.1,
                     INSD:EL245278.1,INSD:EL042297.1,INSD:EL190879.1,
                     INSD:EL056743.1,INSD:BP632240.1,INSD:BP806426.1,
                     INSD:BP614854.1,INSD:AA395076.1,INSD:EL297599.1,
                     INSD:BP808931.1,INSD:EL112614.1,INSD:CD531694.1,
                     INSD:BP616349.1,INSD:DR227829.1,INSD:BP851738.1,
                     INSD:BP628978.1,INSD:EL302142.1,INSD:AV810595.1,
                     INSD:BP790171.1,INSD:AV795516.1,INSD:EH856340.1,
                     INSD:EH982666.1,INSD:AV825877.1,INSD:DR258995.1,
                     INSD:BP798545.1,INSD:DR258984.1,INSD:BP662973.1,
                     INSD:AV814306.1,INSD:EH916983.1,INSD:AV792539.1,
                     INSD:BP842101.1,INSD:BP866091.1,INSD:EH960243.1,
                     INSD:ES026683.1,INSD:EH857328.1,INSD:BP831605.1,
                     INSD:AV802449.1,INSD:BP652381.1,INSD:EH986257.1,
                     INSD:DR227825.1,INSD:BP835713.1,INSD:BP579376.1,
                     INSD:BP633052.1,INSD:EL008010.1,INSD:BP786023.1,
                     INSD:EL265422.1,INSD:AV814893.1,INSD:BP779427.1,
                     INSD:BP810804.1,INSD:AV792279.1,INSD:EH880862.1,
                     INSD:BP815297.1,INSD:ES115791.1,INSD:EH906579.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT009670.1,INSD:AF428313.1,INSD:BT000795.1,
                     INSD:AY050375.1"
                     /note="DEAD box RNA helicase 1 (DRH1); FUNCTIONS IN:
                     ATPase activity, ATP-dependent RNA helicase activity;
                     EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 15
                     growth stages; CONTAINS InterPro DOMAIN/s: DNA/RNA
                     helicase, DEAD/DEAH box type, N-terminal
                     (InterPro:IPR011545), RNA helicase, ATP-dependent,
                     DEAD-box, conserved site (InterPro:IPR000629), RNA
                     helicase, DEAD-box type, Q motif (InterPro:IPR014014),
                     WW/Rsp5/WWP (InterPro:IPR001202), DEAD-like helicase,
                     N-terminal (InterPro:IPR014001), DNA/RNA helicase,
                     C-terminal (InterPro:IPR001650), Helicase, superfamily
                     1/2, ATP-binding domain (InterPro:IPR014021); BEST
                     Arabidopsis thaliana protein match is: DEAD box RNA
                     helicase family protein (TAIR:AT5G14610.2); Has 49839
                     Blast hits to 48969 proteins in 3110 species: Archae -
                     949; Bacteria - 26028; Metazoa - 6650; Fungi - 4984;
                     Plants - 2792; Viruses - 23; Other Eukaryotes - 8413
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="DEAD box RNA helicase 1"
                     /protein_id="AEE73684.1"
                     /db_xref="TAIR:AT3G01540"
                     /db_xref="Araport:AT3G01540"
                     /translation="MAATAAASVVRYAPEDHTLPKPWKGLIDDRTGYLYFWNPETNVT
                     QYEKPTPSLPPKFSPAVSVSSSVQVQQTDAYAPPKDDDKYSRGSERVSRFSEGGRSGP
                     PYSNGAANGVGDSAYGAASTRVPLPSSAPASELSPEAYSRRHEITVSGGQVPPPLMSF
                     EATGFPPELLREVLSAGFSAPTPIQAQSWPIAMQGRDIVAIAKTGSGKTLGYLIPGFL
                     HLQRIRNDSRMGPTILVLSPTRELATQIQEEAVKFGRSSRISCTCLYGGAPKGPQLRD
                     LERGADIVVATPGRLNDILEMRRISLRQISYLVLDEADRMLDMGFEPQIRKIVKEIPT
