LOCUS       CP002685            19698289 bp    DNA     linear   PLN 20-JUL-2017
DEFINITION  Arabidopsis thaliana chromosome 2 sequence.
ACCESSION   CP002685
VERSION     CP002685.1
DBLINK      BioProject: PRJNA10719
            BioSample: SAMN03081427
KEYWORDS    .
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 19698289)
  AUTHORS   Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D.,
            Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V.,
            Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L.,
            Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L.,
            Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H.,
            Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D.,
            Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and
            Venter,J.C.
  TITLE     Sequence and analysis of chromosome 2 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 761-768 (1999)
   PUBMED   10617197
REFERENCE   2  (bases 1 to 19698289)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
REFERENCE   3  (bases 1 to 19698289)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
FEATURES             Location/Qualifiers
     source          1..19698289
                     /organism="Arabidopsis thaliana"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:3702"
                     /chromosome="2"
                     /ecotype="Columbia"
     gap             1..1000
                     /estimated_length=1000
     gene            1025..3173
                     /locus_tag="AT2G01008"
                     /db_xref="Araport:AT2G01008"
                     /db_xref="TAIR:AT2G01008"
     mRNA            join(1025..1272,1458..1510,1873..3173)
                     /locus_tag="AT2G01008"
                     /product="maternal effect embryo arrest protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG511870.1,INSD:EG489100.1,INSD:EG489067.1,
                     INSD:EG489070.1,INSD:EG463378.1,INSD:EG511877.1,
                     INSD:EG511871.1,INSD:EG489069.1,INSD:EG511856.1,
                     INSD:EG434374.1,INSD:EG463377.1,INSD:EG467956.1,
                     INSD:EG511889.1"
                     /inference="similar to RNA sequence, mRNA:INSD:EF183283.1"
                     /db_xref="TAIR:AT2G01008"
                     /db_xref="Araport:AT2G01008"
     CDS             join(1025..1272,1458..1510,1873..2111)
                     /locus_tag="AT2G01008"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG511870.1,INSD:EG489100.1,INSD:EG489067.1,
                     INSD:EG489070.1,INSD:EG463378.1,INSD:EG511877.1,
                     INSD:EG511871.1,INSD:EG489069.1,INSD:EG511856.1,
                     INSD:EG434374.1,INSD:EG463377.1,INSD:EG467956.1,
                     INSD:EG511889.1"
                     /inference="similar to RNA sequence, mRNA:INSD:EF183283.1"
                     /note="FUNCTIONS IN: molecular_function unknown; INVOLVED
                     IN: biological_process unknown; LOCATED IN:
                     cellular_component unknown; BEST Arabidopsis thaliana
                     protein match is: maternal effect embryo arrest 38
                     (TAIR:AT3G43160.1)."
                     /codon_start=1
                     /product="maternal effect embryo arrest protein"
                     /protein_id="AEC05388.1"
                     /db_xref="Araport:AT2G01008"
                     /db_xref="TAIR:AT2G01008"
                     /translation="MLDQDDEWAMKIYRVRGMVDRVREFVDQDEEWSRICRPGVEIVD
                     RVREFVDQDGGTLDQDDEWAMKIYRVRGMVDQKLESSTGSETSSTGSEDSSTRTAGWG
                     WVLRESGQSVGTPFFGSDLGSDRGMVSDIDTRNDRPSGRRDFRRKTFSATFPAIGFVA
                     FFRVFSAVLGQKLMNRRGE"
     gene            2805..3176
                     /gene="MIR5642b"
                     /locus_tag="AT2G03855"
                     /db_xref="Araport:AT2G03855"
     precursor_RNA   2805..3176
                     /gene="MIR5642b"
                     /locus_tag="AT2G03855"
                     /product="microRNA ath-MIR5642b precursor"
                     /db_xref="Araport:AT2G03855"
     ncRNA           3145..3164
                     /ncRNA_class="miRNA"
                     /gene="MIR5642b"
                     /locus_tag="AT2G03855"
                     /product="microRNA ath-miR5642b"
                     /note="mature miRNA accession:MIMAT0022435"
                     /db_xref="Araport:AT2G03855"
     gene            3706..5513
                     /locus_tag="AT2G01010"
                     /gene_synonym="51593.RRNA00001"
                     /db_xref="Araport:AT2G01010"
                     /db_xref="TAIR:AT2G01010"
     rRNA            3706..5513
                     /locus_tag="AT2G01010"
                     /gene_synonym="51593.RRNA00001"
                     /product="18S ribosomal RNA"
                     /db_xref="Araport:AT2G01010"
                     /db_xref="TAIR:AT2G01010"
     gene            5782..5945
                     /locus_tag="AT2G01020"
                     /gene_synonym="51593.RRNA00002"
                     /note="5.8SrRNA"
                     /db_xref="Araport:AT2G01020"
                     /db_xref="TAIR:AT2G01020"
     rRNA            5782..5945
                     /locus_tag="AT2G01020"
                     /gene_synonym="51593.RRNA00002"
                     /product="5S ribosomal RNA"
                     /db_xref="Araport:AT2G01020"
                     /db_xref="TAIR:AT2G01020"
     gene            6571..6672
                     /locus_tag="AT2G01021"
                     /db_xref="Araport:AT2G01021"
                     /db_xref="TAIR:AT2G01021"
     mRNA            6571..6672
                     /locus_tag="AT2G01021"
                     /product="hypothetical protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV550888.1,INSD:ES003763.1,INSD:AV528184.1,
                     INSD:AA042643.1,INSD:ES062036.1,INSD:ES127291.1,
                     INSD:AV528190.1,INSD:EG515143.1,INSD:AV528806.1,
                     INSD:AV554739.1,INSD:ES079704.1,INSD:AV529390.1,
                     INSD:ES047365.1,INSD:EL975300.1,INSD:AV518379.1,
                     INSD:ES104298.1,INSD:AV529950.1,INSD:AV519779.1,
                     INSD:AV551928.1,INSD:AV519505.1,INSD:AV529485.1,
                     INSD:AV532365.1,INSD:BE523635.1"
                     /db_xref="TAIR:AT2G01021"
                     /db_xref="Araport:AT2G01021"
     CDS             6571..6672
                     /locus_tag="AT2G01021"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV550888.1,INSD:ES003763.1,INSD:AV528184.1,
                     INSD:AA042643.1,INSD:ES062036.1,INSD:ES127291.1,
                     INSD:AV528190.1,INSD:EG515143.1,INSD:AV528806.1,
                     INSD:AV554739.1,INSD:ES079704.1,INSD:AV529390.1,
                     INSD:ES047365.1,INSD:EL975300.1,INSD:AV518379.1,
                     INSD:ES104298.1,INSD:AV529950.1,INSD:AV519779.1,
                     INSD:AV551928.1,INSD:AV519505.1,INSD:AV529485.1,
                     INSD:AV532365.1,INSD:BE523635.1"
                     /note="unknown protein; Has 30201 Blast hits to 17322
                     proteins in 780 species: Archae - 12; Bacteria - 1396;
                     Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
                     Other Eukaryotes - 2996 (source: NCBI BLink)."
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEC05389.1"
                     /db_xref="Araport:AT2G01021"
                     /db_xref="TAIR:AT2G01021"
                     /translation="MRPGRMRNGAIRSADRFGAWTDADYGGGLSPGF"
     gene            7090..7505
                     /locus_tag="AT2G03865"
                     /db_xref="Araport:AT2G03865"
     misc_RNA        7090..7505
                     /locus_tag="AT2G03865"
                     /note="novel transcribed region; detected in root, carpel,
                     root apical meristem, receptacle, leaf, dark-grown
                     seedling, light-grown seedling, flower, pollen, aerial,
                     shoot apical meristem;
                     AT2G03865.1"
                     /db_xref="Araport:AT2G03865"
     gene            7669..9399
                     /locus_tag="AT2G03875"
                     /db_xref="Araport:AT2G03875"
     misc_RNA        7669..9399
                     /locus_tag="AT2G03875"
                     /note="novel transcribed region; detected in root, carpel,
                     root apical meristem, receptacle, leaf, dark-grown
                     seedling, light-grown seedling, flower, pollen, aerial,
                     shoot apical meristem;
                     AT2G03875.1"
                     /db_xref="Araport:AT2G03875"
     gene            complement(9648..9767)
                     /locus_tag="AT2G01023"
                     /db_xref="Araport:AT2G01023"
                     /db_xref="TAIR:AT2G01023"
     mRNA            complement(9648..9767)
                     /locus_tag="AT2G01023"
                     /product="hypothetical protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG508416.1,INSD:CB253636.1,INSD:EG508425.1,
                     INSD:EG500867.1,INSD:EG516455.1,INSD:EG500866.1,
                     INSD:EG508424.1,INSD:EG500857.1,INSD:EG500855.1,
                     INSD:EG500858.1"
                     /db_xref="TAIR:AT2G01023"
                     /db_xref="Araport:AT2G01023"
     CDS             complement(9648..9767)
                     /locus_tag="AT2G01023"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG508416.1,INSD:CB253636.1,INSD:EG508425.1,
                     INSD:EG500867.1,INSD:EG516455.1,INSD:EG500866.1,
                     INSD:EG508424.1,INSD:EG500857.1,INSD:EG500855.1,
                     INSD:EG500858.1"
                     /note="unknown protein; Has 30201 Blast hits to 17322
                     proteins in 780 species: Archae - 12; Bacteria - 1396;
                     Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
                     Other Eukaryotes - 2996 (source: NCBI BLink)."
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEC05390.1"
                     /db_xref="Araport:AT2G01023"
                     /db_xref="TAIR:AT2G01023"
                     /translation="MHLRERFGQVCLFTYSSHYAPLRALRVFKTLGEVRNLTK"
     gene            9849..10177
                     /locus_tag="AT2G00340"
                     /db_xref="Araport:AT2G00340"
     misc_RNA        9849..10177
                     /locus_tag="AT2G00340"
                     /note="novel transcribed region;
                     AT2G00340.1"
                     /db_xref="Araport:AT2G00340"
     gene            complement(10478..12861)
                     /locus_tag="AT2G01022"
                     /pseudo
                     /db_xref="Araport:AT2G01022"
                     /db_xref="TAIR:AT2G01022"
     mRNA            complement(<10478..>12861)
                     /locus_tag="AT2G01022"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="Araport:AT2G01022"
                     /db_xref="TAIR:AT2G01022"
     gene            complement(14395..16377)
                     /locus_tag="AT2G01024"
                     /pseudo
                     /db_xref="Araport:AT2G01024"
                     /db_xref="TAIR:AT2G01024"
     mRNA            complement(<14395..>16377)
                     /locus_tag="AT2G01024"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="Araport:AT2G01024"
                     /db_xref="TAIR:AT2G01024"
     gene            complement(17624..22540)
                     /locus_tag="AT2G01026"
                     /pseudo
                     /db_xref="Araport:AT2G01026"
                     /db_xref="TAIR:AT2G01026"
     mRNA            complement(<17624..>22540)
                     /locus_tag="AT2G01026"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="Araport:AT2G01026"
                     /db_xref="TAIR:AT2G01026"
     gene            complement(23971..26923)
                     /locus_tag="AT2G01028"
                     /pseudo
                     /db_xref="Araport:AT2G01028"
                     /db_xref="TAIR:AT2G01028"
     mRNA            complement(<23971..>26923)
                     /locus_tag="AT2G01028"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="Araport:AT2G01028"
                     /db_xref="TAIR:AT2G01028"
     gap             28031..28150
                     /estimated_length=120
     gene            28465..38652
                     /locus_tag="AT2G01029"
                     /pseudo
                     /db_xref="Araport:AT2G01029"
                     /db_xref="TAIR:AT2G01029"
     mRNA            <28465..>38652
                     /locus_tag="AT2G01029"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="Araport:AT2G01029"
                     /db_xref="TAIR:AT2G01029"
     gene            complement(39519..40358)
                     /locus_tag="AT2G01031"
                     /pseudo
                     /db_xref="Araport:AT2G01031"
                     /db_xref="TAIR:AT2G01031"
     mRNA            complement(join(<39519..39776,39867..>40358))
                     /locus_tag="AT2G01031"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="Araport:AT2G01031"
                     /db_xref="TAIR:AT2G01031"
     gene            complement(43427..48350)
                     /locus_tag="AT2G01034"
                     /pseudo
                     /db_xref="Araport:AT2G01034"
                     /db_xref="TAIR:AT2G01034"
     mRNA            complement(<43427..>48350)
                     /locus_tag="AT2G01034"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="Araport:AT2G01034"
                     /db_xref="TAIR:AT2G01034"
     gene            complement(50288..51487)
                     /locus_tag="AT2G01035"
                     /db_xref="Araport:AT2G01035"
     mRNA            complement(join(50288..50567,51062..51259,51363..51487))
                     /locus_tag="AT2G01035"
                     /product="hypothetical protein"
                     /db_xref="Araport:AT2G01035"
     CDS             complement(join(50345..50567,51062..51259,51363..51487))
                     /locus_tag="AT2G01035"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="ANM61244.1"
                     /db_xref="Araport:AT2G01035"
                     /translation="MCRKLHALLSSRYSKTKHWSKVTKPVDFEINFQEDSDELRGVCN
                     QRNADPHCTINQIRKQISSNPKEFSWRSAYQFEAPRLSFLERPTYTLTSNSTKSYHSI
                     SVSAARSQDKPSSNLYPRSLVRSSDSLPCSLLARSFGNLSHCSAHQSGHFSARHSDHL
                     GEHPTAPQQLMRSIRLPNPQA"
     gene            complement(53269..54468)
                     /locus_tag="AT2G01045"
                     /db_xref="Araport:AT2G01045"
     mRNA            complement(join(53269..53548,54043..54240,54344..54468))
                     /locus_tag="AT2G01045"
                     /product="hypothetical protein"
                     /db_xref="Araport:AT2G01045"
     CDS             complement(join(53326..53548,54043..54240,54344..54468))
                     /locus_tag="AT2G01045"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="ANM62620.1"
                     /db_xref="Araport:AT2G01045"
                     /translation="MCRKLHALLSSRYSKTKHWSKVTKPVDFEINFQEDSDELRGVCN
                     QRNADPHCTINQIRKQISSNPKEFSWRSAYQFEAPRLSFLERPTYTLTSNSTKSYHSI
                     SVSAARSQDKPSSNLYPRSLVRSSDSLPCSLLARSFGNLSHCSAHQSGHFSARHSDHL
                     GEHPTAPQQLMRSIRLPNPQA"
     gene            complement(58705..64872)
                     /locus_tag="AT2G01037"
                     /pseudo
                     /db_xref="Araport:AT2G01037"
                     /db_xref="TAIR:AT2G01037"
     mRNA            complement(<58705..>64872)
                     /locus_tag="AT2G01037"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="Araport:AT2G01037"
                     /db_xref="TAIR:AT2G01037"
     gene            complement(65436..67139)
                     /locus_tag="AT2G01040"
                     /gene_synonym="F23H14.1"
                     /pseudo
                     /db_xref="Araport:AT2G01040"
                     /db_xref="TAIR:AT2G01040"
     mRNA            complement(<65436..>67139)
                     /locus_tag="AT2G01040"
                     /gene_synonym="F23H14.1"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="Araport:AT2G01040"
                     /db_xref="TAIR:AT2G01040"
     gene            complement(68337..69884)
                     /locus_tag="AT2G01050"
                     /gene_synonym="F23H14.2"
                     /gene_synonym="F23H14_2"
                     /db_xref="Araport:AT2G01050"
                     /db_xref="TAIR:AT2G01050"
     mRNA            complement(68337..69884)
                     /locus_tag="AT2G01050"
                     /gene_synonym="F23H14.2"
                     /gene_synonym="F23H14_2"
                     /product="zinc ion binding / nucleic acid binding protein"
                     /db_xref="TAIR:AT2G01050"
                     /db_xref="Araport:AT2G01050"
     CDS             complement(68337..69884)
                     /locus_tag="AT2G01050"
                     /gene_synonym="F23H14.2"
                     /gene_synonym="F23H14_2"
                     /note="zinc ion binding;nucleic acid binding; FUNCTIONS
                     IN: zinc ion binding, nucleic acid binding; INVOLVED IN:
                     biological_process unknown; LOCATED IN: cellular_component
                     unknown; CONTAINS InterPro DOMAIN/s: Zinc finger,
                     CCHC-type (InterPro:IPR001878); BEST Arabidopsis thaliana
                     protein match is: unknown protein (TAIR:AT3G31430.1); Has
                     369 Blast hits to 365 proteins in 15 species: Archae - 0;
                     Bacteria - 2; Metazoa - 0; Fungi - 0; Plants - 367;
                     Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="zinc ion binding / nucleic acid binding protein"
                     /protein_id="AEC05391.1"
                     /db_xref="Araport:AT2G01050"
                     /db_xref="TAIR:AT2G01050"
                     /translation="MLDVGEKGRPPGDPPDKLESWATKVKGSAGGGILKPEDVIDDEF
                     VRERVGLEFPDGEDEEPVITIGEEVLEAMNGLWKKCMIVKVLGSQIPISVLNRKLREL
                     WKPSGVMTVMDLPRQFFMIRFELEEEYMAALTGGPWRVLGNYLLVQDWSSRFDPLRDD
                     IVTTPVWVRLSNIPYNYYHRCLLMEIARGLGRPLKVDMNTINFDKGRFARVCIEVNLA
                     KPLKGTVLINGDRYFVAYEGLSKICSSCGIYGHLVHSCPRNVVVKVSAGAETVTDRAV
                     VPVGMEGDDGFTVVQRTARRPAAPVQKMVFAVGASGGRSKQRLRELPKNQGVDLANRF
                     GGLDGNGDLPDLREVAITEGPNKENEYHGRNVGKVMGVPLVKEARGSTQMEKGKGGSK
                     GGFKWKRNGGMKALEPIGPKQKHGAANKPARGLIFGPTKDANSVPVGEDLLSNGKRLR
                     VEQRDVGRPGGVYSSAMGSHAHEASFDLDSSSTLSQRFQREDLMSEIAVVSHEGSEVG
                     NSSEGMA"
     gene            complement(72282..72622)
                     /locus_tag="AT2G03885"
                     /db_xref="Araport:AT2G03885"
     ncRNA           complement(72282..72622)
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT2G03885"
                     /product="other RNA"
                     /db_xref="Araport:AT2G03885"
     gene            complement(73208..75509)
                     /locus_tag="AT2G01060"
                     /gene_synonym="F23H14.3"
                     /gene_synonym="F23H14_3"
                     /db_xref="Araport:AT2G01060"
                     /db_xref="TAIR:AT2G01060"
     mRNA            complement(join(73208..73950,74073..74142,74240..74297,
                     74383..74425,74509..74585,74785..74907,75190..75509))
                     /locus_tag="AT2G01060"
                     /gene_synonym="F23H14.3"
                     /gene_synonym="F23H14_3"
                     /product="myb-like HTH transcriptional regulator family
                     protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH897773.1,INSD:BP662219.1,INSD:BP656469.1,
                     INSD:EL264780.1,INSD:BP577126.1,INSD:EL318045.1,
                     INSD:AV821757.1,INSD:DR751478.1,INSD:DR348567.1,
                     INSD:EH950146.1,INSD:EG517114.1,INSD:EL989129.1,
                     INSD:ES062121.1,INSD:BP799651.1,INSD:ES206633.1,
                     INSD:BP570302.1,INSD:DR751331.1,INSD:DR348563.1,
                     INSD:DR348569.1,INSD:EL119347.1,INSD:EL969809.1,
                     INSD:EL151659.1,INSD:ES138043.1,INSD:ES154891.1,
                     INSD:DR348564.1,INSD:EH816931.1,INSD:AV782297.1,
                     INSD:BP662532.1,INSD:DR751479.1,INSD:EL972294.1,
                     INSD:EL996254.1,INSD:DR379899.1,INSD:EL048062.1,
                     INSD:DR750662.1,INSD:EH832334.1,INSD:ES014351.1,
                     INSD:EL020423.1,INSD:ES156502.1,INSD:DR348565.1,
                     INSD:AI100235.1,INSD:DR751170.1,INSD:BP853760.1,
                     INSD:EL224926.1,INSD:ES188169.1,INSD:ES093616.1,
                     INSD:DR750663.1,INSD:EL326668.1,INSD:EH973077.1,
                     INSD:EL253121.1,INSD:EL061684.1,INSD:BP778375.1,
                     INSD:ES171473.1,INSD:EL162018.1,INSD:DR348570.1,
                     INSD:BP826488.1,INSD:EL190261.1,INSD:BP844448.1,
                     INSD:DR348568.1,INSD:DR348566.1,INSD:EH987581.1,
                     INSD:EL243710.1,INSD:EL986053.1,INSD:AV807179.1,
                     INSD:DR751330.1,INSD:DR751172.1,INSD:T04440.1,
                     INSD:BP824561.1,INSD:BP837942.1,INSD:AV542678.1,
                     INSD:BP665392.1,INSD:ES044470.1,INSD:BP789579.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY084725.1,INSD:BT000013.1,INSD:BX819609.1,
                     INSD:AF370550.1"
                     /db_xref="TAIR:AT2G01060"
                     /db_xref="Araport:AT2G01060"
     mRNA            complement(join(73258..73950,74073..74142,74240..74297,
                     74383..74425,74509..74907,75190..75378))
                     /locus_tag="AT2G01060"
                     /gene_synonym="F23H14.3"
                     /gene_synonym="F23H14_3"
                     /product="myb-like HTH transcriptional regulator family
                     protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH897773.1,INSD:BP662219.1,INSD:BP656469.1,
                     INSD:EL169484.1,INSD:EL264780.1,INSD:BP577126.1,
                     INSD:EL318045.1,INSD:EH950146.1,INSD:EL989129.1,
                     INSD:ES062121.1,INSD:ES206633.1,INSD:BP570302.1,
                     INSD:EL119347.1,INSD:EL969809.1,INSD:EL151659.1,
                     INSD:ES138043.1,INSD:ES154891.1,INSD:EH816931.1,
                     INSD:AV782297.1,INSD:BP662532.1,INSD:EL972294.1,
                     INSD:EL996254.1,INSD:DR379899.1,INSD:EL048062.1,
                     INSD:ES014351.1,INSD:EH832334.1,INSD:EL020423.1,
                     INSD:ES156502.1,INSD:AI100235.1,INSD:BP863834.1,
                     INSD:EL224926.1,INSD:ES188169.1,INSD:ES093616.1,
                     INSD:DR750663.1,INSD:EL326668.1,INSD:EH973077.1,
                     INSD:EL253121.1,INSD:EL061684.1,INSD:BP778375.1,
                     INSD:ES171473.1,INSD:EL162018.1,INSD:EL190261.1,
                     INSD:BP855697.1,INSD:EH987581.1,INSD:EL243710.1,
                     INSD:EL986053.1,INSD:AV807179.1,INSD:AV542678.1,
                     INSD:BP665392.1,INSD:ES044470.1,INSD:BP789579.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820595.1,INSD:BX819609.1"
                     /db_xref="TAIR:AT2G01060"
                     /db_xref="Araport:AT2G01060"
     CDS             complement(join(73456..73950,74073..74142,74240..74297,
                     74383..74425,74509..74585,74785..74902))
                     /locus_tag="AT2G01060"
                     /gene_synonym="F23H14.3"
                     /gene_synonym="F23H14_3"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH897773.1,INSD:BP662219.1,INSD:BP656469.1,
                     INSD:EL264780.1,INSD:BP577126.1,INSD:EL318045.1,
                     INSD:AV821757.1,INSD:DR751478.1,INSD:DR348567.1,
                     INSD:EH950146.1,INSD:EG517114.1,INSD:EL989129.1,
                     INSD:ES062121.1,INSD:BP799651.1,INSD:ES206633.1,
                     INSD:BP570302.1,INSD:DR751331.1,INSD:DR348563.1,
                     INSD:DR348569.1,INSD:EL119347.1,INSD:EL969809.1,
                     INSD:EL151659.1,INSD:ES138043.1,INSD:ES154891.1,
                     INSD:DR348564.1,INSD:EH816931.1,INSD:AV782297.1,
                     INSD:BP662532.1,INSD:DR751479.1,INSD:EL972294.1,
                     INSD:EL996254.1,INSD:DR379899.1,INSD:EL048062.1,
                     INSD:DR750662.1,INSD:EH832334.1,INSD:ES014351.1,
                     INSD:EL020423.1,INSD:ES156502.1,INSD:DR348565.1,
                     INSD:AI100235.1,INSD:DR751170.1,INSD:BP853760.1,
                     INSD:EL224926.1,INSD:ES188169.1,INSD:ES093616.1,
                     INSD:DR750663.1,INSD:EL326668.1,INSD:EH973077.1,
                     INSD:EL253121.1,INSD:EL061684.1,INSD:BP778375.1,
                     INSD:ES171473.1,INSD:EL162018.1,INSD:DR348570.1,
                     INSD:BP826488.1,INSD:EL190261.1,INSD:BP844448.1,
                     INSD:DR348568.1,INSD:DR348566.1,INSD:EH987581.1,
                     INSD:EL243710.1,INSD:EL986053.1,INSD:AV807179.1,
                     INSD:DR751330.1,INSD:DR751172.1,INSD:T04440.1,
                     INSD:BP824561.1,INSD:BP837942.1,INSD:AV542678.1,
                     INSD:BP665392.1,INSD:ES044470.1,INSD:BP789579.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY084725.1,INSD:BT000013.1,INSD:BX819609.1,
                     INSD:AF370550.1"
                     /note="myb-like HTH transcriptional regulator family
                     protein; CONTAINS InterPro DOMAIN/s: Homeodomain-like
                     (InterPro:IPR009057), Myb, DNA-binding
                     (InterPro:IPR014778), Myb-like DNA-binding domain, SHAQKYF
                     class (InterPro:IPR006447), HTH transcriptional regulator,
                     Myb-type, DNA-binding (InterPro:IPR017930),
                     Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis
                     thaliana protein match is: Homeodomain-like superfamily
                     protein (TAIR:AT3G04450.1); Has 1678 Blast hits to 1660
                     proteins in 60 species: Archae - 0; Bacteria - 1; Metazoa
                     - 0; Fungi - 0; Plants - 1660; Viruses - 0; Other
                     Eukaryotes - 17 (source: NCBI BLink)."
                     /codon_start=1
                     /product="myb-like HTH transcriptional regulator family
                     protein"
                     /protein_id="AEC05393.1"
                     /db_xref="Araport:AT2G01060"
                     /db_xref="TAIR:AT2G01060"
                     /translation="MEADNGGPNSSHASKQRLRWTHELHERFVDAVAQLGGPDRATPK
                     GVLRVMGVQGLTIYHVKSHLQKYRLAKYLPDSSSEGKKTDKKESGDMLSGLDGSSGMQ
                     ITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLGEPSAPVT
                     GDSDPATPAPTSESPLQDKSGKDCGPDKSLSVDESLSSYREPLTPDSGCNIGSPDEST
                     GEERLSKKPRLVRGAAGYTPDIVVGHPILESGLNTSYHQSDHVLAFDQPSTSLLGAEE
                     QLDKVSGDNL"
     CDS             complement(join(73456..73950,74073..74142,74240..74297,
                     74383..74425,74509..74556))
                     /locus_tag="AT2G01060"
                     /gene_synonym="F23H14.3"
                     /gene_synonym="F23H14_3"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH897773.1,INSD:BP662219.1,INSD:BP656469.1,
                     INSD:EL169484.1,INSD:EL264780.1,INSD:BP577126.1,
                     INSD:EL318045.1,INSD:EH950146.1,INSD:EL989129.1,
                     INSD:ES062121.1,INSD:ES206633.1,INSD:BP570302.1,
                     INSD:EL119347.1,INSD:EL969809.1,INSD:EL151659.1,
                     INSD:ES138043.1,INSD:ES154891.1,INSD:EH816931.1,
                     INSD:AV782297.1,INSD:BP662532.1,INSD:EL972294.1,
                     INSD:EL996254.1,INSD:DR379899.1,INSD:EL048062.1,
                     INSD:ES014351.1,INSD:EH832334.1,INSD:EL020423.1,
                     INSD:ES156502.1,INSD:AI100235.1,INSD:BP863834.1,
                     INSD:EL224926.1,INSD:ES188169.1,INSD:ES093616.1,
                     INSD:DR750663.1,INSD:EL326668.1,INSD:EH973077.1,
                     INSD:EL253121.1,INSD:EL061684.1,INSD:BP778375.1,
                     INSD:ES171473.1,INSD:EL162018.1,INSD:EL190261.1,
                     INSD:BP855697.1,INSD:EH987581.1,INSD:EL243710.1,
                     INSD:EL986053.1,INSD:AV807179.1,INSD:AV542678.1,
                     INSD:BP665392.1,INSD:ES044470.1,INSD:BP789579.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820595.1,INSD:BX819609.1"
                     /note="myb-like HTH transcriptional regulator family
                     protein; BEST Arabidopsis thaliana protein match is:
                     myb-like HTH transcriptional regulator family protein
                     (TAIR:AT3G13040.2); Has 35333 Blast hits to 34131 proteins
                     in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
                     974; Fungi - 991; Plants - 531; Viruses - 0; Other
                     Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="myb-like HTH transcriptional regulator family
                     protein"
                     /protein_id="AEC05392.1"
                     /db_xref="Araport:AT2G01060"
                     /db_xref="TAIR:AT2G01060"
                     /translation="MGVQGLTIYHVKSHLQKYRLAKYLPDSSSEGKKTDKKESGDMLS
                     GLDGSSGMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGV
                     LGEPSAPVTGDSDPATPAPTSESPLQDKSGKDCGPDKSLSVDESLSSYREPLTPDSGC
                     NIGSPDESTGEERLSKKPRLVRGAAGYTPDIVVGHPILESGLNTSYHQSDHVLAFDQP
                     STSLLGAEEQLDKVSGDNL"
     gene            75520..77865
                     /locus_tag="AT2G01070"
                     /gene_synonym="F23H14.4"
                     /gene_synonym="F23H14_4"
                     /db_xref="Araport:AT2G01070"
                     /db_xref="TAIR:AT2G01070"
     mRNA            join(75520..75780,75858..76779,76880..76975,77145..77400,
                     77475..77865)
                     /locus_tag="AT2G01070"
                     /gene_synonym="F23H14.4"
                     /gene_synonym="F23H14_4"
                     /product="Lung seven transmembrane receptor family
                     protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH877738.1,INSD:EL294524.1,INSD:ES028903.1,
                     INSD:EH827430.1,INSD:EH902553.1,INSD:EH898736.1,
                     INSD:BP789930.1,INSD:AV816964.1,INSD:ES177248.1,
                     INSD:AV808044.1,INSD:EH911807.1,INSD:BX835212.1,
                     INSD:ES147409.1,INSD:F20039.1,INSD:EL339226.1,
                     INSD:EH868728.1,INSD:EL282373.1,INSD:EH975367.1,
                     INSD:EL970620.1,INSD:EL216239.1,INSD:DR368550.1,
                     INSD:CB253960.1,INSD:BX838884.1,INSD:EL105483.1,
                     INSD:AV820186.1,INSD:ES019465.1,INSD:BP785566.1,
                     INSD:EL234374.1,INSD:ES108711.1,INSD:BX838671.1,
                     INSD:EL010707.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820756.1,INSD:BX820779.1,INSD:AK221666.1,
                     INSD:BX818839.1,INSD:BX818790.1"
                     /db_xref="TAIR:AT2G01070"
                     /db_xref="Araport:AT2G01070"
     mRNA            join(75520..75780,75858..76779,76880..76975,77145..77281,
                     77475..77865)
                     /locus_tag="AT2G01070"
                     /gene_synonym="F23H14.4"
                     /gene_synonym="F23H14_4"
                     /product="Lung seven transmembrane receptor family
                     protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH877738.1,INSD:EL294524.1,INSD:ES028903.1,
                     INSD:EH827430.1,INSD:EH902553.1,INSD:EH898736.1,
                     INSD:ES177248.1,INSD:EH911807.1,INSD:ES147409.1,
                     INSD:F20039.1,INSD:EL339226.1,INSD:EH868728.1,
                     INSD:EL282373.1,INSD:EH975367.1,INSD:EL970620.1,
                     INSD:EL216239.1,INSD:EG482206.1,INSD:DR368550.1,
                     INSD:CB253960.1,INSD:EL105483.1,INSD:BX838884.1,
                     INSD:ES019465.1,INSD:BP785566.1,INSD:EL234374.1,
                     INSD:BX838671.1,INSD:EL010707.1"
                     /db_xref="TAIR:AT2G01070"
                     /db_xref="Araport:AT2G01070"
     CDS             join(75596..75780,75858..76779,76880..76975,77145..77281,
                     77475..77625)
                     /locus_tag="AT2G01070"
                     /gene_synonym="F23H14.4"
                     /gene_synonym="F23H14_4"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH877738.1,INSD:EL294524.1,INSD:ES028903.1,
                     INSD:EH827430.1,INSD:EH902553.1,INSD:EH898736.1,
                     INSD:BP789930.1,INSD:AV816964.1,INSD:ES177248.1,
                     INSD:AV808044.1,INSD:EH911807.1,INSD:BX835212.1,
                     INSD:ES147409.1,INSD:F20039.1,INSD:EL339226.1,
                     INSD:EH868728.1,INSD:EL282373.1,INSD:EH975367.1,
                     INSD:EL970620.1,INSD:EL216239.1,INSD:DR368550.1,
                     INSD:CB253960.1,INSD:BX838884.1,INSD:EL105483.1,
                     INSD:AV820186.1,INSD:ES019465.1,INSD:BP785566.1,
                     INSD:EL234374.1,INSD:ES108711.1,INSD:BX838671.1,
                     INSD:EL010707.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820756.1,INSD:BX820779.1,INSD:AK221666.1,
                     INSD:BX818839.1,INSD:BX818790.1"
                     /note="Lung seven transmembrane receptor family protein;
                     FUNCTIONS IN: molecular_function unknown; INVOLVED IN:
                     biological_process unknown; LOCATED IN: endomembrane
                     system, integral to membrane; EXPRESSED IN: 22 plant
                     structures; EXPRESSED DURING: 13 growth stages; CONTAINS
                     InterPro DOMAIN/s: Transmembrane receptor, eukaryota
                     (InterPro:IPR009637); BEST Arabidopsis thaliana protein
                     match is: Lung seven transmembrane receptor family protein
                     (TAIR:AT1G72480.1); Has 35333 Blast hits to 34131 proteins
                     in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
                     974; Fungi - 991; Plants - 531; Viruses - 0; Other
                     Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Lung seven transmembrane receptor family
                     protein"
                     /protein_id="AEC05394.1"
                     /db_xref="Araport:AT2G01070"
                     /db_xref="TAIR:AT2G01070"
                     /translation="MDLGKLIQLSALLCPFLLSLHFRIAGASAHIYSSQPFHDVGNSL
                     LLYGGSEGIFASSRSLIRFENITLWRTITGKGHRSNGLVQAVIFEASDRNNIGGSAYG
                     GQRSICCTPDLAKLQGCKQGEIIRIPSPHDPQWPILLPVRFKGKRSSAKMADTEILIT
                     KTGIYNLLFISCDPQLKGLKMTGKTVWKNPDGYLPGRMAPLVNFYVYMSLAYLLLSAV
                     WFFQYLRFRMDILPLQHCITAVILLGLLEMLFWYLDYANFNHTGMRPLALTTWVVTIG
                     ALRKTVSRILILCVSMGFGVVKSTLGGLTSKVLLVGVTYFIASEILDIAEHVGIIDDM
                     SGRSKLFLVLPDAFLDAFLILWIFTSLSKTLEQLQMKRTSVKLEIYRKFSNALAVMVV
                     ASVAWIVYEVYFKATDPFNERWQTAWTITAFWDVIAFLLLCIICYLWTPSQNSQRYAY
                     SGDVDEENEEAQSLTGGKQDGDISLVKQEKNAESDREEDVEEDKRE"
     CDS             join(75596..75780,75858..76779,76880..76975,77145..77300)
                     /locus_tag="AT2G01070"
                     /gene_synonym="F23H14.4"
                     /gene_synonym="F23H14_4"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH877738.1,INSD:EL294524.1,INSD:ES028903.1,
                     INSD:EH827430.1,INSD:EH902553.1,INSD:EH898736.1,
                     INSD:ES177248.1,INSD:EH911807.1,INSD:ES147409.1,
                     INSD:F20039.1,INSD:EL339226.1,INSD:EH868728.1,
                     INSD:EL282373.1,INSD:EH975367.1,INSD:EL970620.1,
                     INSD:EL216239.1,INSD:EG482206.1,INSD:DR368550.1,
                     INSD:CB253960.1,INSD:EL105483.1,INSD:BX838884.1,
                     INSD:ES019465.1,INSD:BP785566.1,INSD:EL234374.1,
                     INSD:BX838671.1,INSD:EL010707.1"
                     /note="Lung seven transmembrane receptor family protein;
                     FUNCTIONS IN: molecular_function unknown; INVOLVED IN:
                     biological_process unknown; LOCATED IN: endomembrane
                     system, integral to membrane; EXPRESSED IN: 22 plant
                     structures; EXPRESSED DURING: 13 growth stages; CONTAINS
                     InterPro DOMAIN/s: Transmembrane receptor, eukaryota
                     (InterPro:IPR009637); BEST Arabidopsis thaliana protein
                     match is: Lung seven transmembrane receptor family protein
                     (TAIR:AT1G72480.1); Has 30201 Blast hits to 17322 proteins
                     in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
                     17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
                     Eukaryotes - 2996 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Lung seven transmembrane receptor family
                     protein"
                     /protein_id="AEC05395.1"
                     /db_xref="Araport:AT2G01070"
                     /db_xref="TAIR:AT2G01070"
                     /translation="MDLGKLIQLSALLCPFLLSLHFRIAGASAHIYSSQPFHDVGNSL
                     LLYGGSEGIFASSRSLIRFENITLWRTITGKGHRSNGLVQAVIFEASDRNNIGGSAYG
                     GQRSICCTPDLAKLQGCKQGEIIRIPSPHDPQWPILLPVRFKGKRSSAKMADTEILIT
                     KTGIYNLLFISCDPQLKGLKMTGKTVWKNPDGYLPGRMAPLVNFYVYMSLAYLLLSAV
                     WFFQYLRFRMDILPLQHCITAVILLGLLEMLFWYLDYANFNHTGMRPLALTTWVVTIG
                     ALRKTVSRILILCVSMGFGVVKSTLGGLTSKVLLVGVTYFIASEILDIAEHVGIIDDM
                     SGRSKLFLVLPDAFLDAFLILWIFTSLSKTLEQLQMKRTSVKLEIYRKFSNALAVMVV
                     ASVAWIVYEVYFKATDPFNERWQTAWTITAFWDVIAFLLLCIICYLWTPSQNSQRYVT
                     ST"
     gene            77888..79373
                     /locus_tag="AT2G01080"
                     /gene_synonym="F23H14.5"
                     /gene_synonym="F23H14_5"
                     /db_xref="Araport:AT2G01080"
                     /db_xref="TAIR:AT2G01080"
     mRNA            join(77888..78646,79090..79373)
                     /locus_tag="AT2G01080"
                     /gene_synonym="F23H14.5"
                     /gene_synonym="F23H14_5"
                     /product="Late embryogenesis abundant (LEA)
                     hydroxyproline-rich glycoprotein family"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL156747.1,INSD:BP844691.1,INSD:DR314501.1,
                     INSD:ES194140.1,INSD:ES007496.1,INSD:ES055755.1,
                     INSD:AV781708.1,INSD:BX838262.1,INSD:ES068009.1,
                     INSD:EL286784.1,INSD:BX840667.1,INSD:EL287227.1,
                     INSD:BP835850.1,INSD:CB253960.1,INSD:DR314502.1,
                     INSD:BX838421.1,INSD:ES058003.1,INSD:EH970802.1,
                     INSD:ES157781.1,INSD:ES200858.1,INSD:AV821319.1,
                     INSD:BP785566.1,INSD:EL020816.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX821790.1,INSD:BX821947.1,INSD:AY059166.1,
                     INSD:AF378858.1"
                     /db_xref="TAIR:AT2G01080"
                     /db_xref="Araport:AT2G01080"
     CDS             join(78038..78646,79090..79176)
                     /locus_tag="AT2G01080"
                     /gene_synonym="F23H14.5"
                     /gene_synonym="F23H14_5"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL156747.1,INSD:BP844691.1,INSD:DR314501.1,
                     INSD:ES194140.1,INSD:ES007496.1,INSD:ES055755.1,
                     INSD:AV781708.1,INSD:BX838262.1,INSD:ES068009.1,
                     INSD:EL286784.1,INSD:BX840667.1,INSD:EL287227.1,
                     INSD:BP835850.1,INSD:CB253960.1,INSD:DR314502.1,
                     INSD:BX838421.1,INSD:ES058003.1,INSD:EH970802.1,
                     INSD:ES157781.1,INSD:ES200858.1,INSD:AV821319.1,
                     INSD:BP785566.1,INSD:EL020816.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX821790.1,INSD:BX821947.1,INSD:AY059166.1,
                     INSD:AF378858.1"
                     /note="Late embryogenesis abundant (LEA)
                     hydroxyproline-rich glycoprotein family; FUNCTIONS IN:
                     molecular_function unknown; INVOLVED IN:
                     biological_process unknown; LOCATED IN: plasma membrane;
                     EXPRESSED IN: 14 plant structures; EXPRESSED DURING: 6
                     growth stages; CONTAINS InterPro DOMAIN/s: Late
                     embryogenesis abundant protein, group 2
                     (InterPro:IPR004864); BEST Arabidopsis thaliana protein
                     match is: Late embryogenesis abundant (LEA)
                     hydroxyproline-rich glycoprotein family
                     (TAIR:AT2G27080.2); Has 675 Blast hits to 674 proteins in
                     28 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
                     2; Plants - 673; Viruses - 0; Other Eukaryotes - 0
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="Late embryogenesis abundant (LEA)
                     hydroxyproline-rich glycoprotein family"
                     /protein_id="AEC05396.1"
                     /db_xref="Araport:AT2G01080"
                     /db_xref="TAIR:AT2G01080"
                     /translation="MPPPPSSSRAGLNGDPIAAQNQQPYYRSYSSSSSASLKGCCCCL
                     FLLFAFLALLVLAVVLIVILAVKPKKPQFDLQQVAVVYMGISNPSAVLDPTTASLSLT
                     IRMLFTAVNPNKVGIRYGESSFTVMYKGMPLGRATVPGFYQDAHSTKNVEATISVDRV
                     NLMQAHAADLVRDASLNDRVELTVRGDVGAKIRVMNFDSPGVQVSVNCGIGISPRKQA
                     LIYKQCGFDGLSV"
     gene            79779..81710
                     /locus_tag="AT2G01090"
                     /gene_synonym="F23H14.6"
                     /gene_synonym="F23H14_6"
                     /db_xref="Araport:AT2G01090"
                     /db_xref="TAIR:AT2G01090"
     mRNA            join(79779..79805,79945..80061,80147..80180,80606..80690,
                     80856..81216)
                     /locus_tag="AT2G01090"
                     /gene_synonym="F23H14.6"
                     /gene_synonym="F23H14_6"
                     /product="Ubiquinol-cytochrome C reductase hinge protein"
                     /db_xref="TAIR:AT2G01090"
                     /db_xref="Araport:AT2G01090"
     mRNA            join(79843..79852,79945..80061,80147..80180,80606..80690,
                     80856..81200)
                     /locus_tag="AT2G01090"
                     /gene_synonym="F23H14.6"
                     /gene_synonym="F23H14_6"
                     /product="Ubiquinol-cytochrome C reductase hinge protein"
                     /db_xref="Araport:AT2G01090"
                     /db_xref="TAIR:AT2G01090"
     mRNA            join(79964..80061,80147..80180,80606..80690,80856..81212)
                     /locus_tag="AT2G01090"
                     /gene_synonym="F23H14.6"
                     /gene_synonym="F23H14_6"
                     /product="Ubiquinol-cytochrome C reductase hinge protein"
                     /db_xref="Araport:AT2G01090"
                     /db_xref="TAIR:AT2G01090"
     mRNA            join(79989..80061,80147..80180,80606..80690,80856..80970,
                     81662..81710)
                     /locus_tag="AT2G01090"
                     /gene_synonym="F23H14.6"
                     /gene_synonym="F23H14_6"
                     /product="Ubiquinol-cytochrome C reductase hinge protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR261178.1,INSD:EL041221.1,INSD:EG513490.1,
                     INSD:EH990184.1,INSD:EL310702.1,INSD:EH912496.1,
                     INSD:BP653866.1,INSD:EL145271.1,INSD:BP629886.1,
                     INSD:Z18209.1,INSD:EL064390.1,INSD:EG513489.1,
                     INSD:EL033192.1,INSD:DR380031.1,INSD:DR261176.1,
                     INSD:EL031553.1,INSD:BP831340.1,INSD:AV786686.1,
                     INSD:EH977498.1,INSD:EL049044.1,INSD:EH894163.1,
                     INSD:AI997629.1,INSD:AV827614.1,INSD:EL156517.1,
                     INSD:EL056501.1,INSD:DR261175.1,INSD:AV798784.1,
                     INSD:EL071031.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AF360220.1"
                     /db_xref="TAIR:AT2G01090"
                     /db_xref="Araport:AT2G01090"
     CDS             join(80179..80180,80606..80690,80856..80957)
                     /locus_tag="AT2G01090"
                     /gene_synonym="F23H14.6"
                     /gene_synonym="F23H14_6"
                     /codon_start=1
                     /product="Ubiquinol-cytochrome C reductase hinge protein"
                     /protein_id="ANM63169.1"
                     /db_xref="Araport:AT2G01090"
                     /db_xref="TAIR:AT2G01090"
                     /translation="MPEEDVVDQKRYFEESCKPKCVKPLLEYQACVKRIQDDESGHKH
                     CTGQYFDYWHCVDKCVSV"
     CDS             join(80179..80180,80606..80690,80856..80957)
                     /locus_tag="AT2G01090"
                     /gene_synonym="F23H14.6"
                     /gene_synonym="F23H14_6"
                     /codon_start=1
                     /product="Ubiquinol-cytochrome C reductase hinge protein"
                     /protein_id="ANM63170.1"
                     /db_xref="Araport:AT2G01090"
                     /db_xref="TAIR:AT2G01090"
                     /translation="MPEEDVVDQKRYFEESCKPKCVKPLLEYQACVKRIQDDESGHKH
                     CTGQYFDYWHCVDKCVSV"
     CDS             join(80179..80180,80606..80690,80856..80957)
                     /locus_tag="AT2G01090"
                     /gene_synonym="F23H14.6"
                     /gene_synonym="F23H14_6"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR261178.1,INSD:EL041221.1,INSD:EG513490.1,
                     INSD:EH990184.1,INSD:EL310702.1,INSD:EH912496.1,
                     INSD:BP653866.1,INSD:EL145271.1,INSD:BP629886.1,
                     INSD:Z18209.1,INSD:EL064390.1,INSD:EG513489.1,
                     INSD:EL033192.1,INSD:DR380031.1,INSD:DR261176.1,
                     INSD:EL031553.1,INSD:BP831340.1,INSD:AV786686.1,
                     INSD:EH977498.1,INSD:EL049044.1,INSD:EH894163.1,
                     INSD:AI997629.1,INSD:AV827614.1,INSD:EL156517.1,
                     INSD:EL056501.1,INSD:DR261175.1,INSD:AV798784.1,
                     INSD:EL071031.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AF360220.1"
                     /note="Ubiquinol-cytochrome C reductase hinge protein;
                     FUNCTIONS IN: ubiquinol-cytochrome-c reductase activity;
                     INVOLVED IN: mitochondrial electron transport, ubiquinol
                     to cytochrome c; LOCATED IN: mitochondrial respiratory
                     chain complex III; EXPRESSED IN: 24 plant structures;
                     EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
                     DOMAIN/s: Ubiquinol-cytochrome C reductase hinge
                     (InterPro:IPR003422); BEST Arabidopsis thaliana protein
                     match is: Ubiquinol-cytochrome C reductase hinge protein
                     (TAIR:AT1G15120.2); Has 146 Blast hits to 146 proteins in
                     57 species: Archae - 0; Bacteria - 0; Metazoa - 12; Fungi
                     - 4; Plants - 87; Viruses - 0; Other Eukaryotes - 43
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="Ubiquinol-cytochrome C reductase hinge protein"
                     /protein_id="AEC05397.1"
                     /db_xref="Araport:AT2G01090"
                     /db_xref="TAIR:AT2G01090"
                     /translation="MPEEDVVDQKRYFEESCKPKCVKPLLEYQACVKRIQDDESGHKH
                     CTGQYFDYWHCVDKCVSV"
     CDS             join(80179..80180,80606..80690,80856..80957)
                     /locus_tag="AT2G01090"
                     /gene_synonym="F23H14.6"
                     /gene_synonym="F23H14_6"
                     /note="Ubiquinol-cytochrome C reductase hinge protein;
                     FUNCTIONS IN: ubiquinol-cytochrome-c reductase activity;
                     INVOLVED IN: mitochondrial electron transport, ubiquinol
                     to cytochrome c; LOCATED IN: mitochondrial respiratory
                     chain complex III; EXPRESSED IN: 24 plant structures;
                     EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
                     DOMAIN/s: Ubiquinol-cytochrome C reductase hinge
                     (InterPro:IPR003422); BEST Arabidopsis thaliana protein
                     match is: Ubiquinol-cytochrome C reductase hinge protein
                     (TAIR:AT1G15120.2)."
                     /codon_start=1
                     /product="Ubiquinol-cytochrome C reductase hinge protein"
                     /protein_id="AEC05398.1"
                     /db_xref="Araport:AT2G01090"
                     /db_xref="TAIR:AT2G01090"
                     /translation="MPEEDVVDQKRYFEESCKPKCVKPLLEYQACVKRIQDDESGHKH
                     CTGQYFDYWHCVDKCVSV"
     gene            81436..83290
                     /locus_tag="AT2G01100"
                     /gene_synonym="F23H14.7"
                     /gene_synonym="F23H14_7"
                     /db_xref="Araport:AT2G01100"
                     /db_xref="TAIR:AT2G01100"
     mRNA            join(81436..81512,81737..81800,82186..83217)
                     /locus_tag="AT2G01100"
                     /gene_synonym="F23H14.7"
                     /gene_synonym="F23H14_7"
                     /product="FAM133-like protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH797776.1,INSD:EG457335.1,INSD:ES024857.1,
                     INSD:EG456946.1,INSD:EG457334.1,INSD:DR337911.1,
                     INSD:EL236563.1,INSD:DR337908.1,INSD:ES212053.1,
                     INSD:ES027617.1,INSD:ES005369.1,INSD:EL224381.1,
                     INSD:AA720331.1,INSD:ES197838.1,INSD:BP827619.1,
                     INSD:EH868223.1,INSD:BP861274.1,INSD:ES164896.1,
                     INSD:EL149896.1,INSD:ES184109.1,INSD:AV815991.1,
                     INSD:ES199474.1,INSD:AA651066.1,INSD:EL104444.1,
                     INSD:DR337910.1,INSD:EL104562.1,INSD:EH854532.1,
                     INSD:ES034269.1,INSD:ES173599.1,INSD:EG456947.1,
                     INSD:ES010013.1,INSD:ES012357.1,INSD:ES116235.1,
                     INSD:DR337909.1,INSD:ES018213.1,INSD:EH950063.1,
                     INSD:BX836035.1,INSD:ES210945.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY087935.1,INSD:AY125526.1"
                     /db_xref="TAIR:AT2G01100"
                     /db_xref="Araport:AT2G01100"
     mRNA            join(81437..81512,81737..81800,82220..83290)
                     /locus_tag="AT2G01100"
                     /gene_synonym="F23H14.7"
                     /gene_synonym="F23H14_7"
                     /product="FAM133-like protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH797776.1,INSD:EG457335.1,INSD:ES024857.1,
                     INSD:EG456946.1,INSD:EG457334.1,INSD:R65004.1,
                     INSD:EL236563.1,INSD:ES212053.1,INSD:ES027617.1,
                     INSD:ES005369.1,INSD:DR365593.1,INSD:EL224381.1,
                     INSD:AA720331.1,INSD:ES197838.1,INSD:EH868223.1,
                     INSD:ES164896.1,INSD:DR365592.1,INSD:EL149896.1,
                     INSD:ES184109.1,INSD:AV815991.1,INSD:ES199474.1,
                     INSD:AA651066.1,INSD:EL104444.1,INSD:EL104562.1,
                     INSD:EH854532.1,INSD:ES034269.1,INSD:BP845779.1,
                     INSD:ES173599.1,INSD:EG456947.1,INSD:ES010013.1,
                     INSD:ES012357.1,INSD:ES116235.1,INSD:BP562501.2,
                     INSD:ES018213.1,INSD:BP852866.1,INSD:EH950063.1,
                     INSD:ES210945.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY125526.1,INSD:AY072010.1"
                     /db_xref="TAIR:AT2G01100"
                     /db_xref="Araport:AT2G01100"
     mRNA            join(81440..81512,81737..83217)
                     /locus_tag="AT2G01100"
                     /gene_synonym="F23H14.7"
                     /gene_synonym="F23H14_7"
                     /product="FAM133-like protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL982156.1,INSD:EH797776.1,INSD:ES024857.1,
                     INSD:EG457335.1,INSD:EG456946.1,INSD:EG457334.1,
                     INSD:EL980486.1,INSD:EL236563.1,INSD:EL989467.1,
                     INSD:ES027617.1,INSD:ES212053.1,INSD:EL975664.1,
                     INSD:BX837995.1,INSD:ES005369.1,INSD:EL989957.1,
                     INSD:EL224381.1,INSD:AA720331.1,INSD:ES197838.1,
                     INSD:EH868223.1,INSD:ES164896.1,INSD:EG517620.1,
                     INSD:EL975446.1,INSD:EL149896.1,INSD:ES184109.1,
                     INSD:AV815991.1,INSD:EL990635.1,INSD:ES000749.1,
                     INSD:ES199474.1,INSD:AA651066.1,INSD:EL104444.1,
                     INSD:EH854532.1,INSD:EG517618.1,INSD:EL104562.1,
                     INSD:ES034269.1,INSD:BX836911.1,INSD:ES173599.1,
                     INSD:EG456947.1,INSD:ES010013.1,INSD:ES012357.1,
                     INSD:ES116235.1,INSD:EL981720.1,INSD:ES018213.1,
                     INSD:EL969903.1,INSD:EH950063.1,INSD:ES210945.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820090.1,INSD:BX821013.1,INSD:AY125526.1"
                     /db_xref="TAIR:AT2G01100"
                     /db_xref="Araport:AT2G01100"
     CDS             82245..82988
                     /locus_tag="AT2G01100"
                     /gene_synonym="F23H14.7"
                     /gene_synonym="F23H14_7"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH797776.1,INSD:EG457335.1,INSD:ES024857.1,
                     INSD:EG456946.1,INSD:EG457334.1,INSD:DR337911.1,
                     INSD:EL236563.1,INSD:DR337908.1,INSD:ES212053.1,
                     INSD:ES027617.1,INSD:ES005369.1,INSD:EL224381.1,
                     INSD:AA720331.1,INSD:ES197838.1,INSD:BP827619.1,
                     INSD:EH868223.1,INSD:BP861274.1,INSD:ES164896.1,
                     INSD:EL149896.1,INSD:ES184109.1,INSD:AV815991.1,
                     INSD:ES199474.1,INSD:AA651066.1,INSD:EL104444.1,
                     INSD:DR337910.1,INSD:EL104562.1,INSD:EH854532.1,
                     INSD:ES034269.1,INSD:ES173599.1,INSD:EG456947.1,
                     INSD:ES010013.1,INSD:ES012357.1,INSD:ES116235.1,
                     INSD:DR337909.1,INSD:ES018213.1,INSD:EH950063.1,
                     INSD:BX836035.1,INSD:ES210945.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY087935.1,INSD:AY125526.1"
                     /note="unknown protein; Has 19420 Blast hits to 10641
                     proteins in 779 species: Archae - 0; Bacteria - 1003;
                     Metazoa - 10257; Fungi - 1826; Plants - 1570; Viruses -
                     56; Other Eukaryotes - 4708 (source: NCBI BLink)."
                     /codon_start=1
                     /product="FAM133-like protein"
                     /protein_id="AEC05399.1"
                     /db_xref="Araport:AT2G01100"
                     /db_xref="TAIR:AT2G01100"
                     /translation="MDCKKFIQMVEEKKRRVLEKQEAPLKWEQKLEAAANAKADTETK
                     VKRSKGPKRKQRAASESSSESDSSSEVRRKSRRSHNKHRRHAHSDSDDSDRRKEKKSR
                     RQKRRSLSPSDDSTGDYESGSEDELRMKIKHHRRHKWHSSRKTCDDDSTEDVRRKHLK
                     HHRRSEVVTSSDSEEESGRRRRGKYHRHNRGSASSSGSEEDSGKSMKRRQHKRHRLAE
                     SSSEEDGAMRRTRHHKHGRDSASESDGRR"
     CDS             82245..82988
                     /locus_tag="AT2G01100"
                     /gene_synonym="F23H14.7"
                     /gene_synonym="F23H14_7"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH797776.1,INSD:EG457335.1,INSD:ES024857.1,
                     INSD:EG456946.1,INSD:EG457334.1,INSD:R65004.1,
                     INSD:EL236563.1,INSD:ES212053.1,INSD:ES027617.1,
                     INSD:ES005369.1,INSD:DR365593.1,INSD:EL224381.1,
                     INSD:AA720331.1,INSD:ES197838.1,INSD:EH868223.1,
                     INSD:ES164896.1,INSD:DR365592.1,INSD:EL149896.1,
                     INSD:ES184109.1,INSD:AV815991.1,INSD:ES199474.1,
                     INSD:AA651066.1,INSD:EL104444.1,INSD:EL104562.1,
                     INSD:EH854532.1,INSD:ES034269.1,INSD:BP845779.1,
                     INSD:ES173599.1,INSD:EG456947.1,INSD:ES010013.1,
                     INSD:ES012357.1,INSD:ES116235.1,INSD:BP562501.2,
                     INSD:ES018213.1,INSD:BP852866.1,INSD:EH950063.1,
                     INSD:ES210945.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY125526.1,INSD:AY072010.1"
                     /note="unknown protein; Has 19420 Blast hits to 10641
                     proteins in 779 species: Archae - 0; Bacteria - 1003;
                     Metazoa - 10257; Fungi - 1826; Plants - 1570; Viruses -
                     56; Other Eukaryotes - 4708 (source: NCBI BLink)."
                     /codon_start=1
                     /product="FAM133-like protein"
                     /protein_id="AEC05400.1"
                     /db_xref="Araport:AT2G01100"
                     /db_xref="TAIR:AT2G01100"
                     /translation="MDCKKFIQMVEEKKRRVLEKQEAPLKWEQKLEAAANAKADTETK
                     VKRSKGPKRKQRAASESSSESDSSSEVRRKSRRSHNKHRRHAHSDSDDSDRRKEKKSR
                     RQKRRSLSPSDDSTGDYESGSEDELRMKIKHHRRHKWHSSRKTCDDDSTEDVRRKHLK
                     HHRRSEVVTSSDSEEESGRRRRGKYHRHNRGSASSSGSEEDSGKSMKRRQHKRHRLAE
                     SSSEEDGAMRRTRHHKHGRDSASESDGRR"
     CDS             82245..82988
                     /locus_tag="AT2G01100"
                     /gene_synonym="F23H14.7"
                     /gene_synonym="F23H14_7"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL982156.1,INSD:EH797776.1,INSD:ES024857.1,
                     INSD:EG457335.1,INSD:EG456946.1,INSD:EG457334.1,
                     INSD:EL980486.1,INSD:EL236563.1,INSD:EL989467.1,
                     INSD:ES027617.1,INSD:ES212053.1,INSD:EL975664.1,
                     INSD:BX837995.1,INSD:ES005369.1,INSD:EL989957.1,
                     INSD:EL224381.1,INSD:AA720331.1,INSD:ES197838.1,
                     INSD:EH868223.1,INSD:ES164896.1,INSD:EG517620.1,
                     INSD:EL975446.1,INSD:EL149896.1,INSD:ES184109.1,
                     INSD:AV815991.1,INSD:EL990635.1,INSD:ES000749.1,
                     INSD:ES199474.1,INSD:AA651066.1,INSD:EL104444.1,
                     INSD:EH854532.1,INSD:EG517618.1,INSD:EL104562.1,
                     INSD:ES034269.1,INSD:BX836911.1,INSD:ES173599.1,
                     INSD:EG456947.1,INSD:ES010013.1,INSD:ES012357.1,
                     INSD:ES116235.1,INSD:EL981720.1,INSD:ES018213.1,
                     INSD:EL969903.1,INSD:EH950063.1,INSD:ES210945.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820090.1,INSD:BX821013.1,INSD:AY125526.1"
                     /note="unknown protein; Has 35333 Blast hits to 34131
                     proteins in 2444 species: Archae - 798; Bacteria - 22429;
                     Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
                     Other Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="FAM133-like protein"
                     /protein_id="AEC05401.1"
                     /db_xref="Araport:AT2G01100"
                     /db_xref="TAIR:AT2G01100"
                     /translation="MDCKKFIQMVEEKKRRVLEKQEAPLKWEQKLEAAANAKADTETK
                     VKRSKGPKRKQRAASESSSESDSSSEVRRKSRRSHNKHRRHAHSDSDDSDRRKEKKSR
                     RQKRRSLSPSDDSTGDYESGSEDELRMKIKHHRRHKWHSSRKTCDDDSTEDVRRKHLK
                     HHRRSEVVTSSDSEEESGRRRRGKYHRHNRGSASSSGSEEDSGKSMKRRQHKRHRLAE
                     SSSEEDGAMRRTRHHKHGRDSASESDGRR"
     gene            complement(83260..85258)
                     /gene="APG2"
                     /locus_tag="AT2G01110"
                     /gene_synonym="ALBINO AND PALE GREEN 2"
                     /gene_synonym="F23H14.8"
                     /gene_synonym="F23H14_8"
                     /gene_synonym="PGA2"
                     /gene_synonym="TATC"
                     /gene_synonym="TWIN-ARGININE TRANSLOCATION C"
                     /gene_synonym="UNE3"
                     /gene_synonym="unfertilized embryo sac 3"
                     /note="mutant is Albino and pale green; Chloroplast
                     Protein Translocation (tatC). Core subunit of the
                     chloroplast Tat translocase. Integral chloroplast
                     thylakoid membrane protein."
                     /db_xref="Araport:AT2G01110"
                     /db_xref="TAIR:AT2G01110"
     mRNA            complement(join(83260..83995,84085..84375,84450..84718,
                     84836..85258))
                     /gene="APG2"
                     /locus_tag="AT2G01110"
                     /gene_synonym="ALBINO AND PALE GREEN 2"
                     /gene_synonym="F23H14.8"
                     /gene_synonym="F23H14_8"
                     /gene_synonym="PGA2"
                     /gene_synonym="TATC"
                     /gene_synonym="TWIN-ARGININE TRANSLOCATION C"
                     /gene_synonym="UNE3"
                     /gene_synonym="unfertilized embryo sac 3"
                     /product="Sec-independent periplasmic protein translocase"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP857834.1,INSD:EH840871.1,INSD:BE037896.1,
                     INSD:AV805398.1,INSD:EL055345.1,INSD:EH804914.1,
                     INSD:DR280154.1,INSD:EL317591.1,INSD:BE039029.1,
                     INSD:DR280155.1,INSD:DR280153.1,INSD:EL267567.1,
                     INSD:EG521105.1,INSD:EH989680.1,INSD:EH829735.1,
                     INSD:EL079528.1,INSD:EL007742.1,INSD:EL113433.1,
                     INSD:EH876256.1,INSD:EL198908.1,INSD:EH802639.1,
                     INSD:EL173905.1,INSD:AV829300.1,INSD:EH972289.1,
                     INSD:BP653704.1,INSD:ES028612.1,INSD:DR280149.1,
                     INSD:BP859305.1,INSD:BP650497.1,INSD:BP591847.1,
                     INSD:EH867423.1,INSD:ES108316.1,INSD:DR280148.1,
                     INSD:EL051029.1,INSD:EL117982.1,INSD:EH859549.1,
                     INSD:EL991275.1,INSD:DR280150.1,INSD:DR380029.1,
                     INSD:BP812129.1,INSD:EL297296.1,INSD:EL160940.1,
                     INSD:EL203900.1,INSD:AV786168.1,INSD:DR280156.1,
                     INSD:AV541047.1,INSD:EL257346.1,INSD:EG488424.1,
                     INSD:EH868708.1,INSD:EL125725.1,INSD:EL070215.1,
                     INSD:EL243789.1,INSD:EH847515.1,INSD:EG488423.1,
                     INSD:EH801209.1,INSD:EL331576.1,INSD:AV798952.1,
                     INSD:ES152157.1,INSD:EH804047.1,INSD:BP635992.1,
                     INSD:ES039977.1,INSD:BP845588.1,INSD:BP662304.1,
                     INSD:DR280152.1,INSD:BP844555.1,INSD:BX839102.1,
                     INSD:BX840119.1,INSD:EL015396.1,INSD:EL086721.1,
                     INSD:ES165733.1,INSD:EH887049.1,INSD:EH983889.1,
                     INSD:EL967940.1,INSD:EL068299.1,INSD:EG521104.1,
                     INSD:DR280151.1,INSD:EL223325.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820908.1,INSD:AY084784.1,INSD:BX820614.1,
                     INSD:BX821977.1,INSD:AF145045.1,INSD:BX821288.1,
                     INSD:BX821937.1,INSD:BX819534.1,INSD:AY056347.1,
                     INSD:AF360172.1,INSD:BX819468.1,INSD:BX819191.1,
                     INSD:AB054096.1"
                     /db_xref="TAIR:AT2G01110"
                     /db_xref="Araport:AT2G01110"
     CDS             complement(join(83786..83995,84085..84375,84450..84718,
                     84836..85088))
                     /gene="APG2"
                     /locus_tag="AT2G01110"
                     /gene_synonym="ALBINO AND PALE GREEN 2"
                     /gene_synonym="F23H14.8"
                     /gene_synonym="F23H14_8"
                     /gene_synonym="PGA2"
                     /gene_synonym="TATC"
                     /gene_synonym="TWIN-ARGININE TRANSLOCATION C"
                     /gene_synonym="UNE3"
                     /gene_synonym="unfertilized embryo sac 3"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP857834.1,INSD:EH840871.1,INSD:BE037896.1,
                     INSD:AV805398.1,INSD:EL055345.1,INSD:EH804914.1,
                     INSD:DR280154.1,INSD:EL317591.1,INSD:BE039029.1,
                     INSD:DR280155.1,INSD:DR280153.1,INSD:EL267567.1,
                     INSD:EG521105.1,INSD:EH989680.1,INSD:EH829735.1,
                     INSD:EL079528.1,INSD:EL007742.1,INSD:EL113433.1,
                     INSD:EH876256.1,INSD:EL198908.1,INSD:EH802639.1,
                     INSD:EL173905.1,INSD:AV829300.1,INSD:EH972289.1,
                     INSD:BP653704.1,INSD:ES028612.1,INSD:DR280149.1,
                     INSD:BP859305.1,INSD:BP650497.1,INSD:BP591847.1,
                     INSD:EH867423.1,INSD:ES108316.1,INSD:DR280148.1,
                     INSD:EL051029.1,INSD:EL117982.1,INSD:EH859549.1,
                     INSD:EL991275.1,INSD:DR280150.1,INSD:DR380029.1,
                     INSD:BP812129.1,INSD:EL297296.1,INSD:EL160940.1,
                     INSD:EL203900.1,INSD:AV786168.1,INSD:DR280156.1,
                     INSD:AV541047.1,INSD:EL257346.1,INSD:EG488424.1,
                     INSD:EH868708.1,INSD:EL125725.1,INSD:EL070215.1,
                     INSD:EL243789.1,INSD:EH847515.1,INSD:EG488423.1,
                     INSD:EH801209.1,INSD:EL331576.1,INSD:AV798952.1,
                     INSD:ES152157.1,INSD:EH804047.1,INSD:BP635992.1,
                     INSD:ES039977.1,INSD:BP845588.1,INSD:BP662304.1,
                     INSD:DR280152.1,INSD:BP844555.1,INSD:BX839102.1,
                     INSD:BX840119.1,INSD:EL015396.1,INSD:EL086721.1,
                     INSD:ES165733.1,INSD:EH887049.1,INSD:EH983889.1,
                     INSD:EL967940.1,INSD:EL068299.1,INSD:EG521104.1,
                     INSD:DR280151.1,INSD:EL223325.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820908.1,INSD:AY084784.1,INSD:BX820614.1,
                     INSD:BX821977.1,INSD:AF145045.1,INSD:BX821288.1,
                     INSD:BX821937.1,INSD:BX819534.1,INSD:AY056347.1,
                     INSD:AF360172.1,INSD:BX819468.1,INSD:BX819191.1,
                     INSD:AB054096.1"
                     /note="ALBINO AND PALE GREEN 2 (APG2); FUNCTIONS IN:
                     proton motive force dependent protein transmembrane
                     transporter activity; INVOLVED IN: thylakoid membrane
                     organization, double fertilization forming a zygote and
                     endosperm; LOCATED IN: chloroplast thylakoid membrane,
                     receptor complex, chloroplast, integral to thylakoid
                     membrane; EXPRESSED IN: 22 plant structures; EXPRESSED
                     DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
                     Sec-independent periplasmic protein translocase
                     (InterPro:IPR002033), Sec-independent periplasmic protein
                     translocase, conserved site (InterPro:IPR019820), Twin
                     arginine-targeting protein translocase, TatC
                     (InterPro:IPR019822); Has 5953 Blast hits to 5918 proteins
                     in 1859 species: Archae - 177; Bacteria - 3492; Metazoa -
                     0; Fungi - 0; Plants - 81; Viruses - 0; Other Eukaryotes -
                     2203 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Sec-independent periplasmic protein translocase"
                     /protein_id="AEC05402.1"
                     /db_xref="Araport:AT2G01110"
                     /db_xref="TAIR:AT2G01110"
                     /translation="MSSTSTSSALIHHFRLTTRNLGSPTKQRCPYAVTFCNSWREAGL
                     RYSVTQRRSKGFGPVSALNDDDSPTETTPGVGSAVEDRPPDSSEDRSSSVYEFLYPRK
                     EELPDDKEMTIFDHLEELRERIFVSVLAVGAAILGCFAFSKDLIVFLEAPVKTQGVRF
                     LQLAPGEFFFTTLKVSGYCGLLLGSPVILYEIIAFVLPGLTRAERRFLGPIVFGSSLL
                     FYAGLAFSYWVLTPAALNFFVNYAEGVVESLWSIDQYFEFVLVLMFSTGLSFQVPVIQ
                     LLLGQVGVVSGDQMLSIWRYVVVGAVVAAAVVTPSTDPVTQMLLATPLLGLYLGGAWM
                     VKLTGR"
     gene            84873..85086
                     /locus_tag="AT2G03895"
                     /note="Natural antisense transcript overlaps with
                     AT2G01110"
                     /db_xref="Araport:AT2G03895"
     ncRNA           84873..85086
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT2G03895"
                     /product="other RNA"
                     /db_xref="Araport:AT2G03895"
     gene            85401..88399
                     /gene="ORC4"
                     /locus_tag="AT2G01120"
                     /gene_synonym="ATORC4"
                     /gene_synonym="F23H14.9"
                     /gene_synonym="F23H14_9"
                     /gene_synonym="origin recognition complex subunit 4"
                     /gene_synonym="ORIGIN RECOGNITION COMPLEX SUBUNIT 4"
                     /note="Origin Recognition Complex subunit 4. Involved in
                     the initiation of DNA replication. Regulated
                     transcriptionally during cell cycle, peaking at
                     G1/S-phase. Target of E2F/DF family of transcription
                     factors. Interacts with all ORC subunits except ORC1b."
                     /db_xref="Araport:AT2G01120"
                     /db_xref="TAIR:AT2G01120"
     mRNA            join(85401..85553,85642..85732,85821..85877,85965..86012,
                     86097..86147,86234..86277,86351..86414,86512..86601,
                     86748..86839,86923..87004,87121..87206,87286..87395,
                     87467..87559,87630..87694,87761..87904,87998..88399)
                     /gene="ORC4"
                     /locus_tag="AT2G01120"
                     /gene_synonym="ATORC4"
                     /gene_synonym="F23H14.9"
                     /gene_synonym="F23H14_9"
                     /gene_synonym="origin recognition complex subunit 4"
                     /gene_synonym="ORIGIN RECOGNITION COMPLEX SUBUNIT 4"
                     /product="origin recognition complex subunit 4"
                     /db_xref="TAIR:AT2G01120"
                     /db_xref="Araport:AT2G01120"
     mRNA            join(85416..85553,85642..85732,85821..85877,85965..86012,
                     86097..86147,86234..86277,86351..86414,86512..86601,
                     86748..86839,86923..87004,87121..87206,87268..87395,
                     87467..87559,87630..87694,87761..87904,87998..88181)
                     /gene="ORC4"
                     /locus_tag="AT2G01120"
                     /gene_synonym="ATORC4"
                     /gene_synonym="F23H14.9"
                     /gene_synonym="F23H14_9"
                     /gene_synonym="origin recognition complex subunit 4"
                     /gene_synonym="ORIGIN RECOGNITION COMPLEX SUBUNIT 4"
                     /product="origin recognition complex subunit 4"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL210229.1,INSD:EL990935.1,INSD:Z26381.1,
                     INSD:EH858442.1,INSD:EH955635.1,INSD:ES061210.1,
                     INSD:ES189330.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820347.1,INSD:AJ575582.1,INSD:BT011662.1,
                     INSD:AJ586913.1,INSD:BX819004.1,INSD:BT011206.1"
                     /db_xref="TAIR:AT2G01120"
                     /db_xref="Araport:AT2G01120"
     CDS             join(85444..85553,85642..85732,85821..85877,85965..86012,
                     86097..86147,86234..86277,86351..86414,86512..86601,
                     86748..86839,86923..87004,87121..87206,87268..87395,
                     87467..87559,87630..87694,87761..87904,87998..88027)
                     /gene="ORC4"
                     /locus_tag="AT2G01120"
                     /gene_synonym="ATORC4"
                     /gene_synonym="F23H14.9"
                     /gene_synonym="F23H14_9"
                     /gene_synonym="origin recognition complex subunit 4"
                     /gene_synonym="ORIGIN RECOGNITION COMPLEX SUBUNIT 4"
                     /note="origin recognition complex subunit 4 (ORC4);
                     CONTAINS InterPro DOMAIN/s: ATPase, AAA-type, core
                     (InterPro:IPR003959), Origin recognition complex, subunit
                     4 (InterPro:IPR016527)."
                     /codon_start=1
                     /product="origin recognition complex subunit 4"
                     /protein_id="AEC05404.1"
                     /db_xref="Araport:AT2G01120"
                     /db_xref="TAIR:AT2G01120"
                     /translation="MGKETPAEKSLNLIRGRLCDPSYVFRPLSASSDSNYSKLKFIVS
                     TSITEGCNNSMLLLGPRGSGKAAVLDLXXGXLLEQFPDSVSVIRLNGLLHSDDNCAFK
                     EIAKQLCMEHHLLFSKMASFDDNSQFIIAMLRACGLAHKTIIFVLDEFDMFAQGKQRL
                     LYSXLDDAMQSVTSQAVVVGISSRLDADQLLEKRVRSRFSHRKFLFLPPSREELDGLF
                     VHLLSLPADSGFPSGYVSRFNDKIKNLTSDTRFKDILKTLFNANSTVNSFLKFILSLD
                     VRFCAVSLMNLESGLLSLENFKAALSSMQRQPKLEAVRDCSVLELYLLVCMRRLEVKE
                     QSSYNFISVMKEYKAIHDSFHTSDYYAQNVCLRAFEHLRERQVICYAENRGQSQTGEY
                     RLQKLLISASELHQGMRSHACCPAILLKLLDH"
     CDS             join(85444..85553,85642..85732,85821..85877,85965..86012,
                     86097..86147,86234..86277,86351..86414,86512..86601,
                     86748..86839,86923..87004,87121..87206,87286..87395,
                     87467..87559,87630..87694,87761..87904,87998..88027)
                     /gene="ORC4"
                     /locus_tag="AT2G01120"
                     /gene_synonym="ATORC4"
                     /gene_synonym="F23H14.9"
                     /gene_synonym="F23H14_9"
                     /gene_synonym="origin recognition complex subunit 4"
                     /gene_synonym="ORIGIN RECOGNITION COMPLEX SUBUNIT 4"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL210229.1,INSD:EL990935.1,INSD:Z26381.1,
                     INSD:EH858442.1,INSD:EH955635.1,INSD:ES061210.1,
                     INSD:ES189330.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820347.1,INSD:AJ575582.1,INSD:BT011662.1,
                     INSD:AJ586913.1,INSD:BX819004.1,INSD:BT011206.1"
                     /note="origin recognition complex subunit 4 (ORC4);
                     CONTAINS InterPro DOMAIN/s: ATPase, AAA-type, core
                     (InterPro:IPR003959), Origin recognition complex, subunit
                     4 (InterPro:IPR016527); Has 675 Blast hits to 668 proteins
                     in 199 species: Archae - 9; Bacteria - 0; Metazoa - 335;
                     Fungi - 166; Plants - 90; Viruses - 0; Other Eukaryotes -
                     75 (source: NCBI BLink)."
                     /codon_start=1
                     /product="origin recognition complex subunit 4"
                     /protein_id="AEC05403.1"
                     /db_xref="Araport:AT2G01120"
                     /db_xref="TAIR:AT2G01120"
                     /translation="MGKETPAEKSLNLIRGRLCDPSYVFRPLSASSDSNYSKLKFIVS
                     TSITEGCNNSMLLLGPRGSGKAAVLDLXXGXLLEQFPDSVSVIRLNGLLHSDDNCAFK
                     EIAKQLCMEHHLLFSKMASFDDNSQFIIAMLRACGLAHKTIIFVLDEFDMFAQGKQRL
                     LYSXLDDAMQSVTSQAVVVGISSRLDADQLLEKRVRSRFSHRKFLFLPPSREELDGLF
                     VHLLSLPADSGFPSGYVSRFNDKIKNLTSDTRFKDILKTLFNANSTVNSFLKFIFCAV
                     SLMNLESGLLSLENFKAALSSMQRQPKLEAVRDCSVLELYLLVCMRRLEVKEQSSYNF
                     ISVMKEYKAIHDSFHTSDYYAQNVCLRAFEHLRERQVICYAENRGQSQTGEYRLQKLL
                     ISASELHQGMRSHACCPAILLKLLDH"
     gene            complement(88320..94753)
                     /locus_tag="AT2G01130"
                     /gene_synonym="F10A8.28"
                     /db_xref="Araport:AT2G01130"
                     /db_xref="TAIR:AT2G01130"
     mRNA            complement(join(88320..89308,89437..89547,89649..89801,
                     89897..89956,90046..90351,90671..90819,90899..90968,
                     91102..91305,91655..91849,92057..92329,92404..92571,
                     92709..92839,92925..93084,93201..93389,93529..93624,
                     93709..93933,94028..94115,94187..94347,94495..94753))
                     /locus_tag="AT2G01130"
                     /gene_synonym="F10A8.28"
                     /product="DEA(D/H)-box RNA helicase family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP810813.1,INSD:AU229921.1,INSD:BE522980.1,
                     INSD:BE522979.1"
                     /db_xref="TAIR:AT2G01130"
                     /db_xref="Araport:AT2G01130"
     mRNA            complement(join(88489..89308,89437..89547,89649..89801,
                     89897..89956,90046..90351,90671..90819,90899..90968,
                     91102..91305,91655..91849,92057..92329,92404..92571,
                     92709..92839,92925..93084,93201..93389,93529..93624,
                     93709..93933,94028..94115,94187..94369))
                     /locus_tag="AT2G01130"
                     /gene_synonym="F10A8.28"
                     /product="DEA(D/H)-box RNA helicase family protein"
                     /db_xref="Araport:AT2G01130"
                     /db_xref="TAIR:AT2G01130"
     CDS             complement(join(88847..89308,89437..89547,89649..89801,
                     89897..89956,90046..90351,90671..90819,90899..90968,
                     91102..91305,91655..91849,92057..92329,92404..92571,
                     92709..92839,92925..93084,93201..93389,93529..93624,
                     93709..93933,94028..94115,94187..94347,94495..94635))
                     /locus_tag="AT2G01130"
                     /gene_synonym="F10A8.28"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP810813.1,INSD:AU229921.1,INSD:BE522980.1,
                     INSD:BE522979.1"
                     /note="DEA(D/H)-box RNA helicase family protein; FUNCTIONS
                     IN: in 6 functions; INVOLVED IN: biological_process
                     unknown; LOCATED IN: intracellular; EXPRESSED IN: 19 plant
                     structures; EXPRESSED DURING: 12 growth stages; CONTAINS
                     InterPro DOMAIN/s: Helicase-associated domain
                     (InterPro:IPR007502), DNA/RNA helicase, DEAD/DEAH box
                     type, N-terminal (InterPro:IPR011545), Domain of unknown
                     function DUF1605 (InterPro:IPR011709), Double-stranded
                     RNA-binding (InterPro:IPR001159), Double-stranded
                     RNA-binding-like (InterPro:IPR014720), DEAD-like helicase,
                     N-terminal (InterPro:IPR014001), DNA/RNA helicase,
                     C-terminal (InterPro:IPR001650), Helicase, superfamily
                     1/2, ATP-binding domain (InterPro:IPR014021); BEST
                     Arabidopsis thaliana protein match is: DEA(D/H)-box RNA
                     helicase family protein (TAIR:AT1G48650.2); Has 13137
                     Blast hits to 8990 proteins in 1526 species: Archae - 10;
                     Bacteria - 5358; Metazoa - 2929; Fungi - 1766; Plants -
                     978; Viruses - 93; Other Eukaryotes - 2003 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="DEA(D/H)-box RNA helicase family protein"
                     /protein_id="AEC05405.1"
                     /db_xref="Araport:AT2G01130"
                     /db_xref="TAIR:AT2G01130"
                     /translation="MTNRLPPSLYVPPHQRLGSDYGFNPVPLSPVRYVSAYDDRVSED
                     RQPQEGTFHCADLDDWNKRFSMLLKDSLKQEVISREKKDRRDFDKLAALATTLGLYSH
                     AYAKVVVFSKIPLPNYRFDLDDKKPQREVNLHTDLLQRVEAYLTEYLSKSSNRIDRVP
                     ANSVSRTSSISSTDEWFSEQPLPISATKILWQRSLQLRDRQQYWQASVEGQRMLDSRT
                     SLPAFKQRHSVLTAISQNQVIVISGETGCGKTTQIPQFILESEIEANRGAFSSIICTQ
                     PRRISAMSVSERVAYERGEQLGESVGYKVRLEGVKGRDTRLLFCTTGILLRRLLVDRN
                     LRGVTHVIVDEIHERGMNEDFLLIILKDLLSRRSELKLILMSATLDAELFSSYFGGAG
                     VIYIPGFTYPVRSHFLEDILEMTRYRLTPYNQIDDYGQERTWKMNKQIPKKRKSQITF
                     VVEDALRAADFKEFSPETRESLSCWYPDCIGFNLIEFLLCNICENEGPGGILIFLTGW
                     DDISSLKEKLQIHPIFGNPDLVMLLACHGSMETFEQRLIFEEPASGVRKIVLATNIAE
                     TSITINDVAFVIDCGKAKETSYDALNNTPCLLPSWISKVSAQQRRGRAGRVRPGQCYH
                     LYPKCVYDAFAEYQLPEILRTPLHSLCLQIKSLNLGSISEFLSRALQSPELLAVQKAI
                     AFLKIIGALDENEDLTTLGRYLSKLPMEPKLGKMLILGAILGCLDPILTVAAGLSVRD
                     PFLTPQDKKDLAEAAKSQFSRDHSDHLALVRAYEGWKKAEEESAVYDYCWKNFLSIQS
                     LRAIDSLRKEFFSLLKDTGLIDGNPSICNSEGNDANLTRAVICYGMYPGICSVVHNER
                     SFSLKTMEDGQVLLYSNSENARETKIPYPWLVFNEKIKVNSVFLRDSTACSDSTLILF
                     GGSISKGDTDGHLKMLGGYLEFFMKPDVAEIYQTLKKELDELIQNKLLNPKVDMQAHR
                     ELLSAIRLLVSEDGCDGRFVFGHQILRPLEISALSTKPSLFSRTESGPGGDNSKSQLQ
                     TILTRAGYTVPMYKTKQLKNNKFQTTVEFNETQIMGQPCSNKKSAEKDAAAEAIQWLK
                     GGAKESHEQVNHMSKLLKKGKKDHL"
     CDS             complement(join(88847..89308,89437..89547,89649..89801,
                     89897..89956,90046..90351,90671..90819,90899..90968,
                     91102..91305,91655..91849,92057..92329,92404..92571,
                     92709..92839,92925..93084,93201..93389,93529..93624,
                     93709..93933,94028..94115,94187..94293))
                     /locus_tag="AT2G01130"
                     /gene_synonym="F10A8.28"
                     /codon_start=1
                     /product="DEA(D/H)-box RNA helicase family protein"
                     /protein_id="ANM63137.1"
                     /db_xref="Araport:AT2G01130"
                     /db_xref="TAIR:AT2G01130"
                     /translation="MLLKDSLKQEVISREKKDRRDFDKLAALATTLGLYSHAYAKVVV
                     FSKIPLPNYRFDLDDKKPQREVNLHTDLLQRVEAYLTEYLSKSSNRIDRVPANSVSRT
                     SSISSTDEWFSEQPLPISATKILWQRSLQLRDRQQYWQASVEGQRMLDSRTSLPAFKQ
                     RHSVLTAISQNQVIVISGETGCGKTTQIPQFILESEIEANRGAFSSIICTQPRRISAM
                     SVSERVAYERGEQLGESVGYKVRLEGVKGRDTRLLFCTTGILLRRLLVDRNLRGVTHV
                     IVDEIHERGMNEDFLLIILKDLLSRRSELKLILMSATLDAELFSSYFGGAGVIYIPGF
                     TYPVRSHFLEDILEMTRYRLTPYNQIDDYGQERTWKMNKQIPKKRKSQITFVVEDALR
                     AADFKEFSPETRESLSCWYPDCIGFNLIEFLLCNICENEGPGGILIFLTGWDDISSLK
                     EKLQIHPIFGNPDLVMLLACHGSMETFEQRLIFEEPASGVRKIVLATNIAETSITIND
                     VAFVIDCGKAKETSYDALNNTPCLLPSWISKVSAQQRRGRAGRVRPGQCYHLYPKCVY
                     DAFAEYQLPEILRTPLHSLCLQIKSLNLGSISEFLSRALQSPELLAVQKAIAFLKIIG
                     ALDENEDLTTLGRYLSKLPMEPKLGKMLILGAILGCLDPILTVAAGLSVRDPFLTPQD
                     KKDLAEAAKSQFSRDHSDHLALVRAYEGWKKAEEESAVYDYCWKNFLSIQSLRAIDSL
                     RKEFFSLLKDTGLIDGNPSICNSEGNDANLTRAVICYGMYPGICSVVHNERSFSLKTM
                     EDGQVLLYSNSENARETKIPYPWLVFNEKIKVNSVFLRDSTACSDSTLILFGGSISKG
                     DTDGHLKMLGGYLEFFMKPDVAEIYQTLKKELDELIQNKLLNPKVDMQAHRELLSAIR
                     LLVSEDGCDGRFVFGHQILRPLEISALSTKPSLFSRTESGPGGDNSKSQLQTILTRAG
                     YTVPMYKTKQLKNNKFQTTVEFNETQIMGQPCSNKKSAEKDAAAEAIQWLKGGAKESH
                     EQVNHMSKLLKKGKKDHL"
     gene            complement(94727..96863)
                     /gene="PDE345"
                     /locus_tag="AT2G01140"
                     /gene_synonym="AtFBA3"
                     /gene_synonym="FBA3"
                     /gene_synonym="fructose-bisphosphate aldolase 3"
                     /gene_synonym="PIGMENT DEFECTIVE 345"
                     /db_xref="Araport:AT2G01140"
                     /db_xref="TAIR:AT2G01140"
     mRNA            complement(join(94727..95645,95749..95858,95954..96223,
                     96336..96863))
                     /gene="PDE345"
                     /locus_tag="AT2G01140"
                     /gene_synonym="AtFBA3"
                     /gene_synonym="FBA3"
                     /gene_synonym="fructose-bisphosphate aldolase 3"
                     /gene_synonym="PIGMENT DEFECTIVE 345"
                     /product="Aldolase superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES162432.1,INSD:DR235942.1,INSD:EL994091.1,
                     INSD:BP798519.1,INSD:BE524465.1,INSD:BP794764.1,
                     INSD:EH896773.1,INSD:DR235940.1,INSD:DR235963.1,
                     INSD:ES210481.1,INSD:BP648129.1,INSD:EH816359.1,
                     INSD:AV518474.1,INSD:AV526733.1,INSD:DR235965.1,
                     INSD:DR235945.1,INSD:EL010849.1,INSD:BP643832.1,
                     INSD:BE520531.1,INSD:DR235931.1,INSD:DR235935.1,
                     INSD:DR235944.1,INSD:AV554829.1,INSD:DR235939.1,
                     INSD:BP787411.1,INSD:ES167943.1,INSD:EG494105.1,
                     INSD:EL105504.1,INSD:BE523667.1,INSD:BP581425.1,
                     INSD:AV538958.1,INSD:DR235938.1,INSD:EL094564.1,
                     INSD:AV793024.1,INSD:AV544361.1,INSD:EL298689.1,
                     INSD:EL044552.1,INSD:EH878909.1,INSD:DR235930.1,
                     INSD:EH992383.1,INSD:EL086779.1,INSD:BP803002.1,
                     INSD:BP631770.1,INSD:ES135821.1,INSD:BP835183.1,
                     INSD:BP857776.1,INSD:ES173031.1,INSD:ES161388.1,
                     INSD:AV534600.1,INSD:AV519327.1,INSD:EH959638.1,
                     INSD:DR235973.1,INSD:BP641982.1,INSD:BP574898.1,
                     INSD:DR235956.1,INSD:DR235969.1,INSD:AV551921.1,
                     INSD:BP565611.1,INSD:BP782972.1,INSD:DR235953.1,
                     INSD:EG494106.1,INSD:BE525012.1,INSD:AV533494.1,
                     INSD:ES156410.1,INSD:EG499065.1,INSD:ES150154.1,
                     INSD:EL160077.1,INSD:BE524237.1,INSD:DR235955.1,
                     INSD:EG478630.1,INSD:DR235959.1,INSD:AV820129.1,
                     INSD:BE038432.1,INSD:ES190165.1,INSD:Z18204.1,
                     INSD:EH852361.1,INSD:EL278802.1,INSD:EL174142.1,
                     INSD:T42119.1,INSD:ES154192.1,INSD:H76694.1,
                     INSD:EG528921.1,INSD:CD529647.1,INSD:AV532755.1,
                     INSD:EL258375.1,INSD:ES043581.1,INSD:BP622995.1,
                     INSD:EL287015.1,INSD:AV439566.1,INSD:BE530386.1,
                     INSD:BP578458.1,INSD:BE038731.1,INSD:AV782422.1,
                     INSD:EL978168.1,INSD:AV790829.1,INSD:DR235968.1,
                     INSD:DR235970.1,INSD:BP801127.1,INSD:ES121305.1,
                     INSD:ES181399.1,INSD:EH799986.1,INSD:BU636349.1,
                     INSD:BE525869.1,INSD:ES102320.1,INSD:ES131258.1,
                     INSD:EL174586.1,INSD:EH928828.1,INSD:BP795041.1,
                     INSD:ES141212.1,INSD:DR235972.1,INSD:BE529824.1,
                     INSD:EH972836.1,INSD:EL224437.1,INSD:AV818222.1,
                     INSD:EL312063.1,INSD:AV533326.1,INSD:DR235925.1,
                     INSD:DR235971.1,INSD:BE526240.1,INSD:AV543147.1,
                     INSD:EL969288.1,INSD:BE526426.1,INSD:AV547345.1,
                     INSD:DR373541.1,INSD:ES092853.1,INSD:ES168927.1,
                     INSD:DR235976.1,INSD:DR235957.1,INSD:BP828516.1,
                     INSD:EL982327.1,INSD:ES074809.1,INSD:ES095351.1,
                     INSD:EL970322.1,INSD:BP651627.1,INSD:AV531591.1,
                     INSD:EL981267.1,INSD:BP640661.1,INSD:EG520409.1,
                     INSD:EL198963.1,INSD:AV533593.1,INSD:DR235933.1,
                     INSD:DR235928.1,INSD:ES210158.1,INSD:EG456962.1,
                     INSD:DR235927.1,INSD:ES192091.1,INSD:BP815841.1,
                     INSD:BP808951.1,INSD:AV541126.1,INSD:DR235941.1,
                     INSD:EL263383.1,INSD:BP662038.1,INSD:CK121614.1,
                     INSD:ES071126.1,INSD:BP652875.1,INSD:EH888959.1,
                     INSD:BP626936.1,INSD:DR235934.1,INSD:AV539227.1,
                     INSD:BE522016.1,INSD:AV551627.1,INSD:BP779302.1,
                     INSD:AV540961.1,INSD:ES195809.1,INSD:EH992106.1,
                     INSD:DR235962.1,INSD:DR235964.1,INSD:BP645205.1,
                     INSD:BP816921.1,INSD:EL081733.1,INSD:ES085760.1,
                     INSD:AV796977.1,INSD:AV805006.1,INSD:BE527424.1,
                     INSD:DR235954.1,INSD:BP832704.1,INSD:DR235952.1,
                     INSD:DR235947.1,INSD:EG522095.1,INSD:BP820154.1,
                     INSD:EH940157.1,INSD:BP836164.1,INSD:ES127138.1,
                     INSD:AV533903.1,INSD:CB259277.1,INSD:BP582530.1,
                     INSD:DR235961.1,INSD:EL186821.1,INSD:DR235966.1,
                     INSD:BP781274.1,INSD:DR235926.1,INSD:AV830746.1,
                     INSD:DR235951.1,INSD:EL153983.1,INSD:EL337211.1,
                     INSD:EH940139.1,INSD:ES154512.1,INSD:BP579701.1,
                     INSD:ES094926.1,INSD:DR235958.1,INSD:BP786703.1,
                     INSD:EL983896.1,INSD:EL035594.1,INSD:DR235948.1,
                     INSD:ES058133.1,INSD:R30011.1,INSD:BE530118.1,
                     INSD:BE521424.1,INSD:DR235929.1,INSD:ES010937.1,
                     INSD:DR235975.1,INSD:EG429207.1,INSD:DR235924.1,
                     INSD:EG514344.1,INSD:ES110151.1,INSD:ES148791.1,
                     INSD:EL158956.1,INSD:CB259773.1,INSD:BE521425.1,
                     INSD:DR235923.1,INSD:AV821858.1,INSD:ES002140.1,
                     INSD:EG528923.1,INSD:EL148180.1,INSD:AV525313.1,
                     INSD:EG499063.1,INSD:EL321979.1,INSD:ES033084.1,
                     INSD:AV534892.1,INSD:EL977592.1,INSD:DR235950.1,
                     INSD:DR235967.1,INSD:AV534505.1,INSD:ES038487.1,
                     INSD:DR235960.1,INSD:ES073870.1,INSD:BP867058.1,
                     INSD:EL982565.1,INSD:Z30852.1,INSD:EG497886.1,
                     INSD:BE527549.1,INSD:ES032658.1,INSD:EH852400.1,
                     INSD:EH970711.1,INSD:AV812872.1,INSD:DR235949.1,
                     INSD:AV535833.1,INSD:EL164026.1,INSD:DR235937.1,
                     INSD:DR235946.1,INSD:ES069582.1,INSD:EG525499.1,
                     INSD:ES123751.1,INSD:BE845290.1,INSD:ES196914.1,
                     INSD:ES193567.1,INSD:BP841370.1,INSD:BP662796.1,
                     INSD:BP789624.1,INSD:EG497888.1,INSD:BP848334.1,
                     INSD:F15459.1,INSD:AV551677.1,INSD:AV525661.1,
                     INSD:ES163260.1,INSD:BP781481.1,INSD:DR235943.1,
                     INSD:Z29138.1,INSD:BP819287.1,INSD:BP787487.1,
                     INSD:AV803683.1,INSD:AV521617.1,INSD:BP786035.1,
                     INSD:BP581860.1,INSD:EL281821.1,INSD:BX839416.1,
                     INSD:BP631747.1,INSD:AV441867.1,INSD:BP801047.1,
                     INSD:ES043503.1,INSD:BP595583.1,INSD:BP813968.1,
                     INSD:BE527091.1,INSD:DR235932.1,INSD:DR235974.1,
                     INSD:EG478670.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX821886.1,INSD:AY086203.1,INSD:BX819026.1,
                     INSD:BX820040.1,INSD:AF325014.2"
                     /db_xref="TAIR:AT2G01140"
                     /db_xref="Araport:AT2G01140"
     CDS             complement(join(95006..95645,95749..95858,95954..96223,
                     96336..96491))
                     /gene="PDE345"
                     /locus_tag="AT2G01140"
                     /gene_synonym="AtFBA3"
                     /gene_synonym="FBA3"
                     /gene_synonym="fructose-bisphosphate aldolase 3"
                     /gene_synonym="PIGMENT DEFECTIVE 345"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES162432.1,INSD:DR235942.1,INSD:EL994091.1,
                     INSD:BP798519.1,INSD:BE524465.1,INSD:BP794764.1,
                     INSD:EH896773.1,INSD:DR235940.1,INSD:DR235963.1,
                     INSD:ES210481.1,INSD:BP648129.1,INSD:EH816359.1,
                     INSD:AV518474.1,INSD:AV526733.1,INSD:DR235965.1,
                     INSD:DR235945.1,INSD:EL010849.1,INSD:BP643832.1,
                     INSD:BE520531.1,INSD:DR235931.1,INSD:DR235935.1,
                     INSD:DR235944.1,INSD:AV554829.1,INSD:DR235939.1,
                     INSD:BP787411.1,INSD:ES167943.1,INSD:EG494105.1,
                     INSD:EL105504.1,INSD:BE523667.1,INSD:BP581425.1,
                     INSD:AV538958.1,INSD:DR235938.1,INSD:EL094564.1,
                     INSD:AV793024.1,INSD:AV544361.1,INSD:EL298689.1,
                     INSD:EL044552.1,INSD:EH878909.1,INSD:DR235930.1,
                     INSD:EH992383.1,INSD:EL086779.1,INSD:BP803002.1,
                     INSD:BP631770.1,INSD:ES135821.1,INSD:BP835183.1,
                     INSD:BP857776.1,INSD:ES173031.1,INSD:ES161388.1,
                     INSD:AV534600.1,INSD:AV519327.1,INSD:EH959638.1,
                     INSD:DR235973.1,INSD:BP641982.1,INSD:BP574898.1,
                     INSD:DR235956.1,INSD:DR235969.1,INSD:AV551921.1,
                     INSD:BP565611.1,INSD:BP782972.1,INSD:DR235953.1,
                     INSD:EG494106.1,INSD:BE525012.1,INSD:AV533494.1,
                     INSD:ES156410.1,INSD:EG499065.1,INSD:ES150154.1,
                     INSD:EL160077.1,INSD:BE524237.1,INSD:DR235955.1,
                     INSD:EG478630.1,INSD:DR235959.1,INSD:AV820129.1,
                     INSD:BE038432.1,INSD:ES190165.1,INSD:Z18204.1,
                     INSD:EH852361.1,INSD:EL278802.1,INSD:EL174142.1,
                     INSD:T42119.1,INSD:ES154192.1,INSD:H76694.1,
                     INSD:EG528921.1,INSD:CD529647.1,INSD:AV532755.1,
                     INSD:EL258375.1,INSD:ES043581.1,INSD:BP622995.1,
                     INSD:EL287015.1,INSD:AV439566.1,INSD:BE530386.1,
                     INSD:BP578458.1,INSD:BE038731.1,INSD:AV782422.1,
                     INSD:EL978168.1,INSD:AV790829.1,INSD:DR235968.1,
                     INSD:DR235970.1,INSD:BP801127.1,INSD:ES121305.1,
                     INSD:ES181399.1,INSD:EH799986.1,INSD:BU636349.1,
                     INSD:BE525869.1,INSD:ES102320.1,INSD:ES131258.1,
                     INSD:EL174586.1,INSD:EH928828.1,INSD:BP795041.1,
                     INSD:ES141212.1,INSD:DR235972.1,INSD:BE529824.1,
                     INSD:EH972836.1,INSD:EL224437.1,INSD:AV818222.1,
                     INSD:EL312063.1,INSD:AV533326.1,INSD:DR235925.1,
                     INSD:DR235971.1,INSD:BE526240.1,INSD:AV543147.1,
                     INSD:EL969288.1,INSD:BE526426.1,INSD:AV547345.1,
                     INSD:DR373541.1,INSD:ES092853.1,INSD:ES168927.1,
                     INSD:DR235976.1,INSD:DR235957.1,INSD:BP828516.1,
                     INSD:EL982327.1,INSD:ES074809.1,INSD:ES095351.1,
                     INSD:EL970322.1,INSD:BP651627.1,INSD:AV531591.1,
                     INSD:EL981267.1,INSD:BP640661.1,INSD:EG520409.1,
                     INSD:EL198963.1,INSD:AV533593.1,INSD:DR235933.1,
                     INSD:DR235928.1,INSD:ES210158.1,INSD:EG456962.1,
                     INSD:DR235927.1,INSD:ES192091.1,INSD:BP815841.1,
                     INSD:BP808951.1,INSD:AV541126.1,INSD:DR235941.1,
                     INSD:EL263383.1,INSD:BP662038.1,INSD:CK121614.1,
                     INSD:ES071126.1,INSD:BP652875.1,INSD:EH888959.1,
                     INSD:BP626936.1,INSD:DR235934.1,INSD:AV539227.1,
                     INSD:BE522016.1,INSD:AV551627.1,INSD:BP779302.1,
                     INSD:AV540961.1,INSD:ES195809.1,INSD:EH992106.1,
                     INSD:DR235962.1,INSD:DR235964.1,INSD:BP645205.1,
                     INSD:BP816921.1,INSD:EL081733.1,INSD:ES085760.1,
                     INSD:AV796977.1,INSD:AV805006.1,INSD:BE527424.1,
                     INSD:DR235954.1,INSD:BP832704.1,INSD:DR235952.1,
                     INSD:DR235947.1,INSD:EG522095.1,INSD:BP820154.1,
                     INSD:EH940157.1,INSD:BP836164.1,INSD:ES127138.1,
                     INSD:AV533903.1,INSD:CB259277.1,INSD:BP582530.1,
                     INSD:DR235961.1,INSD:EL186821.1,INSD:DR235966.1,
                     INSD:BP781274.1,INSD:DR235926.1,INSD:AV830746.1,
                     INSD:DR235951.1,INSD:EL153983.1,INSD:EL337211.1,
                     INSD:EH940139.1,INSD:ES154512.1,INSD:BP579701.1,
                     INSD:ES094926.1,INSD:DR235958.1,INSD:BP786703.1,
                     INSD:EL983896.1,INSD:EL035594.1,INSD:DR235948.1,
                     INSD:ES058133.1,INSD:R30011.1,INSD:BE530118.1,
                     INSD:BE521424.1,INSD:DR235929.1,INSD:ES010937.1,
                     INSD:DR235975.1,INSD:EG429207.1,INSD:DR235924.1,
                     INSD:EG514344.1,INSD:ES110151.1,INSD:ES148791.1,
                     INSD:EL158956.1,INSD:CB259773.1,INSD:BE521425.1,
                     INSD:DR235923.1,INSD:AV821858.1,INSD:ES002140.1,
                     INSD:EG528923.1,INSD:EL148180.1,INSD:AV525313.1,
                     INSD:EG499063.1,INSD:EL321979.1,INSD:ES033084.1,
                     INSD:AV534892.1,INSD:EL977592.1,INSD:DR235950.1,
                     INSD:DR235967.1,INSD:AV534505.1,INSD:ES038487.1,
                     INSD:DR235960.1,INSD:ES073870.1,INSD:BP867058.1,
                     INSD:EL982565.1,INSD:Z30852.1,INSD:EG497886.1,
                     INSD:BE527549.1,INSD:ES032658.1,INSD:EH852400.1,
                     INSD:EH970711.1,INSD:AV812872.1,INSD:DR235949.1,
                     INSD:AV535833.1,INSD:EL164026.1,INSD:DR235937.1,
                     INSD:DR235946.1,INSD:ES069582.1,INSD:EG525499.1,
                     INSD:ES123751.1,INSD:BE845290.1,INSD:ES196914.1,
                     INSD:ES193567.1,INSD:BP841370.1,INSD:BP662796.1,
                     INSD:BP789624.1,INSD:EG497888.1,INSD:BP848334.1,
                     INSD:F15459.1,INSD:AV551677.1,INSD:AV525661.1,
                     INSD:ES163260.1,INSD:BP781481.1,INSD:DR235943.1,
                     INSD:Z29138.1,INSD:BP819287.1,INSD:BP787487.1,
                     INSD:AV803683.1,INSD:AV521617.1,INSD:BP786035.1,
                     INSD:BP581860.1,INSD:EL281821.1,INSD:BX839416.1,
                     INSD:BP631747.1,INSD:AV441867.1,INSD:BP801047.1,
                     INSD:ES043503.1,INSD:BP595583.1,INSD:BP813968.1,
                     INSD:BE527091.1,INSD:DR235932.1,INSD:DR235974.1,
                     INSD:EG478670.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX821886.1,INSD:AY086203.1,INSD:BX819026.1,
                     INSD:BX820040.1,INSD:AF325014.2"
                     /note="Aldolase superfamily protein; FUNCTIONS IN:
                     fructose-bisphosphate aldolase activity; INVOLVED IN:
                     response to oxidative stress, response to cadmium ion,
                     pentose-phosphate shunt; LOCATED IN: mitochondrion,
                     chloroplast, plastoglobule; EXPRESSED IN: 25 plant
                     structures; EXPRESSED DURING: 15 growth stages; CONTAINS
                     InterPro DOMAIN/s: Aldolase-type TIM barrel
                     (InterPro:IPR013785), Fructose-bisphosphate aldolase,
                     class-I (InterPro:IPR000741); BEST Arabidopsis thaliana
                     protein match is: fructose-bisphosphate aldolase 2
                     (TAIR:AT4G38970.1); Has 4797 Blast hits to 4792 proteins
                     in 909 species: Archae - 0; Bacteria - 723; Metazoa -
                     1159; Fungi - 8; Plants - 476; Viruses - 0; Other
                     Eukaryotes - 2431 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Aldolase superfamily protein"
                     /protein_id="AEC05406.1"
                     /db_xref="Araport:AT2G01140"
                     /db_xref="TAIR:AT2G01140"
                     /translation="MASASFVKPNTLSSPWIGQRSFAHTSASSSPPPRVSFAIRAGAY
                     SDELVKTAKSIASPGRGILAIDESNATCGKRLASIGLDNTEDNRQAYRQLLLTTPGLG
                     DYISGSILFEETLYQSTKDGKTFVDCLRDANIVPGIKVDKGLSPLAGSNEESWCQGLD
                     GLASRSAEYYKQGARFAKWRTVVSVPCGPSALAVKEAAWGLARYAAISQDNGLVPIVE
                     PEILLDGDHPIERTLEVAEKVWSEVFFYLAQNNVMFEGILLKPSMVTPGAEHKNKASP
                     ETVADFTLTMLKRRVPPAVPGIMFLSGGQSEAEATLNLNAMNQSPNPWHVSFSYARAL
                     QNSVLRTWQGKPEKIEASQKALLVRAKANSLAQLGKYSAEGENEDAKKGMFVKGYTY"
     gene            100484..101566
                     /gene="RHA2B"
                     /locus_tag="AT2G01150"
                     /gene_synonym="F10A8.3"
                     /gene_synonym="F10A8_3"
                     /gene_synonym="RING-H2 finger protein 2B"
                     /gene_synonym="RING-H2 FINGER PROTEIN RHA2B"
                     /note="Encodes a RING-H2 finger protein that is expressed
                     in vascular tissue, root tips, embryos and pistils."