                     KRQTLMYTATWPKGVRKIAADLLVNPAQVNIGNVDELVANKSITQHIEVVAPMEKQRR
                     LEQILRSQEPGSKVIIFCSTKRMCDQLTRNLTRQFGAAAIHGDKSQPERDNVLNQFRS
                     GRTPVLVATDVAARGLDVKDIRAVVNYDFPNGVEDYVHRIGRTGRAGATGQAFTFFGD
                     QDSKHASDLIKILEGANQRVPPQIREMATRGGGGMNKFSRWGPPSGGRGRGGDSGYGG
                     RGSFASRDRSSNGWGRERERSRSPERFNRAPPPSSTGSPPRSFHETMMMKHR"
     CDS             complement(join(213077..213212,213311..213619,
                     213716..213993,214070..214420,214520..214789,
                     215401..215469,215615..215773,215855..216142))
                     /gene="DRH1"
                     /locus_tag="AT3G01540"
                     /gene_synonym="ARABIDOPSIS THALIANA DEAD BOX RNA HELICASE
                     1"
                     /gene_synonym="ATDRH1"
                     /gene_synonym="DEAD box RNA helicase 1"
                     /gene_synonym="F4P13.9"
                     /gene_synonym="F4P13_9"
                     /gene_synonym="RNA HELICASE DRH1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP833916.1,INSD:EH841870.1,INSD:DR258998.1,
                     INSD:BP787749.1,INSD:BP615182.1,INSD:BP785012.1,
                     INSD:T43848.1,INSD:EL102123.1,INSD:BP833022.1,
                     INSD:BP786282.1,INSD:BP821492.1,INSD:BP626750.1,
                     INSD:EL203917.1,INSD:EL315405.1,INSD:EL103123.1,
                     INSD:AV815750.1,INSD:ES077655.1,INSD:EL121792.1,
                     INSD:ES110153.1,INSD:BP590736.1,INSD:DR258997.1,
                     INSD:EH826560.1,INSD:EL194383.1,INSD:CD529771.1,
                     INSD:BP613015.1,INSD:EL056695.1,INSD:BP790577.1,
                     INSD:AV548589.1,INSD:AV815251.1,INSD:BP823963.1,
                     INSD:BP838802.1,INSD:EH967163.1,INSD:BP812597.1,
                     INSD:EL987048.1,INSD:DR258994.1,INSD:BP851000.2,
                     INSD:EG481774.1,INSD:BP838847.1,INSD:ES005188.1,
                     INSD:BP640556.1,INSD:BP781196.1,INSD:BP648768.1,
                     INSD:BP838761.1,INSD:EL995166.1,INSD:DR258985.1,
                     INSD:EG480924.1,INSD:BP784810.1,INSD:BP803132.1,
                     INSD:EG508681.1,INSD:EH974242.1,INSD:DR227824.1,
                     INSD:EL312291.1,INSD:BP840101.1,INSD:EL290987.1,
                     INSD:EG513945.1,INSD:EG508667.1,INSD:BP597666.1,
                     INSD:DR258996.1,INSD:BP631225.1,INSD:EG481773.1,
                     INSD:ES191490.1,INSD:BP787955.1,INSD:EL266730.1,
                     INSD:EG440291.1,INSD:AV794320.1,INSD:BP809019.1,
                     INSD:BP820094.1,INSD:EL258947.1,INSD:BP628779.1,
                     INSD:EG513921.1,INSD:CB260959.1,INSD:AV783685.1,
                     INSD:EH862708.1,INSD:EL183981.1,INSD:EL264886.1,
                     INSD:BP823295.1,INSD:EL004778.1,INSD:AV801696.1,
                     INSD:BP660264.1,INSD:EL169086.1,INSD:BP844580.1,
                     INSD:EL150370.1,INSD:N65298.1,INSD:BP652300.1,
                     INSD:BP636219.1,INSD:BP637762.1,INSD:BP782276.1,
                     INSD:AV541922.1,INSD:EL154395.1,INSD:BP850731.1,
                     INSD:AV540998.1,INSD:BP840202.1,INSD:AV795629.1,
                     INSD:EL318816.1,INSD:BP607275.1,INSD:BP787726.1,