                     /db_xref="Araport:AT2G01150"
                     /db_xref="TAIR:AT2G01150"
     mRNA            100484..101524
                     /gene="RHA2B"
                     /locus_tag="AT2G01150"
                     /gene_synonym="F10A8.3"
                     /gene_synonym="F10A8_3"
                     /gene_synonym="RING-H2 finger protein 2B"
                     /gene_synonym="RING-H2 FINGER PROTEIN RHA2B"
                     /product="RING-H2 finger protein 2B"
                     /db_xref="Araport:AT2G01150"
                     /db_xref="TAIR:AT2G01150"
     CDS             100556..101146
                     /gene="RHA2B"
                     /locus_tag="AT2G01150"
                     /gene_synonym="F10A8.3"
                     /gene_synonym="F10A8_3"
                     /gene_synonym="RING-H2 finger protein 2B"
                     /gene_synonym="RING-H2 FINGER PROTEIN RHA2B"
                     /codon_start=1
                     /product="RING-H2 finger protein 2B"
                     /protein_id="ANM62281.1"
                     /db_xref="Araport:AT2G01150"
                     /db_xref="TAIR:AT2G01150"
                     /translation="MGPTTRGLCHFFFFSIHIKKKKEMRCKVVYAARTTTRTKVTKTI
                     SKTISMGLQGQLSDVSSDSIPLMLLALLATFFRHVRSLLLFPSSAPVVVVTSNLSVLA
                     DQLNLNRLFSYRYSDNAASDCIVCLSKLKTGEEVRKLDCRHVFHKQCLEGWLQHLNFN
                     CPLCRSPLLPHHHQGHGSDASISAFPLRSTSTASSH"
     mRNA            100563..101495
                     /gene="RHA2B"
                     /locus_tag="AT2G01150"
                     /gene_synonym="F10A8.3"
                     /gene_synonym="F10A8_3"
                     /gene_synonym="RING-H2 finger protein 2B"
                     /gene_synonym="RING-H2 FINGER PROTEIN RHA2B"
                     /product="RING-H2 finger protein 2B"
                     /db_xref="Araport:AT2G01150"
                     /db_xref="TAIR:AT2G01150"
     CDS             100625..101146
                     /gene="RHA2B"
                     /locus_tag="AT2G01150"
                     /gene_synonym="F10A8.3"
                     /gene_synonym="F10A8_3"
                     /gene_synonym="RING-H2 finger protein 2B"
                     /gene_synonym="RING-H2 FINGER PROTEIN RHA2B"
                     /codon_start=1
                     /product="RING-H2 finger protein 2B"
                     /protein_id="ANM62282.1"
                     /db_xref="Araport:AT2G01150"
                     /db_xref="TAIR:AT2G01150"
                     /translation="MRCKVVYAARTTTRTKVTKTISKTISMGLQGQLSDVSSDSIPLM
                     LLALLATFFRHVRSLLLFPSSAPVVVVTSNLSVLADQLNLNRLFSYRYSDNAASDCIV
                     CLSKLKTGEEVRKLDCRHVFHKQCLEGWLQHLNFNCPLCRSPLLPHHHQGHGSDASIS
                     AFPLRSTSTASSH"
     mRNA            100634..101566
                     /gene="RHA2B"
                     /locus_tag="AT2G01150"
                     /gene_synonym="F10A8.3"
                     /gene_synonym="F10A8_3"
                     /gene_synonym="RING-H2 finger protein 2B"
                     /gene_synonym="RING-H2 FINGER PROTEIN RHA2B"
                     /product="RING-H2 finger protein 2B"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH977161.1,INSD:CB263517.1,INSD:AV532494.1,
                     INSD:EL127274.1,INSD:EH811397.1,INSD:AA728515.1,
                     INSD:DR252653.1,INSD:AV537173.1,INSD:AV563006.1,
                     INSD:DR252655.1,INSD:T76073.1,INSD:DR749570.1,
                     INSD:T04686.1,INSD:DR252652.1,INSD:DR376651.1,
                     INSD:DR252651.1,INSD:AU229961.1,INSD:EL191079.1,
                     INSD:AU238728.1,INSD:DR252654.1,INSD:EL014463.1,
                     INSD:DR252656.1,INSD:EL273556.1,INSD:DR749538.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT025510.1,INSD:AK117891.1,INSD:AF078823.1"
                     /db_xref="TAIR:AT2G01150"
                     /db_xref="Araport:AT2G01150"
     CDS             100703..101146
                     /gene="RHA2B"
                     /locus_tag="AT2G01150"
                     /gene_synonym="F10A8.3"
                     /gene_synonym="F10A8_3"
                     /gene_synonym="RING-H2 finger protein 2B"
                     /gene_synonym="RING-H2 FINGER PROTEIN RHA2B"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH977161.1,INSD:CB263517.1,INSD:AV532494.1,
                     INSD:EL127274.1,INSD:EH811397.1,INSD:AA728515.1,
                     INSD:DR252653.1,INSD:AV537173.1,INSD:AV563006.1,
                     INSD:DR252655.1,INSD:T76073.1,INSD:DR749570.1,
                     INSD:T04686.1,INSD:DR252652.1,INSD:DR376651.1,
                     INSD:DR252651.1,INSD:AU229961.1,INSD:EL191079.1,
                     INSD:AU238728.1,INSD:DR252654.1,INSD:EL014463.1,
                     INSD:DR252656.1,INSD:EL273556.1,INSD:DR749538.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT025510.1,INSD:AK117891.1,INSD:AF078823.1"
                     /note="RING-H2 finger protein 2B (RHA2B); CONTAINS
                     InterPro DOMAIN/s: Zinc finger, RING-type
                     (InterPro:IPR001841), Zinc finger, C3HC4 RING-type
                     (InterPro:IPR018957); BEST Arabidopsis thaliana protein
                     match is: RING-H2 finger A2A (TAIR:AT1G15100.1); Has 8536
                     Blast hits to 8514 proteins in 269 species: Archae - 0;
                     Bacteria - 0; Metazoa - 2151; Fungi - 713; Plants - 4534;
                     Viruses - 16; Other Eukaryotes - 1122 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="RING-H2 finger protein 2B"
                     /protein_id="AEC05407.1"
                     /db_xref="Araport:AT2G01150"
                     /db_xref="TAIR:AT2G01150"
                     /translation="MGLQGQLSDVSSDSIPLMLLALLATFFRHVRSLLLFPSSAPVVV
                     VTSNLSVLADQLNLNRLFSYRYSDNAASDCIVCLSKLKTGEEVRKLDCRHVFHKQCLE
                     GWLQHLNFNCPLCRSPLLPHHHQGHGSDASISAFPLRSTSTASSH"
     gene            102065..102138
                     /locus_tag="AT2G01160"
                     /gene_synonym="48852.TRNA-ASN-1"
                     /db_xref="Araport:AT2G01160"
                     /db_xref="TAIR:AT2G01160"
     tRNA            102065..102138
                     /locus_tag="AT2G01160"
                     /gene_synonym="48852.TRNA-ASN-1"
                     /product="tRNA-Asn"
                     /note="pre-tRNA-tRNA-Asn (anticodon: GTT)"
                     /db_xref="Araport:AT2G01160"
                     /db_xref="TAIR:AT2G01160"
     gene            complement(102156..104574)
                     /gene="BAT1"
                     /locus_tag="AT2G01170"
                     /gene_synonym="AtGABP"
                     /gene_synonym="bidirectional amino acid transporter 1"
                     /gene_synonym="GABA permease"
                     /gene_synonym="GABP"
                     /note="Encodes a bidirectional amino acid transporter that
                     can transport ala, arg, glu and lys, GABA but not pro with
                     both export and import activity. Its expression is
                     localized in the vascular tissues suggesting a function in
                     amino acids export from the phloem into sink tissue."
                     /db_xref="Araport:AT2G01170"
                     /db_xref="TAIR:AT2G01170"
     mRNA            complement(join(102156..102711,102788..102917,
                     102999..103288,103362..103543,103623..103842,
                     103926..103944,104033..104293,104362..104574))
                     /gene="BAT1"
                     /locus_tag="AT2G01170"
                     /gene_synonym="AtGABP"
                     /gene_synonym="bidirectional amino acid transporter 1"
                     /gene_synonym="GABA permease"
                     /gene_synonym="GABP"
                     /product="bidirectional amino acid transporter 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV548940.1,INSD:BU635510.1,INSD:AV537128.1,
                     INSD:DR245191.1,INSD:BX840352.1,INSD:DR245193.1,
                     INSD:BX836224.1,INSD:EL184261.1,INSD:AV800999.1,
                     INSD:BX841151.1,INSD:AI998375.1,INSD:DR376219.1,
                     INSD:EL331256.1,INSD:DR245192.1,INSD:DR245190.1,
                     INSD:T22007.1,INSD:CF652424.1,INSD:DR245194.1,
                     INSD:AV786208.1,INSD:AV818263.1,INSD:BP594382.1,
                     INSD:EL172813.1,INSD:DR378017.1,INSD:EH878607.1,
                     INSD:BP613000.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820764.1,INSD:BX820338.1,INSD:BT020534.1,
                     INSD:BX820771.1,INSD:BX820683.1,INSD:AF019637.1,
                     INSD:BX819028.1,INSD:BX819189.1,INSD:AY080610.1"
                     /db_xref="TAIR:AT2G01170"
                     /db_xref="Araport:AT2G01170"
     mRNA            complement(join(102211..102711,102788..102917,
                     102999..103288,103362..103543,103623..103842,
                     103926..103944,104033..104515))
                     /gene="BAT1"
                     /locus_tag="AT2G01170"
                     /gene_synonym="AtGABP"
                     /gene_synonym="bidirectional amino acid transporter 1"
                     /gene_synonym="GABA permease"
                     /gene_synonym="GABP"
                     /product="bidirectional amino acid transporter 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BU635510.1,INSD:AV537128.1,INSD:AV786208.1,
                     INSD:BX836224.1,INSD:EL184261.1,INSD:AV818263.1,
                     INSD:AV800999.1,INSD:BX839664.1,INSD:BP594382.1,
                     INSD:EL172813.1,INSD:DR378017.1,INSD:AI998375.1,
                     INSD:DR376219.1,INSD:EH878607.1,INSD:BP613000.1,
                     INSD:EL331256.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT020534.1,INSD:BX819189.1"
                     /db_xref="TAIR:AT2G01170"
                     /db_xref="Araport:AT2G01170"
     CDS             complement(join(102364..102711,102788..102917,
                     102999..103288,103362..103543,103623..103842,
                     103926..103944,104033..104293,104362..104462))
                     /gene="BAT1"
                     /locus_tag="AT2G01170"
                     /gene_synonym="AtGABP"
                     /gene_synonym="bidirectional amino acid transporter 1"
                     /gene_synonym="GABA permease"
                     /gene_synonym="GABP"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV548940.1,INSD:BU635510.1,INSD:AV537128.1,
                     INSD:DR245191.1,INSD:BX840352.1,INSD:DR245193.1,
                     INSD:BX836224.1,INSD:EL184261.1,INSD:AV800999.1,
                     INSD:BX841151.1,INSD:AI998375.1,INSD:DR376219.1,
                     INSD:EL331256.1,INSD:DR245192.1,INSD:DR245190.1,
                     INSD:T22007.1,INSD:CF652424.1,INSD:DR245194.1,
                     INSD:AV786208.1,INSD:AV818263.1,INSD:BP594382.1,
                     INSD:EL172813.1,INSD:DR378017.1,INSD:EH878607.1,
                     INSD:BP613000.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820764.1,INSD:BX820338.1,INSD:BT020534.1,
                     INSD:BX820771.1,INSD:BX820683.1,INSD:AF019637.1,
                     INSD:BX819028.1,INSD:BX819189.1,INSD:AY080610.1"
                     /note="bidirectional amino acid transporter 1 (BAT1);
                     FUNCTIONS IN: arginine transmembrane transporter activity,
                     L-lysine transmembrane transporter activity, L-alanine
                     transmembrane transporter activity, L-glutamate
                     transmembrane transporter activity; INVOLVED IN: amino
                     acid transport, transport, transmembrane transport;
                     LOCATED IN: integral to membrane, membrane; EXPRESSED IN:
                     24 plant structures; EXPRESSED DURING: 13 growth stages;
                     CONTAINS InterPro DOMAIN/s: Amino acid permease subfamily
                     (InterPro:IPR004756), Amino acid/polyamine transporter I
                     (InterPro:IPR002293), Amino acid permease domain
                     (InterPro:IPR004841); Has 15465 Blast hits to 15422
                     proteins in 1894 species: Archae - 296; Bacteria - 11987;
                     Metazoa - 438; Fungi - 2169; Plants - 254; Viruses - 0;
                     Other Eukaryotes - 321 (source: NCBI BLink)."
                     /codon_start=1
                     /product="bidirectional amino acid transporter 1"
                     /protein_id="AEC05409.1"
                     /db_xref="Araport:AT2G01170"
                     /db_xref="TAIR:AT2G01170"
                     /translation="MGLGGDQSFVPVMDSGQVRLKELGYKQELKRDLSVFSNFAISFS
                     IISVLTGITTTYNTGLRFGGTVTLVYGWFLAGSFTMCVGLSMAEICSSYPTSGGLYYW
                     SAMLAGPRWAPLASWMTGWFNIVGQWAVTASVDFSLAQLIQVIVLLSTGGRNGGGYKG
                     SDFVVIGIHGGILFIHALLNSLPISVLSFIGQLAALWNLLGVLVLMILIPLVSTERAT
                     TKFVFTNFNTDNGLGITSYAYIFVLGLLMSQYTITGYDASAHMTEETVDADKNGPRGI
                     ISAIGISILFGWGYILGISYAVTDIPSLLSETNNSGGYAIAEIFYLAFKNRFGSGTGG
                     IVCLGVVAVAVFFCGMSSVTSNSRMAYAFSRDGAMPMSPLWHKVNSREVPINAVWLSA
                     LISFCMALTSLGSIVAFQAMVSIATIGLYIAYAIPIILRVTLARNTFVPGPFSLGKYG
                     MVVGWVAVLWVVTISVLFSLPVAYPITAETLNYTPVAVAGLVAITLSYWLFSARHWFT
                     GPISNILS"
     CDS             complement(join(102364..102711,102788..102917,
                     102999..103288,103362..103543,103623..103842,
                     103926..103944,104033..104157))
                     /gene="BAT1"
                     /locus_tag="AT2G01170"
                     /gene_synonym="AtGABP"
                     /gene_synonym="bidirectional amino acid transporter 1"
                     /gene_synonym="GABA permease"
                     /gene_synonym="GABP"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BU635510.1,INSD:AV537128.1,INSD:AV786208.1,
                     INSD:BX836224.1,INSD:EL184261.1,INSD:AV818263.1,
                     INSD:AV800999.1,INSD:BX839664.1,INSD:BP594382.1,
                     INSD:EL172813.1,INSD:DR378017.1,INSD:AI998375.1,
                     INSD:DR376219.1,INSD:EH878607.1,INSD:BP613000.1,
                     INSD:EL331256.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT020534.1,INSD:BX819189.1"
                     /note="bidirectional amino acid transporter 1 (BAT1);
                     FUNCTIONS IN: arginine transmembrane transporter activity,
                     L-lysine transmembrane transporter activity, L-alanine
                     transmembrane transporter activity, L-glutamate
                     transmembrane transporter activity; INVOLVED IN:
                     transport, amino acid transport, transmembrane transport;
                     LOCATED IN: integral to membrane, membrane; EXPRESSED IN:
                     24 plant structures; EXPRESSED DURING: 13 growth stages;
                     CONTAINS InterPro DOMAIN/s: Amino acid permease subfamily
                     (InterPro:IPR004756), Amino acid/polyamine transporter I
                     (InterPro:IPR002293), Amino acid permease domain
                     (InterPro:IPR004841); Has 35333 Blast hits to 34131
                     proteins in 2444 species: Archae - 798; Bacteria - 22429;
                     Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
                     Other Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="bidirectional amino acid transporter 1"
                     /protein_id="AEC05408.1"
                     /db_xref="Araport:AT2G01170"
                     /db_xref="TAIR:AT2G01170"
                     /translation="MCVGLSMAEICSSYPTSGGLYYWSAMLAGPRWAPLASWMTGWFN
                     IVGQWAVTASVDFSLAQLIQVIVLLSTGGRNGGGYKGSDFVVIGIHGGILFIHALLNS
                     LPISVLSFIGQLAALWNLLGVLVLMILIPLVSTERATTKFVFTNFNTDNGLGITSYAY
                     IFVLGLLMSQYTITGYDASAHMTEETVDADKNGPRGIISAIGISILFGWGYILGISYA
                     VTDIPSLLSETNNSGGYAIAEIFYLAFKNRFGSGTGGIVCLGVVAVAVFFCGMSSVTS
                     NSRMAYAFSRDGAMPMSPLWHKVNSREVPINAVWLSALISFCMALTSLGSIVAFQAMV
                     SIATIGLYIAYAIPIILRVTLARNTFVPGPFSLGKYGMVVGWVAVLWVVTISVLFSLP
                     VAYPITAETLNYTPVAVAGLVAITLSYWLFSARHWFTGPISNILS"
     gene            complement(104884..106291)
                     /locus_tag="AT2G01175"
                     /db_xref="Araport:AT2G01175"
                     /db_xref="TAIR:AT2G01175"
     mRNA            complement(join(104884..105795,106072..106291))
                     /locus_tag="AT2G01175"
                     /product="transmembrane protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AU229751.1,INSD:AU238559.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AK117710.1,INSD:BT029198.1"
                     /db_xref="TAIR:AT2G01175"
                     /db_xref="Araport:AT2G01175"
     CDS             complement(105572..105760)
                     /locus_tag="AT2G01175"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AU229751.1,INSD:AU238559.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AK117710.1,INSD:BT029198.1"
                     /note="unknown protein; FUNCTIONS IN: molecular_function
                     unknown; INVOLVED IN: biological_process unknown; LOCATED
                     IN: endomembrane system; Has 35333 Blast hits to 34131
                     proteins in 2444 species: Archae - 798; Bacteria - 22429;
                     Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
                     Other Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="transmembrane protein"
                     /protein_id="AEC05410.1"
                     /db_xref="Araport:AT2G01175"
                     /db_xref="TAIR:AT2G01175"
                     /translation="MLWRLRGLFKLYGHLGFLVLWLLVQPLLDQPVITWFIMSLIIHL
                     LFGLLVPFFKEGKYLASA"
     gene            complement(106621..108829)
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /note="Encodes phosphatidate phosphatase. Up-regulated by
                     genotoxic stress (gamma ray or UV-B) and elicitor
                     treatments with mastoparan and harpin. Expressed in roots
                     and leaves."
                     /db_xref="Araport:AT2G01180"
                     /db_xref="TAIR:AT2G01180"
     mRNA            complement(join(106621..106854,106951..108114,
                     108505..108829))
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /product="phosphatidic acid phosphatase 1"
                     /db_xref="Araport:AT2G01180"
                     /db_xref="TAIR:AT2G01180"
     mRNA            complement(join(106621..106854,106951..108114,
                     108209..108829))
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /product="phosphatidic acid phosphatase 1"
                     /db_xref="Araport:AT2G01180"
                     /db_xref="TAIR:AT2G01180"
     mRNA            complement(join(106730..106854,106941..108114,
                     108505..108810))
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /product="phosphatidic acid phosphatase 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR231468.1,INSD:DR383707.1,INSD:EL266446.1,
                     INSD:EL139101.1,INSD:DR231472.1,INSD:EH929058.1,
                     INSD:DR231471.1,INSD:AV551263.1,INSD:EG516139.1,
                     INSD:EL260246.1,INSD:BP817365.1,INSD:BP854197.1,
                     INSD:ES075455.1,INSD:BP836515.1,INSD:BP805159.1,
                     INSD:EL260518.1,INSD:EL015660.1,INSD:DR231470.1,
                     INSD:BX835431.1,INSD:EG516143.1,INSD:DR372998.1,
                     INSD:BP612139.1,INSD:DR231467.1,INSD:ES096956.1,
                     INSD:EG513579.1,INSD:EG516090.1,INSD:EL010702.1,
                     INSD:AV824728.1,INSD:BP862109.1,INSD:EL155022.1,
                     INSD:EL315725.1,INSD:EG516072.1,INSD:DR231469.1,
                     INSD:AV538892.1,INSD:AI996330.1,INSD:EG479795.1,
                     INSD:BX840561.1,INSD:AV787398.1,INSD:EL252391.1,
                     INSD:BP821380.1,INSD:BP643918.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AF412050.1,INSD:BX819590.1,INSD:AB004318.1,
                     INSD:BX820220.1,INSD:BX820958.1,INSD:BX818851.1,
                     INSD:BX818767.1,INSD:AB053949.1,INSD:AY085869.1,
                     INSD:BX819071.1,INSD:BX820540.1,INSD:AY143886.1"
                     /db_xref="TAIR:AT2G01180"
                     /db_xref="Araport:AT2G01180"
     mRNA            complement(join(106730..106854,106941..108810))
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /product="phosphatidic acid phosphatase 1"
                     /db_xref="Araport:AT2G01180"
                     /db_xref="TAIR:AT2G01180"
     mRNA            complement(join(106842..106854,106951..108114,
                     108209..108231))
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /product="phosphatidic acid phosphatase 1"
                     /db_xref="Araport:AT2G01180"
                     /db_xref="TAIR:AT2G01180"
     mRNA            complement(join(106895..108114,108209..108803))
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /product="phosphatidic acid phosphatase 1"
                     /db_xref="Araport:AT2G01180"
                     /db_xref="TAIR:AT2G01180"
     mRNA            complement(join(106900..108114,108505..108818))
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /product="phosphatidic acid phosphatase 1"
                     /db_xref="Araport:AT2G01180"
                     /db_xref="TAIR:AT2G01180"
     mRNA            complement(106901..108804)
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /product="phosphatidic acid phosphatase 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR383707.1,INSD:BX835431.1,INSD:EL266446.1,
                     INSD:EL139101.1,INSD:EH929058.1,INSD:DR372998.1,
                     INSD:BP612139.1,INSD:EL260246.1,INSD:ES096956.1,
                     INSD:EL010702.1,INSD:DR365674.1,INSD:EL155022.1,
                     INSD:EL315725.1,INSD:ES075455.1,INSD:EG516111.1,
                     INSD:EG516049.1,INSD:AV538892.1,INSD:AI996330.1,
                     INSD:CB257205.1,INSD:EL260518.1,INSD:BX840561.1,
                     INSD:AV787398.1,INSD:BX839099.1,INSD:EL252391.1,
                     INSD:EL015660.1,INSD:BP643918.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AB053949.1,INSD:BX819931.1"
                     /db_xref="TAIR:AT2G01180"
                     /db_xref="Araport:AT2G01180"
     CDS             complement(join(107182..108114,108505..108555))
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /codon_start=1
                     /product="phosphatidic acid phosphatase 1"
                     /protein_id="ANM61749.1"
                     /db_xref="Araport:AT2G01180"
                     /db_xref="TAIR:AT2G01180"
                     /translation="MTIGSFFSSLLFWRNSQDQEAQRGRMQEIDLSVHTIKSHGGRVA
                     SKHKHDWIILVILIAIEIGLNLISPFYRYVGKDMMTDLKYPFKDNTVPIWSVPVYAVL
                     LPIIVFVCFYLKRTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRCFPD
                     GKELYDALGGVVCHGKAAEVKEGHKSFPSGHTSWSFAGLTFLSLYLSGKIKAFNNEGH
                     VAKLCLVIFPLLAACLVGISRVDDYWHHWQDVFAGALIGTLVAAFCYRQFYPNPYHEE
                     GWGPYAYFKAAQERGVPVTSSQNGDALRAMSLQMDSTSLENMESGTSTAPR"
     CDS             complement(join(107182..108114,108505..108555))
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /codon_start=1
                     /product="phosphatidic acid phosphatase 1"
                     /protein_id="ANM61752.1"
                     /db_xref="Araport:AT2G01180"
                     /db_xref="TAIR:AT2G01180"
                     /translation="MTIGSFFSSLLFWRNSQDQEAQRGRMQEIDLSVHTIKSHGGRVA
                     SKHKHDWIILVILIAIEIGLNLISPFYRYVGKDMMTDLKYPFKDNTVPIWSVPVYAVL
                     LPIIVFVCFYLKRTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRCFPD
                     GKELYDALGGVVCHGKAAEVKEGHKSFPSGHTSWSFAGLTFLSLYLSGKIKAFNNEGH
                     VAKLCLVIFPLLAACLVGISRVDDYWHHWQDVFAGALIGTLVAAFCYRQFYPNPYHEE
                     GWGPYAYFKAAQERGVPVTSSQNGDALRAMSLQMDSTSLENMESGTSTAPR"
     CDS             complement(join(107182..108114,108505..108555))
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR231468.1,INSD:DR383707.1,INSD:EL266446.1,
                     INSD:EL139101.1,INSD:DR231472.1,INSD:EH929058.1,
                     INSD:DR231471.1,INSD:AV551263.1,INSD:EG516139.1,
                     INSD:EL260246.1,INSD:BP817365.1,INSD:BP854197.1,
                     INSD:ES075455.1,INSD:BP836515.1,INSD:BP805159.1,
                     INSD:EL260518.1,INSD:EL015660.1,INSD:DR231470.1,
                     INSD:BX835431.1,INSD:EG516143.1,INSD:DR372998.1,
                     INSD:BP612139.1,INSD:DR231467.1,INSD:ES096956.1,
                     INSD:EG513579.1,INSD:EG516090.1,INSD:EL010702.1,
                     INSD:AV824728.1,INSD:BP862109.1,INSD:EL155022.1,
                     INSD:EL315725.1,INSD:EG516072.1,INSD:DR231469.1,
                     INSD:AV538892.1,INSD:AI996330.1,INSD:EG479795.1,
                     INSD:BX840561.1,INSD:AV787398.1,INSD:EL252391.1,
                     INSD:BP821380.1,INSD:BP643918.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AF412050.1,INSD:BX819590.1,INSD:AB004318.1,
                     INSD:BX820220.1,INSD:BX820958.1,INSD:BX818851.1,
                     INSD:BX818767.1,INSD:AB053949.1,INSD:AY085869.1,
                     INSD:BX819071.1,INSD:BX820540.1,INSD:AY143886.1"
                     /note="phosphatidic acid phosphatase 1 (PAP1); FUNCTIONS
                     IN: phosphatidate phosphatase activity; INVOLVED IN:
                     phospholipid metabolic process, response to stress;
                     LOCATED IN: plasma membrane, integral to plasma membrane;
                     EXPRESSED IN: 15 plant structures; EXPRESSED DURING: 8
                     growth stages; CONTAINS InterPro DOMAIN/s: Phosphatidic
                     acid phosphatase/chloroperoxidase, N-terminal
                     (InterPro:IPR016118), Phosphatidic acid phosphatase type
                     2/haloperoxidase (InterPro:IPR000326); BEST Arabidopsis
                     thaliana protein match is: lipid phosphate phosphatase 3
                     (TAIR:AT3G02600.1); Has 2118 Blast hits to 2110 proteins
                     in 392 species: Archae - 9; Bacteria - 357; Metazoa - 920;
                     Fungi - 399; Plants - 198; Viruses - 3; Other Eukaryotes -
                     232 (source: NCBI BLink)."
                     /codon_start=1
                     /product="phosphatidic acid phosphatase 1"
                     /protein_id="AEC05412.1"
                     /db_xref="Araport:AT2G01180"
                     /db_xref="TAIR:AT2G01180"
                     /translation="MTIGSFFSSLLFWRNSQDQEAQRGRMQEIDLSVHTIKSHGGRVA
                     SKHKHDWIILVILIAIEIGLNLISPFYRYVGKDMMTDLKYPFKDNTVPIWSVPVYAVL
                     LPIIVFVCFYLKRTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRCFPD
                     GKELYDALGGVVCHGKAAEVKEGHKSFPSGHTSWSFAGLTFLSLYLSGKIKAFNNEGH
                     VAKLCLVIFPLLAACLVGISRVDDYWHHWQDVFAGALIGTLVAAFCYRQFYPNPYHEE
                     GWGPYAYFKAAQERGVPVTSSQNGDALRAMSLQMDSTSLENMESGTSTAPR"
     CDS             complement(join(107182..108114,108209..108268))
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /codon_start=1
                     /product="phosphatidic acid phosphatase 1"
                     /protein_id="ANM61747.1"
                     /db_xref="Araport:AT2G01180"
                     /db_xref="TAIR:AT2G01180"
                     /translation="MNCIPLLLSSKPEMSSPNPQDQEAQRGRMQEIDLSVHTIKSHGG
                     RVASKHKHDWIILVILIAIEIGLNLISPFYRYVGKDMMTDLKYPFKDNTVPIWSVPVY
                     AVLLPIIVFVCFYLKRTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRC
                     FPDGKELYDALGGVVCHGKAAEVKEGHKSFPSGHTSWSFAGLTFLSLYLSGKIKAFNN
                     EGHVAKLCLVIFPLLAACLVGISRVDDYWHHWQDVFAGALIGTLVAAFCYRQFYPNPY
                     HEEGWGPYAYFKAAQERGVPVTSSQNGDALRAMSLQMDSTSLENMESGTSTAPR"
     CDS             complement(join(107182..108114,108209..108268))
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /codon_start=1
                     /product="phosphatidic acid phosphatase 1"
                     /protein_id="ANM61750.1"
                     /db_xref="Araport:AT2G01180"
                     /db_xref="TAIR:AT2G01180"
                     /translation="MNCIPLLLSSKPEMSSPNPQDQEAQRGRMQEIDLSVHTIKSHGG
                     RVASKHKHDWIILVILIAIEIGLNLISPFYRYVGKDMMTDLKYPFKDNTVPIWSVPVY
                     AVLLPIIVFVCFYLKRTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRC
                     FPDGKELYDALGGVVCHGKAAEVKEGHKSFPSGHTSWSFAGLTFLSLYLSGKIKAFNN
                     EGHVAKLCLVIFPLLAACLVGISRVDDYWHHWQDVFAGALIGTLVAAFCYRQFYPNPY
                     HEEGWGPYAYFKAAQERGVPVTSSQNGDALRAMSLQMDSTSLENMESGTSTAPR"
     CDS             complement(join(107182..108114,108209..108229))
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /codon_start=1
                     /product="phosphatidic acid phosphatase 1"
                     /protein_id="ANM61751.1"
                     /db_xref="Araport:AT2G01180"
                     /db_xref="TAIR:AT2G01180"
                     /translation="MSSPNPQDQEAQRGRMQEIDLSVHTIKSHGGRVASKHKHDWIIL
                     VILIAIEIGLNLISPFYRYVGKDMMTDLKYPFKDNTVPIWSVPVYAVLLPIIVFVCFY
                     LKRTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRCFPDGKELYDALGG
                     VVCHGKAAEVKEGHKSFPSGHTSWSFAGLTFLSLYLSGKIKAFNNEGHVAKLCLVIFP
                     LLAACLVGISRVDDYWHHWQDVFAGALIGTLVAAFCYRQFYPNPYHEEGWGPYAYFKA
                     AQERGVPVTSSQNGDALRAMSLQMDSTSLENMESGTSTAPR"
     CDS             complement(107182..108090)
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /codon_start=1
                     /product="phosphatidic acid phosphatase 1"
                     /protein_id="ANM61748.1"
                     /db_xref="Araport:AT2G01180"
                     /db_xref="TAIR:AT2G01180"
                     /translation="MQEIDLSVHTIKSHGGRVASKHKHDWIILVILIAIEIGLNLISP
                     FYRYVGKDMMTDLKYPFKDNTVPIWSVPVYAVLLPIIVFVCFYLKRTCVYDLHHSILG
                     LLFAVLITGVITDSIKVATGRPRPNFYWRCFPDGKELYDALGGVVCHGKAAEVKEGHK
                     SFPSGHTSWSFAGLTFLSLYLSGKIKAFNNEGHVAKLCLVIFPLLAACLVGISRVDDY
                     WHHWQDVFAGALIGTLVAAFCYRQFYPNPYHEEGWGPYAYFKAAQERGVPVTSSQNGD
                     ALRAMSLQMDSTSLENMESGTSTAPR"
     CDS             complement(107182..108090)
                     /gene="PAP1"
                     /locus_tag="AT2G01180"
                     /gene_synonym="ATLPP1"
                     /gene_synonym="ATPAP1"
                     /gene_synonym="F10A8.6"
                     /gene_synonym="F10A8_6"
                     /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
                     /gene_synonym="LPP1"
                     /gene_synonym="phosphatidic acid phosphatase 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR383707.1,INSD:BX835431.1,INSD:EL266446.1,
                     INSD:EL139101.1,INSD:EH929058.1,INSD:DR372998.1,
                     INSD:BP612139.1,INSD:EL260246.1,INSD:ES096956.1,
                     INSD:EL010702.1,INSD:DR365674.1,INSD:EL155022.1,
                     INSD:EL315725.1,INSD:ES075455.1,INSD:EG516111.1,
                     INSD:EG516049.1,INSD:AV538892.1,INSD:AI996330.1,
                     INSD:CB257205.1,INSD:EL260518.1,INSD:BX840561.1,
                     INSD:AV787398.1,INSD:BX839099.1,INSD:EL252391.1,
                     INSD:EL015660.1,INSD:BP643918.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AB053949.1,INSD:BX819931.1"
                     /note="phosphatidic acid phosphatase 1 (PAP1); FUNCTIONS
                     IN: phosphatidate phosphatase activity; INVOLVED IN:
                     phospholipid metabolic process, response to stress;
                     LOCATED IN: plasma membrane, integral to plasma membrane;
                     EXPRESSED IN: 15 plant structures; EXPRESSED DURING: 8
                     growth stages; CONTAINS InterPro DOMAIN/s: Phosphatidic
                     acid phosphatase/chloroperoxidase, N-terminal
                     (InterPro:IPR016118), Phosphatidic acid phosphatase type
                     2/haloperoxidase (InterPro:IPR000326); BEST Arabidopsis
                     thaliana protein match is: lipid phosphate phosphatase 3
                     (TAIR:AT3G02600.1); Has 35333 Blast hits to 34131 proteins
                     in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
                     974; Fungi - 991; Plants - 531; Viruses - 0; Other
                     Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="phosphatidic acid phosphatase 1"
                     /protein_id="AEC05411.1"
                     /db_xref="Araport:AT2G01180"
                     /db_xref="TAIR:AT2G01180"
                     /translation="MQEIDLSVHTIKSHGGRVASKHKHDWIILVILIAIEIGLNLISP
                     FYRYVGKDMMTDLKYPFKDNTVPIWSVPVYAVLLPIIVFVCFYLKRTCVYDLHHSILG
                     LLFAVLITGVITDSIKVATGRPRPNFYWRCFPDGKELYDALGGVVCHGKAAEVKEGHK
                     SFPSGHTSWSFAGLTFLSLYLSGKIKAFNNEGHVAKLCLVIFPLLAACLVGISRVDDY
                     WHHWQDVFAGALIGTLVAAFCYRQFYPNPYHEEGWGPYAYFKAAQERGVPVTSSQNGD
                     ALRAMSLQMDSTSLENMESGTSTAPR"
     gene            114926..117750
                     /gene="PDE331"
                     /locus_tag="AT2G01190"
                     /gene_synonym="F10A8.7"
                     /gene_synonym="F10A8_7"
                     /gene_synonym="PIGMENT DEFECTIVE 331"
                     /db_xref="Araport:AT2G01190"
                     /db_xref="TAIR:AT2G01190"
     mRNA            join(114926..116323,116435..117750)
                     /gene="PDE331"
                     /locus_tag="AT2G01190"
                     /gene_synonym="F10A8.7"
                     /gene_synonym="F10A8_7"
                     /gene_synonym="PIGMENT DEFECTIVE 331"
                     /product="Octicosapeptide/Phox/Bem1p family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP789601.1,INSD:EL079991.1,INSD:DR269780.1,
                     INSD:BP602956.1,INSD:ES031002.1,INSD:EG483777.1,
                     INSD:BX834552.1,INSD:DR269781.1,INSD:BP811662.1,
                     INSD:CB257033.1,INSD:BX834902.1,INSD:BE521962.1,
                     INSD:BE522230.1,INSD:ES151828.1,INSD:BP602009.1,
                     INSD:AV552451.1,INSD:DR269782.1,INSD:AV441115.1,
                     INSD:BP611273.1,INSD:BP784454.1,INSD:EL130889.1,
                     INSD:EL336226.1,INSD:BP601516.1,INSD:BP784097.1,
                     INSD:BP808131.1,INSD:AV829026.1,INSD:ES119245.1,
                     INSD:BX834134.1,INSD:DR372811.1,INSD:BP852413.1,
                     INSD:EH910385.1,INSD:BP619376.1,INSD:EL200482.1,
                     INSD:EL147021.1,INSD:AV548395.1,INSD:AV812606.1,
                     INSD:DR269783.1,INSD:BP669990.1,INSD:BP808565.1,
                     INSD:AI998569.1,INSD:AV519351.1,INSD:EH899005.1,
                     INSD:BX838915.1,INSD:BG459229.1,INSD:BP782577.1,
                     INSD:AV803977.1,INSD:EL325097.1,INSD:EH991165.1,
                     INSD:BP804296.1,INSD:BP611941.1,INSD:BP783513.1,
                     INSD:BP587037.1,INSD:BX837332.1,INSD:AV546420.1,
                     INSD:BX837145.1,INSD:BP785628.1,INSD:BP790921.1,
                     INSD:EL206790.1,INSD:EL205939.1,INSD:AA041057.1,
                     INSD:BP793608.1,INSD:EL193926.1,INSD:BX837663.1,
                     INSD:BP781842.1,INSD:EL299341.1,INSD:BP793703.1,
                     INSD:BX835343.1,INSD:EG483774.1,INSD:BX836870.1,
                     INSD:BX838084.1,INSD:EL045497.1,INSD:BP808851.1,
                     INSD:DR269779.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY117302.1,INSD:AY070060.1,INSD:AY085774.1,
                     INSD:BX821235.1,INSD:BX821716.1,INSD:BX842018.1"
                     /db_xref="TAIR:AT2G01190"
                     /db_xref="Araport:AT2G01190"
     CDS             join(115023..116323,116435..117296)
                     /gene="PDE331"
                     /locus_tag="AT2G01190"
                     /gene_synonym="F10A8.7"
                     /gene_synonym="F10A8_7"
                     /gene_synonym="PIGMENT DEFECTIVE 331"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP789601.1,INSD:EL079991.1,INSD:DR269780.1,
                     INSD:BP602956.1,INSD:ES031002.1,INSD:EG483777.1,
                     INSD:BX834552.1,INSD:DR269781.1,INSD:BP811662.1,
                     INSD:CB257033.1,INSD:BX834902.1,INSD:BE521962.1,
                     INSD:BE522230.1,INSD:ES151828.1,INSD:BP602009.1,
                     INSD:AV552451.1,INSD:DR269782.1,INSD:AV441115.1,
                     INSD:BP611273.1,INSD:BP784454.1,INSD:EL130889.1,
                     INSD:EL336226.1,INSD:BP601516.1,INSD:BP784097.1,
                     INSD:BP808131.1,INSD:AV829026.1,INSD:ES119245.1,
                     INSD:BX834134.1,INSD:DR372811.1,INSD:BP852413.1,
                     INSD:EH910385.1,INSD:BP619376.1,INSD:EL200482.1,
                     INSD:EL147021.1,INSD:AV548395.1,INSD:AV812606.1,
                     INSD:DR269783.1,INSD:BP669990.1,INSD:BP808565.1,
                     INSD:AI998569.1,INSD:AV519351.1,INSD:EH899005.1,
                     INSD:BX838915.1,INSD:BG459229.1,INSD:BP782577.1,
                     INSD:AV803977.1,INSD:EL325097.1,INSD:EH991165.1,
                     INSD:BP804296.1,INSD:BP611941.1,INSD:BP783513.1,
                     INSD:BP587037.1,INSD:BX837332.1,INSD:AV546420.1,
                     INSD:BX837145.1,INSD:BP785628.1,INSD:BP790921.1,
                     INSD:EL206790.1,INSD:EL205939.1,INSD:AA041057.1,
                     INSD:BP793608.1,INSD:EL193926.1,INSD:BX837663.1,
                     INSD:BP781842.1,INSD:EL299341.1,INSD:BP793703.1,
                     INSD:BX835343.1,INSD:EG483774.1,INSD:BX836870.1,
                     INSD:BX838084.1,INSD:EL045497.1,INSD:BP808851.1,
                     INSD:DR269779.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY117302.1,INSD:AY070060.1,INSD:AY085774.1,
                     INSD:BX821235.1,INSD:BX821716.1,INSD:BX842018.1"
                     /note="Octicosapeptide/Phox/Bem1p family protein; LOCATED
                     IN: cytosol, nucleus; EXPRESSED IN: 23 plant structures;
                     EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
                     DOMAIN/s: Octicosapeptide/Phox/Bem1p (InterPro:IPR000270);
                     BEST Arabidopsis thaliana protein match is:
                     Octicosapeptide/Phox/Bem1p family protein
                     (TAIR:AT3G18230.1); Has 5347 Blast hits to 4615 proteins
                     in 344 species: Archae - 4; Bacteria - 100; Metazoa -
                     2308; Fungi - 1293; Plants - 931; Viruses - 29; Other
                     Eukaryotes - 682 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Octicosapeptide/Phox/Bem1p family protein"
                     /protein_id="AEC05413.1"
                     /db_xref="Araport:AT2G01190"
                     /db_xref="TAIR:AT2G01190"
                     /translation="MEPPPSSLSSTAVASTSISAATAPVPPPLPPHVTSSYPESLDSS
                     PRSRTTDGWDDLPAPSGGGGGGGGSAVSSKLRFMCSYGGHILPRPHDKSLCYMGGDTR
                     IVVVDRNSSLPSLIARLSNTLLDGRSFTLKYQLPSEDLDSLISVTTDEDLDNMIEEYD
                     RTISASNSTKPSRLRLFLFTSKPEATQSMGQILESSAKSDDWFLNALNSAGLLNRGFS
                     DSDTNVNRLLGLDDALALRSNSGDNNNRDGDDGSVKSAKQQQPPPPQQQEQQQGGQDV
                     NCLPDSPMLDTSSSFGSTSSSPSLANLPPIRVHVEEPGGVRTLPDQRNLGIEEQFARF
                     NVGNKHQLHDDGFAAISSPPPMPVTIALPAAPVTAATVSNEFQARVYSDDERSDHGVQ
                     AGYRKPPTPRSQPQNLPPQQAHQLKSNSGGGHELPSPNSVSSDSSMSNPMFHQRPSVY
                     QEPIAQIPSGSTVVTGMINPSDPSTLLSQHQNQDPAYILHPQFEQQSAQSQPQQQFIH
                     TAAPPQYIHHHPSSGLPVPTYIQVYPSQQPQQSFHQHAGRLDQQPYPVYYVTAPVPPR
                     PYSMPVPQSPSVSDAAGSIPSNHPNSTMMPPPPNNHMRSVSSGKPEMGQAGVYTTAPG
                     VGGAQMVHQIPTNQQQFMGYSQIRHPPQSGSAGNPNYGYEYVDNAHTQIYYTQPMGHA
                     QYQTMTGPPPAMVMPDGSAAAKLPAENMTQQIRSSQPL"
     gene            117969..120095
                     /gene="IAA32"
                     /locus_tag="AT2G01200"
                     /gene_synonym="F10A8.8"
                     /gene_synonym="F10A8_8"
                     /gene_synonym="indole-3-acetic acid inducible 32"
                     /gene_synonym="maternal effect embryo arrest 10"
                     /gene_synonym="MEE10"
                     /note="Belongs to auxin inducible gene family."
                     /db_xref="Araport:AT2G01200"
                     /db_xref="TAIR:AT2G01200"
     mRNA            join(117969..118532,118636..118887,118967..119075,
                     119153..119332)
                     /gene="IAA32"
                     /locus_tag="AT2G01200"
                     /gene_synonym="F10A8.8"
                     /gene_synonym="F10A8_8"
                     /gene_synonym="indole-3-acetic acid inducible 32"
                     /gene_synonym="maternal effect embryo arrest 10"
                     /gene_synonym="MEE10"
                     /product="indole-3-acetic acid inducible 32"
                     /inference="Similar to RNA sequence, EST:INSD:AU229023.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:DQ446449.1,INSD:DQ652944.1,INSD:AY669803.1"
                     /db_xref="TAIR:AT2G01200"
                     /db_xref="Araport:AT2G01200"
     mRNA            join(118018..118174,118369..118532,118636..118887,
                     118967..119075,119153..120095)
                     /gene="IAA32"
                     /locus_tag="AT2G01200"
                     /gene_synonym="F10A8.8"
                     /gene_synonym="F10A8_8"
                     /gene_synonym="indole-3-acetic acid inducible 32"
                     /gene_synonym="maternal effect embryo arrest 10"
                     /gene_synonym="MEE10"
                     /product="indole-3-acetic acid inducible 32"
                     /inference="similar to RNA sequence, mRNA:INSD:BX821769.1"
                     /db_xref="TAIR:AT2G01200"
                     /db_xref="Araport:AT2G01200"
     CDS             join(118385..118532,118636..118887,118967..119075,
                     119153..119219)
                     /gene="IAA32"
                     /locus_tag="AT2G01200"
                     /gene_synonym="F10A8.8"
                     /gene_synonym="F10A8_8"
                     /gene_synonym="indole-3-acetic acid inducible 32"
                     /gene_synonym="maternal effect embryo arrest 10"
                     /gene_synonym="MEE10"
                     /inference="similar to RNA sequence, mRNA:INSD:BX821769.1"
                     /note="indole-3-acetic acid inducible 32 (IAA32);
                     FUNCTIONS IN: sequence-specific DNA binding transcription
                     factor activity; INVOLVED IN: response to auxin stimulus,
                     embryo development ending in seed dormancy, pollen
                     development; LOCATED IN: nucleus; CONTAINS InterPro
                     DOMAIN/s: Aux/IAA-ARF-dimerisation (InterPro:IPR011525),
                     AUX/IAA protein (InterPro:IPR003311); BEST Arabidopsis
                     thaliana protein match is: indole-3-acetic acid inducible
                     34 (TAIR:AT1G15050.1); Has 35333 Blast hits to 34131
                     proteins in 2444 species: Archae - 798; Bacteria - 22429;
                     Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
                     Other Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="indole-3-acetic acid inducible 32"
                     /protein_id="AEC05414.2"
                     /db_xref="Araport:AT2G01200"
                     /db_xref="TAIR:AT2G01200"
                     /translation="MDPNTPADFFKGSSKFHTYYSQTKKGGGVIDLGLSLRTIQHETY
                     LPPARMIGLDGYGELIDWSQPSYNSITQLKSEDTGHQRLAQGYYNNEGESRGKYAYVK
                     VNLDGLVVGRKVCLVDQGAYATLALQLNDMFGMQTVSGLRLFQTESEFSLVYRDREGI
                     WRNVGDVPWKEFVESVDRMRIARRNDALLPF"
     CDS             join(118385..118532,118636..118887,118967..119075,
                     119153..119219)
                     /gene="IAA32"
                     /locus_tag="AT2G01200"
                     /gene_synonym="F10A8.8"
                     /gene_synonym="F10A8_8"
                     /gene_synonym="indole-3-acetic acid inducible 32"
                     /gene_synonym="maternal effect embryo arrest 10"
                     /gene_synonym="MEE10"
                     /inference="Similar to RNA sequence, EST:INSD:AU229023.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:DQ446449.1,INSD:DQ652944.1,INSD:AY669803.1"
                     /note="indole-3-acetic acid inducible 32 (IAA32);
                     FUNCTIONS IN: sequence-specific DNA binding transcription
                     factor activity; INVOLVED IN: response to auxin stimulus,
                     embryo development ending in seed dormancy, pollen
                     development; LOCATED IN: nucleus; CONTAINS InterPro
                     DOMAIN/s: Aux/IAA-ARF-dimerisation (InterPro:IPR011525),
                     AUX/IAA protein (InterPro:IPR003311); BEST Arabidopsis
                     thaliana protein match is: indole-3-acetic acid inducible
                     34 (TAIR:AT1G15050.1); Has 35333 Blast hits to 34131
                     proteins in 2444 species: Archae - 798; Bacteria - 22429;
                     Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
                     Other Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="indole-3-acetic acid inducible 32"
                     /protein_id="AEC05415.1"
                     /db_xref="Araport:AT2G01200"
                     /db_xref="TAIR:AT2G01200"
                     /translation="MDPNTPADFFKGSSKFHTYYSQTKKGGGVIDLGLSLRTIQHETY
                     LPPARMIGLDGYGELIDWSQPSYNSITQLKSEDTGHQRLAQGYYNNEGESRGKYAYVK
                     VNLDGLVVGRKVCLVDQGAYATLALQLNDMFGMQTVSGLRLFQTESEFSLVYRDREGI
                     WRNVGDVPWKEFVESVDRMRIARRNDALLPF"
     gene            complement(119270..121980)
                     /locus_tag="AT2G01210"
                     /gene_synonym="F10A8.9"
                     /gene_synonym="F10A8_9"
                     /db_xref="Araport:AT2G01210"
                     /db_xref="TAIR:AT2G01210"
     mRNA            complement(join(119270..120188,120264..121980))
                     /locus_tag="AT2G01210"
                     /gene_synonym="F10A8.9"
                     /gene_synonym="F10A8_9"
                     /product="Leucine-rich repeat protein kinase family
                     protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL121332.1,INSD:BX841010.1,INSD:ES132488.1,
                     INSD:DR230258.1,INSD:EL303351.1,INSD:CK118177.1,
                     INSD:EL127750.1,INSD:BX836646.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BX820284.1"
                     /db_xref="TAIR:AT2G01210"
                     /db_xref="Araport:AT2G01210"
     CDS             complement(join(119509..120188,120264..121734))
                     /locus_tag="AT2G01210"
                     /gene_synonym="F10A8.9"
                     /gene_synonym="F10A8_9"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL121332.1,INSD:BX841010.1,INSD:ES132488.1,
                     INSD:DR230258.1,INSD:EL303351.1,INSD:CK118177.1,
                     INSD:EL127750.1,INSD:BX836646.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BX820284.1"
                     /note="Leucine-rich repeat protein kinase family protein;
                     FUNCTIONS IN: protein serine/threonine kinase activity,
                     kinase activity, ATP binding; INVOLVED IN: transmembrane
                     receptor protein tyrosine kinase signaling pathway,
                     protein amino acid phosphorylation; LOCATED IN:
                     chloroplast stroma, chloroplast, plasma membrane,
                     plant-type cell wall; EXPRESSED IN: 11 plant structures;
                     EXPRESSED DURING: 6 growth stages; CONTAINS InterPro
                     DOMAIN/s: Protein kinase, catalytic domain
                     (InterPro:IPR000719), Leucine-rich repeat-containing
                     N-terminal domain, type 2 (InterPro:IPR013210),
                     Leucine-rich repeat (InterPro:IPR001611),
                     Serine/threonine-protein kinase-like domain
                     (InterPro:IPR017442), Protein kinase-like domain
                     (InterPro:IPR011009), Serine/threonine-protein kinase,
                     active site (InterPro:IPR008271); BEST Arabidopsis
                     thaliana protein match is: Leucine-rich repeat protein
                     kinase family protein (TAIR:AT1G25320.1); Has 133812 Blast
                     hits to 98087 proteins in 4104 species: Archae - 103;
                     Bacteria - 11207; Metazoa - 34549; Fungi - 6957; Plants -
                     66297; Viruses - 188; Other Eukaryotes - 14511 (source:
                     NCBI BLink)."
                     /codon_start=1
                     /product="Leucine-rich repeat protein kinase family
                     protein"
                     /protein_id="AEC05416.1"
                     /db_xref="Araport:AT2G01210"
                     /db_xref="TAIR:AT2G01210"
                     /translation="MLASLIIFVALLCNVTVISGLNDEGFALLTFKQSVHDDPTGSLN
                     NWNSSDENACSWNGVTCKELRVVSLSIPRKNLYGSLPSSLGFLSSLRHLNLRSNRFYG
                     SLPIQLFHLQGLQSLVLYGNSFDGSLSEEIGKLKLLQTLDLSQNLFNGSLPLSILQCN
                     RLKTLDVSRNNLSGPLPDGFGSAFVSLEKLDLAFNQFNGSIPSDIGNLSNLQGTADFS
                     HNHFTGSIPPALGDLPEKVYIDLTFNNLSGPIPQTGALMNRGPTAFIGNTGLCGPPLK
                     DLCQGYQLGLNASYPFIPSNNPPEDSDSTNSETKQKSSGLSKSAVIAIVLCDVFGICL
                     VGLLFTYCYSKFCACNRENQFGVEKESKKRASECLCFRKDESETPSENVEHCDIVPLD
                     AQVAFNLEELLKASAFVLGKSGIGIVYKVVLENGLTLAVRRLGEGGSQRFKEFQTEVE
                     AIGKLKHPNIASLRAYYWSVDEKLLIYDYVSNGNLATALHGKPGMMTIAPLTWSERLR
                     IMKGIATGLVYLHEFSPKKYVHGDLKPSNILIGQDMEPKISDFGLARLANIAGGSSPT
                     IQSNRIIQTDQQPQERQQHHHKSVSSEFTAHSSSGSYYQAPETLKMVKPSQKWDVYSY
                     GIILLELIAGRSPAVEVGTSEMDLVRWVQVCIEEKKPLCDVLDPCLAPEAETEDEIVA
                     VLKIAISCVNSSPEKRPTMRHVSDTLDRLPVAGD"
     gene            complement(122882..123086)
                     /locus_tag="AT2G03905"
                     /db_xref="Araport:AT2G03905"
     ncRNA           complement(122882..123086)
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT2G03905"
                     /product="other RNA"
                     /db_xref="Araport:AT2G03905"
     gene            123023..126611
                     /locus_tag="AT2G01220"
                     /gene_synonym="AT2G01230"
                     /gene_synonym="F10A8.10"
                     /gene_synonym="F10A8_10"
                     /db_xref="Araport:AT2G01220"
                     /db_xref="TAIR:AT2G01220"
     mRNA            join(123023..123390,123483..123581,123671..123755,
                     123854..123923,124065..124125,124216..124269,
                     124551..124707,124811..124907,125274..125383,
                     125592..125698,125876..125986,126088..126611)
                     /locus_tag="AT2G01220"
                     /gene_synonym="AT2G01230"
                     /gene_synonym="F10A8.10"
                     /gene_synonym="F10A8_10"
                     /product="Nucleotidylyl transferase superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL181414.1,INSD:ES082729.1,INSD:DR379508.1,
                     INSD:AU239296.1,INSD:CF651449.1,INSD:EH819394.1,
                     INSD:AV812368.1,INSD:ES014703.1,INSD:EL122216.1,
                     INSD:EL262829.1,INSD:DR355395.1,INSD:ES175040.1,
                     INSD:EG420442.1,INSD:DR355397.1,INSD:EH911227.1,
                     INSD:EL078843.1,INSD:ES210955.1,INSD:AV819017.1,
                     INSD:CB252482.1,INSD:BP832411.1,INSD:DR289356.1,
                     INSD:ES211159.1,INSD:ES178783.1,INSD:DR289357.1,
                     INSD:ES041634.1,INSD:AU230588.1,INSD:BE037752.1,
                     INSD:AV832063.1,INSD:ES036215.1,INSD:EL036278.1,
                     INSD:DR380195.1,INSD:EG420453.1,INSD:EL011887.1,
                     INSD:BP647225.1,INSD:CF651450.1,INSD:ES210931.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AK118433.1,INSD:AK176608.1,INSD:BX842433.1,
                     INSD:AY120748.1,INSD:AK176125.1"
                     /db_xref="TAIR:AT2G01220"
                     /db_xref="Araport:AT2G01220"
     mRNA            join(123276..123390,123483..123581,123671..123755,
                     123854..123923,124065..124125,124216..124269,
                     124551..124707,124814..124907,125274..125383,
                     125592..125698,125876..125986,126088..126407)
                     /locus_tag="AT2G01220"
                     /gene_synonym="AT2G01230"
                     /gene_synonym="F10A8.10"
                     /gene_synonym="F10A8_10"
                     /product="Nucleotidylyl transferase superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES082729.1,INSD:EL181414.1,INSD:DR379508.1,
                     INSD:AU239296.1,INSD:EH819394.1,INSD:AV812368.1,
                     INSD:ES014703.1,INSD:EL262829.1,INSD:EL122216.1,
                     INSD:DR355395.1,INSD:ES175040.1,INSD:EG420442.1,
                     INSD:DR355397.1,INSD:EL078843.1,INSD:ES210955.1,
                     INSD:AV819017.1,INSD:BP832411.1,INSD:DR289356.1,
                     INSD:ES211159.1,INSD:ES178783.1,INSD:ES041634.1,
                     INSD:AU230588.1,INSD:BE037752.1,INSD:ES036215.1,
                     INSD:AV832063.1,INSD:EL036278.1,INSD:DR380195.1,
                     INSD:EG420453.1,INSD:EL011887.1,INSD:BP647225.1,
                     INSD:ES210931.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AY084877.1"
                     /db_xref="TAIR:AT2G01220"
                     /db_xref="Araport:AT2G01220"
     CDS             join(123301..123390,123483..123581,123671..123755,
                     123854..123923,124065..124125,124216..124269,
                     124551..124707,124811..124907,125274..125383,
                     125592..125698,125876..125986,126088..126213)
                     /locus_tag="AT2G01220"
                     /gene_synonym="AT2G01230"
                     /gene_synonym="F10A8.10"
                     /gene_synonym="F10A8_10"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL181414.1,INSD:ES082729.1,INSD:DR379508.1,
                     INSD:AU239296.1,INSD:CF651449.1,INSD:EH819394.1,
                     INSD:AV812368.1,INSD:ES014703.1,INSD:EL122216.1,
                     INSD:EL262829.1,INSD:DR355395.1,INSD:ES175040.1,
                     INSD:EG420442.1,INSD:DR355397.1,INSD:EH911227.1,
                     INSD:EL078843.1,INSD:ES210955.1,INSD:AV819017.1,
                     INSD:CB252482.1,INSD:BP832411.1,INSD:DR289356.1,
                     INSD:ES211159.1,INSD:ES178783.1,INSD:DR289357.1,
                     INSD:ES041634.1,INSD:AU230588.1,INSD:BE037752.1,
                     INSD:AV832063.1,INSD:ES036215.1,INSD:EL036278.1,
                     INSD:DR380195.1,INSD:EG420453.1,INSD:EL011887.1,
                     INSD:BP647225.1,INSD:CF651450.1,INSD:ES210931.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AK118433.1,INSD:AK176608.1,INSD:BX842433.1,
                     INSD:AY120748.1,INSD:AK176125.1"
                     /note="Nucleotidylyl transferase superfamily protein;
                     FUNCTIONS IN: nucleotidyltransferase activity; INVOLVED
                     IN: biosynthetic process; LOCATED IN: chloroplast
                     envelope; EXPRESSED IN: 23 plant structures; EXPRESSED
                     DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
                     Rossmann-like alpha/beta/alpha sandwich fold
                     (InterPro:IPR014729), Cytidylyltransferase
                     (InterPro:IPR004820); BEST Arabidopsis thaliana protein
                     match is: Nucleotidylyl transferase superfamily protein
                     (TAIR:AT3G27610.1); Has 429 Blast hits to 422 proteins in
                     57 species: Archae - 6; Bacteria - 30; Metazoa - 0; Fungi
                     - 7; Plants - 76; Viruses - 0; Other Eukaryotes - 310
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="Nucleotidylyl transferase superfamily protein"
                     /protein_id="AEC05417.1"
                     /db_xref="Araport:AT2G01220"
                     /db_xref="TAIR:AT2G01220"
                     /translation="MGDAAIRTVVEAIHSSPTQAVVYLCGGASLALGWLMSVPGASNT
                     LLESVVPYSRVSMVQLLGRVPSQHCSQALAKEMALLAYNRALKLSKPGYPVLGVGFTG
                     SLVTSRPKRGDHRFFLSMRASDRILESSVTLTKNLRSREEEDKVSSCALIQAMAKACQ
                     VSGTLDSGLTESEVPYESETHFTEEQELEQLINGHLCCKIYPFSGEAHGSDEDRKIIL
                     PGSFNPLHEGHLKLLEVAMSVCGGGYPCFEISAINADKPPLTIAQIKDRVKQFEVVGK
                     TIIVSNQPYFYKKAELFPGSSFVIGADTAARLVNPKYYEGSIKRMLEILGDCKRTGCT
                     FLVGGRNVDGVFKVLEDVDIPEEIIDMFISIPADIFRMDISSTEIRKKQGGGTN"
     CDS             join(123301..123390,123483..123581,123671..123755,
                     123854..123923,124065..124125,124216..124269,
                     124551..124707,124814..124907,125274..125383,
                     125592..125698,125876..125986,126088..126213)
                     /locus_tag="AT2G01220"
                     /gene_synonym="AT2G01230"
                     /gene_synonym="F10A8.10"
                     /gene_synonym="F10A8_10"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES082729.1,INSD:EL181414.1,INSD:DR379508.1,
                     INSD:AU239296.1,INSD:EH819394.1,INSD:AV812368.1,
                     INSD:ES014703.1,INSD:EL262829.1,INSD:EL122216.1,
                     INSD:DR355395.1,INSD:ES175040.1,INSD:EG420442.1,
                     INSD:DR355397.1,INSD:EL078843.1,INSD:ES210955.1,
                     INSD:AV819017.1,INSD:BP832411.1,INSD:DR289356.1,
                     INSD:ES211159.1,INSD:ES178783.1,INSD:ES041634.1,
                     INSD:AU230588.1,INSD:BE037752.1,INSD:ES036215.1,
                     INSD:AV832063.1,INSD:EL036278.1,INSD:DR380195.1,
                     INSD:EG420453.1,INSD:EL011887.1,INSD:BP647225.1,
                     INSD:ES210931.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AY084877.1"
                     /note="Nucleotidylyl transferase superfamily protein;
                     FUNCTIONS IN: nucleotidyltransferase activity; INVOLVED
                     IN: biosynthetic process; LOCATED IN: chloroplast
                     envelope; EXPRESSED IN: 23 plant structures; EXPRESSED
                     DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
                     Rossmann-like alpha/beta/alpha sandwich fold
                     (InterPro:IPR014729), Cytidylyltransferase
                     (InterPro:IPR004820); BEST Arabidopsis thaliana protein
                     match is: Nucleotidylyl transferase superfamily protein
                     (TAIR:AT3G27610.2); Has 432 Blast hits to 425 proteins in
                     57 species: Archae - 6; Bacteria - 30; Metazoa - 0; Fungi
                     - 7; Plants - 78; Viruses - 0; Other Eukaryotes - 311
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="Nucleotidylyl transferase superfamily protein"
                     /protein_id="AEC05418.1"
                     /db_xref="Araport:AT2G01220"
                     /db_xref="TAIR:AT2G01220"
                     /translation="MGDAAIRTVVEAIHSSPTQAVVYLCGGASLALGWLMSVPGASNT
                     LLESVVPYSRVSMVQLLGRVPSQHCSQALAKEMALLAYNRALKLSKPGYPVLGVGFTG
                     SLVTSRPKRGDHRFFLSMRASDRILESSVTLTKNLRSREEEDKVSSCALIQAMAKACQ
                     VSGTLDSGLTESEVPYESETHFTEEQELEQLINGHLCCKIYPFSGAHGSDEDRKIILP
                     GSFNPLHEGHLKLLEVAMSVCGGGYPCFEISAINADKPPLTIAQIKDRVKQFEVVGKT
                     IIVSNQPYFYKKAELFPGSSFVIGADTAARLVNPKYYEGSIKRMLEILGDCKRTGCTF
                     LVGGRNVDGVFKVLEDVDIPEEIIDMFISIPADIFRMDISSTEIRKKQGGGTN"
     gene            complement(128291..129132)
                     /locus_tag="AT2G01240"
                     /gene_synonym="F10A8.12"
                     /gene_synonym="F10A8_12"
                     /db_xref="Araport:AT2G01240"
                     /db_xref="TAIR:AT2G01240"
     mRNA            complement(join(128291..128594,128706..128775,
                     128863..128992,129083..129132))
                     /locus_tag="AT2G01240"
                     /gene_synonym="F10A8.12"
                     /gene_synonym="F10A8_12"
                     /product="reticulon-like protein B15"
                     /inference="Similar to RNA sequence, EST:INSD:AY164889.1"
                     /db_xref="TAIR:AT2G01240"
                     /db_xref="Araport:AT2G01240"
     CDS             complement(join(128440..128594,128706..128775,
                     128863..128992,129083..129132))
                     /locus_tag="AT2G01240"
                     /gene_synonym="F10A8.12"
                     /gene_synonym="F10A8_12"
                     /inference="Similar to RNA sequence, EST:INSD:AY164889.1"
                     /note="Reticulon family protein; INVOLVED IN:
                     biological_process unknown; LOCATED IN: endoplasmic
                     reticulum; CONTAINS InterPro DOMAIN/s: Reticulon
                     (InterPro:IPR003388); BEST Arabidopsis thaliana protein
                     match is: VIRB2-interacting protein 2 (TAIR:AT4G11220.1);
                     Has 375 Blast hits to 375 proteins in 24 species: Archae -
                     0; Bacteria - 0; Metazoa - 12; Fungi - 5; Plants - 358;
                     Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="reticulon-like protein B15"
                     /protein_id="AEC05419.2"
                     /db_xref="Araport:AT2G01240"
                     /db_xref="TAIR:AT2G01240"
                     /translation="MLILFLWAKFGEVFFTRRPPTPEELNQPDSPLKALFSMMEGHLL
                     MLYEIAYGKDNKTFLKTILYVAIIYNIGSYISLLTILYICLVCSMTIPVVYMQFQELI
                     DSFMGKVSEEKNNLLEVFKQVVSKIPRAPKVE"
     gene            complement(132578..134455)
                     /locus_tag="AT2G01250"
                     /gene_synonym="F10A8.13"
                     /gene_synonym="F10A8_13"
                     /db_xref="Araport:AT2G01250"
                     /db_xref="TAIR:AT2G01250"
     mRNA            complement(join(132578..133158,133258..133360,
                     133455..133534,133773..133830,133923..134020,
                     134091..134273,134359..134455))
                     /locus_tag="AT2G01250"
                     /gene_synonym="F10A8.13"
                     /gene_synonym="F10A8_13"
                     /product="Ribosomal protein L30/L7 family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR294037.1,INSD:EL011713.1,INSD:EL977623.1,
                     INSD:ES026714.1,INSD:EH838832.1,INSD:ES011960.1,
                     INSD:EL053809.1,INSD:EL998579.1,INSD:DR294022.1,
                     INSD:ES094790.1,INSD:BP856213.1,INSD:ES060724.1,
                     INSD:DR294063.1,INSD:BP648015.1,INSD:ES070866.1,
                     INSD:BP857115.1,INSD:EL186761.1,INSD:BP861753.1,
                     INSD:EL263860.1,INSD:EL152969.1,INSD:EL030479.1,
                     INSD:EL056385.1,INSD:AA721945.1,INSD:ES088203.1,
                     INSD:DR294048.1,INSD:EH815901.1,INSD:DR294046.1,
                     INSD:ES134415.1,INSD:EL303214.1,INSD:EH800433.1,
                     INSD:EL117119.1,INSD:EL256430.1,INSD:EH810910.1,
                     INSD:EL312959.1,INSD:DR294038.1,INSD:ES052352.1,
                     INSD:ES166482.1,INSD:ES091302.1,INSD:EL006631.1,
                     INSD:BP852073.1,INSD:ES180581.1,INSD:EH810985.1,
                     INSD:ES117109.1,INSD:ES200285.1,INSD:EL081272.1,
                     INSD:ES198105.1,INSD:DR294014.1,INSD:ES050026.1,
                     INSD:EL082898.1,INSD:ES105732.1,INSD:DR294062.1,
                     INSD:EL206550.1,INSD:ES058474.1,INSD:ES196094.1,
                     INSD:BP857095.1,INSD:EL186085.1,INSD:ES050871.1,
                     INSD:EL220531.1,INSD:EL988985.1,INSD:ES058306.1,
                     INSD:EH914587.1,INSD:ES134928.1,INSD:EH912604.1,
                     INSD:EL981591.1,INSD:ES025955.1,INSD:EL970618.1,
                     INSD:ES208951.1,INSD:EH930637.1,INSD:ES213030.1,
                     INSD:EL022887.1,INSD:EL260991.1,INSD:BP837411.1,
                     INSD:EH961497.1,INSD:BP798646.1,INSD:AV554308.1,
                     INSD:EL019133.1,INSD:ES206290.1,INSD:ES034298.1,
                     INSD:DR294069.1,INSD:EH887225.1,INSD:EL319090.1,
                     INSD:ES070521.1,INSD:ES040969.1,INSD:ES053058.1,
                     INSD:EL092181.1,INSD:EL147685.1,INSD:DR294047.1,
                     INSD:ES014256.1,INSD:ES095643.1,INSD:BP866065.1,
                     INSD:ES025070.1,INSD:EL133428.1,INSD:EL066831.1,
                     INSD:ES200327.1,INSD:DR294053.1,INSD:DR294065.1,
                     INSD:EH960497.1,INSD:EH991345.1,INSD:ES080601.1,
                     INSD:EL295779.1,INSD:DR294043.1,INSD:DR294036.1,
                     INSD:BP857749.1,INSD:EL024884.1,INSD:ES143570.1,
                     INSD:DR294039.1,INSD:EH879447.1,INSD:BP826121.1,
                     INSD:ES165736.1,INSD:BP816624.1,INSD:EL210222.1,
                     INSD:ES008494.1,INSD:DR294070.1,INSD:BP867728.1,
                     INSD:EL264067.1,INSD:EL968786.1,INSD:DR294058.1,
                     INSD:ES080063.1,INSD:EL299349.1,INSD:EH847004.1,
                     INSD:EL222273.1,INSD:EL967501.1,INSD:ES135813.1,
                     INSD:EL321718.1,INSD:EL233618.1,INSD:EH798337.1,
                     INSD:ES080861.1,INSD:EL038365.1,INSD:EL053881.1,
                     INSD:ES177466.1,INSD:DR294060.1,INSD:EL318633.1,
                     INSD:EL207315.1,INSD:ES208418.1,INSD:DR294015.1,
                     INSD:EH929939.1,INSD:ES180788.1,INSD:EH836441.1,
                     INSD:ES177756.1,INSD:EH797171.1,INSD:AV808973.1,
                     INSD:EL970747.1,INSD:ES081968.1,INSD:ES139374.1,
                     INSD:EG528297.1,INSD:EH894329.1,INSD:EH897148.1,
                     INSD:ES148128.1,INSD:DR294040.1,INSD:DR294049.1,
                     INSD:DR294055.1,INSD:ES154215.1,INSD:ES115044.1,
                     INSD:ES098756.1,INSD:ES122063.1,INSD:BP652097.1,
                     INSD:EL333394.1,INSD:EL176088.1,INSD:EL141947.1,
                     INSD:EL057474.1,INSD:EH889288.1,INSD:ES065545.1,
                     INSD:ES148270.1,INSD:BP853572.1,INSD:BP563400.1,
                     INSD:ES116392.1,INSD:DR294044.1,INSD:DR294024.1,
                     INSD:ES028491.1,INSD:EL235644.1,INSD:ES186244.1,
                     INSD:EH949975.1,INSD:DR294017.1,INSD:ES157117.1,
                     INSD:BP832063.1,INSD:DR294056.1,INSD:ES143628.1,
                     INSD:EL144257.1,INSD:DR294020.1,INSD:DR294071.1,
                     INSD:EH952170.1,INSD:EL985424.1,INSD:DR294032.1,
                     INSD:EL246181.1,INSD:EL240998.1,INSD:EH932082.1,
                     INSD:ES021271.1,INSD:EL166173.1,INSD:EH808115.1,
                     INSD:DR294066.1,INSD:DR294050.1,INSD:EH800860.1,
                     INSD:ES175042.1,INSD:EH956977.1,INSD:ES042054.1,
                     INSD:ES142452.1,INSD:DR294026.1,INSD:DR294067.1,
                     INSD:EH989549.1,INSD:ES131259.1,INSD:DR294031.1,
                     INSD:DR294021.1,INSD:BP866605.1,INSD:ES152992.1,
                     INSD:ES156398.1,INSD:EH890466.1,INSD:ES026094.1,
                     INSD:EH947872.1,INSD:ES152046.1,INSD:ES207408.1,
                     INSD:DR294034.1,INSD:BP847361.1,INSD:ES166765.1,
                     INSD:ES149331.1,INSD:BP815237.2,INSD:ES009072.1,
                     INSD:EH822698.1,INSD:ES105123.1,INSD:EH993369.1,
                     INSD:ES015319.1,INSD:EL155788.1,INSD:ES059353.1,
                     INSD:EL305550.1,INSD:BP851384.1,INSD:EH820802.1,
                     INSD:EL227904.1,INSD:EL334369.1,INSD:BP839811.1,
                     INSD:ES022790.1,INSD:EL188906.1,INSD:EL978120.1,
                     INSD:EG528298.1,INSD:ES093586.1,INSD:EL151921.1,
                     INSD:ES082960.1,INSD:EL080049.1,INSD:EH865375.1,
                     INSD:ES123161.1,INSD:BP800439.1,INSD:DR294016.1,
                     INSD:EH959963.1,INSD:EH983054.1,INSD:AV539599.1,
                     INSD:ES136569.1,INSD:EL217320.1,INSD:EL003883.1,
                     INSD:ES164934.1,INSD:ES173126.1,INSD:DR294045.1,
                     INSD:ES123671.1,INSD:EH950609.1,INSD:DR294027.1,
                     INSD:EL025259.1,INSD:ES015113.1,INSD:EL151918.1,
                     INSD:EL073947.1,INSD:Z33779.1,INSD:ES111041.1,
                     INSD:ES105370.1,INSD:DR294029.1,INSD:DR294025.1,
                     INSD:ES035853.1,INSD:DR294018.1,INSD:BP803963.1,
                     INSD:ES170664.1,INSD:EL124576.1,INSD:EH990450.1,
                     INSD:ES123737.1,INSD:ES216445.1,INSD:ES093626.1,
                     INSD:ES181678.1,INSD:EH938832.1,INSD:EL973263.1,
                     INSD:BP843164.1,INSD:DR294051.1,INSD:ES130214.1,
                     INSD:DR294052.1,INSD:DR294041.1,INSD:EL180253.1,
                     INSD:BP832532.1,INSD:EL145390.1,INSD:EL288802.1,
                     INSD:BP863531.1,INSD:ES151774.1,INSD:ES084181.1"
                     /db_xref="TAIR:AT2G01250"
                     /db_xref="Araport:AT2G01250"
     mRNA            complement(join(132697..133079,133258..133360,
                     133455..133534,133773..133830,133923..134020,
                     134091..134273,134359..134455))
                     /locus_tag="AT2G01250"
                     /gene_synonym="F10A8.13"
                     /gene_synonym="F10A8_13"
                     /product="Ribosomal protein L30/L7 family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR294037.1,INSD:EL289142.1,INSD:EH838832.1,
                     INSD:ES011960.1,INSD:ES094790.1,INSD:BP856213.1,
                     INSD:ES119717.1,INSD:ES060724.1,INSD:EL260357.1,
                     INSD:ES053914.1,INSD:ES070866.1,INSD:ES097877.1,
                     INSD:BP857115.1,INSD:EL186761.1,INSD:BP593542.1,
                     INSD:EL263860.1,INSD:EL030479.1,INSD:EL992584.1,
                     INSD:ES088203.1,INSD:AA721945.1,INSD:DR294048.1,
                     INSD:DR294046.1,INSD:EL303214.1,INSD:ES181879.1,
                     INSD:EL117119.1,INSD:EL256430.1,INSD:EH834840.1,
                     INSD:BP624637.1,INSD:BP633063.1,INSD:ES166482.1,
                     INSD:EL034917.1,INSD:ES091302.1,INSD:BP570454.1,
                     INSD:BP617868.1,INSD:EH876881.1,INSD:EL006631.1,
                     INSD:EH810985.1,INSD:ES180581.1,INSD:ES117109.1,
                     INSD:ES200285.1,INSD:AV832263.1,INSD:ES105732.1,
                     INSD:EL206550.1,INSD:EL186085.1,INSD:BP857095.1,
                     INSD:EL232261.1,INSD:EL169472.1,INSD:ES050871.1,
                     INSD:ES192284.1,INSD:EL981591.1,INSD:EL970618.1,
                     INSD:ES208951.1,INSD:EH930637.1,INSD:ES213030.1,
                     INSD:EL260991.1,INSD:ES168944.1,INSD:EH961497.1,
                     INSD:DR294057.1,INSD:BP579598.1,INSD:AV554308.1,
                     INSD:EL019133.1,INSD:ES034298.1,INSD:DR294069.1,
                     INSD:EL319090.1,INSD:EH887225.1,INSD:ES070521.1,
                     INSD:ES040969.1,INSD:ES053058.1,INSD:EL092181.1,
                     INSD:EL190892.1,INSD:EL147685.1,INSD:DR294047.1,
                     INSD:ES095643.1,INSD:ES020741.1,INSD:EL066831.1,
                     INSD:EL133428.1,INSD:EL021841.1,INSD:EH960497.1,
                     INSD:ES080601.1,INSD:DR294036.1,INSD:ES143570.1,
                     INSD:DR294039.1,INSD:BP664406.1,INSD:BP826121.1,
                     INSD:AV567128.1,INSD:DR294054.1,INSD:EL203865.1,
                     INSD:EL968786.1,INSD:BP867728.1,INSD:DR294070.1,
                     INSD:DR294058.1,INSD:ES080063.1,INSD:EL299349.1,
                     INSD:EH847004.1,INSD:EL222273.1,INSD:EL967501.1,
                     INSD:EL233618.1,INSD:EH798337.1,INSD:ES080861.1,
                     INSD:ES177466.1,INSD:BP660992.1,INSD:EL318633.1,
                     INSD:EL041169.1,INSD:BP580614.1,INSD:EL207315.1,
                     INSD:BP560500.2,INSD:BU635159.1,INSD:ES208418.1,
                     INSD:DR255285.1,INSD:DR294015.1,INSD:BP660459.1,
                     INSD:EH929939.1,INSD:ES180788.1,INSD:ES177756.1,
                     INSD:EH836441.1,INSD:EH797171.1,INSD:BP645966.1,
                     INSD:EL970747.1,INSD:EH894329.1,INSD:EH897148.1,
                     INSD:DR379278.1,INSD:ES107049.1,INSD:ES115044.1,
                     INSD:BP641595.1,INSD:EL057474.1,INSD:EL231114.1,
                     INSD:ES148270.1,INSD:EH891761.1,INSD:BP563400.1,
                     INSD:ES028491.1,INSD:BP623646.1,INSD:ES008857.1,
                     INSD:EH949975.1,INSD:DR294017.1,INSD:BP832063.1,
                     INSD:EL144257.1,INSD:ES192948.1,INSD:DR294020.1,
                     INSD:EL152312.1,INSD:EL985424.1,INSD:EH932082.1,
                     INSD:ES021271.1,INSD:EL166173.1,INSD:DR294066.1,