                     INSD:BP593828.1,INSD:BP635440.1,INSD:BP777708.1,
                     INSD:AV816951.1,INSD:ES032057.1,INSD:AV822831.1,
                     INSD:BP582351.1,INSD:DR258992.1,INSD:AV794753.1,
                     INSD:AA651159.1,INSD:BP794281.1,INSD:ES095301.1,
                     INSD:EG461059.1,INSD:CB258604.1,INSD:BP647968.1,
                     INSD:DR258989.1,INSD:BP608240.1,INSD:BP815661.1,
                     INSD:AV794317.1,INSD:EL306999.1,INSD:EL046430.1,
                     INSD:CB253858.1,INSD:BP832706.1,INSD:EG461060.1,
                     INSD:BP811823.1,INSD:EH829663.1,INSD:BP658261.1,
                     INSD:AV541894.1,INSD:BP651452.1,INSD:CD532456.1,
                     INSD:BP643610.1,INSD:BP842399.1,INSD:BP658771.1,
                     INSD:ES176986.1,INSD:BP613443.1,INSD:AV792941.1,
                     INSD:BP805469.1,INSD:CD534425.1,INSD:CB253438.1,
                     INSD:BP786896.1,INSD:ES101558.1,INSD:AV529980.1,
                     INSD:BP651930.1,INSD:BP839068.1,INSD:ES158017.1,
                     INSD:BP831700.1,INSD:AV540879.1,INSD:AV813943.1,
                     INSD:BP657319.1,INSD:EL191738.1,INSD:AV820980.1,
                     INSD:EG508680.1,INSD:AV826586.1,INSD:ES102566.1,
                     INSD:EH850728.1,INSD:BP817839.1,INSD:ES141651.1,
                     INSD:AV821082.1,INSD:BP614404.1,INSD:EH913596.1,
                     INSD:BP650353.1,INSD:BP786322.1,INSD:EL285033.1,
                     INSD:EH976461.1,INSD:AV829498.1,INSD:ES100550.1,
                     INSD:DR258987.1,INSD:BP651060.1,INSD:BP799271.1,
                     INSD:EL227974.1,INSD:BP813321.1,INSD:BP848609.1,
                     INSD:BP819128.1,INSD:DR227826.1,INSD:BP816102.1,
                     INSD:ES030481.1,INSD:EG440290.1,INSD:BP658509.1,
                     INSD:BP578578.1,INSD:BP607576.1,INSD:AV829722.1,
                     INSD:BP808020.1,INSD:EL216670.1,INSD:EL138511.1,
                     INSD:AV824478.1,INSD:BP639154.1,INSD:DR259443.1,
                     INSD:EL194872.1,INSD:EL980051.1,INSD:BP781715.1,
                     INSD:EL159122.1,INSD:EL214274.1,INSD:EL009939.1,
                     INSD:BP642668.1,INSD:H36043.1,INSD:BP837153.1,
                     INSD:BP831417.1,INSD:BP809232.1,INSD:EL975580.1,
                     INSD:EL245278.1,INSD:BE522709.1,INSD:EL042297.1,
                     INSD:EL190879.1,INSD:EL056743.1,INSD:BP566314.1,
                     INSD:BP806426.1,INSD:BP632240.1,INSD:AV806531.1,
                     INSD:AA395076.1,INSD:BP808931.1,INSD:EL297599.1,
                     INSD:EL112614.1,INSD:CD531694.1,INSD:BP616349.1,
                     INSD:DR227829.1,INSD:EG464311.1,INSD:BP851738.1,
                     INSD:BP628978.1,INSD:EL302142.1,INSD:AV810595.1,
                     INSD:BP790171.1,INSD:BP619883.1,INSD:EH856340.1,
                     INSD:EH982666.1,INSD:AV825877.1,INSD:DR258995.1,
                     INSD:BP798545.1,INSD:DR258984.1,INSD:BP662973.1,
                     INSD:BP585512.1,INSD:EH916983.1,INSD:BP842101.1,
                     INSD:AB050574.1,INSD:BP866091.1,INSD:EH960243.1,
                     INSD:ES026683.1,INSD:EH857328.1,INSD:BP831605.1,
                     INSD:AV802449.1,INSD:EG464310.1,INSD:BP601164.1,