                     INSD:EH800860.1,INSD:DR294050.1,INSD:EH949171.1,
                     INSD:EH956977.1,INSD:ES175042.1,INSD:ES207300.1,
                     INSD:ES042054.1,INSD:ES091300.1,INSD:ES142452.1,
                     INSD:BP626851.1,INSD:BP787819.1,INSD:DR294026.1,
                     INSD:DR294023.1,INSD:DR294021.1,INSD:BP866605.1,
                     INSD:ES152992.1,INSD:EH890466.1,INSD:EH947872.1,
                     INSD:ES152046.1,INSD:BP584212.1,INSD:EL116898.1,
                     INSD:ES166765.1,INSD:ES149331.1,INSD:BP815237.2,
                     INSD:EH993369.1,INSD:ES015319.1,INSD:EL155788.1,
                     INSD:EH801739.1,INSD:EL305550.1,INSD:EL234268.1,
                     INSD:ES143162.1,INSD:DR372085.1,INSD:BP851384.1,
                     INSD:EL227904.1,INSD:BP839811.1,INSD:ES022790.1,
                     INSD:EH861777.1,INSD:EH869697.1,INSD:BP571087.1,
                     INSD:ES082960.1,INSD:EH865375.1,INSD:EL080049.1,
                     INSD:ES123161.1,INSD:DR294016.1,INSD:EH959963.1,
                     INSD:EL217320.1,INSD:EL003883.1,INSD:BP571214.1,
                     INSD:EH947739.1,INSD:ES173126.1,INSD:EH950609.1,
                     INSD:ES123671.1,INSD:EL025259.1,INSD:ES015113.1,
                     INSD:EH905879.1,INSD:EL073947.1,INSD:ES111041.1,
                     INSD:EL328877.1,INSD:AV784664.1,INSD:DR294029.1,
                     INSD:DR294025.1,INSD:ES136148.1,INSD:BP803963.1,
                     INSD:DR378178.1,INSD:ES170664.1,INSD:ES123737.1,
                     INSD:BP782687.1,INSD:ES109409.1,INSD:BP843164.1,
                     INSD:DR294051.1,INSD:DR294052.1,INSD:DR294041.1,
                     INSD:EL180253.1,INSD:EL145390.1,INSD:EL288802.1,
                     INSD:BP663847.1,INSD:ES204398.1,INSD:ES151774.1,
                     INSD:ES084181.1,INSD:BP589418.1,INSD:EL011713.1,
                     INSD:EL977623.1,INSD:EH819465.1,INSD:ES026714.1,
                     INSD:ES016093.1,INSD:ES175702.1,INSD:EL053809.1,
                     INSD:ES192557.1,INSD:EL252836.1,INSD:EL998579.1,
                     INSD:DR294022.1,INSD:ES138249.1,INSD:DR294063.1,
                     INSD:BP861753.1,INSD:EL152969.1,INSD:EL056385.1,
                     INSD:EH815901.1,INSD:ES209444.1,INSD:ES134415.1,
                     INSD:EH800433.1,INSD:EH810910.1,INSD:EL312959.1,
                     INSD:DR294038.1,INSD:ES052352.1,INSD:ES118326.1,
                     INSD:BP597382.1,INSD:BP852073.1,INSD:EL157374.1,
                     INSD:EL158425.1,INSD:ES184408.1,INSD:EL081272.1,
                     INSD:ES198105.1,INSD:DR294014.1,INSD:AV781647.1,
                     INSD:ES050026.1,INSD:BP567362.1,INSD:BP627919.1,
                     INSD:EL082898.1,INSD:AV820893.1,INSD:DR294062.1,
                     INSD:ES058474.1,INSD:ES196094.1,INSD:EL220531.1,
                     INSD:EL988985.1,INSD:EL108470.1,INSD:ES058306.1,
                     INSD:EH914587.1,INSD:ES134928.1,INSD:ES149935.1,
                     INSD:EH912604.1,INSD:ES025955.1,INSD:AV819713.1,
                     INSD:EL022887.1,INSD:BP837411.1,INSD:BP663013.1,
                     INSD:BP798646.1,INSD:ES206290.1,INSD:EL236840.1,
                     INSD:EH799627.1,INSD:EL290846.1,INSD:BP661431.1,
                     INSD:ES014256.1,INSD:ES025070.1,INSD:BP866065.1,
                     INSD:ES200327.1,INSD:DR294053.1,INSD:DR294065.1,
                     INSD:EH991345.1,INSD:EL295779.1,INSD:BP649138.1,
                     INSD:DR294043.1,INSD:BP857749.1,INSD:EL024884.1,
                     INSD:AI997918.1,INSD:EH879447.1,INSD:ES165736.1,
                     INSD:EL210222.1,INSD:ES008494.1,INSD:BP816624.1,
                     INSD:EL264067.1,INSD:CA781593.1,INSD:ES135813.1,
                     INSD:EL321718.1,INSD:AV804294.1,INSD:EL038365.1,
                     INSD:EL053881.1,INSD:BP606037.1,INSD:DR294060.1,
                     INSD:BP661923.1,INSD:BP577569.1,INSD:EL270271.1,
                     INSD:AV808973.1,INSD:EL102002.1,INSD:AV823657.1,
                     INSD:BP601736.1,INSD:ES081968.1,INSD:ES139374.1,
                     INSD:EG528297.1,INSD:ES148128.1,INSD:BP627782.1,
                     INSD:DR294040.1,INSD:DR294049.1,INSD:DR294055.1,
                     INSD:ES154215.1,INSD:ES098756.1,INSD:ES122063.1,
                     INSD:EL333394.1,INSD:ES046196.1,INSD:ES105024.1,
                     INSD:BP621626.1,INSD:EL176088.1,INSD:ES065545.1,
                     INSD:EH889288.1,INSD:EL141947.1,INSD:ES140070.1,
                     INSD:BP636565.1,INSD:BP853572.1,INSD:ES116392.1,
                     INSD:DR294044.1,INSD:DR294024.1,INSD:ES186244.1,
                     INSD:EL235644.1,INSD:EL195093.1,INSD:ES157117.1,
                     INSD:DR294056.1,INSD:ES143628.1,INSD:EL039900.1,
                     INSD:DR294071.1,INSD:EH952170.1,INSD:DR294032.1,
                     INSD:BP596256.1,INSD:EL246181.1,INSD:EL240998.1,
                     INSD:ES017502.1,INSD:EL247898.1,INSD:ES155492.1,
                     INSD:BP633614.1,INSD:EH808115.1,INSD:BP649171.1,
                     INSD:AV538194.1,INSD:DR294067.1,INSD:EH989549.1,
                     INSD:ES131259.1,INSD:BP635425.1,INSD:DR294031.1,
                     INSD:ES156398.1,INSD:ES026094.1,INSD:BP631627.1,
                     INSD:AV539940.1,INSD:ES207408.1,INSD:DR294034.1,
                     INSD:EL245459.1,INSD:BP847361.1,INSD:BP818439.1,
                     INSD:EH958211.1,INSD:ES009072.1,INSD:EH822698.1,
                     INSD:ES105123.1,INSD:EL092904.1,INSD:ES059353.1,
                     INSD:EH820802.1,INSD:ES038209.1,INSD:BP646219.1,
                     INSD:EL334369.1,INSD:BP634245.1,INSD:EL188906.1,
                     INSD:AV557005.1,INSD:EL978120.1,INSD:EG528298.1,
                     INSD:ES093586.1,INSD:EL151921.1,INSD:BP630233.1,
                     INSD:EL253052.1,INSD:BP800439.1,INSD:BP574113.1,
                     INSD:EH983054.1,INSD:BP661461.1,INSD:AV539599.1,
                     INSD:ES136569.1,INSD:ES164934.1,INSD:DR294045.1,
                     INSD:DR294027.1,INSD:EL151918.1,INSD:Z33779.1,
                     INSD:ES105370.1,INSD:ES035853.1,INSD:DR294018.1,
                     INSD:AV832224.1,INSD:EH990450.1,INSD:EL124576.1,
                     INSD:EL051488.1,INSD:AV521734.1,INSD:AM111229.1,
                     INSD:ES216445.1,INSD:ES093626.1,INSD:ES181678.1,
                     INSD:EL240454.1,INSD:EH938832.1,INSD:EL973263.1,
                     INSD:ES032293.1,INSD:ES130214.1,INSD:BP832532.1,
                     INSD:BP863531.1,INSD:BP592665.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY081698.1,INSD:BX818796.1,INSD:AY045994.1,
                     INSD:AF370484.1,INSD:AY085139.1,INSD:AY079328.1"
                     /db_xref="TAIR:AT2G01250"
                     /db_xref="Araport:AT2G01250"
     CDS             complement(join(132943..133158,133258..133360,
                     133455..133534,133773..133830,133923..134020,
                     134091..134264))
                     /locus_tag="AT2G01250"
                     /gene_synonym="F10A8.13"
                     /gene_synonym="F10A8_13"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR294037.1,INSD:EL289142.1,INSD:EH838832.1,
                     INSD:ES011960.1,INSD:ES094790.1,INSD:BP856213.1,
                     INSD:ES119717.1,INSD:ES060724.1,INSD:EL260357.1,
                     INSD:ES053914.1,INSD:ES070866.1,INSD:ES097877.1,
                     INSD:BP857115.1,INSD:EL186761.1,INSD:BP593542.1,
                     INSD:EL263860.1,INSD:EL030479.1,INSD:EL992584.1,
                     INSD:ES088203.1,INSD:AA721945.1,INSD:DR294048.1,
                     INSD:DR294046.1,INSD:EL303214.1,INSD:ES181879.1,
                     INSD:EL117119.1,INSD:EL256430.1,INSD:EH834840.1,
                     INSD:BP624637.1,INSD:BP633063.1,INSD:ES166482.1,
                     INSD:EL034917.1,INSD:ES091302.1,INSD:BP570454.1,
                     INSD:BP617868.1,INSD:EH876881.1,INSD:EL006631.1,
                     INSD:EH810985.1,INSD:ES180581.1,INSD:ES117109.1,
                     INSD:ES200285.1,INSD:AV832263.1,INSD:ES105732.1,
                     INSD:EL206550.1,INSD:EL186085.1,INSD:BP857095.1,
                     INSD:EL232261.1,INSD:EL169472.1,INSD:ES050871.1,
                     INSD:ES192284.1,INSD:EL981591.1,INSD:EL970618.1,
                     INSD:ES208951.1,INSD:EH930637.1,INSD:ES213030.1,
                     INSD:EL260991.1,INSD:ES168944.1,INSD:EH961497.1,
                     INSD:DR294057.1,INSD:BP579598.1,INSD:AV554308.1,
                     INSD:EL019133.1,INSD:ES034298.1,INSD:DR294069.1,
                     INSD:EL319090.1,INSD:EH887225.1,INSD:ES070521.1,
                     INSD:ES040969.1,INSD:ES053058.1,INSD:EL092181.1,
                     INSD:EL190892.1,INSD:EL147685.1,INSD:DR294047.1,
                     INSD:ES095643.1,INSD:ES020741.1,INSD:EL066831.1,
                     INSD:EL133428.1,INSD:EL021841.1,INSD:EH960497.1,
                     INSD:ES080601.1,INSD:DR294036.1,INSD:ES143570.1,
                     INSD:DR294039.1,INSD:BP664406.1,INSD:BP826121.1,
                     INSD:AV567128.1,INSD:DR294054.1,INSD:EL203865.1,
                     INSD:EL968786.1,INSD:BP867728.1,INSD:DR294070.1,
                     INSD:DR294058.1,INSD:ES080063.1,INSD:EL299349.1,
                     INSD:EH847004.1,INSD:EL222273.1,INSD:EL967501.1,
                     INSD:EL233618.1,INSD:EH798337.1,INSD:ES080861.1,
                     INSD:ES177466.1,INSD:BP660992.1,INSD:EL318633.1,
                     INSD:EL041169.1,INSD:BP580614.1,INSD:EL207315.1,
                     INSD:BP560500.2,INSD:BU635159.1,INSD:ES208418.1,
                     INSD:DR255285.1,INSD:DR294015.1,INSD:BP660459.1,
                     INSD:EH929939.1,INSD:ES180788.1,INSD:ES177756.1,
                     INSD:EH836441.1,INSD:EH797171.1,INSD:BP645966.1,
                     INSD:EL970747.1,INSD:EH894329.1,INSD:EH897148.1,
                     INSD:DR379278.1,INSD:ES107049.1,INSD:ES115044.1,
                     INSD:BP641595.1,INSD:EL057474.1,INSD:EL231114.1,
                     INSD:ES148270.1,INSD:EH891761.1,INSD:BP563400.1,
                     INSD:ES028491.1,INSD:BP623646.1,INSD:ES008857.1,
                     INSD:EH949975.1,INSD:DR294017.1,INSD:BP832063.1,
                     INSD:EL144257.1,INSD:ES192948.1,INSD:DR294020.1,
                     INSD:EL152312.1,INSD:EL985424.1,INSD:EH932082.1,
                     INSD:ES021271.1,INSD:EL166173.1,INSD:DR294066.1,
                     INSD:EH800860.1,INSD:DR294050.1,INSD:EH949171.1,
                     INSD:EH956977.1,INSD:ES175042.1,INSD:ES207300.1,
                     INSD:ES042054.1,INSD:ES091300.1,INSD:ES142452.1,
                     INSD:BP626851.1,INSD:BP787819.1,INSD:DR294026.1,
                     INSD:DR294023.1,INSD:DR294021.1,INSD:BP866605.1,
                     INSD:ES152992.1,INSD:EH890466.1,INSD:EH947872.1,
                     INSD:ES152046.1,INSD:BP584212.1,INSD:EL116898.1,
                     INSD:ES166765.1,INSD:ES149331.1,INSD:BP815237.2,
                     INSD:EH993369.1,INSD:ES015319.1,INSD:EL155788.1,
                     INSD:EH801739.1,INSD:EL305550.1,INSD:EL234268.1,
                     INSD:ES143162.1,INSD:DR372085.1,INSD:BP851384.1,
                     INSD:EL227904.1,INSD:BP839811.1,INSD:ES022790.1,
                     INSD:EH861777.1,INSD:EH869697.1,INSD:BP571087.1,
                     INSD:ES082960.1,INSD:EH865375.1,INSD:EL080049.1,
                     INSD:ES123161.1,INSD:DR294016.1,INSD:EH959963.1,
                     INSD:EL217320.1,INSD:EL003883.1,INSD:BP571214.1,
                     INSD:EH947739.1,INSD:ES173126.1,INSD:EH950609.1,
                     INSD:ES123671.1,INSD:EL025259.1,INSD:ES015113.1,
                     INSD:EH905879.1,INSD:EL073947.1,INSD:ES111041.1,
                     INSD:EL328877.1,INSD:AV784664.1,INSD:DR294029.1,
                     INSD:DR294025.1,INSD:ES136148.1,INSD:BP803963.1,
                     INSD:DR378178.1,INSD:ES170664.1,INSD:ES123737.1,
                     INSD:BP782687.1,INSD:ES109409.1,INSD:BP843164.1,
                     INSD:DR294051.1,INSD:DR294052.1,INSD:DR294041.1,
                     INSD:EL180253.1,INSD:EL145390.1,INSD:EL288802.1,
                     INSD:BP663847.1,INSD:ES204398.1,INSD:ES151774.1,
                     INSD:ES084181.1,INSD:BP589418.1,INSD:EL011713.1,
                     INSD:EL977623.1,INSD:EH819465.1,INSD:ES026714.1,
                     INSD:ES016093.1,INSD:ES175702.1,INSD:EL053809.1,
                     INSD:ES192557.1,INSD:EL252836.1,INSD:EL998579.1,
                     INSD:DR294022.1,INSD:ES138249.1,INSD:DR294063.1,
                     INSD:BP861753.1,INSD:EL152969.1,INSD:EL056385.1,
                     INSD:EH815901.1,INSD:ES209444.1,INSD:ES134415.1,
                     INSD:EH800433.1,INSD:EH810910.1,INSD:EL312959.1,
                     INSD:DR294038.1,INSD:ES052352.1,INSD:ES118326.1,
                     INSD:BP597382.1,INSD:BP852073.1,INSD:EL157374.1,
                     INSD:EL158425.1,INSD:ES184408.1,INSD:EL081272.1,
                     INSD:ES198105.1,INSD:DR294014.1,INSD:AV781647.1,
                     INSD:ES050026.1,INSD:BP567362.1,INSD:BP627919.1,
                     INSD:EL082898.1,INSD:AV820893.1,INSD:DR294062.1,
                     INSD:ES058474.1,INSD:ES196094.1,INSD:EL220531.1,
                     INSD:EL988985.1,INSD:EL108470.1,INSD:ES058306.1,
                     INSD:EH914587.1,INSD:ES134928.1,INSD:ES149935.1,
                     INSD:EH912604.1,INSD:ES025955.1,INSD:AV819713.1,
                     INSD:EL022887.1,INSD:BP837411.1,INSD:BP663013.1,
                     INSD:BP798646.1,INSD:ES206290.1,INSD:EL236840.1,
                     INSD:EH799627.1,INSD:EL290846.1,INSD:BP661431.1,
                     INSD:ES014256.1,INSD:ES025070.1,INSD:BP866065.1,
                     INSD:ES200327.1,INSD:DR294053.1,INSD:DR294065.1,
                     INSD:EH991345.1,INSD:EL295779.1,INSD:BP649138.1,
                     INSD:DR294043.1,INSD:BP857749.1,INSD:EL024884.1,
                     INSD:AI997918.1,INSD:EH879447.1,INSD:ES165736.1,
                     INSD:EL210222.1,INSD:ES008494.1,INSD:BP816624.1,
                     INSD:EL264067.1,INSD:CA781593.1,INSD:ES135813.1,
                     INSD:EL321718.1,INSD:AV804294.1,INSD:EL038365.1,
                     INSD:EL053881.1,INSD:BP606037.1,INSD:DR294060.1,
                     INSD:BP661923.1,INSD:BP577569.1,INSD:EL270271.1,
                     INSD:AV808973.1,INSD:EL102002.1,INSD:AV823657.1,
                     INSD:BP601736.1,INSD:ES081968.1,INSD:ES139374.1,
                     INSD:EG528297.1,INSD:ES148128.1,INSD:BP627782.1,
                     INSD:DR294040.1,INSD:DR294049.1,INSD:DR294055.1,
                     INSD:ES154215.1,INSD:ES098756.1,INSD:ES122063.1,
                     INSD:EL333394.1,INSD:ES046196.1,INSD:ES105024.1,
                     INSD:BP621626.1,INSD:EL176088.1,INSD:ES065545.1,
                     INSD:EH889288.1,INSD:EL141947.1,INSD:ES140070.1,
                     INSD:BP636565.1,INSD:BP853572.1,INSD:ES116392.1,
                     INSD:DR294044.1,INSD:DR294024.1,INSD:ES186244.1,
                     INSD:EL235644.1,INSD:EL195093.1,INSD:ES157117.1,
                     INSD:DR294056.1,INSD:ES143628.1,INSD:EL039900.1,
                     INSD:DR294071.1,INSD:EH952170.1,INSD:DR294032.1,
                     INSD:BP596256.1,INSD:EL246181.1,INSD:EL240998.1,
                     INSD:ES017502.1,INSD:EL247898.1,INSD:ES155492.1,
                     INSD:BP633614.1,INSD:EH808115.1,INSD:BP649171.1,
                     INSD:AV538194.1,INSD:DR294067.1,INSD:EH989549.1,
                     INSD:ES131259.1,INSD:BP635425.1,INSD:DR294031.1,
                     INSD:ES156398.1,INSD:ES026094.1,INSD:BP631627.1,
                     INSD:AV539940.1,INSD:ES207408.1,INSD:DR294034.1,
                     INSD:EL245459.1,INSD:BP847361.1,INSD:BP818439.1,
                     INSD:EH958211.1,INSD:ES009072.1,INSD:EH822698.1,
                     INSD:ES105123.1,INSD:EL092904.1,INSD:ES059353.1,
                     INSD:EH820802.1,INSD:ES038209.1,INSD:BP646219.1,
                     INSD:EL334369.1,INSD:BP634245.1,INSD:EL188906.1,
                     INSD:AV557005.1,INSD:EL978120.1,INSD:EG528298.1,
                     INSD:ES093586.1,INSD:EL151921.1,INSD:BP630233.1,
                     INSD:EL253052.1,INSD:BP800439.1,INSD:BP574113.1,
                     INSD:EH983054.1,INSD:BP661461.1,INSD:AV539599.1,
                     INSD:ES136569.1,INSD:ES164934.1,INSD:DR294045.1,
                     INSD:DR294027.1,INSD:EL151918.1,INSD:Z33779.1,
                     INSD:ES105370.1,INSD:ES035853.1,INSD:DR294018.1,
                     INSD:AV832224.1,INSD:EH990450.1,INSD:EL124576.1,
                     INSD:EL051488.1,INSD:AV521734.1,INSD:AM111229.1,
                     INSD:ES216445.1,INSD:ES093626.1,INSD:ES181678.1,
                     INSD:EL240454.1,INSD:EH938832.1,INSD:EL973263.1,
                     INSD:ES032293.1,INSD:ES130214.1,INSD:BP832532.1,
                     INSD:BP863531.1,INSD:BP592665.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY081698.1,INSD:BX818796.1,INSD:AY045994.1,
                     INSD:AF370484.1,INSD:AY085139.1,INSD:AY079328.1"
                     /note="Ribosomal protein L30/L7 family protein; FUNCTIONS
                     IN: structural constituent of ribosome, transcription
                     regulator activity; INVOLVED IN: translation; LOCATED IN:
                     in 8 components; EXPRESSED IN: 27 plant structures;
                     EXPRESSED DURING: 14 growth stages; CONTAINS InterPro
                     DOMAIN/s: Ribosomal protein L30, N-terminal
                     (InterPro:IPR012988), Ribosomal protein L7, eukaryotic
                     (InterPro:IPR005998), Ribosomal protein L30p/L7e,
                     conserved region (InterPro:IPR000517), Ribosomal protein
                     L30, conserved site (InterPro:IPR018038), Ribosomal
                     protein L30, ferredoxin-like fold domain
                     (InterPro:IPR016082); BEST Arabidopsis thaliana protein
                     match is: Ribosomal protein L30/L7 family protein
                     (TAIR:AT3G13580.1); Has 1297 Blast hits to 1295 proteins
                     in 388 species: Archae - 210; Bacteria - 1; Metazoa - 453;
                     Fungi - 213; Plants - 195; Viruses - 0; Other Eukaryotes -
                     225 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Ribosomal protein L30/L7 family protein"
                     /protein_id="AEC05420.1"
                     /db_xref="Araport:AT2G01250"
                     /db_xref="TAIR:AT2G01250"
                     /translation="MVESKVVVPESVLKKRKREEEWALEKKQNVEAAKKKNAENRKLI
                     FKRAEQYSKEYAEKEKELISLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKI
                     LQLLRLRQIFNGVFLKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKLNHQR
                     IALTDNSIVEQALGKHGIICTEDLIHEILTVGPHFKEANNFLWPFQLKAPLGGLKKKR
                     NHYVEGGDAGNRENFINELIRRMN"
     CDS             complement(join(133038..133079,133258..133360,
                     133455..133534,133773..133830,133923..134020,
                     134091..134264))
                     /locus_tag="AT2G01250"
                     /gene_synonym="F10A8.13"
                     /gene_synonym="F10A8_13"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR294037.1,INSD:EL011713.1,INSD:EL977623.1,
                     INSD:ES026714.1,INSD:EH838832.1,INSD:ES011960.1,
                     INSD:EL053809.1,INSD:EL998579.1,INSD:DR294022.1,
                     INSD:ES094790.1,INSD:BP856213.1,INSD:ES060724.1,
                     INSD:DR294063.1,INSD:BP648015.1,INSD:ES070866.1,
                     INSD:BP857115.1,INSD:EL186761.1,INSD:BP861753.1,
                     INSD:EL263860.1,INSD:EL152969.1,INSD:EL030479.1,
                     INSD:EL056385.1,INSD:AA721945.1,INSD:ES088203.1,
                     INSD:DR294048.1,INSD:EH815901.1,INSD:DR294046.1,
                     INSD:ES134415.1,INSD:EL303214.1,INSD:EH800433.1,
                     INSD:EL117119.1,INSD:EL256430.1,INSD:EH810910.1,
                     INSD:EL312959.1,INSD:DR294038.1,INSD:ES052352.1,
                     INSD:ES166482.1,INSD:ES091302.1,INSD:EL006631.1,
                     INSD:BP852073.1,INSD:ES180581.1,INSD:EH810985.1,
                     INSD:ES117109.1,INSD:ES200285.1,INSD:EL081272.1,
                     INSD:ES198105.1,INSD:DR294014.1,INSD:ES050026.1,
                     INSD:EL082898.1,INSD:ES105732.1,INSD:DR294062.1,
                     INSD:EL206550.1,INSD:ES058474.1,INSD:ES196094.1,
                     INSD:BP857095.1,INSD:EL186085.1,INSD:ES050871.1,
                     INSD:EL220531.1,INSD:EL988985.1,INSD:ES058306.1,
                     INSD:EH914587.1,INSD:ES134928.1,INSD:EH912604.1,
                     INSD:EL981591.1,INSD:ES025955.1,INSD:EL970618.1,
                     INSD:ES208951.1,INSD:EH930637.1,INSD:ES213030.1,
                     INSD:EL022887.1,INSD:EL260991.1,INSD:BP837411.1,
                     INSD:EH961497.1,INSD:BP798646.1,INSD:AV554308.1,
                     INSD:EL019133.1,INSD:ES206290.1,INSD:ES034298.1,
                     INSD:DR294069.1,INSD:EH887225.1,INSD:EL319090.1,
                     INSD:ES070521.1,INSD:ES040969.1,INSD:ES053058.1,
                     INSD:EL092181.1,INSD:EL147685.1,INSD:DR294047.1,
                     INSD:ES014256.1,INSD:ES095643.1,INSD:BP866065.1,
                     INSD:ES025070.1,INSD:EL133428.1,INSD:EL066831.1,
                     INSD:ES200327.1,INSD:DR294053.1,INSD:DR294065.1,
                     INSD:EH960497.1,INSD:EH991345.1,INSD:ES080601.1,
                     INSD:EL295779.1,INSD:DR294043.1,INSD:DR294036.1,
                     INSD:BP857749.1,INSD:EL024884.1,INSD:ES143570.1,
                     INSD:DR294039.1,INSD:EH879447.1,INSD:BP826121.1,
                     INSD:ES165736.1,INSD:BP816624.1,INSD:EL210222.1,
                     INSD:ES008494.1,INSD:DR294070.1,INSD:BP867728.1,
                     INSD:EL264067.1,INSD:EL968786.1,INSD:DR294058.1,
                     INSD:ES080063.1,INSD:EL299349.1,INSD:EH847004.1,
                     INSD:EL222273.1,INSD:EL967501.1,INSD:ES135813.1,
                     INSD:EL321718.1,INSD:EL233618.1,INSD:EH798337.1,
                     INSD:ES080861.1,INSD:EL038365.1,INSD:EL053881.1,
                     INSD:ES177466.1,INSD:DR294060.1,INSD:EL318633.1,
                     INSD:EL207315.1,INSD:ES208418.1,INSD:DR294015.1,
                     INSD:EH929939.1,INSD:ES180788.1,INSD:EH836441.1,
                     INSD:ES177756.1,INSD:EH797171.1,INSD:AV808973.1,
                     INSD:EL970747.1,INSD:ES081968.1,INSD:ES139374.1,
                     INSD:EG528297.1,INSD:EH894329.1,INSD:EH897148.1,
                     INSD:ES148128.1,INSD:DR294040.1,INSD:DR294049.1,
                     INSD:DR294055.1,INSD:ES154215.1,INSD:ES115044.1,
                     INSD:ES098756.1,INSD:ES122063.1,INSD:BP652097.1,
                     INSD:EL333394.1,INSD:EL176088.1,INSD:EL141947.1,
                     INSD:EL057474.1,INSD:EH889288.1,INSD:ES065545.1,
                     INSD:ES148270.1,INSD:BP853572.1,INSD:BP563400.1,
                     INSD:ES116392.1,INSD:DR294044.1,INSD:DR294024.1,
                     INSD:ES028491.1,INSD:EL235644.1,INSD:ES186244.1,
                     INSD:EH949975.1,INSD:DR294017.1,INSD:ES157117.1,
                     INSD:BP832063.1,INSD:DR294056.1,INSD:ES143628.1,
                     INSD:EL144257.1,INSD:DR294020.1,INSD:DR294071.1,
                     INSD:EH952170.1,INSD:EL985424.1,INSD:DR294032.1,
                     INSD:EL246181.1,INSD:EL240998.1,INSD:EH932082.1,
                     INSD:ES021271.1,INSD:EL166173.1,INSD:EH808115.1,
                     INSD:DR294066.1,INSD:DR294050.1,INSD:EH800860.1,
                     INSD:ES175042.1,INSD:EH956977.1,INSD:ES042054.1,
                     INSD:ES142452.1,INSD:DR294026.1,INSD:DR294067.1,
                     INSD:EH989549.1,INSD:ES131259.1,INSD:DR294031.1,
                     INSD:DR294021.1,INSD:BP866605.1,INSD:ES152992.1,
                     INSD:ES156398.1,INSD:EH890466.1,INSD:ES026094.1,
                     INSD:EH947872.1,INSD:ES152046.1,INSD:ES207408.1,
                     INSD:DR294034.1,INSD:BP847361.1,INSD:ES166765.1,
                     INSD:ES149331.1,INSD:BP815237.2,INSD:ES009072.1,
                     INSD:EH822698.1,INSD:ES105123.1,INSD:EH993369.1,
                     INSD:ES015319.1,INSD:EL155788.1,INSD:ES059353.1,
                     INSD:EL305550.1,INSD:BP851384.1,INSD:EH820802.1,
                     INSD:EL227904.1,INSD:EL334369.1,INSD:BP839811.1,
                     INSD:ES022790.1,INSD:EL188906.1,INSD:EL978120.1,
                     INSD:EG528298.1,INSD:ES093586.1,INSD:EL151921.1,
                     INSD:ES082960.1,INSD:EL080049.1,INSD:EH865375.1,
                     INSD:ES123161.1,INSD:BP800439.1,INSD:DR294016.1,
                     INSD:EH959963.1,INSD:EH983054.1,INSD:AV539599.1,
                     INSD:ES136569.1,INSD:EL217320.1,INSD:EL003883.1,
                     INSD:ES164934.1,INSD:ES173126.1,INSD:DR294045.1,
                     INSD:ES123671.1,INSD:EH950609.1,INSD:DR294027.1,
                     INSD:EL025259.1,INSD:ES015113.1,INSD:EL151918.1,
                     INSD:EL073947.1,INSD:Z33779.1,INSD:ES111041.1,
                     INSD:ES105370.1,INSD:DR294029.1,INSD:DR294025.1,
                     INSD:ES035853.1,INSD:DR294018.1,INSD:BP803963.1,
                     INSD:ES170664.1,INSD:EL124576.1,INSD:EH990450.1,
                     INSD:ES123737.1,INSD:ES216445.1,INSD:ES093626.1,
                     INSD:ES181678.1,INSD:EH938832.1,INSD:EL973263.1,
                     INSD:BP843164.1,INSD:DR294051.1,INSD:ES130214.1,
                     INSD:DR294052.1,INSD:DR294041.1,INSD:EL180253.1,
                     INSD:BP832532.1,INSD:EL145390.1,INSD:EL288802.1,
                     INSD:BP863531.1,INSD:ES151774.1,INSD:ES084181.1"
                     /note="Ribosomal protein L30/L7 family protein; FUNCTIONS
                     IN: structural constituent of ribosome; INVOLVED IN:
                     translation; LOCATED IN: cytosolic large ribosomal
                     subunit, chloroplast, plasma membrane, large ribosomal
                     subunit, membrane; EXPRESSED IN: 25 plant structures;
                     EXPRESSED DURING: 14 growth stages; CONTAINS InterPro
                     DOMAIN/s: Ribosomal protein L30, N-terminal
                     (InterPro:IPR012988), Ribosomal protein L30p/L7e,
                     conserved region (InterPro:IPR000517), Ribosomal protein
                     L30, conserved site (InterPro:IPR018038), Ribosomal
                     protein L30, ferredoxin-like fold domain
                     (InterPro:IPR016082); BEST Arabidopsis thaliana protein
                     match is: Ribosomal protein L30/L7 family protein
                     (TAIR:AT3G13580.1); Has 1075 Blast hits to 1075 proteins
                     in 310 species: Archae - 55; Bacteria - 0; Metazoa - 442;
                     Fungi - 204; Plants - 182; Viruses - 0; Other Eukaryotes -
                     192 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Ribosomal protein L30/L7 family protein"
                     /protein_id="AEC05421.1"
                     /db_xref="Araport:AT2G01250"
                     /db_xref="TAIR:AT2G01250"
                     /translation="MVESKVVVPESVLKKRKREEEWALEKKQNVEAAKKKNAENRKLI
                     FKRAEQYSKEYAEKEKELISLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKI
                     LQLLRLRQIFNGVFLKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKLNHQR
                     IALTDNSIVEQPTTSFGHSSLRHH"
     gene            complement(135223..137916)
                     /locus_tag="AT2G01260"
                     /gene_synonym="F10A8.14"
                     /gene_synonym="F10A8_14"
                     /db_xref="Araport:AT2G01260"
                     /db_xref="TAIR:AT2G01260"
     mRNA            complement(join(135223..135717,135996..136087,
                     136170..136255,136623..136851,136938..137164,
                     137253..137916))
                     /locus_tag="AT2G01260"
                     /gene_synonym="F10A8.14"
                     /gene_synonym="F10A8_14"
                     /product="hypothetical protein (DUF789)"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR231737.1,INSD:EL057964.1,INSD:BP572320.1,
                     INSD:BP600925.1,INSD:EH990366.1,INSD:AV522477.1,
                     INSD:DR231738.1,INSD:EL171190.1,INSD:BP607439.1,
                     INSD:DR231743.1,INSD:DR231742.1,INSD:EL043699.1,
                     INSD:ES012010.1,INSD:EL062481.1,INSD:EL321270.1,
                     INSD:AV533382.1,INSD:DR231741.1,INSD:DR231740.1,
                     INSD:AU226714.1,INSD:BP590301.1,INSD:DR371453.1,
                     INSD:EL176718.1,INSD:AI998372.1,INSD:EL218259.1,
                     INSD:BP847570.1,INSD:DR231739.1,INSD:EH895024.1,
                     INSD:BP779285.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820926.1,INSD:BX821018.1,INSD:AK228022.1,
                     INSD:BX820932.1,INSD:BT008310.1,INSD:AY089198.1,
                     INSD:BX820505.1"
                     /db_xref="TAIR:AT2G01260"
                     /db_xref="Araport:AT2G01260"
     mRNA            complement(join(135223..135717,135996..136087,
                     136170..136851,136938..137164,137253..137916))
                     /locus_tag="AT2G01260"
                     /gene_synonym="F10A8.14"
                     /gene_synonym="F10A8_14"
                     /product="hypothetical protein (DUF789)"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL057964.1,INSD:DR231737.1,INSD:BP572320.1,
                     INSD:BP600925.1,INSD:EH990366.1,INSD:AV522477.1,
                     INSD:DR231738.1,INSD:EL171190.1,INSD:BP607439.1,
                     INSD:EL043699.1,INSD:EL062481.1,INSD:EL321270.1,
                     INSD:AV533382.1,INSD:DR231741.1,INSD:AU226714.1,
                     INSD:BP611710.1,INSD:DR231740.1,INSD:BP590301.1,
                     INSD:EL176718.1,INSD:EL218259.1,INSD:BP847570.1,
                     INSD:EH895024.1,INSD:DR231739.1,INSD:BP779285.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BX820744.1"
                     /db_xref="TAIR:AT2G01260"
                     /db_xref="Araport:AT2G01260"
     mRNA            complement(join(135227..136087,136170..136255,
                     136623..136851,136938..137164,137253..137806))
                     /locus_tag="AT2G01260"
                     /gene_synonym="F10A8.14"
                     /gene_synonym="F10A8_14"
                     /product="hypothetical protein (DUF789)"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL057964.1,INSD:DR231737.1,INSD:BP572320.1,
                     INSD:BP600925.1,INSD:EH990366.1,INSD:AV522477.1,
                     INSD:DR231738.1,INSD:BP796130.1,INSD:EL171190.1,
                     INSD:BP607439.1,INSD:ES012010.1,INSD:EL062481.1,
                     INSD:EL321270.1,INSD:AV533382.1,INSD:DR231741.1,
                     INSD:AU226714.1,INSD:DR231740.1,INSD:BP590301.1,
                     INSD:EL176718.1,INSD:AI998372.1,INSD:EL218259.1,
                     INSD:BP847570.1,INSD:EH895024.1,INSD:DR231739.1,
                     INSD:BP779285.1"
                     /db_xref="TAIR:AT2G01260"
                     /db_xref="Araport:AT2G01260"
     CDS             complement(join(135494..135717,135996..136087,
                     136170..136255,136623..136851,136938..137164,
                     137253..137504))
                     /locus_tag="AT2G01260"
                     /gene_synonym="F10A8.14"
                     /gene_synonym="F10A8_14"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR231737.1,INSD:EL057964.1,INSD:BP572320.1,
                     INSD:BP600925.1,INSD:EH990366.1,INSD:AV522477.1,
                     INSD:DR231738.1,INSD:EL171190.1,INSD:BP607439.1,
                     INSD:DR231743.1,INSD:DR231742.1,INSD:EL043699.1,
                     INSD:ES012010.1,INSD:EL062481.1,INSD:EL321270.1,
                     INSD:AV533382.1,INSD:DR231741.1,INSD:DR231740.1,
                     INSD:AU226714.1,INSD:BP590301.1,INSD:DR371453.1,
                     INSD:EL176718.1,INSD:AI998372.1,INSD:EL218259.1,
                     INSD:BP847570.1,INSD:DR231739.1,INSD:EH895024.1,
                     INSD:BP779285.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820926.1,INSD:BX821018.1,INSD:AK228022.1,
                     INSD:BX820932.1,INSD:BT008310.1,INSD:AY089198.1,
                     INSD:BX820505.1"
                     /note="Protein of unknown function (DUF789); CONTAINS
                     InterPro DOMAIN/s: Protein of unknown function DUF789
                     (InterPro:IPR008507); BEST Arabidopsis thaliana protein
                     match is: Protein of unknown function (DUF789)
                     (TAIR:AT1G15030.1); Has 265 Blast hits to 263 proteins in
                     17 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
                     0; Plants - 263; Viruses - 0; Other Eukaryotes - 2
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="hypothetical protein (DUF789)"
                     /protein_id="AEC05422.1"
                     /db_xref="Araport:AT2G01260"
                     /db_xref="TAIR:AT2G01260"
                     /translation="MLGAGFQLTRGRHGDDPFYTSAKTRRANQRIDQLRRAQSDVSNV
                     PSSAPSPHKQQLEPSDLSSSNLDRFLESVTPSVPAQFLSKTLLRERRADDDYNKLVPY
                     FVLGDIWDSFAEWSAYGTGVPLVLNNNKDRVIQYYVPSLSAIQIYAHSHALDSSLKSR
                     RPGDSSDSDFRDSSSDVSSDSDSERVSARVDCISLRDQHQEDSSSDDGEPLGSQGRLM
                     FEYLERDLPYIREPFADKVLDLAAQFPELMTLRSCDLLRSSWFSVAWYPIYRIPTGPT
                     LKDLDACFLTYHSLHTSFGGEGSEQSMSLTQPRESEKMSLPVFGLASYKFRGSLWTPI
                     GGSEHQLVNSLFQAADKWLHSCHVSHPDFLFFCRR"
     CDS             complement(join(135907..136087,136170..136255,
                     136623..136851,136938..137164,137253..137504))
                     /locus_tag="AT2G01260"
                     /gene_synonym="F10A8.14"
                     /gene_synonym="F10A8_14"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL057964.1,INSD:DR231737.1,INSD:BP572320.1,
                     INSD:BP600925.1,INSD:EH990366.1,INSD:AV522477.1,
                     INSD:DR231738.1,INSD:EL171190.1,INSD:BP607439.1,
                     INSD:EL043699.1,INSD:EL062481.1,INSD:EL321270.1,
                     INSD:AV533382.1,INSD:DR231741.1,INSD:AU226714.1,
                     INSD:BP611710.1,INSD:DR231740.1,INSD:BP590301.1,
                     INSD:EL176718.1,INSD:EL218259.1,INSD:BP847570.1,
                     INSD:EH895024.1,INSD:DR231739.1,INSD:BP779285.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BX820744.1"
                     /note="Protein of unknown function (DUF789); CONTAINS
                     InterPro DOMAIN/s: Protein of unknown function DUF789
                     (InterPro:IPR008507); BEST Arabidopsis thaliana protein
                     match is: Protein of unknown function (DUF789)
                     (TAIR:AT1G15030.1); Has 35333 Blast hits to 34131 proteins
                     in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
                     974; Fungi - 991; Plants - 531; Viruses - 0; Other
                     Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="hypothetical protein (DUF789)"
                     /protein_id="AEC05423.1"
                     /db_xref="Araport:AT2G01260"
                     /db_xref="TAIR:AT2G01260"
                     /translation="MLGAGFQLTRGRHGDDPFYTSAKTRRANQRIDQLRRAQSDVSNV
                     PSSAPSPHKQQLEPSDLSSSNLDRFLESVTPSVPAQFLSKTLLRERRADDDYNKLVPY
                     FVLGDIWDSFAEWSAYGTGVPLVLNNNKDRVIQYYVPSLSAIQIYAHSHALDSSLKSR
                     RPGDSSDSDFRDSSSDVSSDSDSERVSARVDCISLRDQHQEDSSSDDGEPLGSQGRLM
                     FEYLERDLPYIREPFADKVLDLAAQFPELMTLRSCDLLRSSWFSVAWYPIYRIPTGPT
                     LKDLDACFLTYHSLHTSFGGKPKLFYLSKQQVVGLHCSTTYTISNQNT"
     CDS             complement(join(136560..136851,136938..137164,
                     137253..137504))
                     /locus_tag="AT2G01260"
                     /gene_synonym="F10A8.14"
                     /gene_synonym="F10A8_14"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL057964.1,INSD:DR231737.1,INSD:BP572320.1,
                     INSD:BP600925.1,INSD:EH990366.1,INSD:AV522477.1,
                     INSD:DR231738.1,INSD:BP796130.1,INSD:EL171190.1,
                     INSD:BP607439.1,INSD:ES012010.1,INSD:EL062481.1,
                     INSD:EL321270.1,INSD:AV533382.1,INSD:DR231741.1,
                     INSD:AU226714.1,INSD:DR231740.1,INSD:BP590301.1,
                     INSD:EL176718.1,INSD:AI998372.1,INSD:EL218259.1,
                     INSD:BP847570.1,INSD:EH895024.1,INSD:DR231739.1,
                     INSD:BP779285.1"
                     /note="Protein of unknown function (DUF789); CONTAINS
                     InterPro DOMAIN/s: Protein of unknown function DUF789
                     (InterPro:IPR008507); BEST Arabidopsis thaliana protein
                     match is: Protein of unknown function (DUF789)
                     (TAIR:AT1G15030.1); Has 35333 Blast hits to 34131 proteins
                     in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
                     974; Fungi - 991; Plants - 531; Viruses - 0; Other
                     Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="hypothetical protein (DUF789)"
                     /protein_id="AEC05424.2"
                     /db_xref="Araport:AT2G01260"
                     /db_xref="TAIR:AT2G01260"
                     /translation="MLGAGFQLTRGRHGDDPFYTSAKTRRANQRIDQLRRAQSDVSNV
                     PSSAPSPHKQQLEPSDLSSSNLDRFLESVTPSVPAQFLSKTLLRERRADDDYNKLVPY
                     FVLGDIWDSFAEWSAYGTGVPLVLNNNKDRVIQYYVPSLSAIQIYAHSHALDSSLKSR
                     RPGDSSDSDFRDSSSDVSSDSDSERVSARVDCISLRDQHQEDSSSDDGEPLGSQGRLM
                     FEYLERDLPYIREPFADKVCAFISLLEPKAWCRYYILR"
     gene            139309..142560
                     /gene="QSOX2"
                     /locus_tag="AT2G01270"
                     /gene_synonym="AtQSOX2"
                     /gene_synonym="F10A8.15"
                     /gene_synonym="F10A8_15"
                     /gene_synonym="quiescin-sulfhydryl oxidase 2"
                     /note="Encodes a protein disulfide isomerase-like (PDIL)
                     protein, a member of a multigene family within the
                     thioredoxin (TRX) superfamily. This protein also belongs
                     to the quiescin-sulfhydryl oxidase (QSOX) family, which
                     possess an Erv1-like domain at the COOH terminus in
                     addition to a TRX domain."
                     /db_xref="Araport:AT2G01270"
                     /db_xref="TAIR:AT2G01270"
     mRNA            join(139309..139650,139916..139940,140010..140102,
                     140200..140381,140546..140615,140712..140780,
                     140861..140937,141030..141171,141255..141295,
                     141377..141523,141608..142039,142126..142560)
                     /gene="QSOX2"
                     /locus_tag="AT2G01270"
                     /gene_synonym="AtQSOX2"
                     /gene_synonym="F10A8.15"
                     /gene_synonym="F10A8_15"
                     /gene_synonym="quiescin-sulfhydryl oxidase 2"
                     /product="quiescin-sulfhydryl oxidase 2"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP837884.1,INSD:EH900279.1,INSD:BP842318.1,
                     INSD:AV785491.1,INSD:EL320859.1,INSD:ES015387.1,
                     INSD:EL180207.1,INSD:ES155146.1,INSD:BP590799.1,
                     INSD:AV821521.1,INSD:H37164.1,INSD:DR368200.1,
                     INSD:EL075624.1,INSD:AV799849.1,INSD:BP813092.1,
                     INSD:EL176493.1,INSD:BP598538.1,INSD:AA720220.1,
                     INSD:DR368201.1,INSD:EL325189.1,INSD:BX834466.1,
                     INSD:BP662993.1,INSD:BP614997.1,INSD:EL181282.1,
                     INSD:BP608741.1,INSD:BP610453.1,INSD:BP583856.1,
                     INSD:EH939382.1,INSD:EH890826.1,INSD:EH870237.1,
                     INSD:BX836846.1,INSD:EL237773.1,INSD:BP850950.1,
                     INSD:EG499726.1,INSD:EL193960.1,INSD:EL094920.1,
                     INSD:BP609292.1,INSD:ES005914.1,INSD:DR368205.1,
                     INSD:AV814161.1,INSD:T22047.1,INSD:DR368203.1,
                     INSD:BP610212.1,INSD:EH990553.1,INSD:EH813189.1,
                     INSD:EL034993.1,INSD:BP790758.1,INSD:EL190564.1,
                     INSD:AI100146.1,INSD:AV809088.1,INSD:BP609155.1,
                     INSD:EL266690.1,INSD:BP595059.1,INSD:DR368202.1,
                     INSD:ES026826.1,INSD:EL192223.1,INSD:EL328428.1,
                     INSD:AV558035.1,INSD:EL235190.1,INSD:BP777866.1,
                     INSD:EH944542.1,INSD:BP785019.1,INSD:EL999041.1,
                     INSD:BP644323.1,INSD:BP608071.1,INSD:EL171487.1,
                     INSD:EL094093.1,INSD:DR384173.1,INSD:BP841745.1,
                     INSD:AV829883.1,INSD:BP586413.1,INSD:AV525710.1,
                     INSD:BP854873.1,INSD:EG499725.1,INSD:ES017014.1,
                     INSD:AV824271.1,INSD:BP617066.1,INSD:EH918707.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT000880.1,INSD:BX819763.1,INSD:BX820234.1,
                     INSD:AY090364.1,INSD:BX820469.1,INSD:AY125539.1,
                     INSD:AY035175.1"
                     /db_xref="TAIR:AT2G01270"
                     /db_xref="Araport:AT2G01270"
     mRNA            join(139309..139940,140010..140102,140200..140381,
                     140546..140615,140712..140780,140861..140937,
                     141030..141171,141255..141295,141377..141523,
                     141608..142039,142126..142141)
                     /gene="QSOX2"
                     /locus_tag="AT2G01270"
                     /gene_synonym="AtQSOX2"
                     /gene_synonym="F10A8.15"
                     /gene_synonym="F10A8_15"
                     /gene_synonym="quiescin-sulfhydryl oxidase 2"
                     /product="quiescin-sulfhydryl oxidase 2"
                     /db_xref="Araport:AT2G01270"
                     /db_xref="TAIR:AT2G01270"
     mRNA            join(139331..139620,139716..139940,140010..140102,
                     140200..140381,140546..140615,140712..140780,
                     140861..140937,141030..141171,141255..141295,
                     141377..141523,141608..142039,142126..142141)
                     /gene="QSOX2"
                     /locus_tag="AT2G01270"
                     /gene_synonym="AtQSOX2"
                     /gene_synonym="F10A8.15"
                     /gene_synonym="F10A8_15"
                     /gene_synonym="quiescin-sulfhydryl oxidase 2"
                     /product="quiescin-sulfhydryl oxidase 2"
                     /db_xref="Araport:AT2G01270"
                     /db_xref="TAIR:AT2G01270"
     CDS             join(139457..139650,139916..139940,140010..140102,
                     140200..140381,140546..140615,140712..140780,
                     140861..140937,141030..141171,141255..141295,
                     141377..141523,141608..142039,142126..142141)
                     /gene="QSOX2"
                     /locus_tag="AT2G01270"
                     /gene_synonym="AtQSOX2"
                     /gene_synonym="F10A8.15"
                     /gene_synonym="F10A8_15"
                     /gene_synonym="quiescin-sulfhydryl oxidase 2"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP837884.1,INSD:EH900279.1,INSD:BP842318.1,
                     INSD:AV785491.1,INSD:EL320859.1,INSD:ES015387.1,
                     INSD:EL180207.1,INSD:ES155146.1,INSD:BP590799.1,
                     INSD:AV821521.1,INSD:H37164.1,INSD:DR368200.1,
                     INSD:EL075624.1,INSD:AV799849.1,INSD:BP813092.1,
                     INSD:EL176493.1,INSD:BP598538.1,INSD:AA720220.1,
                     INSD:DR368201.1,INSD:EL325189.1,INSD:BX834466.1,
                     INSD:BP662993.1,INSD:BP614997.1,INSD:EL181282.1,
                     INSD:BP608741.1,INSD:BP610453.1,INSD:BP583856.1,
                     INSD:EH939382.1,INSD:EH890826.1,INSD:EH870237.1,
                     INSD:BX836846.1,INSD:EL237773.1,INSD:BP850950.1,
                     INSD:EG499726.1,INSD:EL193960.1,INSD:EL094920.1,
                     INSD:BP609292.1,INSD:ES005914.1,INSD:DR368205.1,
                     INSD:AV814161.1,INSD:T22047.1,INSD:DR368203.1,
                     INSD:BP610212.1,INSD:EH990553.1,INSD:EH813189.1,
                     INSD:EL034993.1,INSD:BP790758.1,INSD:EL190564.1,
                     INSD:AI100146.1,INSD:AV809088.1,INSD:BP609155.1,
                     INSD:EL266690.1,INSD:BP595059.1,INSD:DR368202.1,
                     INSD:ES026826.1,INSD:EL192223.1,INSD:EL328428.1,
                     INSD:AV558035.1,INSD:EL235190.1,INSD:BP777866.1,
                     INSD:EH944542.1,INSD:BP785019.1,INSD:EL999041.1,
                     INSD:BP644323.1,INSD:BP608071.1,INSD:EL171487.1,
                     INSD:EL094093.1,INSD:DR384173.1,INSD:BP841745.1,
                     INSD:AV829883.1,INSD:BP586413.1,INSD:AV525710.1,
                     INSD:BP854873.1,INSD:EG499725.1,INSD:ES017014.1,
                     INSD:AV824271.1,INSD:BP617066.1,INSD:EH918707.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT000880.1,INSD:BX819763.1,INSD:BX820234.1,
                     INSD:AY090364.1,INSD:BX820469.1,INSD:AY125539.1,
                     INSD:AY035175.1"
                     /note="quiescin-sulfhydryl oxidase 2 (QSOX2); FUNCTIONS
                     IN: thiol oxidase activity; INVOLVED IN: oxidation
                     reduction, cell redox homeostasis; LOCATED IN: Golgi
                     apparatus; EXPRESSED IN: 24 plant structures; EXPRESSED
                     DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
                     Thioredoxin fold (InterPro:IPR012335), Erv1/Alr
                     (InterPro:IPR006863), Thioredoxin domain
                     (InterPro:IPR013766), Thioredoxin, conserved site
                     (InterPro:IPR017937), ERV/ALR sulphydryl oxidase
                     (InterPro:IPR017905), Thioredoxin-like
                     (InterPro:IPR017936), Thioredoxin-like fold
                     (InterPro:IPR012336); BEST Arabidopsis thaliana protein
                     match is: quiescin-sulfhydryl oxidase 1
                     (TAIR:AT1G15020.1); Has 2833 Blast hits to 2194 proteins
                     in 312 species: Archae - 22; Bacteria - 32; Metazoa -
                     1533; Fungi - 396; Plants - 476; Viruses - 0; Other
                     Eukaryotes - 374 (source: NCBI BLink)."
                     /codon_start=1
                     /product="quiescin-sulfhydryl oxidase 2"
                     /protein_id="AEC05425.1"
                     /db_xref="Araport:AT2G01270"
                     /db_xref="TAIR:AT2G01270"
                     /translation="MSLVHLLLFAGLVIAASSSSPGSRLILREISDQKDKAVELNTTN
                     FDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVARLFNGPDAIHPGIVLMTRVDCA
                     MKTNTKLCDKFSVSHYPMLFWGPPTKFVSGSWEPKKDKSEILVIDDGRTAERLLNWIN
                     KQIGSSYGLDDQKFKNEHALSNLTDYNQISQAVYDVEEATAEAFDIILAHKAIKSSET
                     SASFIRFIQLLAAHHLSRRCRKGAAEILVNYDDLCPSGNCSYEKSGGNDTLGNFPICG
                     KDVPRGYYMFCRGSKNDTRGFSCGLWVLMHSLSVRIEDGESHFAFTTICDFVNNFFMC
                     DECRLHFNDMCLSVKTPFKKARDFVLWVWSTHNKVNERLLKDEASLGTGDPKFPKIIW
                     PPKELCPLCYLSSNQKSIEWDHEHVYKFLKNYYGPKLVSLYKEKSVSRSKEETVSATE
                     DLTVATNALVVPIGAALAIAIASCAFGALACYWRTQQKNRKPRRR"
     CDS             join(139887..139940,140010..140102,140200..140381,
                     140546..140615,140712..140780,140861..140937,
                     141030..141171,141255..141295,141377..141523,
                     141608..142039,142126..142141)
                     /gene="QSOX2"
                     /locus_tag="AT2G01270"
                     /gene_synonym="AtQSOX2"
                     /gene_synonym="F10A8.15"
                     /gene_synonym="F10A8_15"
                     /gene_synonym="quiescin-sulfhydryl oxidase 2"
                     /codon_start=1
                     /product="quiescin-sulfhydryl oxidase 2"
                     /protein_id="ANM61904.1"
                     /db_xref="Araport:AT2G01270"
                     /db_xref="TAIR:AT2G01270"
                     /translation="MRVSFSIDSRCPACRNYKPHYEKVARLFNGPDAIHPGIVLMTRV
                     DCAMKTNTKLCDKFSVSHYPMLFWGPPTKFVSGSWEPKKDKSEILVIDDGRTAERLLN
                     WINKQIGSSYGLDDQKFKNEHALSNLTDYNQISQAVYDVEEATAEAFDIILAHKAIKS
                     SETSASFIRFIQLLAAHHLSRRCRKGAAEILVNYDDLCPSGNCSYEKSGGNDTLGNFP
                     ICGKDVPRGYYMFCRGSKNDTRGFSCGLWVLMHSLSVRIEDGESHFAFTTICDFVNNF
                     FMCDECRLHFNDMCLSVKTPFKKARDFVLWVWSTHNKVNERLLKDEASLGTGDPKFPK
                     IIWPPKELCPLCYLSSNQKSIEWDHEHVYKFLKNYYGPKLVSLYKEKSVSRSKEETVS
                     ATEDLTVATNALVVPIGAALAIAIASCAFGALACYWRTQQKNRKPRRR"
     CDS             join(139887..139940,140010..140102,140200..140381,
                     140546..140615,140712..140780,140861..140937,
                     141030..141171,141255..141295,141377..141523,
                     141608..142039,142126..142141)
                     /gene="QSOX2"
                     /locus_tag="AT2G01270"
                     /gene_synonym="AtQSOX2"
                     /gene_synonym="F10A8.15"
                     /gene_synonym="F10A8_15"
                     /gene_synonym="quiescin-sulfhydryl oxidase 2"
                     /codon_start=1
                     /product="quiescin-sulfhydryl oxidase 2"
                     /protein_id="ANM61905.1"
                     /db_xref="Araport:AT2G01270"
                     /db_xref="TAIR:AT2G01270"
                     /translation="MRVSFSIDSRCPACRNYKPHYEKVARLFNGPDAIHPGIVLMTRV
                     DCAMKTNTKLCDKFSVSHYPMLFWGPPTKFVSGSWEPKKDKSEILVIDDGRTAERLLN
                     WINKQIGSSYGLDDQKFKNEHALSNLTDYNQISQAVYDVEEATAEAFDIILAHKAIKS
                     SETSASFIRFIQLLAAHHLSRRCRKGAAEILVNYDDLCPSGNCSYEKSGGNDTLGNFP
                     ICGKDVPRGYYMFCRGSKNDTRGFSCGLWVLMHSLSVRIEDGESHFAFTTICDFVNNF
                     FMCDECRLHFNDMCLSVKTPFKKARDFVLWVWSTHNKVNERLLKDEASLGTGDPKFPK
                     IIWPPKELCPLCYLSSNQKSIEWDHEHVYKFLKNYYGPKLVSLYKEKSVSRSKEETVS
                     ATEDLTVATNALVVPIGAALAIAIASCAFGALACYWRTQQKNRKPRRR"
     gene            complement(142498..144524)
                     /locus_tag="AT2G01275"
                     /db_xref="Araport:AT2G01275"
                     /db_xref="TAIR:AT2G01275"
     mRNA            complement(join(142498..142789,142874..142954,
                     143030..143230,143408..143479,143564..143845,
                     144373..144524))
                     /locus_tag="AT2G01275"
                     /product="RING/FYVE/PHD zinc finger superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP790758.1,INSD:BP598538.1,INSD:BP617066.1,
                     INSD:AV814161.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT012639.1,INSD:BX819618.1"
                     /db_xref="TAIR:AT2G01275"
                     /db_xref="Araport:AT2G01275"
     mRNA            complement(join(142499..142789,142874..142954,
                     143030..143230,143408..143479,143564..143845,
                     144217..144389))
                     /locus_tag="AT2G01275"
                     /product="RING/FYVE/PHD zinc finger superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP790758.1,INSD:BP598538.1,INSD:BP617066.1,
                     INSD:CK118118.1,INSD:AV814161.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BT012639.1"
                     /db_xref="TAIR:AT2G01275"
                     /db_xref="Araport:AT2G01275"
     mRNA            complement(join(142610..142789,142874..142954,
                     143030..143230,143408..143479,143564..143845,
                     144070..144136,144217..144524))
                     /locus_tag="AT2G01275"
                     /product="RING/FYVE/PHD zinc finger superfamily protein"
                     /db_xref="Araport:AT2G01275"
                     /db_xref="TAIR:AT2G01275"
     mRNA            complement(join(142610..142789,142874..142954,
                     143030..143230,143408..143479,143564..144136,
                     144217..144524))
                     /locus_tag="AT2G01275"
                     /product="RING/FYVE/PHD zinc finger superfamily protein"
                     /db_xref="Araport:AT2G01275"
                     /db_xref="TAIR:AT2G01275"
     mRNA            complement(join(142610..142789,142874..142954,
                     143030..143230,143408..143479,143564..144038))
                     /locus_tag="AT2G01275"
                     /product="RING/FYVE/PHD zinc finger superfamily protein"
                     /db_xref="Araport:AT2G01275"
                     /db_xref="TAIR:AT2G01275"
     CDS             complement(join(142610..142789,142874..142954,
                     143030..143230,143408..143479,143564..143887))
                     /locus_tag="AT2G01275"
                     /codon_start=1
                     /product="RING/FYVE/PHD zinc finger superfamily protein"
                     /protein_id="ANM61906.1"
                     /db_xref="Araport:AT2G01275"
                     /db_xref="TAIR:AT2G01275"
                     /translation="MQILTPTHYLSFLQLHVSFYTVRTENMGDHFVLLVDRLITESTI
                     EAAIQSRNQMLQANIPVEECTILDDKTLEMLRNGDLSMAECRICHDEDLDSNMETPCS
                     CSGSVKYAHRRCVQRWCNEKGDTTCEICHQEFKPDYTAPPPLLELGHVPLHFRGNWGI
                     SQREHRFITVVPADSTFIDQPYPLSSTTSFICCRSLVLIFMALLILRHTLPLVLTGSN
                     LHVFPLFTLLFLRILGIMLPIYVVTKAVATCRRHSRTLDTSPSDDSSDEETDSWRLPQ
                     TQSYIIGVR"
     CDS             complement(join(142610..142789,142874..142954,
                     143030..143230,143408..143479,143564..143887))
                     /locus_tag="AT2G01275"
                     /codon_start=1
                     /product="RING/FYVE/PHD zinc finger superfamily protein"
                     /protein_id="ANM61908.1"
                     /db_xref="Araport:AT2G01275"
                     /db_xref="TAIR:AT2G01275"
                     /translation="MQILTPTHYLSFLQLHVSFYTVRTENMGDHFVLLVDRLITESTI
                     EAAIQSRNQMLQANIPVEECTILDDKTLEMLRNGDLSMAECRICHDEDLDSNMETPCS
                     CSGSVKYAHRRCVQRWCNEKGDTTCEICHQEFKPDYTAPPPLLELGHVPLHFRGNWGI
                     SQREHRFITVVPADSTFIDQPYPLSSTTSFICCRSLVLIFMALLILRHTLPLVLTGSN
                     LHVFPLFTLLFLRILGIMLPIYVVTKAVATCRRHSRTLDTSPSDDSSDEETDSWRLPQ
                     TQSYIIGVR"
     CDS             complement(join(142610..142789,142874..142954,
                     143030..143230,143408..143479,143564..143809))
                     /locus_tag="AT2G01275"
                     /codon_start=1
                     /product="RING/FYVE/PHD zinc finger superfamily protein"
                     /protein_id="ANM61907.1"
                     /db_xref="Araport:AT2G01275"
                     /db_xref="TAIR:AT2G01275"
                     /translation="MGDHFVLLVDRLITESTIEAAIQSRNQMLQANIPVEECTILDDK
                     TLEMLRNGDLSMAECRICHDEDLDSNMETPCSCSGSVKYAHRRCVQRWCNEKGDTTCE
                     ICHQEFKPDYTAPPPLLELGHVPLHFRGNWGISQREHRFITVVPADSTFIDQPYPLSS
                     TTSFICCRSLVLIFMALLILRHTLPLVLTGSNLHVFPLFTLLFLRILGIMLPIYVVTK
                     AVATCRRHSRTLDTSPSDDSSDEETDSWRLPQTQSYIIGVR"
     CDS             complement(join(142610..142789,142874..142954,
                     143030..143230,143408..143479,143564..143809))
                     /locus_tag="AT2G01275"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP790758.1,INSD:BP598538.1,INSD:BP617066.1,
                     INSD:AV814161.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT012639.1,INSD:BX819618.1"
                     /note="RING/FYVE/PHD zinc finger superfamily protein;
                     FUNCTIONS IN: zinc ion binding; CONTAINS InterPro
                     DOMAIN/s: Protein of unknown function DUF3675
                     (InterPro:IPR022143), Zinc finger, C3HC4 RING-type
                     (InterPro:IPR018957), Zinc finger, RING-CH-type
                     (InterPro:IPR011016); BEST Arabidopsis thaliana protein
                     match is: RING/FYVE/PHD zinc finger superfamily protein
                     (TAIR:AT5G38070.1); Has 30201 Blast hits to 17322 proteins
                     in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
                     17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
                     Eukaryotes - 2996 (source: NCBI BLink)."
                     /codon_start=1
                     /product="RING/FYVE/PHD zinc finger superfamily protein"
                     /protein_id="AEC05426.1"
                     /db_xref="Araport:AT2G01275"
                     /db_xref="TAIR:AT2G01275"
                     /translation="MGDHFVLLVDRLITESTIEAAIQSRNQMLQANIPVEECTILDDK
                     TLEMLRNGDLSMAECRICHDEDLDSNMETPCSCSGSVKYAHRRCVQRWCNEKGDTTCE
                     ICHQEFKPDYTAPPPLLELGHVPLHFRGNWGISQREHRFITVVPADSTFIDQPYPLSS
                     TTSFICCRSLVLIFMALLILRHTLPLVLTGSNLHVFPLFTLLFLRILGIMLPIYVVTK
                     AVATCRRHSRTLDTSPSDDSSDEETDSWRLPQTQSYIIGVR"
     CDS             complement(join(142610..142789,142874..142954,
                     143030..143230,143408..143479,143564..143809))
                     /locus_tag="AT2G01275"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP790758.1,INSD:BP598538.1,INSD:BP617066.1,
                     INSD:CK118118.1,INSD:AV814161.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BT012639.1"
                     /note="RING/FYVE/PHD zinc finger superfamily protein;
                     FUNCTIONS IN: zinc ion binding; CONTAINS InterPro
                     DOMAIN/s: Protein of unknown function DUF3675
                     (InterPro:IPR022143), Zinc finger, C3HC4 RING-type
                     (InterPro:IPR018957), Zinc finger, RING-CH-type
                     (InterPro:IPR011016); BEST Arabidopsis thaliana protein
                     match is: RING/FYVE/PHD zinc finger superfamily protein
                     (TAIR:AT5G38070.1); Has 35333 Blast hits to 34131 proteins
                     in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
                     974; Fungi - 991; Plants - 531; Viruses - 0; Other
                     Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="RING/FYVE/PHD zinc finger superfamily protein"
                     /protein_id="AEC05427.1"
                     /db_xref="Araport:AT2G01275"
                     /db_xref="TAIR:AT2G01275"
                     /translation="MGDHFVLLVDRLITESTIEAAIQSRNQMLQANIPVEECTILDDK
                     TLEMLRNGDLSMAECRICHDEDLDSNMETPCSCSGSVKYAHRRCVQRWCNEKGDTTCE
                     ICHQEFKPDYTAPPPLLELGHVPLHFRGNWGISQREHRFITVVPADSTFIDQPYPLSS
                     TTSFICCRSLVLIFMALLILRHTLPLVLTGSNLHVFPLFTLLFLRILGIMLPIYVVTK
                     AVATCRRHSRTLDTSPSDDSSDEETDSWRLPQTQSYIIGVR"
     gene            144551..145237
                     /locus_tag="AT2G00350"
                     /db_xref="Araport:AT2G00350"
     misc_RNA        144551..145237
                     /locus_tag="AT2G00350"
                     /note="novel transcribed region;
                     AT2G00350.1"
                     /db_xref="Araport:AT2G00350"
     gene            145676..149394
                     /gene="MEE65"
                     /locus_tag="AT2G01280"
                     /gene_synonym="F10A8.16"
                     /gene_synonym="F10A8_16"
                     /gene_synonym="maternal effect embryo arrest 65"
                     /db_xref="Araport:AT2G01280"
                     /db_xref="TAIR:AT2G01280"
     mRNA            join(145676..145737,145836..145921,145992..146048,
                     146117..146205,146277..146353,146472..146489,
                     146602..146714,146856..146944,147028..147114,
                     147208..147288,147370..147513,147612..147780,
                     147866..147954,148053..148133,148207..148374,
                     148454..148516,148611..149394)
                     /gene="MEE65"
                     /locus_tag="AT2G01280"
                     /gene_synonym="F10A8.16"
                     /gene_synonym="F10A8_16"
                     /gene_synonym="maternal effect embryo arrest 65"
                     /product="Cyclin/Brf1-like TBP-binding protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG420504.1,INSD:BP622580.1,INSD:AV800214.1,
                     INSD:EG425126.1,INSD:EL101808.1,INSD:EG420506.1,
                     INSD:EG430387.1,INSD:EL160680.1,INSD:BP787728.1,
                     INSD:EG453948.1,INSD:BP629667.1,INSD:EG453947.1,
                     INSD:EG465551.1,INSD:EL239483.1,INSD:EG465540.1,
                     INSD:BP624060.1,INSD:BP627195.1,INSD:EG425123.1,
                     INSD:EG421573.1,INSD:EG420502.1,INSD:EL977102.1,
                     INSD:EG420508.1,INSD:BP779941.1,INSD:EL274594.1,
                     INSD:BP595133.1,INSD:BP623556.1,INSD:BP595013.1,
                     INSD:EG465684.1,INSD:EG430388.1,INSD:EG465707.1,
                     INSD:BP649528.1,INSD:EL237455.1,INSD:BP648191.1,
                     INSD:ES026124.1,INSD:EG456712.1,INSD:BP791484.1,
                     INSD:EL101356.1,INSD:EH831873.1,INSD:BP649526.1,
                     INSD:EL335371.1,INSD:DR370611.1,INSD:EG425127.1,
                     INSD:EH810049.1"
                     /db_xref="TAIR:AT2G01280"
                     /db_xref="Araport:AT2G01280"
     CDS             join(145676..145737,145836..145921,145992..146048,
                     146117..146205,146277..146353,146472..146489,
                     146602..146714,146856..146944,147028..147114,
                     147208..147288,147370..147513,147612..147780,
                     147866..147954,148053..148133,148207..148374,
                     148454..148516,148611..148784)
                     /gene="MEE65"
                     /locus_tag="AT2G01280"
                     /gene_synonym="F10A8.16"
                     /gene_synonym="F10A8_16"
                     /gene_synonym="maternal effect embryo arrest 65"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG420504.1,INSD:BP622580.1,INSD:AV800214.1,
                     INSD:EG425126.1,INSD:EL101808.1,INSD:EG420506.1,
                     INSD:EG430387.1,INSD:EL160680.1,INSD:BP787728.1,
                     INSD:EG453948.1,INSD:BP629667.1,INSD:EG453947.1,
                     INSD:EG465551.1,INSD:EL239483.1,INSD:EG465540.1,
                     INSD:BP624060.1,INSD:BP627195.1,INSD:EG425123.1,
                     INSD:EG421573.1,INSD:EG420502.1,INSD:EL977102.1,
                     INSD:EG420508.1,INSD:BP779941.1,INSD:EL274594.1,
                     INSD:BP595133.1,INSD:BP623556.1,INSD:BP595013.1,
                     INSD:EG465684.1,INSD:EG430388.1,INSD:EG465707.1,
                     INSD:BP649528.1,INSD:EL237455.1,INSD:BP648191.1,
                     INSD:ES026124.1,INSD:EG456712.1,INSD:BP791484.1,
                     INSD:EL101356.1,INSD:EH831873.1,INSD:BP649526.1,
                     INSD:EL335371.1,INSD:DR370611.1,INSD:EG425127.1,
                     INSD:EH810049.1"
                     /note="maternal effect embryo arrest 65 (MEE65); FUNCTIONS
                     IN: RNA polymerase II transcription factor activity,
                     cation:chloride symporter activity; INVOLVED IN: embryo
                     development ending in seed dormancy; LOCATED IN: nucleus;
                     CONTAINS InterPro DOMAIN/s: Transcription factor TFIIB
                     related (InterPro:IPR000812), Transcription factor TFIIB,
                     cyclin-related (InterPro:IPR013150), Cyclin-like
                     (InterPro:IPR011028), Cyclin-related (InterPro:IPR013763),
                     Cyclin (InterPro:IPR006670), Brf1-like TBP-binding
                     (InterPro:IPR011665); BEST Arabidopsis thaliana protein
                     match is: Cyclin/Brf1-like TBP-binding protein
                     (TAIR:AT3G09360.1); Has 35333 Blast hits to 34131 proteins
                     in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
                     974; Fungi - 991; Plants - 531; Viruses - 0; Other
                     Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Cyclin/Brf1-like TBP-binding protein"
                     /protein_id="AEC05428.1"
                     /db_xref="Araport:AT2G01280"
                     /db_xref="TAIR:AT2G01280"
                     /translation="MVWCKHCAKNVPKIRPFDGGLACDLCGRILENFNFSTDVTFVKN
                     AAGQVCNIVTSVGNSSSRDRRRRKAIDELRNLKDALGIGDERDDVVDMAAVFYEAAMD
                     QNFTKGRRAELVQSSCLYLACSYLRVSVYELGSVYLQLCEMLYLVQNKNYEELVDPSI
                     FIPRFTNSLLKGAHAKAKDVANTAKNIISSMKRDWIQTGRKPSGICGAAIYMAALSHG
                     IMYSRADIAKVVHMCEATITKRLNEFANTEAGSLTVDELDESEEILRKETFTPRPNSD
                     KGVVNCKHKDLKRFGYGLCKSCHDDFIIISGGVVGGSDPPAYQRAEKERMEKAAREEN
                     EGGIGNLNHDEQVNVSKRAKKCSEKGEGETYGGERHAEYSDESDICSDDDDSEVEHVL
                     LGEDETRLKTTAWNLQNKDYLEEQAEKEAALKAANCPEDARNLVEASKAAVANSRKEK
                     RRKRAEEAKNAPPSATATEASYTETQRVNQHHVLDELLDTSPTQKKPRTETVTEKKKE
                     EHEIVEDEEDEEDYAAPHADENFYEDEVEEEENGYDFGLY"
     mRNA            join(145676..145737,145836..145921,145992..146048,
                     146117..146205,146277..146353,146472..146489,
                     146602..146714,146856..146944,147028..147114,
                     147208..147288,147370..147513,147612..147780,
                     147866..147954,148053..148133,148207..148422)
                     /gene="MEE65"
                     /locus_tag="AT2G01280"
                     /gene_synonym="F10A8.16"
                     /gene_synonym="F10A8_16"
                     /gene_synonym="maternal effect embryo arrest 65"
                     /product="Cyclin/Brf1-like TBP-binding protein"
                     /db_xref="Araport:AT2G01280"
                     /db_xref="TAIR:AT2G01280"
     CDS             join(145676..145737,145836..145921,145992..146048,
                     146117..146205,146277..146353,146472..146489,
                     146602..146714,146856..146944,147028..147114,
                     147208..147288,147370..147513,147612..147780,
                     147866..147954,148053..148133,148207..148422)
                     /gene="MEE65"
                     /locus_tag="AT2G01280"
                     /gene_synonym="F10A8.16"
                     /gene_synonym="F10A8_16"
                     /gene_synonym="maternal effect embryo arrest 65"
                     /codon_start=1
                     /product="Cyclin/Brf1-like TBP-binding protein"
                     /protein_id="ANM63084.1"
                     /db_xref="Araport:AT2G01280"
                     /db_xref="TAIR:AT2G01280"
                     /translation="MVWCKHCAKNVPKIRPFDGGLACDLCGRILENFNFSTDVTFVKN
                     AAGQVCNIVTSVGNSSSRDRRRRKAIDELRNLKDALGIGDERDDVVDMAAVFYEAAMD
                     QNFTKGRRAELVQSSCLYLACSYLRVSVYELGSVYLQLCEMLYLVQNKNYEELVDPSI
                     FIPRFTNSLLKGAHAKAKDVANTAKNIISSMKRDWIQTGRKPSGICGAAIYMAALSHG
                     IMYSRADIAKVVHMCEATITKRLNEFANTEAGSLTVDELDESEEILRKETFTPRPNSD
                     KGVVNCKHKDLKRFGYGLCKSCHDDFIIISGGVVGGSDPPAYQRAEKERMEKAAREEN
                     EGGIGNLNHDEQVNVSKRAKKCSEKGEGETYGGERHAEYSDESDICSDDDDSEVEHVL
                     LGEDETRLKTTAWNLQNKDYLEEQAEKEAALKAANCPEDARNLVEASKAAVANSRKEK
                     RRKRAEEAKNAPPSATATEAVCRTLERKIKIYSIF"
     mRNA            join(145676..145737,145836..145921,145992..146048,
                     146117..146205,146277..146353,146472..146489,
                     146602..146714,146856..146944,147028..147114,
                     147208..147288,147370..147513,147612..147780,
                     147866..147954,148053..148406)
                     /gene="MEE65"
                     /locus_tag="AT2G01280"
                     /gene_synonym="F10A8.16"
                     /gene_synonym="F10A8_16"
                     /gene_synonym="maternal effect embryo arrest 65"
                     /product="Cyclin/Brf1-like TBP-binding protein"
                     /db_xref="Araport:AT2G01280"
                     /db_xref="TAIR:AT2G01280"
     CDS             join(145676..145737,145836..145921,145992..146048,
                     146117..146205,146277..146353,146472..146489,
                     146602..146714,146856..146944,147028..147114,
                     147208..147288,147370..147513,147612..147780,
                     147866..147954,148053..148244)
                     /gene="MEE65"
                     /locus_tag="AT2G01280"
                     /gene_synonym="F10A8.16"
                     /gene_synonym="F10A8_16"
                     /gene_synonym="maternal effect embryo arrest 65"
                     /codon_start=1
                     /product="Cyclin/Brf1-like TBP-binding protein"
                     /protein_id="ANM63083.1"
                     /db_xref="Araport:AT2G01280"
                     /db_xref="TAIR:AT2G01280"
                     /translation="MVWCKHCAKNVPKIRPFDGGLACDLCGRILENFNFSTDVTFVKN
                     AAGQVCNIVTSVGNSSSRDRRRRKAIDELRNLKDALGIGDERDDVVDMAAVFYEAAMD
                     QNFTKGRRAELVQSSCLYLACSYLRVSVYELGSVYLQLCEMLYLVQNKNYEELVDPSI
                     FIPRFTNSLLKGAHAKAKDVANTAKNIISSMKRDWIQTGRKPSGICGAAIYMAALSHG
                     IMYSRADIAKVVHMCEATITKRLNEFANTEAGSLTVDELDESEEILRKETFTPRPNSD
                     KGVVNCKHKDLKRFGYGLCKSCHDDFIIISGGVVGGSDPPAYQRAEKERMEKAAREEN
                     EGGIGNLNHDEQVNVSKRAKKCSEKGEGETYGGERHAEYSDESDICSDDDDSEVEHVL
                     LGEDETRLKTTAWNLQNKDYLEVIDRLYHLSSLGFGHSVKNLYCLVGASRKGSSSEGC
                     "
     gene            148875..149493
                     /locus_tag="AT2G03925"
                     /note="Natural antisense transcript overlaps with
                     AT2G01290"
                     /db_xref="Araport:AT2G03925"
     ncRNA           148875..149493
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT2G03925"
                     /product="other RNA"
                     /db_xref="Araport:AT2G03925"
     gene            complement(148919..150585)
                     /gene="RPI2"
                     /locus_tag="AT2G01290"
                     /gene_synonym="F10A8.17"
                     /gene_synonym="F10A8_17"
                     /gene_synonym="ribose-5-phosphate isomerase 2"
                     /note="Cytosolic ribose-5-phosphate isomerase. Knockout
                     mutation causes chloroplast dysfunction, late flowering
                     and premature cell death."
                     /db_xref="Araport:AT2G01290"
                     /db_xref="TAIR:AT2G01290"
     mRNA            complement(148919..150382)
                     /gene="RPI2"
                     /locus_tag="AT2G01290"
                     /gene_synonym="F10A8.17"
                     /gene_synonym="F10A8_17"
                     /gene_synonym="ribose-5-phosphate isomerase 2"
                     /product="ribose-5-phosphate isomerase 2"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG420504.1,INSD:BP622580.1,INSD:EG430387.1,
                     INSD:EL160680.1,INSD:BP787728.1,INSD:EG423879.1,
                     INSD:EG423888.1,INSD:BP629667.1,INSD:EG453947.1,
                     INSD:EL155238.1,INSD:BP627195.1,INSD:EG421573.1,
                     INSD:EG420502.1,INSD:AV536641.1,INSD:EG420508.1,
                     INSD:EH971196.1,INSD:EH932054.1,INSD:BP595133.1,
                     INSD:BP595013.1,INSD:EG465684.1,INSD:EG465707.1,
                     INSD:BP648191.1,INSD:EG456712.1,INSD:EG423881.1,
                     INSD:EL101356.1,INSD:DR350289.1,INSD:BP649526.1,
                     INSD:EL335371.1,INSD:EG423894.1,INSD:EG425126.1,
                     INSD:EL101808.1,INSD:AV828033.1,INSD:AV800214.1,
                     INSD:EG423885.1,INSD:EG420506.1,INSD:EG423874.1,
                     INSD:DR350288.1,INSD:EG453948.1,INSD:EG423890.1,
                     INSD:EG465551.1,INSD:EL239483.1,INSD:EG465540.1,
                     INSD:BP624060.1,INSD:BP834709.1,INSD:BP830057.1,
                     INSD:EL977102.1,INSD:BP837557.1,INSD:BP779941.1,
                     INSD:EL274594.1,INSD:EG423877.1,INSD:BP623556.1,
                     INSD:EG430388.1,INSD:DR350292.1,INSD:BP649528.1,
                     INSD:DR350291.1,INSD:EL237455.1,INSD:ES026124.1,
                     INSD:BP812362.1,INSD:BP791484.1,INSD:EH831873.1,
                     INSD:EL101434.1,INSD:DR370611.1,INSD:EG425127.1,
                     INSD:EG423892.1,INSD:EG423883.1,INSD:EH810049.1,
                     INSD:DR350290.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY066038.1,INSD:AY054172.1,INSD:BX819220.1"
                     /db_xref="TAIR:AT2G01290"
                     /db_xref="Araport:AT2G01290"
     CDS             complement(149192..149989)
                     /gene="RPI2"
                     /locus_tag="AT2G01290"
                     /gene_synonym="F10A8.17"
                     /gene_synonym="F10A8_17"
                     /gene_synonym="ribose-5-phosphate isomerase 2"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG420504.1,INSD:BP622580.1,INSD:EG430387.1,
                     INSD:EL160680.1,INSD:BP787728.1,INSD:EG423879.1,
                     INSD:EG423888.1,INSD:BP629667.1,INSD:EG453947.1,
                     INSD:EL155238.1,INSD:BP627195.1,INSD:EG421573.1,
                     INSD:EG420502.1,INSD:AV536641.1,INSD:EG420508.1,
                     INSD:EH971196.1,INSD:EH932054.1,INSD:BP595133.1,
                     INSD:BP595013.1,INSD:EG465684.1,INSD:EG465707.1,
                     INSD:BP648191.1,INSD:EG456712.1,INSD:EG423881.1,
                     INSD:EL101356.1,INSD:DR350289.1,INSD:BP649526.1,
                     INSD:EL335371.1,INSD:EG423894.1,INSD:EG425126.1,
                     INSD:EL101808.1,INSD:AV828033.1,INSD:AV800214.1,
                     INSD:EG423885.1,INSD:EG420506.1,INSD:EG423874.1,
                     INSD:DR350288.1,INSD:EG453948.1,INSD:EG423890.1,
                     INSD:EG465551.1,INSD:EL239483.1,INSD:EG465540.1,
                     INSD:BP624060.1,INSD:BP834709.1,INSD:BP830057.1,
                     INSD:EL977102.1,INSD:BP837557.1,INSD:BP779941.1,
                     INSD:EL274594.1,INSD:EG423877.1,INSD:BP623556.1,
                     INSD:EG430388.1,INSD:DR350292.1,INSD:BP649528.1,
                     INSD:DR350291.1,INSD:EL237455.1,INSD:ES026124.1,
                     INSD:BP812362.1,INSD:BP791484.1,INSD:EH831873.1,
                     INSD:EL101434.1,INSD:DR370611.1,INSD:EG425127.1,
                     INSD:EG423892.1,INSD:EG423883.1,INSD:EH810049.1,
                     INSD:DR350290.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY066038.1,INSD:AY054172.1,INSD:BX819220.1"
                     /note="ribose-5-phosphate isomerase 2 (RPI2); CONTAINS
                     InterPro DOMAIN/s: Ribose-5-phosphate isomerase, type A,
                     subgroup (InterPro:IPR020672), Ribose 5-phosphate
                     isomerase, type A (InterPro:IPR004788); BEST Arabidopsis
                     thaliana protein match is: Ribose 5-phosphate isomerase,
                     type A protein (TAIR:AT1G71100.1); Has 5035 Blast hits to
                     5035 proteins in 1937 species: Archae - 235; Bacteria -
                     3542; Metazoa - 112; Fungi - 145; Plants - 141; Viruses -
                     0; Other Eukaryotes - 860 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ribose-5-phosphate isomerase 2"
                     /protein_id="AEC05429.1"
                     /db_xref="Araport:AT2G01290"
                     /db_xref="TAIR:AT2G01290"
                     /translation="MALAYDPLFITSDKSLSAFDVASSPPQPMNLTQDELKRIAAYKA
                     VEFVESGMVLGLGTGSTAKHAVDRIGELLRQGKLENIVGIPTSKKTQEQALSLGIPLS
                     DLDAHPVIDLSIDGADEVDPFLNLVKGRGGSLLREKMIEGASKKFVVIVDDSKMVKHI
                     GGSKLALPVEIVPFCWKFTAEKLRSLLEGYGCEANLRLGEKGKAFVTDNGNYIVDMHV
                     EEDMGDLGAVSDAILRLPGVVEHGMFLDMASTVIIAGELGVKIKNKH"
     gene            complement(151057..151971)
                     /locus_tag="AT2G01300"
                     /gene_synonym="F10A8.18"
                     /gene_synonym="F10A8_18"
                     /db_xref="Araport:AT2G01300"
                     /db_xref="TAIR:AT2G01300"
     mRNA            complement(151057..151971)
                     /locus_tag="AT2G01300"
                     /gene_synonym="F10A8.18"
                     /gene_synonym="F10A8_18"
                     /product="mediator of RNA polymerase II transcription
                     subunit"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG425134.1,INSD:EG420517.1,INSD:DR244509.1,
                     INSD:EG423896.1,INSD:EL276407.1,INSD:EG418946.1,
                     INSD:EG425136.1,INSD:EG423779.1,INSD:EG423763.1,
                     INSD:EG422056.1,INSD:EG425647.1,INSD:EG420543.1,
                     INSD:EG423761.1,INSD:DR287675.1,INSD:EG425648.1,
                     INSD:EH830587.1,INSD:EG420539.1,INSD:AV824533.1,
                     INSD:EG420535.1,INSD:EG420533.1,INSD:EL249419.1,
                     INSD:EG422059.1,INSD:EG423898.1,INSD:EG422062.1,
                     INSD:EG420541.1,INSD:EG420524.1,INSD:EG423759.1,
                     INSD:EG420518.1,INSD:EG425646.1,INSD:EG418940.1,
                     INSD:DR380231.1,INSD:EG418949.1,INSD:AV786536.1,
                     INSD:DR244508.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY065356.1,INSD:AY117184.1,INSD:AY600542.1,
                     INSD:AY084896.1"
                     /db_xref="TAIR:AT2G01300"
                     /db_xref="Araport:AT2G01300"
     CDS             complement(151221..151691)
                     /locus_tag="AT2G01300"
                     /gene_synonym="F10A8.18"
                     /gene_synonym="F10A8_18"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG425134.1,INSD:EG420517.1,INSD:DR244509.1,
                     INSD:EG423896.1,INSD:EL276407.1,INSD:EG418946.1,
                     INSD:EG425136.1,INSD:EG423779.1,INSD:EG423763.1,
                     INSD:EG422056.1,INSD:EG425647.1,INSD:EG420543.1,
                     INSD:EG423761.1,INSD:DR287675.1,INSD:EG425648.1,
                     INSD:EH830587.1,INSD:EG420539.1,INSD:AV824533.1,
                     INSD:EG420535.1,INSD:EG420533.1,INSD:EL249419.1,
                     INSD:EG422059.1,INSD:EG423898.1,INSD:EG422062.1,
                     INSD:EG420541.1,INSD:EG420524.1,INSD:EG423759.1,
                     INSD:EG420518.1,INSD:EG425646.1,INSD:EG418940.1,
                     INSD:DR380231.1,INSD:EG418949.1,INSD:AV786536.1,
                     INSD:DR244508.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY065356.1,INSD:AY117184.1,INSD:AY600542.1,
                     INSD:AY084896.1"
                     /note="unknown protein; BEST Arabidopsis thaliana protein
                     match is: unknown protein (TAIR:AT1G15010.1); Has 73 Blast
                     hits to 73 proteins in 12 species: Archae - 0; Bacteria -
                     0; Metazoa - 0; Fungi - 0; Plants - 73; Viruses - 0; Other
                     Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit"
                     /protein_id="AEC05430.1"
                     /db_xref="Araport:AT2G01300"
                     /db_xref="TAIR:AT2G01300"
                     /translation="MEATLFSSPPSISPLRFHPLVLSQRAIIPKKKKMTMRVSAAASS
                     GKDHYYGGGRLVDENMIVLRKRIHEMKMVERNYEPPSHWMDWEKRFYNSYDSVICDSV
                     GLLQSFLMNSRPTVAIATLLFLLVSVPVSSTVIAFRLIDLLHWLLAAATSAHVA"
     gene            complement(152298..152827)
                     /locus_tag="AT2G01310"
                     /gene_synonym="F10A8.19"
                     /gene_synonym="F10A8_19"
                     /db_xref="Araport:AT2G01310"
                     /db_xref="TAIR:AT2G01310"
     mRNA            complement(152298..152827)
                     /locus_tag="AT2G01310"
                     /gene_synonym="F10A8.19"
                     /gene_synonym="F10A8_19"
                     /product="hypothetical protein"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT026002.1,INSD:AY261788.1"
                     /db_xref="TAIR:AT2G01310"
                     /db_xref="Araport:AT2G01310"
     CDS             complement(152481..152642)
                     /locus_tag="AT2G01310"
                     /gene_synonym="F10A8.19"
                     /gene_synonym="F10A8_19"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT026002.1,INSD:AY261788.1"
                     /note="BEST Arabidopsis thaliana protein match is:
                     cyclin-dependent protein kinase 3;2 (TAIR:AT1G47210.1);
                     Has 37 Blast hits to 37 proteins in 6 species: Archae - 0;
                     Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 37; Viruses
                     - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEC05431.1"
                     /db_xref="Araport:AT2G01310"
                     /db_xref="TAIR:AT2G01310"
                     /translation="MMEQEIWVRVTRAAAKRKASTAMGIDEDRLNKKRVFLGELLNVS
                     NVNLLSNLN"
     gene            complement(154097..158204)
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /db_xref="Araport:AT2G01320"
                     /db_xref="TAIR:AT2G01320"
     mRNA            complement(join(154097..154500,154677..154983,
                     155061..155145,155240..155452,155621..155841,
                     155940..156071,156384..156660,156760..156961,
                     157050..157182,157279..157429,157509..157699,
                     157806..158182))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /product="ABC-2 type transporter family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES180379.1,INSD:EL289590.1,INSD:BP650518.1,
                     INSD:BP791746.1,INSD:BP817522.1,INSD:BE527126.1,
                     INSD:ES066750.1,INSD:ES038688.1,INSD:ES033925.1,
                     INSD:EL310129.1,INSD:BP821257.1,INSD:BX839593.1,
                     INSD:DR368588.1,INSD:ES011664.1,INSD:BP846491.1,
                     INSD:BX839207.1,INSD:BP649492.1,INSD:EL102054.1,
                     INSD:BX839737.1,INSD:ES066780.1,INSD:BP561220.2,
                     INSD:EL059766.1,INSD:EH812294.1,INSD:AA041094.1,
                     INSD:BP818375.1,INSD:BP648375.1,INSD:ES043701.1,
                     INSD:BP786331.1,INSD:BX839137.1,INSD:AV795192.1,
                     INSD:AV827197.1,INSD:BP783683.1,INSD:EH873395.1,
                     INSD:BP637095.1,INSD:BP780737.1,INSD:BP836965.1,
                     INSD:BP837562.1,INSD:BX839423.1,INSD:BP836008.1,
                     INSD:AV529792.1,INSD:AV523999.1,INSD:ES185869.1,
                     INSD:ES121515.1,INSD:AV792401.1"
                     /db_xref="TAIR:AT2G01320"
                     /db_xref="Araport:AT2G01320"
     mRNA            complement(join(154131..154503,154677..154983,
                     155061..155145,155240..155452,155621..155841,
                     155940..156071,156384..156660,156760..156961,
                     157050..157182,157279..157429,157509..157699,
                     157806..158204))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /product="ABC-2 type transporter family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES180379.1,INSD:EL289590.1,INSD:AV801065.1,
                     INSD:BP652737.1,INSD:BP637501.1,INSD:AV793373.1,
                     INSD:BP817522.1,INSD:BE527126.1,INSD:ES038688.1,
                     INSD:ES066750.1,INSD:ES033925.1,INSD:EL310129.1,
                     INSD:BP638399.1,INSD:BP821257.1,INSD:BX839593.1,
                     INSD:DR368588.1,INSD:ES011664.1,INSD:BP846491.1,
                     INSD:BX839207.1,INSD:EL102054.1,INSD:BX839737.1,
                     INSD:BP782506.1,INSD:ES066780.1,INSD:BP561220.2,
                     INSD:EL059766.1,INSD:EH812294.1,INSD:AA041094.1,
                     INSD:BP818375.1,INSD:ES043701.1,INSD:BP649337.1,
                     INSD:BP646256.1,INSD:BP644731.1,INSD:BX839137.1,
                     INSD:AV827197.1,INSD:EH873395.1,INSD:BP836965.1,
                     INSD:BP837562.1,INSD:BX839423.1,INSD:BP641148.1,
                     INSD:AV791247.1,INSD:BP836008.1,INSD:AV529792.1,
                     INSD:AV785572.1,INSD:ES185869.1,INSD:ES121515.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BX820795.1"
                     /db_xref="TAIR:AT2G01320"
                     /db_xref="Araport:AT2G01320"
     mRNA            complement(join(154222..154983,155061..155145,
                     155240..155452,155621..155841,155940..156071,
                     156384..156660,156760..156961,157050..157182,
                     157279..157429,157509..157699,157806..158204))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /product="ABC-2 type transporter family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP788083.1,INSD:ES180379.1,INSD:EL289590.1,
                     INSD:BP817522.1,INSD:BE527126.1,INSD:ES066750.1,
                     INSD:EL310129.1,INSD:EL157613.1,INSD:BP821257.1,
                     INSD:BX839593.1,INSD:DR368588.1,INSD:BP846491.1,
                     INSD:BX839207.1,INSD:EL102054.1,INSD:BX839737.1,
                     INSD:ES066780.1,INSD:BP561220.2,INSD:EL059766.1,
                     INSD:BX835455.1,INSD:BP661581.1,INSD:EH812294.1,
                     INSD:AA041094.1,INSD:BP818375.1,INSD:EH988586.1,
                     INSD:AV797498.1,INSD:BX835762.1,INSD:BX839137.1,
                     INSD:AV827197.1,INSD:EH873395.1,INSD:BX835685.1,
                     INSD:BP836965.1,INSD:BP837562.1,INSD:BX839423.1,
                     INSD:BP836008.1,INSD:AV529792.1,INSD:ES185869.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AF367318.1,INSD:AY133617.1"
                     /db_xref="TAIR:AT2G01320"
                     /db_xref="Araport:AT2G01320"
     mRNA            complement(join(154414..154500,154677..155145,
                     155240..155452,155621..155841,155940..156071,
                     156384..156660,156760..156961,157050..157182,
                     157279..157429,157509..157699,157806..158182))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /product="ABC-2 type transporter family protein"
                     /db_xref="Araport:AT2G01320"
                     /db_xref="TAIR:AT2G01320"
     mRNA            complement(join(154428..154500,154611..154983,
                     155061..155145,155240..155452,155621..155841,
                     155940..156071,156384..156660,156760..156961,
                     157050..157182,157279..157429,157509..157699,
                     157806..158182))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /product="ABC-2 type transporter family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BX836659.1,INSD:ES180379.1,INSD:EL289590.1,
                     INSD:BP817522.1,INSD:BE527126.1,INSD:ES038688.1,
                     INSD:ES066750.1,INSD:ES033925.1,INSD:EL310129.1,
                     INSD:EL157613.1,INSD:BP821257.1,INSD:BX839593.1,
                     INSD:DR368588.1,INSD:BP846491.1,INSD:BX839207.1,
                     INSD:EL102054.1,INSD:BX839737.1,INSD:ES066780.1,
                     INSD:EL059766.1,INSD:BP561220.2,INSD:EH812294.1,
                     INSD:AA041094.1,INSD:BP818375.1,INSD:EH988586.1,
                     INSD:BX839137.1,INSD:AV827197.1,INSD:EH873395.1,
                     INSD:BP836965.1,INSD:BP837562.1,INSD:BX839423.1,
                     INSD:BP836008.1,INSD:AV529792.1,INSD:ES185869.1,
                     INSD:ES121515.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AY133617.1"
                     /db_xref="TAIR:AT2G01320"
                     /db_xref="Araport:AT2G01320"
     CDS             complement(join(154487..154500,154677..154983,
                     155061..155145,155240..155452,155621..155841,
                     155940..156071,156384..156660,156760..156961,
                     157050..157182,157279..157429,157509..157699,
                     157806..158063))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES180379.1,INSD:EL289590.1,INSD:AV801065.1,
                     INSD:BP652737.1,INSD:BP637501.1,INSD:AV793373.1,
                     INSD:BP817522.1,INSD:BE527126.1,INSD:ES038688.1,
                     INSD:ES066750.1,INSD:ES033925.1,INSD:EL310129.1,
                     INSD:BP638399.1,INSD:BP821257.1,INSD:BX839593.1,
                     INSD:DR368588.1,INSD:ES011664.1,INSD:BP846491.1,
                     INSD:BX839207.1,INSD:EL102054.1,INSD:BX839737.1,
                     INSD:BP782506.1,INSD:ES066780.1,INSD:BP561220.2,
                     INSD:EL059766.1,INSD:EH812294.1,INSD:AA041094.1,
                     INSD:BP818375.1,INSD:ES043701.1,INSD:BP649337.1,
                     INSD:BP646256.1,INSD:BP644731.1,INSD:BX839137.1,
                     INSD:AV827197.1,INSD:EH873395.1,INSD:BP836965.1,
                     INSD:BP837562.1,INSD:BX839423.1,INSD:BP641148.1,
                     INSD:AV791247.1,INSD:BP836008.1,INSD:AV529792.1,
                     INSD:AV785572.1,INSD:ES185869.1,INSD:ES121515.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BX820795.1"
                     /note="ABC-2 type transporter family protein; FUNCTIONS
                     IN: ATPase activity, coupled to transmembrane movement of
                     substances; LOCATED IN: chloroplast; EXPRESSED IN: 22
                     plant structures; EXPRESSED DURING: 14 growth stages;
                     CONTAINS InterPro DOMAIN/s: ATPase, AAA+ type, core
                     (InterPro:IPR003593), ABC transporter-like
                     (InterPro:IPR003439), ABC-2 type transporter
                     (InterPro:IPR013525), ABC transporter, conserved site
                     (InterPro:IPR017871); BEST Arabidopsis thaliana protein
                     match is: ABC-2 type transporter family protein
                     (TAIR:AT3G25620.2); Has 387358 Blast hits to 354249
                     proteins in 4108 species: Archae - 7085; Bacteria -
                     307995; Metazoa - 8597; Fungi - 6708; Plants - 5391;
                     Viruses - 19; Other Eukaryotes - 51563 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="ABC-2 type transporter family protein"
                     /protein_id="AEC05432.1"
                     /db_xref="Araport:AT2G01320"
                     /db_xref="TAIR:AT2G01320"
                     /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIAL
                     LPEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGR
                     LLAIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLF
                     FSQLTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISG
                     GEKKRLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPR
                     GSVYAKFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYS
                     SSETVYSSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWR
                     QFFLLLKRAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVA
                     AINTAMAALTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGA
                     VLYPMARLNPTLSRFGKFCGIVTVESFAASAMGLTVGAMVPSTEAAMAVGPSLMTVFI
                     VFGGYYVNADNTPIIFRWIPRASLIRWAFQGLCINEFSGLKFDHQNTFDVQTGEQALE
                     RLSFGGRRIRETIAAQSRILMFWYSATYLLLEKNKPKYQKLELLVDNGETGNSGVQLD
                     KAEVDQTEKPEDDDINQPLDDQNQTSDSDDELDEIRPFVLEGSKV"
     CDS             complement(join(154487..154503,154677..154983,
                     155061..155145,155240..155452,155621..155841,
                     155940..156071,156384..156660,156760..156961,
                     157050..157182,157279..157429,157509..157699,
                     157806..158063))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES180379.1,INSD:EL289590.1,INSD:BP650518.1,
                     INSD:BP791746.1,INSD:BP817522.1,INSD:BE527126.1,
                     INSD:ES066750.1,INSD:ES038688.1,INSD:ES033925.1,
                     INSD:EL310129.1,INSD:BP821257.1,INSD:BX839593.1,
                     INSD:DR368588.1,INSD:ES011664.1,INSD:BP846491.1,
                     INSD:BX839207.1,INSD:BP649492.1,INSD:EL102054.1,
                     INSD:BX839737.1,INSD:ES066780.1,INSD:BP561220.2,
                     INSD:EL059766.1,INSD:EH812294.1,INSD:AA041094.1,
                     INSD:BP818375.1,INSD:BP648375.1,INSD:ES043701.1,
                     INSD:BP786331.1,INSD:BX839137.1,INSD:AV795192.1,
                     INSD:AV827197.1,INSD:BP783683.1,INSD:EH873395.1,
                     INSD:BP637095.1,INSD:BP780737.1,INSD:BP836965.1,
                     INSD:BP837562.1,INSD:BX839423.1,INSD:BP836008.1,
                     INSD:AV529792.1,INSD:AV523999.1,INSD:ES185869.1,
                     INSD:ES121515.1,INSD:AV792401.1"
                     /note="ABC-2 type transporter family protein; FUNCTIONS
                     IN: ATPase activity, coupled to transmembrane movement of
                     substances; LOCATED IN: chloroplast; EXPRESSED IN: 22
                     plant structures; EXPRESSED DURING: 14 growth stages;
                     CONTAINS InterPro DOMAIN/s: ATPase, AAA+ type, core
                     (InterPro:IPR003593), ABC transporter-like
                     (InterPro:IPR003439), ABC-2 type transporter
                     (InterPro:IPR013525), ABC transporter, conserved site
                     (InterPro:IPR017871); BEST Arabidopsis thaliana protein
                     match is: ABC-2 type transporter family protein
                     (TAIR:AT3G25620.2); Has 387349 Blast hits to 354243
                     proteins in 4108 species: Archae - 7085; Bacteria -
                     307989; Metazoa - 8597; Fungi - 6708; Plants - 5387;
                     Viruses - 19; Other Eukaryotes - 51564 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="ABC-2 type transporter family protein"
                     /protein_id="AEC05434.1"
                     /db_xref="Araport:AT2G01320"
                     /db_xref="TAIR:AT2G01320"
                     /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIAL
                     LPEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGR
                     LLAIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLF
                     FSQLTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISG
                     GEKKRLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPR
                     GSVYAKFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYS
                     SSETVYSSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWR
                     QFFLLLKRAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVA
                     AINTAMAALTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGA
                     VLYPMARLNPTLSRFGKFCGIVTVESFAASAMGLTVGAMVPSTEAAMAVGPSLMTVFI
                     VFGGYYVNADNTPIIFRWIPRASLIRWAFQGLCINEFSGLKFDHQNTFDVQTGEQALE
                     RLSFGGRRIRETIAAQSRILMFWYSATYLLLEKNKPKYQKLELLVDNGETGNSGVQLD
                     KAEVDQTEKPEDDDINQPLDDQNQTSDSDDELDEIRPFVLEAGSKV"
     mRNA            complement(join(154504..154983,155061..155145,
                     155240..155841,155940..156071,156384..156660,
                     156760..156961,157050..157182,157279..157429,
                     157509..157699,157806..158182))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /product="ABC-2 type transporter family protein"
                     /db_xref="Araport:AT2G01320"
                     /db_xref="TAIR:AT2G01320"
     mRNA            complement(join(154504..154983,155061..155841,
                     155940..156071,156384..156660,156760..156961,
                     157050..157182,157279..157429,157509..157699,
                     157806..158182))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /product="ABC-2 type transporter family protein"
                     /db_xref="Araport:AT2G01320"
                     /db_xref="TAIR:AT2G01320"
     mRNA            complement(join(154533..155145,155240..155452,
                     155621..155841,155940..156071,156384..156660,
                     156760..156961,157050..157182,157279..157429,
                     157509..157699,157806..158182))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /product="ABC-2 type transporter family protein"
                     /db_xref="Araport:AT2G01320"
                     /db_xref="TAIR:AT2G01320"
     CDS             complement(join(154669..154983,155061..155145,
                     155240..155452,155621..155841,155940..156071,
                     156384..156660,156760..156961,157050..157182,
                     157279..157429,157509..157699,157806..158063))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BX836659.1,INSD:ES180379.1,INSD:EL289590.1,
                     INSD:BP817522.1,INSD:BE527126.1,INSD:ES038688.1,
                     INSD:ES066750.1,INSD:ES033925.1,INSD:EL310129.1,