                     INSD:BP652381.1,INSD:EH986257.1,INSD:DR227825.1,
                     INSD:BP835713.1,INSD:BP579376.1,INSD:BP786097.1,
                     INSD:BP609469.1,INSD:BP633052.1,INSD:BP786023.1,
                     INSD:BP810804.1,INSD:EL265422.1,INSD:AV814893.1,
                     INSD:BP779427.1,INSD:AV792279.1,INSD:BP576030.1,
                     INSD:EH880862.1,INSD:BP605267.1,INSD:BP815297.1,
                     INSD:ES115791.1,INSD:EH906579.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY062591.1,INSD:AB010259.1"
                     /note="DEAD box RNA helicase 1 (DRH1); FUNCTIONS IN:
                     ATPase activity, ATP-dependent RNA helicase activity;
                     EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 15
                     growth stages; CONTAINS InterPro DOMAIN/s: DNA/RNA
                     helicase, DEAD/DEAH box type, N-terminal
                     (InterPro:IPR011545), RNA helicase, ATP-dependent,
                     DEAD-box, conserved site (InterPro:IPR000629), RNA
                     helicase, DEAD-box type, Q motif (InterPro:IPR014014),
                     WW/Rsp5/WWP (InterPro:IPR001202), DEAD-like helicase,
                     N-terminal (InterPro:IPR014001), DNA/RNA helicase,
                     C-terminal (InterPro:IPR001650), Helicase, superfamily
                     1/2, ATP-binding domain (InterPro:IPR014021); BEST
                     Arabidopsis thaliana protein match is: DEAD box RNA
                     helicase family protein (TAIR:AT5G14610.2); Has 50187
                     Blast hits to 49315 proteins in 3135 species: Archae -
                     949; Bacteria - 26432; Metazoa - 6592; Fungi - 4988;
                     Plants - 2789; Viruses - 23; Other Eukaryotes - 8414
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="DEAD box RNA helicase 1"
                     /protein_id="AEE73683.1"
                     /db_xref="TAIR:AT3G01540"
                     /db_xref="Araport:AT3G01540"
                     /translation="MAATAAASVVRYAPEDHTLPKPWKGLIDDRTGYLYFWNPETNVT
                     QYEKPTPSLPPKFSPAVSVSSSVQVQQTDAYAPPKDDDKYSRGSERVSRFSEGGRSGP
                     PYSNGAANGVGDSAYGAASTRVPLPSSAPASELSPEAYSRRHEITVSGGQVPPPLMSF
                     EATGFPPELLREVLSAGFSAPTPIQAQSWPIAMQGRDIVAIAKTGSGKTLGYLIPGFL
                     HLQRIRNDSRMGPTILVLSPTRELATQIQEEAVKFGRSSRISCTCLYGGAPKGPQLRD
                     LERGADIVVATPGRLNDILEMRRISLRQISYLVLDEADRMLDMGFEPQIRKIVKEIPT
                     KRQTLMYTATWPKGVRKIAADLLVNPAQVNIGNVDELVANKSITQHIEVVAPMEKQRR
                     LEQILRSQEPGSKVIIFCSTKRMCDQLTRNLTRQFGAAAIHGDKSQPERDNVLNQFRS
                     GRTPVLVATDVAARGLDVKDIRAVVNYDFPNGVEDYVHRIGRTGRAGATGQAFTFFGD
                     QDSKHASDLIKILEGANQRVPPQIREMATRGGGGMNKFSRWGPPSGGRGRGGDSGYGG
                     RGSFASRDSRSSNGWGRERERSRSPERFNRAPPPSSTGSPPRSFHETMMMKHR"
     CDS             complement(join(213077..213212,213311..213619,
                     213716..213993,214070..214420,214520..214789,
                     215401..215469,215615..215773,215855..216142))
                     /gene="DRH1"
                     /locus_tag="AT3G01540"
                     /gene_synonym="ARABIDOPSIS THALIANA DEAD BOX RNA HELICASE
                     1"
                     /gene_synonym="ATDRH1"