                     INSD:EL157613.1,INSD:BP821257.1,INSD:BX839593.1,
                     INSD:DR368588.1,INSD:BP846491.1,INSD:BX839207.1,
                     INSD:EL102054.1,INSD:BX839737.1,INSD:ES066780.1,
                     INSD:EL059766.1,INSD:BP561220.2,INSD:EH812294.1,
                     INSD:AA041094.1,INSD:BP818375.1,INSD:EH988586.1,
                     INSD:BX839137.1,INSD:AV827197.1,INSD:EH873395.1,
                     INSD:BP836965.1,INSD:BP837562.1,INSD:BX839423.1,
                     INSD:BP836008.1,INSD:AV529792.1,INSD:ES185869.1,
                     INSD:ES121515.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AY133617.1"
                     /note="ABC-2 type transporter family protein; FUNCTIONS
                     IN: ATPase activity, coupled to transmembrane movement of
                     substances; LOCATED IN: chloroplast; EXPRESSED IN: 22
                     plant structures; EXPRESSED DURING: 14 growth stages;
                     CONTAINS InterPro DOMAIN/s: ATPase, AAA+ type, core
                     (InterPro:IPR003593), ABC transporter-like
                     (InterPro:IPR003439), ABC-2 type transporter
                     (InterPro:IPR013525), ABC transporter, conserved site
                     (InterPro:IPR017871); BEST Arabidopsis thaliana protein
                     match is: ABC-2 type transporter family protein
                     (TAIR:AT3G25620.2); Has 35333 Blast hits to 34131 proteins
                     in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
                     974; Fungi - 991; Plants - 531; Viruses - 0; Other
                     Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ABC-2 type transporter family protein"
                     /protein_id="AEC05433.1"
                     /db_xref="Araport:AT2G01320"
                     /db_xref="TAIR:AT2G01320"
                     /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIAL
                     LPEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGR
                     LLAIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLF
                     FSQLTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISG
                     GEKKRLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPR
                     GSVYAKFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYS
                     SSETVYSSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWR
                     QFFLLLKRAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVA
                     AINTAMAALTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGA
                     VLYPMARLNPTLSRFGKFCGIVTVESFAASAMGLTVGAMVPSTEAAMAVGPSLMTVFI
                     VFGGYYVNADNTPIIFRWIPRASLIRWAFQGLCINEFSGLKFDHQNTFDVQTGEQALE
                     RLSFGGRRIRETIAAQSRILMFWYSATYLLLEKNKPKYQKLELLVDNGETGNSGVQLD
                     KAEVDQTEKPEDDDINQPLDDQNQTSDSDDELDEIRPFVLEGL"
     CDS             complement(join(154669..154983,155061..155145,
                     155240..155452,155621..155841,155940..156071,
                     156384..156660,156760..156961,157050..157182,
                     157279..157429,157509..157699,157806..158063))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP788083.1,INSD:ES180379.1,INSD:EL289590.1,
                     INSD:BP817522.1,INSD:BE527126.1,INSD:ES066750.1,
                     INSD:EL310129.1,INSD:EL157613.1,INSD:BP821257.1,
                     INSD:BX839593.1,INSD:DR368588.1,INSD:BP846491.1,
                     INSD:BX839207.1,INSD:EL102054.1,INSD:BX839737.1,
                     INSD:ES066780.1,INSD:BP561220.2,INSD:EL059766.1,
                     INSD:BX835455.1,INSD:BP661581.1,INSD:EH812294.1,
                     INSD:AA041094.1,INSD:BP818375.1,INSD:EH988586.1,
                     INSD:AV797498.1,INSD:BX835762.1,INSD:BX839137.1,
                     INSD:AV827197.1,INSD:EH873395.1,INSD:BX835685.1,
                     INSD:BP836965.1,INSD:BP837562.1,INSD:BX839423.1,
                     INSD:BP836008.1,INSD:AV529792.1,INSD:ES185869.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AF367318.1,INSD:AY133617.1"
                     /note="ABC-2 type transporter family protein; FUNCTIONS
                     IN: ATPase activity, coupled to transmembrane movement of
                     substances; LOCATED IN: chloroplast; EXPRESSED IN: 22
                     plant structures; EXPRESSED DURING: 14 growth stages;
                     CONTAINS InterPro DOMAIN/s: ATPase, AAA+ type, core
                     (InterPro:IPR003593), ABC transporter-like
                     (InterPro:IPR003439), ABC transporter, conserved site
                     (InterPro:IPR017871), ABC-2 type transporter
                     (InterPro:IPR013525); BEST Arabidopsis thaliana protein
                     match is: ABC-2 type transporter family protein
                     (TAIR:AT3G25620.2); Has 387535 Blast hits to 354405
                     proteins in 4108 species: Archae - 7090; Bacteria -
                     308145; Metazoa - 8600; Fungi - 6710; Plants - 5407;
                     Viruses - 19; Other Eukaryotes - 51564 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="ABC-2 type transporter family protein"
                     /protein_id="AEC05435.1"
                     /db_xref="Araport:AT2G01320"
                     /db_xref="TAIR:AT2G01320"
                     /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIAL
                     LPEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGR
                     LLAIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLF
                     FSQLTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISG
                     GEKKRLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPR
                     GSVYAKFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYS
                     SSETVYSSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWR
                     QFFLLLKRAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVA
                     AINTAMAALTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGA
                     VLYPMARLNPTLSRFGKFCGIVTVESFAASAMGLTVGAMVPSTEAAMAVGPSLMTVFI
                     VFGGYYVNADNTPIIFRWIPRASLIRWAFQGLCINEFSGLKFDHQNTFDVQTGEQALE
                     RLSFGGRRIRETIAAQSRILMFWYSATYLLLEKNKPKYQKLELLVDNGETGNSGVQLD
                     KAEVDQTEKPEDDDINQPLDDQNQTSDSDDELDEIRPFVLEGL"
     CDS             complement(join(154977..155145,155240..155452,
                     155621..155841,155940..156071,156384..156660,
                     156760..156961,157050..157182,157279..157429,
                     157509..157699,157806..158063))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /codon_start=1
                     /product="ABC-2 type transporter family protein"
                     /protein_id="ANM62898.1"
                     /db_xref="Araport:AT2G01320"
                     /db_xref="TAIR:AT2G01320"
                     /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIAL
                     LPEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGR
                     LLAIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLF
                     FSQLTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISG
                     GEKKRLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPR
                     GSVYAKFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYS
                     SSETVYSSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWR
                     QFFLLLKRAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVA
                     AINTAMAALTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGA
                     VLYPMARLNPTLSRFGKFCGIVTVESFAASAMGLTVGAMVPSTEAAMAVGPSLMTVFI
                     VFGGYYVNADNTPIIFRWIPRASLIRWAFQGLCINEFSGLKFDHQNTFDVQTGEQVTI
                     SSCQTPFIASVYKVIGGYIMFGRR"
     CDS             complement(join(154977..155145,155240..155452,
                     155621..155841,155940..156071,156384..156660,
                     156760..156961,157050..157182,157279..157429,
                     157509..157699,157806..158063))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /codon_start=1
                     /product="ABC-2 type transporter family protein"
                     /protein_id="ANM62899.1"
                     /db_xref="Araport:AT2G01320"
                     /db_xref="TAIR:AT2G01320"
                     /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIAL
                     LPEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGR
                     LLAIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLF
                     FSQLTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISG
                     GEKKRLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPR
                     GSVYAKFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYS
                     SSETVYSSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWR
                     QFFLLLKRAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVA
                     AINTAMAALTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGA
                     VLYPMARLNPTLSRFGKFCGIVTVESFAASAMGLTVGAMVPSTEAAMAVGPSLMTVFI
                     VFGGYYVNADNTPIIFRWIPRASLIRWAFQGLCINEFSGLKFDHQNTFDVQTGEQVTI
                     SSCQTPFIASVYKVIGGYIMFGRR"
     CDS             complement(join(155617..155841,155940..156071,
                     156384..156660,156760..156961,157050..157182,
                     157279..157429,157509..157699,157806..158063))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /codon_start=1
                     /product="ABC-2 type transporter family protein"
                     /protein_id="ANM62900.1"
                     /db_xref="Araport:AT2G01320"
                     /db_xref="TAIR:AT2G01320"
                     /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIAL
                     LPEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGR
                     LLAIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLF
                     FSQLTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISG
                     GEKKRLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPR
                     GSVYAKFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYS
                     SSETVYSSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWR
                     QFFLLLKRAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVA
                     AINTAMAALTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGA
                     VLYPMARLNPTLSR"
     CDS             complement(join(155617..155841,155940..156071,
                     156384..156660,156760..156961,157050..157182,
                     157279..157429,157509..157699,157806..158063))
                     /gene="ABCG7"
                     /locus_tag="AT2G01320"
                     /gene_synonym="ATP-binding cassette G7"
                     /gene_synonym="F10A8.20"
                     /gene_synonym="F10A8_20"
                     /codon_start=1
                     /product="ABC-2 type transporter family protein"
                     /protein_id="ANM62901.1"
                     /db_xref="Araport:AT2G01320"
                     /db_xref="TAIR:AT2G01320"
                     /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIAL
                     LPEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGR
                     LLAIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLF
                     FSQLTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISG
                     GEKKRLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPR
                     GSVYAKFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYS
                     SSETVYSSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWR
                     QFFLLLKRAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVA
                     AINTAMAALTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGA
                     VLYPMARLNPTLSR"
     gene            complement(158183..160870)
                     /locus_tag="AT2G01330"
                     /gene_synonym="F10A8.21"
                     /gene_synonym="F10A8_21"
                     /db_xref="Araport:AT2G01330"
                     /db_xref="TAIR:AT2G01330"
     mRNA            complement(join(158183..158674,158761..159174,
                     159275..159697,159771..159957,160042..160203,
                     160364..160870))
                     /locus_tag="AT2G01330"
                     /gene_synonym="F10A8.21"
                     /gene_synonym="F10A8_21"
                     /product="nucleotide binding protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AI995430.1,INSD:BX839321.1,INSD:BX835552.1"
                     /db_xref="TAIR:AT2G01330"
                     /db_xref="Araport:AT2G01330"
     CDS             complement(join(158417..158674,158761..159174,
                     159275..159697,159771..159957,160042..160203,
                     160364..160755))
                     /locus_tag="AT2G01330"
                     /gene_synonym="F10A8.21"
                     /gene_synonym="F10A8_21"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AI995430.1,INSD:BX839321.1,INSD:BX835552.1"
                     /note="nucleotide binding; CONTAINS InterPro DOMAIN/s:
                     WD40 repeat 2 (InterPro:IPR019782), WD40
                     repeat-like-containing domain (InterPro:IPR011046), WD40
                     repeat, conserved site (InterPro:IPR019775),
                     WD40-repeat-containing domain (InterPro:IPR017986),
                     WD40/YVTN repeat-like-containing domain
                     (InterPro:IPR015943), WD40 repeat (InterPro:IPR001680),
                     WD40 repeat, subgroup (InterPro:IPR019781); BEST
                     Arabidopsis thaliana protein match is: transducin family
                     protein / WD-40 repeat family protein (TAIR:AT3G18060.1);
                     Has 35333 Blast hits to 34131 proteins in 2444 species:
                     Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi -
                     991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="nucleotide binding protein"
                     /protein_id="AEC05436.1"
                     /db_xref="Araport:AT2G01330"
                     /db_xref="TAIR:AT2G01330"
                     /translation="MAKLLETFPCVPSTERGRGILISGDSKSDTILYCNGRSVFIRSL
                     RQLQDVQVYGEHGYAVTVARYSPNGEWIASADVSGTVRVWGTHNGFVLKNEFRVLAGR
                     VDDLQWSFDGLRIVASGDGKGKSLVRSFAWDSGNTMGDFDGHSRRVLSCAFKPTRPFR
                     IATCGEDFLVNFYDGPPFKFHSSHREHSNFVNCIRYSPDGTKFITVSSDKKGMIYDGK
                     TGDKVGELASEDGHKGSIYAVSWSPDSKRVLTVSADKSAKVWEVAEDGTIGSVIKTLS
                     FMESGGAEDMLVGCLWQNDHLITVSLGGTMSLFSADDMDKPPLLLSGHIKNVTSLAVL
                     GENQKTILSCSYDGLIVKWLKGVGYSCKLQMKDTKIKRLAATESSIFISGYDNMVWRI
                     PLTDNGYGAAEHVDIGHQPLDISIAVDSPEATALVSFDSGVVLLNGLNILSKIDLGFA
                     VAASVISPDGKEAIVGGQDGKLHIYSVSGDNNLKEEAVLEKHRGALTVIRYSPDLTMF
                     ASGDANREAVVWDRETKQVKLNNMLFHTARINSLAWSPNNKMVATGSIDTCVIVYEVD
                     KPASSRITARNAHLGGVNAVAFIDDCTVASSGEDASVRLWHIEPQ"
     gene            163954..165290
                     /gene="At17.1"
                     /locus_tag="AT2G01340"
                     /gene_synonym="F10A8.22"
                     /gene_synonym="F10A8_22"
                     /note="Encodes a protein whose expression is responsive to
                     nematode infection."
                     /db_xref="Araport:AT2G01340"
                     /db_xref="TAIR:AT2G01340"
     mRNA            join(163954..164187,164293..164709,165012..165290)
                     /gene="At17.1"
                     /locus_tag="AT2G01340"
                     /gene_synonym="F10A8.22"
                     /gene_synonym="F10A8_22"
                     /product="plastid movement impaired protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH817971.1,INSD:AI998967.1,INSD:DR381991.1,
                     INSD:EG489968.1,INSD:EG489970.1,INSD:DR370452.1,
                     INSD:BP647323.1,INSD:DR195639.1,INSD:DR195637.1,
                     INSD:AV567706.1,INSD:F20095.1,INSD:EL063974.1,
                     INSD:EL116407.1,INSD:EG489951.1,INSD:EG489947.1,
                     INSD:BP625400.1,INSD:EG489975.1,INSD:BP828310.1,
                     INSD:EG489946.1,INSD:EL341023.1,INSD:EG489949.1,
                     INSD:AV552747.1,INSD:EG489976.1,INSD:EG489992.1,
                     INSD:ES133712.1,INSD:AA605560.1,INSD:BP640790.1,
                     INSD:EG489969.1,INSD:AV788779.1,INSD:ES203190.1,
                     INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
                     INSD:ES142510.1,INSD:AA597480.1,INSD:AV807584.1,
                     INSD:AU229941.1,INSD:AV824928.1,INSD:DR195635.1,
                     INSD:EG489994.1,INSD:EG489989.1,INSD:EH978378.1,
                     INSD:DR382969.1,INSD:BP654757.1,INSD:EL057912.1,
                     INSD:DR195638.1,INSD:DR376100.1,INSD:EG489995.1,
                     INSD:EG489997.1,INSD:EH796977.1,INSD:EG489990.1,
                     INSD:AV561135.1,INSD:EG489971.1,INSD:EG489948.1,
                     INSD:EH965219.1,INSD:AV544254.1,INSD:EH907781.1,
                     INSD:DR195636.1,INSD:H77204.1,INSD:AA597406.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AK226497.1,INSD:BT025275.1,INSD:BT021987.1"
                     /db_xref="TAIR:AT2G01340"
                     /db_xref="Araport:AT2G01340"
     CDS             join(164014..164187,164293..164709,165012..165068)
                     /gene="At17.1"
                     /locus_tag="AT2G01340"
                     /gene_synonym="F10A8.22"
                     /gene_synonym="F10A8_22"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH817971.1,INSD:AI998967.1,INSD:DR381991.1,
                     INSD:EG489968.1,INSD:EG489970.1,INSD:DR370452.1,
                     INSD:BP647323.1,INSD:DR195639.1,INSD:DR195637.1,
                     INSD:AV567706.1,INSD:F20095.1,INSD:EL063974.1,
                     INSD:EL116407.1,INSD:EG489951.1,INSD:EG489947.1,
                     INSD:BP625400.1,INSD:EG489975.1,INSD:BP828310.1,
                     INSD:EG489946.1,INSD:EL341023.1,INSD:EG489949.1,
                     INSD:AV552747.1,INSD:EG489976.1,INSD:EG489992.1,
                     INSD:ES133712.1,INSD:AA605560.1,INSD:BP640790.1,
                     INSD:EG489969.1,INSD:AV788779.1,INSD:ES203190.1,
                     INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
                     INSD:ES142510.1,INSD:AA597480.1,INSD:AV807584.1,
                     INSD:AU229941.1,INSD:AV824928.1,INSD:DR195635.1,
                     INSD:EG489994.1,INSD:EG489989.1,INSD:EH978378.1,
                     INSD:DR382969.1,INSD:BP654757.1,INSD:EL057912.1,
                     INSD:DR195638.1,INSD:DR376100.1,INSD:EG489995.1,
                     INSD:EG489997.1,INSD:EH796977.1,INSD:EG489990.1,
                     INSD:AV561135.1,INSD:EG489971.1,INSD:EG489948.1,
                     INSD:EH965219.1,INSD:AV544254.1,INSD:EH907781.1,
                     INSD:DR195636.1,INSD:H77204.1,INSD:AA597406.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AK226497.1,INSD:BT025275.1,INSD:BT021987.1"
                     /note="At17.1; FUNCTIONS IN: molecular_function unknown;
                     INVOLVED IN: N-terminal protein myristoylation, response
                     to nematode; LOCATED IN: plasma membrane; BEST Arabidopsis
                     thaliana protein match is: plastid movement impaired 2
                     (TAIR:AT1G66480.1); Has 110 Blast hits to 110 proteins in
                     13 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
                     0; Plants - 107; Viruses - 0; Other Eukaryotes - 3
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="plastid movement impaired protein"
                     /protein_id="AEC05438.1"
                     /db_xref="Araport:AT2G01340"
                     /db_xref="TAIR:AT2G01340"
                     /translation="MGNSLGGKKTTKVMKIDGETFKLKTPVTAEEVLKDFPGHVLLDS
                     ESVKHYGARAKPLEAKQRLEAKRLYFVVEPVKECPPRRVRSGIHVSAKERLESLMLAR
                     RSSSDLSILKPPGGWTTEEEEGAVRRVKVRIPKAELEKLVKEGATEAEATQKIAALFM
                     AKQRQEEAYQNTRQDEPATTATATATTTATRGVKSRLKRVSFMAERGGGSEITVA"
     gene            complement(165141..167259)
                     /gene="QPT"
                     /locus_tag="AT2G01350"
                     /gene_synonym="F10A8.23"
                     /gene_synonym="F10A8_23"
                     /gene_synonym="quinolinate phoshoribosyltransferase"
                     /note="At2g01350 encodes quinolinate phosphoribosyl
                     transferase involved in NAD biosynthesis as shown by
                     heterologous expression in E. coli."
                     /db_xref="Araport:AT2G01350"
                     /db_xref="TAIR:AT2G01350"
     mRNA            complement(join(165141..165428,165512..165579,
                     165652..165828,165915..166067,166200..166283,
                     166491..166637,166723..166856,166935..167071,
                     167160..167259))
                     /gene="QPT"
                     /locus_tag="AT2G01350"
                     /gene_synonym="F10A8.23"
                     /gene_synonym="F10A8_23"
                     /gene_synonym="quinolinate phoshoribosyltransferase"
                     /product="quinolinate phoshoribosyltransferase"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR227211.1,INSD:EH852095.1,INSD:DR253391.1,
                     INSD:ES050510.1,INSD:EG489968.1,INSD:EG489970.1,
                     INSD:ES091571.1,INSD:ES068432.1,INSD:DR370452.1,
                     INSD:EL043779.1,INSD:BP647323.1,INSD:EL339442.1,
                     INSD:EL060425.1,INSD:AV567706.1,INSD:ES200271.1,
                     INSD:F20095.1,INSD:EL063974.1,INSD:EH909870.1,
                     INSD:EL116407.1,INSD:ES042884.1,INSD:BP625400.1,
                     INSD:EG489951.1,INSD:EG489947.1,INSD:ES015962.1,
                     INSD:ES068020.1,INSD:EG489975.1,INSD:BP828310.1,
                     INSD:EG489946.1,INSD:ES185091.1,INSD:EL341023.1,
                     INSD:EG489949.1,INSD:EG489976.1,INSD:ES209928.1,
                     INSD:EG489992.1,INSD:AA605560.1,INSD:ES133712.1,
                     INSD:BP640790.1,INSD:EG489969.1,INSD:AV788779.1,
                     INSD:ES203190.1,INSD:EL298540.1,INSD:ES071276.1,
                     INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
                     INSD:ES142510.1,INSD:EL090267.1,INSD:ES064918.1,
                     INSD:DR253404.1,INSD:DR356976.1,INSD:AU229941.1,
                     INSD:EG489994.1,INSD:DR227210.1,INSD:DR253408.1,
                     INSD:EG489989.1,INSD:EH978378.1,INSD:DR382969.1,
                     INSD:BP654757.1,INSD:ES023089.1,INSD:DR376100.1,
                     INSD:EG489995.1,INSD:ES074280.1,INSD:EG489997.1,
                     INSD:EH796977.1,INSD:EG489990.1,INSD:AV561135.1,
                     INSD:EG489971.1,INSD:EG489948.1,INSD:DR227209.1,
                     INSD:EH804801.1,INSD:EH965219.1,INSD:ES206307.1,
                     INSD:AV544254.1,INSD:ES108394.1,INSD:EL150270.1,
                     INSD:ES136762.1,INSD:ES097394.1,INSD:EH940894.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AK222052.1"
                     /db_xref="TAIR:AT2G01350"
                     /db_xref="Araport:AT2G01350"
     mRNA            complement(join(165141..165428,165512..165579,
                     165652..165828,165915..166067,166200..166283,
                     166491..166619,166723..166856,166935..167071,
                     167160..167253))
                     /gene="QPT"
                     /locus_tag="AT2G01350"
                     /gene_synonym="F10A8.23"
                     /gene_synonym="F10A8_23"
                     /gene_synonym="quinolinate phoshoribosyltransferase"
                     /product="quinolinate phoshoribosyltransferase"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH852095.1,INSD:AV829736.1,INSD:ES091571.1,
                     INSD:DR253410.1,INSD:BP647323.1,INSD:EL060425.1,
                     INSD:F20095.1,INSD:EL063974.1,INSD:EL116407.1,
                     INSD:EH909870.1,INSD:ES015962.1,INSD:EG489951.1,
                     INSD:DR253394.1,INSD:DR253402.1,INSD:ES209928.1,
                     INSD:DR253392.1,INSD:ES133712.1,INSD:AA605560.1,
                     INSD:EG489969.1,INSD:AV788779.1,INSD:ES203190.1,
                     INSD:ES199799.1,INSD:DR253398.1,INSD:DR253408.1,
                     INSD:EH978378.1,INSD:EG489989.1,INSD:DR376100.1,
                     INSD:DR253412.1,INSD:EG489997.1,INSD:EG489990.1,
                     INSD:AV561135.1,INSD:EG489971.1,INSD:DR253390.1,
                     INSD:EH804801.1,INSD:DR253393.1,INSD:ES037813.1,
                     INSD:ES108394.1,INSD:EL150270.1,INSD:ES136762.1,
                     INSD:EH940894.1,INSD:DR253396.1,INSD:DR253409.1,
                     INSD:BP802173.1,INSD:BP819756.1,INSD:ES050510.1,
                     INSD:DR253391.1,INSD:EG489968.1,INSD:DR253407.1,
                     INSD:EG489970.1,INSD:ES068432.1,INSD:DR370452.1,
                     INSD:EL043779.1,INSD:EL339442.1,INSD:BP830351.1,
                     INSD:DR253397.1,INSD:AV567706.1,INSD:ES200271.1,
                     INSD:DR253403.1,INSD:ES042884.1,INSD:EG489947.1,
                     INSD:BP625400.1,INSD:EG489975.1,INSD:ES068020.1,
                     INSD:BP828310.1,INSD:EG489946.1,INSD:ES185091.1,
                     INSD:EL341023.1,INSD:EG489949.1,INSD:EG489976.1,
                     INSD:DR253405.1,INSD:EG489992.1,INSD:ES051581.1,
                     INSD:BP640790.1,INSD:F20096.1,INSD:DR253411.1,
                     INSD:DR253406.1,INSD:EL298540.1,INSD:DR253401.1,
                     INSD:ES071276.1,INSD:EL263638.1,INSD:EG489993.1,
                     INSD:ES142510.1,INSD:ES064918.1,INSD:EL090267.1,
                     INSD:AU238711.1,INSD:DR253404.1,INSD:DR253400.1,
                     INSD:DR356976.1,INSD:AU229941.1,INSD:BP796261.1,
                     INSD:EG489994.1,INSD:DR253399.1,INSD:DR227210.1,
                     INSD:DR382969.1,INSD:BP654757.1,INSD:ES023089.1,
                     INSD:EG489995.1,INSD:ES074280.1,INSD:EH796977.1,
                     INSD:EG489948.1,INSD:EH965219.1,INSD:ES206307.1,
                     INSD:AV544254.1,INSD:ES097394.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY057685.1,INSD:AY116955.1,INSD:AK222052.1,
                     INSD:AY086867.1,INSD:AK117875.1"
                     /db_xref="TAIR:AT2G01350"
                     /db_xref="Araport:AT2G01350"
     mRNA            complement(join(165141..165428,165512..165579,
                     165652..165828,165915..166067,166200..166283,
                     166491..166637,166723..167071,167160..167247))
                     /gene="QPT"
                     /locus_tag="AT2G01350"
                     /gene_synonym="F10A8.23"
                     /gene_synonym="F10A8_23"
                     /gene_synonym="quinolinate phoshoribosyltransferase"
                     /product="quinolinate phoshoribosyltransferase"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH852095.1,INSD:ES050510.1,INSD:EG489968.1,
                     INSD:EG489970.1,INSD:ES091571.1,INSD:ES068432.1,
                     INSD:DR370452.1,INSD:EL043779.1,INSD:BP647323.1,
                     INSD:EL339442.1,INSD:EL060425.1,INSD:AV567706.1,
                     INSD:ES200271.1,INSD:F20095.1,INSD:EL063974.1,
                     INSD:EH909870.1,INSD:EL116407.1,INSD:ES042884.1,
                     INSD:BP625400.1,INSD:EG489951.1,INSD:EG489947.1,
                     INSD:ES015962.1,INSD:ES068020.1,INSD:EG489975.1,
                     INSD:BP828310.1,INSD:EG489946.1,INSD:ES185091.1,
                     INSD:EL341023.1,INSD:EG489949.1,INSD:EG489976.1,
                     INSD:ES209928.1,INSD:ES051581.1,INSD:EG489992.1,
                     INSD:AA605560.1,INSD:ES133712.1,INSD:BP640790.1,
                     INSD:F20096.1,INSD:EG489969.1,INSD:AV788779.1,
                     INSD:ES203190.1,INSD:EL298540.1,INSD:ES071276.1,
                     INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
                     INSD:ES142510.1,INSD:EL090267.1,INSD:ES064918.1,
                     INSD:AU229941.1,INSD:EG489994.1,INSD:EG489989.1,
                     INSD:EH978378.1,INSD:DR382969.1,INSD:BP654757.1,
                     INSD:ES023089.1,INSD:DR376100.1,INSD:EG489995.1,
                     INSD:ES074280.1,INSD:EG489997.1,INSD:EH796977.1,
                     INSD:EG489990.1,INSD:AV561135.1,INSD:EG489971.1,
                     INSD:EG489948.1,INSD:EH804801.1,INSD:EH965219.1,
                     INSD:ES206307.1,INSD:ES037813.1,INSD:AV544254.1,
                     INSD:ES108394.1,INSD:EL150270.1,INSD:DR288876.1,
                     INSD:ES136762.1,INSD:ES097394.1,INSD:EH940894.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AK222052.1"
                     /db_xref="TAIR:AT2G01350"
                     /db_xref="Araport:AT2G01350"
     mRNA            complement(join(165141..165428,165512..165579,
                     165652..165828,165915..166067,166200..166283,
                     166491..166637,166723..166856,166935..167247))
                     /gene="QPT"
                     /locus_tag="AT2G01350"
                     /gene_synonym="F10A8.23"
                     /gene_synonym="F10A8_23"
                     /gene_synonym="quinolinate phoshoribosyltransferase"
                     /product="quinolinate phoshoribosyltransferase"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH852095.1,INSD:DR253391.1,INSD:ES050510.1,
                     INSD:DR356975.1,INSD:EG489968.1,INSD:EG489970.1,
                     INSD:ES091571.1,INSD:ES068432.1,INSD:DR370452.1,
                     INSD:EL043779.1,INSD:BP647323.1,INSD:EL339442.1,
                     INSD:EH872393.1,INSD:EL060425.1,INSD:AV567706.1,
                     INSD:ES200271.1,INSD:F20095.1,INSD:EL063974.1,
                     INSD:EH909870.1,INSD:EL116407.1,INSD:ES042884.1,
                     INSD:BP625400.1,INSD:EG489951.1,INSD:EG489947.1,
                     INSD:ES015962.1,INSD:ES068020.1,INSD:EG489975.1,
                     INSD:BP828310.1,INSD:EG489946.1,INSD:ES185091.1,
                     INSD:EL341023.1,INSD:EG489949.1,INSD:EG489976.1,
                     INSD:ES209928.1,INSD:ES051581.1,INSD:EG489992.1,
                     INSD:AA605560.1,INSD:ES133712.1,INSD:BP640790.1,
                     INSD:F20096.1,INSD:EG489969.1,INSD:AV788779.1,
                     INSD:ES203190.1,INSD:EL298540.1,INSD:ES071276.1,
                     INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
                     INSD:ES142510.1,INSD:DR356974.1,INSD:EL090267.1,
                     INSD:ES064918.1,INSD:DR356976.1,INSD:AU229941.1,
                     INSD:EL323396.1,INSD:EG489994.1,INSD:DR227210.1,
                     INSD:EG489989.1,INSD:EH978378.1,INSD:DR382969.1,
                     INSD:BP654757.1,INSD:ES023089.1,INSD:DR376100.1,
                     INSD:EG489995.1,INSD:ES074280.1,INSD:EG489997.1,
                     INSD:EH796977.1,INSD:EG489990.1,INSD:AV561135.1,
                     INSD:EG489971.1,INSD:EG489948.1,INSD:EH804801.1,
                     INSD:EH965219.1,INSD:ES206307.1,INSD:ES037813.1,
                     INSD:AV544254.1,INSD:ES108394.1,INSD:EL150270.1,
                     INSD:ES097394.1,INSD:ES136762.1,INSD:EH940894.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820514.1,INSD:AK222052.1"
                     /db_xref="TAIR:AT2G01350"
                     /db_xref="Araport:AT2G01350"
     CDS             complement(join(165332..165428,165512..165579,
                     165652..165828,165915..166067,166200..166283,
                     166491..166619,166723..166856,166935..167071,
                     167160..167209))
                     /gene="QPT"
                     /locus_tag="AT2G01350"
                     /gene_synonym="F10A8.23"
                     /gene_synonym="F10A8_23"
                     /gene_synonym="quinolinate phoshoribosyltransferase"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR227211.1,INSD:EH852095.1,INSD:DR253391.1,
                     INSD:ES050510.1,INSD:EG489968.1,INSD:EG489970.1,
                     INSD:ES091571.1,INSD:ES068432.1,INSD:DR370452.1,
                     INSD:EL043779.1,INSD:BP647323.1,INSD:EL339442.1,
                     INSD:EL060425.1,INSD:AV567706.1,INSD:ES200271.1,
                     INSD:F20095.1,INSD:EL063974.1,INSD:EH909870.1,
                     INSD:EL116407.1,INSD:ES042884.1,INSD:BP625400.1,
                     INSD:EG489951.1,INSD:EG489947.1,INSD:ES015962.1,
                     INSD:ES068020.1,INSD:EG489975.1,INSD:BP828310.1,
                     INSD:EG489946.1,INSD:ES185091.1,INSD:EL341023.1,
                     INSD:EG489949.1,INSD:EG489976.1,INSD:ES209928.1,
                     INSD:EG489992.1,INSD:AA605560.1,INSD:ES133712.1,
                     INSD:BP640790.1,INSD:EG489969.1,INSD:AV788779.1,
                     INSD:ES203190.1,INSD:EL298540.1,INSD:ES071276.1,
                     INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
                     INSD:ES142510.1,INSD:EL090267.1,INSD:ES064918.1,
                     INSD:DR253404.1,INSD:DR356976.1,INSD:AU229941.1,
                     INSD:EG489994.1,INSD:DR227210.1,INSD:DR253408.1,
                     INSD:EG489989.1,INSD:EH978378.1,INSD:DR382969.1,
                     INSD:BP654757.1,INSD:ES023089.1,INSD:DR376100.1,
                     INSD:EG489995.1,INSD:ES074280.1,INSD:EG489997.1,
                     INSD:EH796977.1,INSD:EG489990.1,INSD:AV561135.1,
                     INSD:EG489971.1,INSD:EG489948.1,INSD:DR227209.1,
                     INSD:EH804801.1,INSD:EH965219.1,INSD:ES206307.1,
                     INSD:AV544254.1,INSD:ES108394.1,INSD:EL150270.1,
                     INSD:ES136762.1,INSD:ES097394.1,INSD:EH940894.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AK222052.1"
                     /note="quinolinate phoshoribosyltransferase (QPT);
                     FUNCTIONS IN: nicotinate-nucleotide diphosphorylase
                     (carboxylating) activity; INVOLVED IN: NAD biosynthetic
                     process; LOCATED IN: chloroplast; EXPRESSED IN: 23 plant
                     structures; EXPRESSED DURING: 13 growth stages; CONTAINS
                     InterPro DOMAIN/s: Aldolase-type TIM barrel
                     (InterPro:IPR013785), Nicotinate-nucleotide
                     pyrophosphorylase (InterPro:IPR004393), Quinolinate
                     phosphoribosyl transferase, N-terminal
                     (InterPro:IPR022412), Quinolinate phosphoribosyl
                     transferase, C-terminal domain (InterPro:IPR002638); Has
                     5825 Blast hits to 5825 proteins in 1916 species: Archae -
                     184; Bacteria - 3588; Metazoa - 59; Fungi - 124; Plants -
                     57; Viruses - 0; Other Eukaryotes - 1813 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="quinolinate phoshoribosyltransferase"
                     /protein_id="AEC05441.1"
                     /db_xref="Araport:AT2G01350"
                     /db_xref="TAIR:AT2G01350"
                     /translation="MISVSRFLSPQFYAIPRSFVKMSASATQTAGEVSMGIKPPSHPT
                     YDLKAVIKLALAEDAGHTGDVTCMATIPFDMEVEAYFLAKEDGIVAGVALADMIFEHV
                     DPSLKDGDYVHKGLKFGKVSGNAHKIVVAERVLLNFMQRMSGIATLTKLMADAASPAC
                     ILETRKTAPGLRLVDKWAVLIGGGRNHRMGLFDMVMIKDNHISAAGGIVNAVKSVDEY
                     LKQKNLEMDVEVETRTLEEVKEVLEYASGSETRLTRIMLDNMVVPLENGDVDVTMLKD
                     AVELINGRFETEASGNVTLETVHKIGQSGVTFISSGALTHSVKALDISLKIDTELALE
                     VGRRTKRA"
     CDS             complement(join(165332..165428,165512..165579,
                     165652..165828,165915..166067,166200..166283,
                     166491..166637,166723..166856,166935..167071,
                     167160..167209))
                     /gene="QPT"
                     /locus_tag="AT2G01350"
                     /gene_synonym="F10A8.23"
                     /gene_synonym="F10A8_23"
                     /gene_synonym="quinolinate phoshoribosyltransferase"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH852095.1,INSD:AV829736.1,INSD:ES091571.1,
                     INSD:DR253410.1,INSD:BP647323.1,INSD:EL060425.1,
                     INSD:F20095.1,INSD:EL063974.1,INSD:EL116407.1,
                     INSD:EH909870.1,INSD:ES015962.1,INSD:EG489951.1,
                     INSD:DR253394.1,INSD:DR253402.1,INSD:ES209928.1,
                     INSD:DR253392.1,INSD:ES133712.1,INSD:AA605560.1,
                     INSD:EG489969.1,INSD:AV788779.1,INSD:ES203190.1,
                     INSD:ES199799.1,INSD:DR253398.1,INSD:DR253408.1,
                     INSD:EH978378.1,INSD:EG489989.1,INSD:DR376100.1,
                     INSD:DR253412.1,INSD:EG489997.1,INSD:EG489990.1,
                     INSD:AV561135.1,INSD:EG489971.1,INSD:DR253390.1,
                     INSD:EH804801.1,INSD:DR253393.1,INSD:ES037813.1,
                     INSD:ES108394.1,INSD:EL150270.1,INSD:ES136762.1,
                     INSD:EH940894.1,INSD:DR253396.1,INSD:DR253409.1,
                     INSD:BP802173.1,INSD:BP819756.1,INSD:ES050510.1,
                     INSD:DR253391.1,INSD:EG489968.1,INSD:DR253407.1,
                     INSD:EG489970.1,INSD:ES068432.1,INSD:DR370452.1,
                     INSD:EL043779.1,INSD:EL339442.1,INSD:BP830351.1,
                     INSD:DR253397.1,INSD:AV567706.1,INSD:ES200271.1,
                     INSD:DR253403.1,INSD:ES042884.1,INSD:EG489947.1,
                     INSD:BP625400.1,INSD:EG489975.1,INSD:ES068020.1,
                     INSD:BP828310.1,INSD:EG489946.1,INSD:ES185091.1,
                     INSD:EL341023.1,INSD:EG489949.1,INSD:EG489976.1,
                     INSD:DR253405.1,INSD:EG489992.1,INSD:ES051581.1,
                     INSD:BP640790.1,INSD:F20096.1,INSD:DR253411.1,
                     INSD:DR253406.1,INSD:EL298540.1,INSD:DR253401.1,
                     INSD:ES071276.1,INSD:EL263638.1,INSD:EG489993.1,
                     INSD:ES142510.1,INSD:ES064918.1,INSD:EL090267.1,
                     INSD:AU238711.1,INSD:DR253404.1,INSD:DR253400.1,
                     INSD:DR356976.1,INSD:AU229941.1,INSD:BP796261.1,
                     INSD:EG489994.1,INSD:DR253399.1,INSD:DR227210.1,
                     INSD:DR382969.1,INSD:BP654757.1,INSD:ES023089.1,
                     INSD:EG489995.1,INSD:ES074280.1,INSD:EH796977.1,
                     INSD:EG489948.1,INSD:EH965219.1,INSD:ES206307.1,
                     INSD:AV544254.1,INSD:ES097394.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY057685.1,INSD:AY116955.1,INSD:AK222052.1,
                     INSD:AY086867.1,INSD:AK117875.1"
                     /note="quinolinate phoshoribosyltransferase (QPT);
                     FUNCTIONS IN: nicotinate-nucleotide diphosphorylase
                     (carboxylating) activity; INVOLVED IN: NAD biosynthetic
                     process; LOCATED IN: chloroplast; EXPRESSED IN: 23 plant
                     structures; EXPRESSED DURING: 13 growth stages; CONTAINS
                     InterPro DOMAIN/s: Aldolase-type TIM barrel
                     (InterPro:IPR013785), Nicotinate-nucleotide
                     pyrophosphorylase (InterPro:IPR004393), Quinolinate
                     phosphoribosyl transferase, N-terminal
                     (InterPro:IPR022412), Quinolinate phosphoribosyl
                     transferase, C-terminal domain (InterPro:IPR002638); Has
                     5853 Blast hits to 5853 proteins in 1914 species: Archae -
                     184; Bacteria - 3582; Metazoa - 59; Fungi - 129; Plants -
                     57; Viruses - 0; Other Eukaryotes - 1842 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="quinolinate phoshoribosyltransferase"
                     /protein_id="AEC05440.1"
                     /db_xref="Araport:AT2G01350"
                     /db_xref="TAIR:AT2G01350"
                     /translation="MISVSRFLSPQFYAIPRSFVKMSASATQTAGEVSMGIKPPSHPT
                     YDLKAVIKLALAEDAGHTGDVTCMATIPFDMEVEAYFLAKEDGIVAGVALADMIFEHV
                     DPSLKVEWMRKDGDYVHKGLKFGKVSGNAHKIVVAERVLLNFMQRMSGIATLTKLMAD
                     AASPACILETRKTAPGLRLVDKWAVLIGGGRNHRMGLFDMVMIKDNHISAAGGIVNAV
                     KSVDEYLKQKNLEMDVEVETRTLEEVKEVLEYASGSETRLTRIMLDNMVVPLENGDVD
                     VTMLKDAVELINGRFETEASGNVTLETVHKIGQSGVTFISSGALTHSVKALDISLKID
                     TELALEVGRRTKRA"
     CDS             complement(join(165332..165428,165512..165579,
                     165652..165828,165915..166067,166200..166283,
                     166491..166637,166723..166856,166935..167058))
                     /gene="QPT"
                     /locus_tag="AT2G01350"
                     /gene_synonym="F10A8.23"
                     /gene_synonym="F10A8_23"
                     /gene_synonym="quinolinate phoshoribosyltransferase"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH852095.1,INSD:ES050510.1,INSD:EG489968.1,
                     INSD:EG489970.1,INSD:ES091571.1,INSD:ES068432.1,
                     INSD:DR370452.1,INSD:EL043779.1,INSD:BP647323.1,
                     INSD:EL339442.1,INSD:EL060425.1,INSD:AV567706.1,
                     INSD:ES200271.1,INSD:F20095.1,INSD:EL063974.1,
                     INSD:EH909870.1,INSD:EL116407.1,INSD:ES042884.1,
                     INSD:BP625400.1,INSD:EG489951.1,INSD:EG489947.1,
                     INSD:ES015962.1,INSD:ES068020.1,INSD:EG489975.1,
                     INSD:BP828310.1,INSD:EG489946.1,INSD:ES185091.1,
                     INSD:EL341023.1,INSD:EG489949.1,INSD:EG489976.1,
                     INSD:ES209928.1,INSD:ES051581.1,INSD:EG489992.1,
                     INSD:AA605560.1,INSD:ES133712.1,INSD:BP640790.1,
                     INSD:F20096.1,INSD:EG489969.1,INSD:AV788779.1,
                     INSD:ES203190.1,INSD:EL298540.1,INSD:ES071276.1,
                     INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
                     INSD:ES142510.1,INSD:EL090267.1,INSD:ES064918.1,
                     INSD:AU229941.1,INSD:EG489994.1,INSD:EG489989.1,
                     INSD:EH978378.1,INSD:DR382969.1,INSD:BP654757.1,
                     INSD:ES023089.1,INSD:DR376100.1,INSD:EG489995.1,
                     INSD:ES074280.1,INSD:EG489997.1,INSD:EH796977.1,
                     INSD:EG489990.1,INSD:AV561135.1,INSD:EG489971.1,
                     INSD:EG489948.1,INSD:EH804801.1,INSD:EH965219.1,
                     INSD:ES206307.1,INSD:ES037813.1,INSD:AV544254.1,
                     INSD:ES108394.1,INSD:EL150270.1,INSD:DR288876.1,
                     INSD:ES136762.1,INSD:ES097394.1,INSD:EH940894.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AK222052.1"
                     /note="quinolinate phoshoribosyltransferase (QPT);
                     FUNCTIONS IN: nicotinate-nucleotide diphosphorylase
                     (carboxylating) activity; INVOLVED IN: NAD biosynthetic
                     process; LOCATED IN: chloroplast; EXPRESSED IN: 23 plant
                     structures; EXPRESSED DURING: 13 growth stages; CONTAINS
                     InterPro DOMAIN/s: Aldolase-type TIM barrel
                     (InterPro:IPR013785), Nicotinate-nucleotide
                     pyrophosphorylase (InterPro:IPR004393), Quinolinate
                     phosphoribosyl transferase, N-terminal
                     (InterPro:IPR022412), Quinolinate phosphoribosyl
                     transferase, C-terminal domain (InterPro:IPR002638); Has
                     5862 Blast hits to 5862 proteins in 1918 species: Archae -
                     184; Bacteria - 3596; Metazoa - 59; Fungi - 124; Plants -
                     57; Viruses - 0; Other Eukaryotes - 1842 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="quinolinate phoshoribosyltransferase"
                     /protein_id="AEC05442.1"
                     /db_xref="Araport:AT2G01350"
                     /db_xref="TAIR:AT2G01350"
                     /translation="MSASATQTAGEVSMGIKPPSHPTYDLKAVIKLALAEDAGHTGDV
                     TCMATIPFDMEVEAYFLAKEDGIVAGVALADMIFEHVDPSLKVEWMRKDGDYVHKGLK
                     FGKVSGNAHKIVVAERVLLNFMQRMSGIATLTKLMADAASPACILETRKTAPGLRLVD
                     KWAVLIGGGRNHRMGLFDMVMIKDNHISAAGGIVNAVKSVDEYLKQKNLEMDVEVETR
                     TLEEVKEVLEYASGSETRLTRIMLDNMVVPLENGDVDVTMLKDAVELINGRFETEASG
                     NVTLETVHKIGQSGVTFISSGALTHSVKALDISLKIDTELALEVGRRTKRA"
     CDS             complement(join(165332..165428,165512..165579,
                     165652..165828,165915..166067,166200..166283,
                     166491..166637,166723..166842))
                     /gene="QPT"
                     /locus_tag="AT2G01350"
                     /gene_synonym="F10A8.23"
                     /gene_synonym="F10A8_23"
                     /gene_synonym="quinolinate phoshoribosyltransferase"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH852095.1,INSD:DR253391.1,INSD:ES050510.1,
                     INSD:DR356975.1,INSD:EG489968.1,INSD:EG489970.1,
                     INSD:ES091571.1,INSD:ES068432.1,INSD:DR370452.1,
                     INSD:EL043779.1,INSD:BP647323.1,INSD:EL339442.1,
                     INSD:EH872393.1,INSD:EL060425.1,INSD:AV567706.1,
                     INSD:ES200271.1,INSD:F20095.1,INSD:EL063974.1,
                     INSD:EH909870.1,INSD:EL116407.1,INSD:ES042884.1,
                     INSD:BP625400.1,INSD:EG489951.1,INSD:EG489947.1,
                     INSD:ES015962.1,INSD:ES068020.1,INSD:EG489975.1,
                     INSD:BP828310.1,INSD:EG489946.1,INSD:ES185091.1,
                     INSD:EL341023.1,INSD:EG489949.1,INSD:EG489976.1,
                     INSD:ES209928.1,INSD:ES051581.1,INSD:EG489992.1,
                     INSD:AA605560.1,INSD:ES133712.1,INSD:BP640790.1,
                     INSD:F20096.1,INSD:EG489969.1,INSD:AV788779.1,
                     INSD:ES203190.1,INSD:EL298540.1,INSD:ES071276.1,
                     INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
                     INSD:ES142510.1,INSD:DR356974.1,INSD:EL090267.1,
                     INSD:ES064918.1,INSD:DR356976.1,INSD:AU229941.1,
                     INSD:EL323396.1,INSD:EG489994.1,INSD:DR227210.1,
                     INSD:EG489989.1,INSD:EH978378.1,INSD:DR382969.1,
                     INSD:BP654757.1,INSD:ES023089.1,INSD:DR376100.1,
                     INSD:EG489995.1,INSD:ES074280.1,INSD:EG489997.1,
                     INSD:EH796977.1,INSD:EG489990.1,INSD:AV561135.1,
                     INSD:EG489971.1,INSD:EG489948.1,INSD:EH804801.1,
                     INSD:EH965219.1,INSD:ES206307.1,INSD:ES037813.1,
                     INSD:AV544254.1,INSD:ES108394.1,INSD:EL150270.1,
                     INSD:ES097394.1,INSD:ES136762.1,INSD:EH940894.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820514.1,INSD:AK222052.1"
                     /note="quinolinate phoshoribosyltransferase (QPT);
                     FUNCTIONS IN: nicotinate-nucleotide diphosphorylase
                     (carboxylating) activity; INVOLVED IN: NAD biosynthetic
                     process; LOCATED IN: chloroplast; EXPRESSED IN: 23 plant
                     structures; EXPRESSED DURING: 13 growth stages; CONTAINS
                     InterPro DOMAIN/s: Aldolase-type TIM barrel
                     (InterPro:IPR013785), Nicotinate-nucleotide
                     pyrophosphorylase (InterPro:IPR004393), Quinolinate
                     phosphoribosyl transferase, N-terminal
                     (InterPro:IPR022412), Quinolinate phosphoribosyl
                     transferase, C-terminal domain (InterPro:IPR002638); Has
                     35333 Blast hits to 34131 proteins in 2444 species: Archae
                     - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991;
                     Plants - 531; Viruses - 0; Other Eukaryotes - 9610
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="quinolinate phoshoribosyltransferase"
                     /protein_id="AEC05439.1"
                     /db_xref="Araport:AT2G01350"
                     /db_xref="TAIR:AT2G01350"
                     /translation="MATIPFDMEVEAYFLAKEDGIVAGVALADMIFEHVDPSLKVEWM
                     RKDGDYVHKGLKFGKVSGNAHKIVVAERVLLNFMQRMSGIATLTKLMADAASPACILE
                     TRKTAPGLRLVDKWAVLIGGGRNHRMGLFDMVMIKDNHISAAGGIVNAVKSVDEYLKQ
                     KNLEMDVEVETRTLEEVKEVLEYASGSETRLTRIMLDNMVVPLENGDVDVTMLKDAVE
                     LINGRFETEASGNVTLETVHKIGQSGVTFISSGALTHSVKALDISLKIDTELALEVGR
                     RTKRA"
     gene            167931..168479
                     /locus_tag="AT2G01360"
                     /gene_synonym="F10A8.24"
                     /gene_synonym="F10A8_24"
                     /db_xref="Araport:AT2G01360"
                     /db_xref="TAIR:AT2G01360"
     mRNA            167931..168479
                     /locus_tag="AT2G01360"
                     /gene_synonym="F10A8.24"
                     /gene_synonym="F10A8_24"
                     /product="pentatricopeptide (PPR) repeat protein"
                     /inference="similar to RNA sequence, mRNA:INSD:BT015631.1"
                     /db_xref="TAIR:AT2G01360"
                     /db_xref="Araport:AT2G01360"
     CDS             167931..168479
                     /locus_tag="AT2G01360"
                     /gene_synonym="F10A8.24"
                     /gene_synonym="F10A8_24"
                     /inference="similar to RNA sequence, mRNA:INSD:BT015631.1"
                     /note="pentatricopeptide (PPR) repeat-containing protein;
                     CONTAINS InterPro DOMAIN/s: Pentatricopeptide repeat
                     (InterPro:IPR002885); BEST Arabidopsis thaliana protein
                     match is: Tetratricopeptide repeat (TPR)-like superfamily
                     protein (TAIR:AT2G01390.1); Has 425 Blast hits to 414
                     proteins in 21 species: Archae - 0; Bacteria - 0; Metazoa
                     - 0; Fungi - 0; Plants - 420; Viruses - 0; Other
                     Eukaryotes - 5 (source: NCBI BLink)."