                     /gene_synonym="DEAD box RNA helicase 1"
                     /gene_synonym="F4P13.9"
                     /gene_synonym="F4P13_9"
                     /gene_synonym="RNA HELICASE DRH1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH841870.1,INSD:BP787749.1,INSD:BP615182.1,
                     INSD:BP785012.1,INSD:T43848.1,INSD:EL102123.1,
                     INSD:BP786282.1,INSD:BP626750.1,INSD:EL203917.1,
                     INSD:EL315405.1,INSD:EL103123.1,INSD:AV815750.1,
                     INSD:ES077655.1,INSD:EL121792.1,INSD:ES110153.1,
                     INSD:BP590736.1,INSD:EH826560.1,INSD:EL194383.1,
                     INSD:CD529771.1,INSD:BP613015.1,INSD:EL056695.1,
                     INSD:BP790577.1,INSD:AV548589.1,INSD:DR258993.1,
                     INSD:AV815251.1,INSD:EH967163.1,INSD:EL987048.1,
                     INSD:ES005188.1,INSD:BP640556.1,INSD:BP781196.1,
                     INSD:BP648768.1,INSD:EL995166.1,INSD:BP784810.1,
                     INSD:EG508681.1,INSD:EH974242.1,INSD:EL312291.1,
                     INSD:EL290987.1,INSD:EG508667.1,INSD:BP597666.1,
                     INSD:BP631225.1,INSD:ES191490.1,INSD:BP787955.1,
                     INSD:EL266730.1,INSD:EG440291.1,INSD:AV794320.1,
                     INSD:EL258947.1,INSD:BP628779.1,INSD:CB260959.1,
                     INSD:AV783685.1,INSD:EH862708.1,INSD:EL183981.1,
                     INSD:EL264886.1,INSD:EL004778.1,INSD:AV801696.1,
                     INSD:BP660264.1,INSD:EL169086.1,INSD:EL150370.1,
                     INSD:N65298.1,INSD:BP652300.1,INSD:DR258988.1,
                     INSD:BP636219.1,INSD:BP637762.1,INSD:BP782276.1,
                     INSD:AV541922.1,INSD:EL154395.1,INSD:AV540998.1,
                     INSD:AV795629.1,INSD:EL318816.1,INSD:BP607275.1,
                     INSD:BP787726.1,INSD:BP593828.1,INSD:BP635440.1,
                     INSD:BP777708.1,INSD:AV816951.1,INSD:ES032057.1,
                     INSD:BP582351.1,INSD:AV794753.1,INSD:AA651159.1,
                     INSD:BP794281.1,INSD:ES095301.1,INSD:EG461059.1,
                     INSD:BP647968.1,INSD:DR227828.1,INSD:BP608240.1,
                     INSD:AV794317.1,INSD:EL306999.1,INSD:EL046430.1,
                     INSD:EG461060.1,INSD:EH829663.1,INSD:BP658261.1,
                     INSD:AV541894.1,INSD:BP651452.1,INSD:CD532456.1,
                     INSD:BP643610.1,INSD:BP658771.1,INSD:ES176986.1,
                     INSD:BP613443.1,INSD:AV792941.1,INSD:CD534425.1,
                     INSD:CB253438.1,INSD:BP786896.1,INSD:ES101558.1,
                     INSD:BP651930.1,INSD:ES158017.1,INSD:AV813943.1,
                     INSD:BP657319.1,INSD:AV540879.1,INSD:AV820980.1,
                     INSD:EL191738.1,INSD:EG508680.1,INSD:DR258990.1,
                     INSD:ES102566.1,INSD:EH850728.1,INSD:ES141651.1,
                     INSD:AV821082.1,INSD:BP614404.1,INSD:EH913596.1,
                     INSD:BP650353.1,INSD:BP786322.1,INSD:EL285033.1,
                     INSD:EH976461.1,INSD:ES100550.1,INSD:BP651060.1,
                     INSD:EL227974.1,INSD:ES030481.1,INSD:EG440290.1,
                     INSD:BP658509.1,INSD:BP578578.1,INSD:BP607576.1,
                     INSD:DR258981.1,INSD:EL216670.1,INSD:EL138511.1,
                     INSD:AV824478.1,INSD:BP639154.1,INSD:DR259443.1,
                     INSD:DR258982.1,INSD:EL194872.1,INSD:EL980051.1,
                     INSD:BP781715.1,INSD:EL159122.1,INSD:EL214274.1,
                     INSD:EL009939.1,INSD:BP642668.1,INSD:H36043.1,
                     INSD:EL975580.1,INSD:EL245278.1,INSD:BE522709.1,
                     INSD:EL042297.1,INSD:EL190879.1,INSD:EL056743.1,
                     INSD:BP566314.1,INSD:DR258991.1,INSD:BP632240.1,
                     INSD:AV806531.1,INSD:AA395076.1,INSD:EL297599.1,
                     INSD:EL112614.1,INSD:CD531694.1,INSD:BP616349.1,
                     INSD:EG464311.1,INSD:BP628978.1,INSD:AV810595.1,
                     INSD:EL302142.1,INSD:BP790171.1,INSD:BP619883.1,
                     INSD:EH856340.1,INSD:BP662973.1,INSD:BP585512.1,
                     INSD:EH916983.1,INSD:AB050574.1,INSD:DR258983.1,
                     INSD:EH960243.1,INSD:ES026683.1,INSD:EH857328.1,
                     INSD:AV802449.1,INSD:EG464310.1,INSD:BP601164.1,
                     INSD:BP652381.1,INSD:EH986257.1,INSD:BP579376.1,
                     INSD:BP786097.1,INSD:BP609469.1,INSD:BP633052.1,
                     INSD:DR258986.1,INSD:BP786023.1,INSD:EL265422.1,
                     INSD:AV814893.1,INSD:BP779427.1,INSD:AV792279.1,
                     INSD:BP576030.1,INSD:EH880862.1,INSD:BP605267.1,
                     INSD:ES115791.1,INSD:EH906579.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX823517.1,INSD:AB010259.1"
                     /note="DEAD box RNA helicase 1 (DRH1); FUNCTIONS IN:
                     ATPase activity, ATP-dependent RNA helicase activity;
                     EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 15
                     growth stages; CONTAINS InterPro DOMAIN/s: DNA/RNA
                     helicase, DEAD/DEAH box type, N-terminal
                     (InterPro:IPR011545), RNA helicase, ATP-dependent,
                     DEAD-box, conserved site (InterPro:IPR000629), RNA
                     helicase, DEAD-box type, Q motif (InterPro:IPR014014),
                     WW/Rsp5/WWP (InterPro:IPR001202), DEAD-like helicase,
                     N-terminal (InterPro:IPR014001), DNA/RNA helicase,
                     C-terminal (InterPro:IPR001650), Helicase, superfamily
                     1/2, ATP-binding domain (InterPro:IPR014021); BEST
                     Arabidopsis thaliana protein match is: DEAD box RNA
                     helicase family protein (TAIR:AT5G14610.2); Has 35333
                     Blast hits to 34131 proteins in 2444 species: Archae -
                     798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants
                     - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="DEAD box RNA helicase 1"
                     /protein_id="AEE73685.1"
                     /db_xref="TAIR:AT3G01540"
                     /db_xref="Araport:AT3G01540"
                     /translation="MAATAAASVVRYAPEDHTLPKPWKGLIDDRTGYLYFWNPETNVT
                     QYEKPTPSLPPKFSPAVSVSSSVQVQQTDAYAPPKDDDKYSRGSERVSRFSEGGRSGP
                     PYSNGAANGVGDSAYGAASTRVPLPSSAPASELSPEAYSRRHEITVSGGQVPPPLMSF
                     EATGFPPELLREVLSAGFSAPTPIQAQSWPIAMQGRDIVAIAKTGSGKTLGYLIPGFL
                     HLQRIRNDSRMGPTILVLSPTRELATQIQEEAVKFGRSSRISCTCLYGGAPKGPQLRD
                     LERGADIVVATPGRLNDILEMRRISLRQISYLVLDEADRMLDMGFEPQIRKIVKEIPT
                     KRQTLMYTATWPKGVRKIAADLLVNPAQVNIGNVDELVANKSITQHIEVVAPMEKQRR
                     LEQILRSQEPGSKVIIFCSTKRMCDQLTRNLTRQFGAAAIHGDKSQPERDNVLNQFRS
                     GRTPVLVATDVAARGLDVKDIRAVVNYDFPNGVEDYVHRIGRTGRAGATGQAFTFFGD
                     QDSKHASDLIKILEGANQRVPPQIREMATRGGGGMNKFSRWGPPSGGRGRGGDSGYGG
                     RGSFASRDSRSSNGWGRERERSRSPERFNRAPPPSSTGSPPRSFHETMMMKHR"
     CDS             complement(join(213077..213212,213311..213619,
                     213716..213993,214070..214420,214520..214789,
                     215401..215469,215615..215773,215855..216142))
                     /gene="DRH1"
                     /locus_tag="AT3G01540"
                     /gene_synonym="ARABIDOPSIS THALIANA DEAD BOX RNA HELICASE
                     1"
                     /gene_synonym="ATDRH1"
                     /gene_synonym="DEAD box RNA helicase 1"
                     /gene_synonym="F4P13.9"
                     /gene_synonym="F4P13_9"
                     /gene_synonym="RNA HELICASE DRH1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP833916.1,INSD:CD532456.1,INSD:EH841870.1,
                     INSD:DR258998.1,INSD:BP842399.1,INSD:ES176986.1,
                     INSD:T43848.1,INSD:EL102123.1,INSD:AV792941.1,
                     INSD:BP833022.1,INSD:BP805469.1,INSD:CD534425.1,
                     INSD:BP786896.1,INSD:CB253438.1,INSD:BP821492.1,
                     INSD:ES101558.1,INSD:EL203917.1,INSD:AV529980.1,
                     INSD:EL103123.1,INSD:EL315405.1,INSD:AV815750.1,
                     INSD:EL121792.1,INSD:ES077655.1,INSD:BP839068.1,
                     INSD:ES110153.1,INSD:ES158017.1,INSD:BP831700.1,
                     INSD:AV540879.1,INSD:EL191738.1,INSD:EG508680.1,
                     INSD:AV826586.1,INSD:ES102566.1,INSD:DR258997.1,
                     INSD:EH850728.1,INSD:EH826560.1,INSD:BP817839.1,
                     INSD:EL194383.1,INSD:EL056695.1,INSD:BP790577.1,
                     INSD:ES141651.1,INSD:EH913596.1,INSD:EH976461.1,
                     INSD:AV829498.1,INSD:BP823963.1,INSD:ES100550.1,
                     INSD:BP838802.1,INSD:EH967163.1,INSD:BP812597.1,
                     INSD:DR258987.1,INSD:EL987048.1,INSD:DR258994.1,
                     INSD:EG481774.1,INSD:BP851000.2,INSD:BP799271.1,
                     INSD:EL227974.1,INSD:BP813321.1,INSD:BP848609.1,
                     INSD:BP838847.1,INSD:BP819128.1,INSD:ES005188.1,
                     INSD:DR227826.1,INSD:BP781196.1,INSD:BP838761.1,
                     INSD:BP816102.1,INSD:ES030481.1,INSD:EL995166.1,
                     INSD:DR258985.1,INSD:EG480924.1,INSD:AV829722.1,
                     INSD:BP808020.1,INSD:BP784810.1,INSD:BP803132.1,
                     INSD:EL216670.1,INSD:EG508681.1,INSD:EH974242.1,
                     INSD:DR227824.1,INSD:EL138511.1,INSD:EL312291.1,
                     INSD:AV824478.1,INSD:DR259443.1,INSD:EL194872.1,
                     INSD:BP840101.1,INSD:EL290987.1,INSD:EL980051.1,
                     INSD:EG508667.1,INSD:EG513945.1,INSD:EL159122.1,
                     INSD:DR258996.1,INSD:EL214274.1,INSD:EL009939.1,
                     INSD:EG481773.1,INSD:ES191490.1,INSD:EL266730.1,
                     INSD:AV794320.1,INSD:BP809019.1,INSD:BP642668.1,
                     INSD:BP820094.1,INSD:H36043.1,INSD:BP837153.1,
                     INSD:BP831417.1,INSD:EL258947.1,INSD:BP809232.1,
                     INSD:EG513921.1,INSD:EL245278.1,INSD:EL975580.1,
                     INSD:CB260959.1,INSD:EH862708.1,INSD:EL183981.1,
                     INSD:EL042297.1,INSD:EL264886.1,INSD:EL190879.1,
                     INSD:EL056743.1,INSD:BP823295.1,INSD:EL004778.1,
                     INSD:BP566314.1,INSD:BP806426.1,INSD:EL169086.1,
                     INSD:BP844580.1,INSD:N65298.1,INSD:AV806531.1,
                     INSD:BP808931.1,INSD:EL112614.1,INSD:DR227829.1,
                     INSD:EG464311.1,INSD:BP851738.1,INSD:BP636219.1,
                     INSD:EL302142.1,INSD:EL154395.1,INSD:BP850731.1,
                     INSD:AV540998.1,INSD:BP840202.1,INSD:EH982666.1,
                     INSD:EH856340.1,INSD:AV825877.1,INSD:DR258995.1,
                     INSD:BP798545.1,INSD:DR258984.1,INSD:EH916983.1,
                     INSD:EL318816.1,INSD:AV795629.1,INSD:BP842101.1,
                     INSD:AB050574.1,INSD:BP593828.1,INSD:BP777708.1,
                     INSD:BP866091.1,INSD:AV816951.1,INSD:EH960243.1,
                     INSD:ES032057.1,INSD:ES026683.1,INSD:EH857328.1,
                     INSD:AV822831.1,INSD:BP831605.1,INSD:DR258992.1,
                     INSD:AV794753.1,INSD:EG464310.1,INSD:EH986257.1,
                     INSD:DR227825.1,INSD:BP835713.1,INSD:ES095301.1,
                     INSD:EG461059.1,INSD:CB258604.1,INSD:BP786097.1,
                     INSD:DR258989.1,INSD:BP810804.1,INSD:EL265422.1,
                     INSD:BP815661.1,INSD:BP576030.1,INSD:EH880862.1,
                     INSD:CB253858.1,INSD:EL046430.1,INSD:EL306999.1,
                     INSD:BP832706.1,INSD:EG461060.1,INSD:BP811823.1,
                     INSD:EH829663.1,INSD:BP815297.1,INSD:EH906579.1,
                     INSD:ES115791.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY062591.1,INSD:AB010259.1"
                     /note="DEAD box RNA helicase 1 (DRH1); FUNCTIONS IN:
                     ATPase activity, ATP-dependent RNA helicase activity;
                     EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 15
                     growth stages; CONTAINS InterPro DOMAIN/s: DNA/RNA
                     helicase, DEAD/DEAH box type, N-terminal
                     (InterPro:IPR011545), RNA helicase, ATP-dependent,
                     DEAD-box, conserved site (InterPro:IPR000629), RNA
                     helicase, DEAD-box type, Q motif (InterPro:IPR014014),
                     WW/Rsp5/WWP (InterPro:IPR001202), DEAD-like helicase,
                     N-terminal (InterPro:IPR014001), DNA/RNA helicase,
                     C-terminal (InterPro:IPR001650), Helicase, superfamily
                     1/2, ATP-binding domain (InterPro:IPR014021); BEST
                     Arabidopsis thaliana protein match is: DEAD box RNA
                     helicase family protein (TAIR:AT5G14610.2); Has 35333
                     Blast hits to 34131 proteins in 2444 species: Archae -
                     798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants
                     - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product=&