                     /codon_start=1
                     /product="pentatricopeptide (PPR) repeat protein"
                     /protein_id="AEC05443.2"
                     /db_xref="Araport:AT2G01360"
                     /db_xref="TAIR:AT2G01360"
                     /translation="MTTNSWHSILVIYLASLALDWSLEMGIHLEKSAYLALAGNFLRS
                     NELSKVIDVVKEMVKSQHSLGVYHGAMLIHMLGFGRRPSLAAEALDLLPDDQKGLSAY
                     TALMDVYISAGSPEKAMKILGEMREREIMPSLGTYDVLLSGLEKTSDFQRETSSLRKE
                     QKSLVASTRFREIVHVEDKICM"
     gene            complement(168631..169642)
                     /locus_tag="AT2G01370"
                     /gene_synonym="F10A8.25"
                     /gene_synonym="F10A8_25"
                     /db_xref="Araport:AT2G01370"
                     /db_xref="TAIR:AT2G01370"
     mRNA            complement(168631..169642)
                     /locus_tag="AT2G01370"
                     /gene_synonym="F10A8.25"
                     /gene_synonym="F10A8_25"
                     /product="DNA-binding storekeeper protein-related
                     transcriptional regulator"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG434392.1,INSD:AY649247.1,INSD:EG434411.1,
                     INSD:EG434435.1,INSD:EG428775.1,INSD:EG428777.1,
                     INSD:EG434409.1,INSD:EG434412.1,INSD:EG428776.1,
                     INSD:EG434408.1,INSD:EG428772.1,INSD:EG428779.1,
                     INSD:EG434410.1,INSD:ES158940.1,INSD:EG434405.1,
                     INSD:EG428782.1,INSD:EG434406.1,INSD:EG428781.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY501359.1,INSD:AY464618.1"
                     /db_xref="TAIR:AT2G01370"
                     /db_xref="Araport:AT2G01370"
     CDS             complement(168791..169549)
                     /locus_tag="AT2G01370"
                     /gene_synonym="F10A8.25"
                     /gene_synonym="F10A8_25"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG434392.1,INSD:AY649247.1,INSD:EG434411.1,
                     INSD:EG434435.1,INSD:EG428775.1,INSD:EG428777.1,
                     INSD:EG434409.1,INSD:EG434412.1,INSD:EG428776.1,
                     INSD:EG434408.1,INSD:EG428772.1,INSD:EG428779.1,
                     INSD:EG434410.1,INSD:ES158940.1,INSD:EG434405.1,
                     INSD:EG428782.1,INSD:EG434406.1,INSD:EG428781.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY501359.1,INSD:AY464618.1"
                     /note="DNA-binding storekeeper protein-related
                     transcriptional regulator; CONTAINS InterPro DOMAIN/s:
                     Protein of unknown function DUF573 (InterPro:IPR007592);
                     BEST Arabidopsis thaliana protein match is: DNA-binding
                     storekeeper protein-related transcriptional regulator
                     (TAIR:AT1G55950.1); Has 264 Blast hits to 262 proteins in
                     14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
                     5; Plants - 259; Viruses - 0; Other Eukaryotes - 0
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="DNA-binding storekeeper protein-related
                     transcriptional regulator"
                     /protein_id="AEC05444.1"
                     /db_xref="Araport:AT2G01370"
                     /db_xref="TAIR:AT2G01370"
                     /translation="MKGITKKLLVSRSLKRLTAKKNRRKIHRETNKRLKPEEDPSMVK
                     RRQDSDSDSLEKEVSVVVTKTSDDEMVSTDTKKNYFQRIWSDDDEIVLLQGMVDFEND
                     KGKSPYDDMTGFIDTVKNFISFQANQHQFTTKIRRLKDKFLKKWNNGVDENSLVNAHD
                     RKCFQLSKVIWEPTTKVEEVGDWFVNSYLVGSIARLGVSEDVMKQSWSMVPIETKKEV
                     EEKFKLLKDEESENLRLKTSFLQKVNSMIIEATN"
     gene            complement(169967..170613)
                     /locus_tag="AT2G01372"
                     /note="Pseudogene of AT3G13062"
                     /pseudo
                     /db_xref="Araport:AT2G01372"
                     /db_xref="TAIR:AT2G01372"
     misc_RNA        complement(169967..170613)
                     /locus_tag="AT2G01372"
                     /note="pseudogene of Polyketide cyclase/dehydrase and
                     lipid transport superfamily protein;
                     AT2G01372.1"
                     /pseudo
                     /db_xref="Araport:AT2G01372"
                     /db_xref="TAIR:AT2G01372"
     gene            171098..171472
                     /locus_tag="AT2G01379"
                     /db_xref="Araport:AT2G01379"
     mRNA            171098..171472
                     /locus_tag="AT2G01379"
                     /product="transmembrane protein"
                     /db_xref="Araport:AT2G01379"
     CDS             171098..171343
                     /locus_tag="AT2G01379"
                     /codon_start=1
                     /product="transmembrane protein"
                     /protein_id="ANM61634.1"
                     /db_xref="Araport:AT2G01379"
                     /translation="MRIMWKFIIVMLCFIALVGSRGTSATSRLRMKKEDIGRRFALQN
                     KLQRGPVPPSQPSPCHNKLNPLSHSQVYSSHTYVTCP"
     gene            complement(171157..171433)
                     /locus_tag="AT2G03945"
                     /db_xref="Araport:AT2G03945"
     ncRNA           complement(171157..171433)
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT2G03945"
                     /product="other RNA"
                     /db_xref="Araport:AT2G03945"
     gene            172176..174137
                     /gene="EMB3111"
                     /locus_tag="AT2G01390"
                     /gene_synonym="EMBRYO DEFECTIVE 3111"
                     /gene_synonym="F10A8.29"
                     /db_xref="Araport:AT2G01390"
                     /db_xref="TAIR:AT2G01390"
     mRNA            join(172176..172976,173125..174137)
                     /gene="EMB3111"
                     /locus_tag="AT2G01390"
                     /gene_synonym="EMBRYO DEFECTIVE 3111"
                     /gene_synonym="F10A8.29"
                     /product="Tetratricopeptide repeat (TPR)-like superfamily
                     protein"
                     /inference="similar to RNA sequence, mRNA:INSD:BT012081.1"
                     /db_xref="TAIR:AT2G01390"
                     /db_xref="Araport:AT2G01390"
     CDS             join(172256..172976,173125..174137)
                     /gene="EMB3111"
                     /locus_tag="AT2G01390"
                     /gene_synonym="EMBRYO DEFECTIVE 3111"
                     /gene_synonym="F10A8.29"
                     /inference="similar to RNA sequence, mRNA:INSD:BT012081.1"
                     /note="Tetratricopeptide repeat (TPR)-like superfamily
                     protein; INVOLVED IN: biological_process unknown; LOCATED
                     IN: chloroplast; CONTAINS InterPro DOMAIN/s:
                     Pentatricopeptide repeat (InterPro:IPR002885); BEST
                     Arabidopsis thaliana protein match is: pentatricopeptide
                     (PPR) repeat-containing protein (TAIR:AT2G01360.1); Has
                     35333 Blast hits to 34131 proteins in 2444 species: Archae
                     - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991;
                     Plants - 531; Viruses - 0; Other Eukaryotes - 9610
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="Tetratricopeptide repeat (TPR)-like superfamily
                     protein"
                     /protein_id="AEC05445.1"
                     /db_xref="Araport:AT2G01390"
                     /db_xref="TAIR:AT2G01390"
                     /translation="MRFSSIFRNTPIQFSNRRSSVKLLHSLPRLKPTNSKRFSQKPKL
                     VKTQTLPDPSVYTRDIVSNIYNILKYSNWDSAQEQLPHLGVRWDSHIINRVLKAHPPM
                     QKAWLFFNWAAQIKGFKHDHFTYTTMLDIFGEAGRIQSMYSVFHLMKEKGVLIDTVTY
                     TSLIHWVSSSGDVDGAMRLWEEMRDNGCEPTVVSYTAYMKMLFADGRVEEATEVYKEM
                     LRSRVSPNCHTYTVLMEYLVATGKCEEALDIFFKMQEIGVQPDKAACNILIAKALKFG
                     ETSFMTRVLVYMKENGVVLRYPIFVEALETLKAAGESDDLLREVNSHISVESLCSSDI
                     DETPTAEVNDTKNSDDSRVISSVLLMKQNLVAVDILLNQMRDRNIKLDSFVVSAIIET
                     NCDRCRTEGASLAFDYSLEMGIHLKKSAYLALIGNFLRSNELPKVIEVVKEMVKAQHS
                     LGCYQGAMLIHRLGFGRRPRLAADVFDLLPDDQKGVAAYTALMDVYISAGSPEKAMKI
                     LREMREREIMPSLGTYDVLLSGLEKTSDFQKEVALLRKEKKSLVASARFRENVHVEDK
                     ICDLLFATNLL"
     gene            174168..175617
                     /locus_tag="AT2G01400"
                     /gene_synonym="F10A8.4"
                     /db_xref="Araport:AT2G01400"
                     /db_xref="TAIR:AT2G01400"
     mRNA            join(174168..174434,174760..175617)
                     /locus_tag="AT2G01400"
                     /gene_synonym="F10A8.4"
                     /product="hypothetical protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR316509.1,INSD:DR370358.1,INSD:EG503223.1,
                     INSD:EG420421.1,INSD:EH913036.1,INSD:ES139032.1,
                     INSD:EG512771.1,INSD:EL114840.1,INSD:EL206856.1,
                     INSD:AU229089.1,INSD:EG512761.1,INSD:EH915097.1,
                     INSD:ES047420.1,INSD:AU231107.1,INSD:EG425651.1,
                     INSD:CD533235.1,INSD:BP625867.1,INSD:DR316512.1,
                     INSD:CD530330.1,INSD:ES142449.1,INSD:BP787424.1,
                     INSD:EH901047.1,INSD:AI998222.1,INSD:DR316511.1,
                     INSD:DR378789.1,INSD:BP639670.1,INSD:EL020267.1,
                     INSD:EG512778.1,INSD:ES036621.1,INSD:ES123407.1,
                     INSD:EG503224.1,INSD:ES027931.1,INSD:ES078273.1,
                     INSD:EL250811.1,INSD:EH985658.1,INSD:DR316508.1,
                     INSD:CD533247.1,INSD:EG425656.1,INSD:EL013150.1,
                     INSD:EG420419.1,INSD:CD533145.1,INSD:EG496957.1,
                     INSD:EL088593.1,INSD:DR316510.1,INSD:EG425655.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY086346.1,INSD:BT004934.1,INSD:AK118883.1,
                     INSD:BX820561.1"
                     /db_xref="TAIR:AT2G01400"
                     /db_xref="Araport:AT2G01400"
     mRNA            join(174168..174434,174760..174988,175158..175180)
                     /locus_tag="AT2G01400"
                     /gene_synonym="F10A8.4"
                     /product="hypothetical protein"
                     /db_xref="Araport:AT2G01400"
                     /db_xref="TAIR:AT2G01400"
     CDS             join(174315..174434,174760..174988,175158..175180)
                     /locus_tag="AT2G01400"
                     /gene_synonym="F10A8.4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="ANM61587.1"
                     /db_xref="Araport:AT2G01400"
                     /db_xref="TAIR:AT2G01400"
                     /translation="MARSCSIWTPVLISLSPVTGESPKISRRRVILATSIGSPQPLLE
                     AKIKEPQKLQVLDSKDVSRRNTMLYLAAGFLGGINFLNGEAAEARVGRKENRKKALEK
                     LRAKAKESEPNNKSGFLLQNV"
     CDS             join(174315..174434,174760..175080)
                     /locus_tag="AT2G01400"
                     /gene_synonym="F10A8.4"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR316509.1,INSD:DR370358.1,INSD:EG503223.1,
                     INSD:EG420421.1,INSD:EH913036.1,INSD:ES139032.1,
                     INSD:EG512771.1,INSD:EL114840.1,INSD:EL206856.1,
                     INSD:AU229089.1,INSD:EG512761.1,INSD:EH915097.1,
                     INSD:ES047420.1,INSD:AU231107.1,INSD:EG425651.1,
                     INSD:CD533235.1,INSD:BP625867.1,INSD:DR316512.1,
                     INSD:CD530330.1,INSD:ES142449.1,INSD:BP787424.1,
                     INSD:EH901047.1,INSD:AI998222.1,INSD:DR316511.1,
                     INSD:DR378789.1,INSD:BP639670.1,INSD:EL020267.1,
                     INSD:EG512778.1,INSD:ES036621.1,INSD:ES123407.1,
                     INSD:EG503224.1,INSD:ES027931.1,INSD:ES078273.1,
                     INSD:EL250811.1,INSD:EH985658.1,INSD:DR316508.1,
                     INSD:CD533247.1,INSD:EG425656.1,INSD:EL013150.1,
                     INSD:EG420419.1,INSD:CD533145.1,INSD:EG496957.1,
                     INSD:EL088593.1,INSD:DR316510.1,INSD:EG425655.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY086346.1,INSD:BT004934.1,INSD:AK118883.1,
                     INSD:BX820561.1"
                     /note="unknown protein; Has 19 Blast hits to 19 proteins
                     in 6 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi
                     - 0; Plants - 19; Viruses - 0; Other Eukaryotes - 0
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEC05446.1"
                     /db_xref="Araport:AT2G01400"
                     /db_xref="TAIR:AT2G01400"
                     /translation="MARSCSIWTPVLISLSPVTGESPKISRRRVILATSIGSPQPLLE
                     AKIKEPQKLQVLDSKDVSRRNTMLYLAAGFLGGINFLNGEAAEARVGRKENRKKALEK
                     LRAKAKESEPNNKSGNQKIEKELEKEEVFPLLPPPLVVEANLLQ"
     gene            complement(175040..176407)
                     /locus_tag="AT2G01410"
                     /gene_synonym="F10A8.30"
                     /db_xref="Araport:AT2G01410"
                     /db_xref="TAIR:AT2G01410"
     mRNA            complement(175040..176407)
                     /locus_tag="AT2G01410"
                     /gene_synonym="F10A8.30"
                     /product="NHL domain-containing protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG422196.1,INSD:EH816157.1,INSD:DR370358.1,
                     INSD:DR285321.1,INSD:EG423273.1,INSD:EG503223.1,
                     INSD:EH888346.1,INSD:EG420421.1,INSD:EL167471.1,
                     INSD:EG423783.1,INSD:EG423272.1,INSD:EL146647.1,
                     INSD:EG423277.1,INSD:EL218394.1,INSD:DR285323.1,
                     INSD:EG512761.1,INSD:EL334008.1,INSD:EG498766.1,
                     INSD:AU231107.1,INSD:ES031473.1,INSD:CD533235.1,
                     INSD:BP625867.1,INSD:CD530330.1,INSD:ES142449.1,
                     INSD:AU237971.1,INSD:EG423780.1,INSD:EH901047.1,
                     INSD:AI998222.1,INSD:DR316511.1,INSD:EG423268.1,
                     INSD:EG423269.1,INSD:EH863480.1,INSD:EL164556.1,
                     INSD:EG512778.1,INSD:EL020267.1,INSD:EG423270.1,
                     INSD:EG512770.1,INSD:EG503224.1,INSD:EG422188.1,
                     INSD:ES052084.1,INSD:EG423276.1,INSD:EL330208.1,
                     INSD:EG422194.1,INSD:EH925840.1,INSD:CD533145.1,
                     INSD:EG496957.1,INSD:EL088593.1,INSD:EG425655.1,
                     INSD:EG423790.1,INSD:EG423785.1,INSD:EG423787.1,
                     INSD:EG498765.1,INSD:EH913036.1,INSD:DR285320.1,
                     INSD:EG496726.1,INSD:ES139032.1,INSD:EG512771.1,
                     INSD:EG423267.1,INSD:EG423781.1,INSD:DR285322.1,
                     INSD:EL114840.1,INSD:EG422185.1,INSD:EL206856.1,
                     INSD:AU229089.1,INSD:EG423791.1,INSD:EH915097.1,
                     INSD:ES047420.1,INSD:EG425651.1,INSD:EG509799.1,
                     INSD:DR316512.1,INSD:EG423796.1,INSD:BP787424.1,
                     INSD:EG496725.1,INSD:DR378789.1,INSD:EG422170.1,
                     INSD:BP639670.1,INSD:EG509815.1,INSD:EG423274.1,
                     INSD:ES036621.1,INSD:ES123407.1,INSD:EG423271.1,
                     INSD:EG423266.1,INSD:ES027931.1,INSD:EG512760.1,
                     INSD:EG423782.1,INSD:EL167417.1,INSD:ES078273.1,
                     INSD:EL250811.1,INSD:CD533247.1,INSD:EG425656.1,
                     INSD:EL013150.1,INSD:EG509806.1,INSD:EG420419.1,
                     INSD:EG512777.1,INSD:DR316510.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX818766.1,INSD:BX820148.1,INSD:BX819398.1,
                     INSD:AY735571.1,INSD:BX820492.1,INSD:AK117175.1"
                     /db_xref="TAIR:AT2G01410"
                     /db_xref="Araport:AT2G01410"
     gene            175202..176330
                     /locus_tag="AT2G03975"
                     /note="Natural antisense transcript overlaps with
                     AT2G01410"
                     /db_xref="Araport:AT2G03975"
     ncRNA           175202..176330
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT2G03975"
                     /product="other RNA"
                     /db_xref="Araport:AT2G03975"
     CDS             complement(175209..176372)
                     /locus_tag="AT2G01410"
                     /gene_synonym="F10A8.30"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG422196.1,INSD:EH816157.1,INSD:DR370358.1,
                     INSD:DR285321.1,INSD:EG423273.1,INSD:EG503223.1,
                     INSD:EH888346.1,INSD:EG420421.1,INSD:EL167471.1,
                     INSD:EG423783.1,INSD:EG423272.1,INSD:EL146647.1,
                     INSD:EG423277.1,INSD:EL218394.1,INSD:DR285323.1,
                     INSD:EG512761.1,INSD:EL334008.1,INSD:EG498766.1,
                     INSD:AU231107.1,INSD:ES031473.1,INSD:CD533235.1,
                     INSD:BP625867.1,INSD:CD530330.1,INSD:ES142449.1,
                     INSD:AU237971.1,INSD:EG423780.1,INSD:EH901047.1,
                     INSD:AI998222.1,INSD:DR316511.1,INSD:EG423268.1,
                     INSD:EG423269.1,INSD:EH863480.1,INSD:EL164556.1,
                     INSD:EG512778.1,INSD:EL020267.1,INSD:EG423270.1,
                     INSD:EG512770.1,INSD:EG503224.1,INSD:EG422188.1,
                     INSD:ES052084.1,INSD:EG423276.1,INSD:EL330208.1,
                     INSD:EG422194.1,INSD:EH925840.1,INSD:CD533145.1,
                     INSD:EG496957.1,INSD:EL088593.1,INSD:EG425655.1,
                     INSD:EG423790.1,INSD:EG423785.1,INSD:EG423787.1,
                     INSD:EG498765.1,INSD:EH913036.1,INSD:DR285320.1,
                     INSD:EG496726.1,INSD:ES139032.1,INSD:EG512771.1,
                     INSD:EG423267.1,INSD:EG423781.1,INSD:DR285322.1,
                     INSD:EL114840.1,INSD:EG422185.1,INSD:EL206856.1,
                     INSD:AU229089.1,INSD:EG423791.1,INSD:EH915097.1,
                     INSD:ES047420.1,INSD:EG425651.1,INSD:EG509799.1,
                     INSD:DR316512.1,INSD:EG423796.1,INSD:BP787424.1,
                     INSD:EG496725.1,INSD:DR378789.1,INSD:EG422170.1,
                     INSD:BP639670.1,INSD:EG509815.1,INSD:EG423274.1,
                     INSD:ES036621.1,INSD:ES123407.1,INSD:EG423271.1,
                     INSD:EG423266.1,INSD:ES027931.1,INSD:EG512760.1,
                     INSD:EG423782.1,INSD:EL167417.1,INSD:ES078273.1,
                     INSD:EL250811.1,INSD:CD533247.1,INSD:EG425656.1,
                     INSD:EL013150.1,INSD:EG509806.1,INSD:EG420419.1,
                     INSD:EG512777.1,INSD:DR316510.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX818766.1,INSD:BX820148.1,INSD:BX819398.1,
                     INSD:AY735571.1,INSD:BX820492.1,INSD:AK117175.1"
                     /note="NHL domain-containing protein; FUNCTIONS IN:
                     molecular_function unknown; INVOLVED IN:
                     biological_process unknown; LOCATED IN: plasma membrane;
                     EXPRESSED IN: 26 plant structures; EXPRESSED DURING: 15
                     growth stages; CONTAINS InterPro DOMAIN/s: Six-bladed
                     beta-propeller, TolB-like (InterPro:IPR011042); BEST
                     Arabidopsis thaliana protein match is: Calcium-dependent
                     phosphotriesterase superfamily protein (TAIR:AT2G16760.1);
                     Has 137 Blast hits to 137 proteins in 39 species: Archae -
                     0; Bacteria - 57; Metazoa - 0; Fungi - 0; Plants - 76;
                     Viruses - 0; Other Eukaryotes - 4 (source: NCBI BLink)."
                     /codon_start=1
                     /product="NHL domain-containing protein"
                     /protein_id="AEC05447.1"
                     /db_xref="Araport:AT2G01410"
                     /db_xref="TAIR:AT2G01410"
                     /translation="MKANMSSSSSTRYRSFFVFPILFAVLFLGLLIPSSADNRHVINF
                     RSPGLYPEGLTWDPRDQHFLVGSLHSRTIHSVSDAGVIETLISDLDLPENSTILGLAV
                     DSTNRRLLACIQSLPPLPPFSALASYDLRSGGRRVFLSPLPSLPGDDEDIARDVANDV
                     AVDFKGNAYVTNSAKNFIWKVDRDGAASIFSKSPLFNSQPVAADADASFRDCGLNGIV
                     YISKGYLLVVQSNTGKVFKVDEDSGNARLVLLNGDLIAADGMTRRRRDGTVMVVSQKK
                     LWLLKSQDSWSEGVVYDEIDLDIEGFPTAVTVAGRDRIYVLYGRVMEGIMGSSYKEEG
                     AREWFGIEEVWSEKEGGEDKIWLYVLIGFGFAYFCFWRFQMKKLITNMDKKIT"
     gene            complement(178960..179203)
                     /locus_tag="AT2G03985"
                     /db_xref="Araport:AT2G03985"
     ncRNA           complement(178960..179203)
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT2G03985"
                     /product="other RNA"
                     /db_xref="Araport:AT2G03985"
     gene            complement(180033..183764)
                     /gene="PIN4"
                     /locus_tag="AT2G01420"
                     /gene_synonym="ARABIDOPSIS PIN-FORMED 4"
                     /gene_synonym="ATPIN4"
                     /gene_synonym="AUXIN TRANSPORTER SPLICE VARIANT B"
                     /gene_synonym="F10A8.27"
                     /gene_synonym="PIN-FORMED 4"
                     /note="Encodes a putative auxin efflux carrier that is
                     localized in developing and mature root meristems. It is
                     involved in the maintenance of embryonic auxin gradients.
                     A role for AtPIN4 in generating a sink for auxin below the
                     quiescent center of the root meristem that is essential
                     for auxin distribution and patterning is proposed. In the
                     root, PIN4 is detected around the quiescent center and
                     cells surrounding it, and localizes basally in provascular
                     cells. PIN4 expression is upregulated in
                     brassinosteroid-insensitive mutant (PMID 16141452)."
                     /db_xref="Araport:AT2G01420"
                     /db_xref="TAIR:AT2G01420"
     mRNA            complement(join(180033..180544,180649..180725,
                     180820..180977,181355..181440,181580..181847,
                     182017..183764))
                     /gene="PIN4"
                     /locus_tag="AT2G01420"
                     /gene_synonym="ARABIDOPSIS PIN-FORMED 4"
                     /gene_synonym="ATPIN4"
                     /gene_synonym="AUXIN TRANSPORTER SPLICE VARIANT B"
                     /gene_synonym="F10A8.27"
                     /gene_synonym="PIN-FORMED 4"
                     /product="Auxin efflux carrier family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP590224.1,INSD:AV803269.1,INSD:EH863822.1,
                     INSD:BP593323.1,INSD:AV830715.1,INSD:EG524029.1,
                     INSD:EH918999.1,INSD:AV816911.1,INSD:EL298344.1,
                     INSD:EH795608.1,INSD:BX836105.1,INSD:AV805675.1,
                     INSD:EH864106.1,INSD:BP636712.1,INSD:EL156998.1,
                     INSD:EL176190.1,INSD:BP620481.1,INSD:EL165806.1,
                     INSD:AV795593.1,INSD:EL186934.1,INSD:BP864386.1,
                     INSD:EL228275.1,INSD:BE526564.1,INSD:EH933837.1,
                     INSD:EL232807.1,INSD:T43636.1,INSD:R84151.1,
                     INSD:EH817095.1,INSD:EL255235.1,INSD:BX840155.1,
                     INSD:EH941408.1,INSD:AV812593.1,INSD:DR354068.1,
                     INSD:AV811044.1,INSD:EH822472.1,INSD:AV829212.1,
                     INSD:Z46533.1,INSD:EL175307.1,INSD:EL005739.1,
                     INSD:EH810878.1,INSD:EL217865.1,INSD:EH975337.1,
                     INSD:EL309524.1,INSD:EG524031.1,INSD:EL162185.1,
                     INSD:EH943014.1,INSD:AI099739.1,INSD:BX839961.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AF087016.1,INSD:AK221116.1,INSD:BX820960.1"
                     /db_xref="TAIR:AT2G01420"
                     /db_xref="Araport:AT2G01420"
     mRNA            complement(join(180033..180544,180649..180725,
                     180820..180977,181355..181440,181580..181847,
                     182005..183764))
                     /gene="PIN4"
                     /locus_tag="AT2G01420"
                     /gene_synonym="ARABIDOPSIS PIN-FORMED 4"
                     /gene_synonym="ATPIN4"
                     /gene_synonym="AUXIN TRANSPORTER SPLICE VARIANT B"
                     /gene_synonym="F10A8.27"
                     /gene_synonym="PIN-FORMED 4"
                     /product="Auxin efflux carrier family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP590224.1,INSD:AV803269.1,INSD:EH863822.1,
                     INSD:BP593323.1,INSD:AV830715.1,INSD:EG524029.1,
                     INSD:EH918999.1,INSD:AV816911.1,INSD:EL298344.1,
                     INSD:EH795608.1,INSD:BX836105.1,INSD:AV805675.1,
                     INSD:EH864106.1,INSD:BP636712.1,INSD:EL156998.1,
                     INSD:EL176190.1,INSD:BP620481.1,INSD:EL165806.1,
                     INSD:AV795593.1,INSD:EL186934.1,INSD:BP864386.1,
                     INSD:EL228275.1,INSD:BE526564.1,INSD:Z38079.1,
                     INSD:EH933837.1,INSD:EL232807.1,INSD:T43636.1,
                     INSD:R84151.1,INSD:EH817095.1,INSD:EL255235.1,
                     INSD:BX840155.1,INSD:EH941408.1,INSD:DR354068.1,
                     INSD:AV812593.1,INSD:AV811044.1,INSD:EH822472.1,
                     INSD:AV829212.1,INSD:Z46533.1,INSD:EL175307.1,
                     INSD:EL005739.1,INSD:EH810878.1,INSD:EL217865.1,
                     INSD:EH975337.1,INSD:EL309524.1,INSD:EG524031.1,
                     INSD:EL162185.1,INSD:EH943014.1,INSD:AI099739.1,
                     INSD:BX839961.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY091009.1,INSD:AK221116.1,INSD:BT008691.1"
                     /db_xref="TAIR:AT2G01420"
                     /db_xref="Araport:AT2G01420"
     mRNA            complement(join(180068..180544,180649..180725,
                     180820..181440,181580..181847,182005..183639))
                     /gene="PIN4"
                     /locus_tag="AT2G01420"
                     /gene_synonym="ARABIDOPSIS PIN-FORMED 4"
                     /gene_synonym="ATPIN4"
                     /gene_synonym="AUXIN TRANSPORTER SPLICE VARIANT B"
                     /gene_synonym="F10A8.27"
                     /gene_synonym="PIN-FORMED 4"
                     /product="Auxin efflux carrier family protein"
                     /db_xref="Araport:AT2G01420"
                     /db_xref="TAIR:AT2G01420"
     CDS             complement(join(180478..180544,180649..180725,
                     180820..180977,181355..181440,181580..181847,
                     182017..183199))
                     /gene="PIN4"
                     /locus_tag="AT2G01420"
                     /gene_synonym="ARABIDOPSIS PIN-FORMED 4"
                     /gene_synonym="ATPIN4"
                     /gene_synonym="AUXIN TRANSPORTER SPLICE VARIANT B"
                     /gene_synonym="F10A8.27"
                     /gene_synonym="PIN-FORMED 4"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP590224.1,INSD:AV803269.1,INSD:EH863822.1,
                     INSD:BP593323.1,INSD:AV830715.1,INSD:EG524029.1,
                     INSD:EH918999.1,INSD:AV816911.1,INSD:EL298344.1,
                     INSD:EH795608.1,INSD:BX836105.1,INSD:AV805675.1,
                     INSD:EH864106.1,INSD:BP636712.1,INSD:EL156998.1,
                     INSD:EL176190.1,INSD:BP620481.1,INSD:EL165806.1,
                     INSD:AV795593.1,INSD:EL186934.1,INSD:BP864386.1,
                     INSD:EL228275.1,INSD:BE526564.1,INSD:EH933837.1,
                     INSD:EL232807.1,INSD:T43636.1,INSD:R84151.1,
                     INSD:EH817095.1,INSD:EL255235.1,INSD:BX840155.1,
                     INSD:EH941408.1,INSD:AV812593.1,INSD:DR354068.1,
                     INSD:AV811044.1,INSD:EH822472.1,INSD:AV829212.1,
                     INSD:Z46533.1,INSD:EL175307.1,INSD:EL005739.1,
                     INSD:EH810878.1,INSD:EL217865.1,INSD:EH975337.1,
                     INSD:EL309524.1,INSD:EG524031.1,INSD:EL162185.1,
                     INSD:EH943014.1,INSD:AI099739.1,INSD:BX839961.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AF087016.1,INSD:AK221116.1,INSD:BX820960.1"
                     /note="PIN-FORMED 4 (PIN4); FUNCTIONS IN: auxin:hydrogen
                     symporter activity, transporter activity; INVOLVED IN:
                     root development, pattern specification process, auxin
                     polar transport; LOCATED IN: endomembrane system, integral
                     to membrane; EXPRESSED IN: 27 plant structures; EXPRESSED
                     DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s:
                     Auxin efflux carrier, subgroup (InterPro:IPR014024), Auxin
                     efflux carrier (InterPro:IPR004776); BEST Arabidopsis
                     thaliana protein match is: Auxin efflux carrier family
                     protein (TAIR:AT1G70940.1); Has 1811 Blast hits to 1602
                     proteins in 498 species: Archae - 31; Bacteria - 1046;
                     Metazoa - 12; Fungi - 10; Plants - 485; Viruses - 0; Other
                     Eukaryotes - 227 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Auxin efflux carrier family protein"
                     /protein_id="AEC05448.1"
                     /db_xref="Araport:AT2G01420"
                     /db_xref="TAIR:AT2G01420"
                     /translation="MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINR
                     FVAIFAVPLLSFHFISTNDPYAMNFRFVAADTLQKIIMLVLLALWANLTKNGSLEWMI
                     TIFSLSTLPNTLVMGIPLLIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLL
                     IMEQFPETGASIVSFKVESDVVSLDGHDFLETDAEIGNDGKLHVTVRKSNASRRSLMM
                     TPRPSNLTGAEIYSLSSTPRGSNFNHSDFYSVMGFPGGRLSNFGPADLYSVQSSRGPT
                     PRPSNFEENNAVKYGFYNNTNSSVPAAGSYPAPNPEFSTGTGVSTKPNKIPKENQQQL
                     QEKDSKASHDAKELHMFVWSSSASPVSDVFGGGAGDNVATEQSEQGAKEIRMVVSDQP
                     RKSGGDDIGGLDSGEGEREIEKATAGLNKMGSNSTAELEAAGGDGGGNNGTHMPPTSV
                     MTRLILIMVWRKLIRNPNTYSSLIGLIWALVAYRWHVAMPKILQQSISILSDAGLGMA
                     MFSLGLFMALQPKIIACGNSVATFAMAVRFITGPAIMAVAGIAIGLHGDLLRIAIVQA
                     ALPQGIVPFVFAKEYNVHPTILSTGVIFGMLIALPITLVYYILLGL"
     CDS             complement(join(180478..180544,180649..180725,
                     180820..180977,181355..181440,181580..181847,
                     182005..183199))
                     /gene="PIN4"
                     /locus_tag="AT2G01420"
                     /gene_synonym="ARABIDOPSIS PIN-FORMED 4"
                     /gene_synonym="ATPIN4"
                     /gene_synonym="AUXIN TRANSPORTER SPLICE VARIANT B"
                     /gene_synonym="F10A8.27"
                     /gene_synonym="PIN-FORMED 4"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP590224.1,INSD:AV803269.1,INSD:EH863822.1,
                     INSD:BP593323.1,INSD:AV830715.1,INSD:EG524029.1,
                     INSD:EH918999.1,INSD:AV816911.1,INSD:EL298344.1,
                     INSD:EH795608.1,INSD:BX836105.1,INSD:AV805675.1,
                     INSD:EH864106.1,INSD:BP636712.1,INSD:EL156998.1,
                     INSD:EL176190.1,INSD:BP620481.1,INSD:EL165806.1,
                     INSD:AV795593.1,INSD:EL186934.1,INSD:BP864386.1,
                     INSD:EL228275.1,INSD:BE526564.1,INSD:Z38079.1,
                     INSD:EH933837.1,INSD:EL232807.1,INSD:T43636.1,
                     INSD:R84151.1,INSD:EH817095.1,INSD:EL255235.1,
                     INSD:BX840155.1,INSD:EH941408.1,INSD:DR354068.1,
                     INSD:AV812593.1,INSD:AV811044.1,INSD:EH822472.1,
                     INSD:AV829212.1,INSD:Z46533.1,INSD:EL175307.1,
                     INSD:EL005739.1,INSD:EH810878.1,INSD:EL217865.1,
                     INSD:EH975337.1,INSD:EL309524.1,INSD:EG524031.1,
                     INSD:EL162185.1,INSD:EH943014.1,INSD:AI099739.1,
                     INSD:BX839961.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY091009.1,INSD:AK221116.1,INSD:BT008691.1"
                     /note="PIN-FORMED 4 (PIN4); FUNCTIONS IN: auxin:hydrogen
                     symporter activity, transporter activity; INVOLVED IN:
                     root development, pattern specification process, auxin
                     polar transport; LOCATED IN: endomembrane system, integral
                     to membrane; EXPRESSED IN: 27 plant structures; EXPRESSED
                     DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s:
                     Auxin efflux carrier, subgroup (InterPro:IPR014024), Auxin
                     efflux carrier (InterPro:IPR004776); BEST Arabidopsis
                     thaliana protein match is: Auxin efflux carrier family
                     protein (TAIR:AT1G70940.1); Has 1823 Blast hits to 1616
                     proteins in 502 species: Archae - 31; Bacteria - 1046;
                     Metazoa - 18; Fungi - 10; Plants - 487; Viruses - 2; Other
                     Eukaryotes - 229 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Auxin efflux carrier family protein"
                     /protein_id="AEC05449.1"
                     /db_xref="Araport:AT2G01420"
                     /db_xref="TAIR:AT2G01420"
                     /translation="MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINR
                     FVAIFAVPLLSFHFISTNDPYAMNFRFVAADTLQKIIMLVLLALWANLTKNGSLEWMI
                     TIFSLSTLPNTLVMGIPLLIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLL
                     IMEQFPETGASIVSFKVESDVVSLDGHDFLETDAEIGNDGKLHVTVRKSNASRRSLMM
                     TPRPSNLTGAEIYSLSSTPRGSNFNHSDFYSVMGFPGGRLSNFGPADLYSVQSSRGPT
                     PRPSNFEENNAVKYGFYNNTNSSVPAAGSYPAPNPEFSTGTGVSTKPNKIPKENQQQL
                     QEKDSKASHDAKELHMFVWSSSASPVSDVFGGGAGDNVATEQSEQGAKEIRMVVSDQP
                     RKSNARGGGDDIGGLDSGEGEREIEKATAGLNKMGSNSTAELEAAGGDGGGNNGTHMP
                     PTSVMTRLILIMVWRKLIRNPNTYSSLIGLIWALVAYRWHVAMPKILQQSISILSDAG
                     LGMAMFSLGLFMALQPKIIACGNSVATFAMAVRFITGPAIMAVAGIAIGLHGDLLRIA
                     IVQAALPQGIVPFVFAKEYNVHPTILSTGVIFGMLIALPITLVYYILLGL"
     CDS             complement(join(181344..181440,181580..181847,
                     182005..183199))
                     /gene="PIN4"
                     /locus_tag="AT2G01420"
                     /gene_synonym="ARABIDOPSIS PIN-FORMED 4"
                     /gene_synonym="ATPIN4"
                     /gene_synonym="AUXIN TRANSPORTER SPLICE VARIANT B"
                     /gene_synonym="F10A8.27"
                     /gene_synonym="PIN-FORMED 4"
                     /codon_start=1
                     /product="Auxin efflux carrier family protein"
                     /protein_id="ANM61517.1"
                     /db_xref="Araport:AT2G01420"
                     /db_xref="TAIR:AT2G01420"
                     /translation="MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINR
                     FVAIFAVPLLSFHFISTNDPYAMNFRFVAADTLQKIIMLVLLALWANLTKNGSLEWMI
                     TIFSLSTLPNTLVMGIPLLIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLL
                     IMEQFPETGASIVSFKVESDVVSLDGHDFLETDAEIGNDGKLHVTVRKSNASRRSLMM
                     TPRPSNLTGAEIYSLSSTPRGSNFNHSDFYSVMGFPGGRLSNFGPADLYSVQSSRGPT
                     PRPSNFEENNAVKYGFYNNTNSSVPAAGSYPAPNPEFSTGTGVSTKPNKIPKENQQQL
                     QEKDSKASHDAKELHMFVWSSSASPVSDVFGGGAGDNVATEQSEQGAKEIRMVVSDQP
                     RKSNARGGGDDIGGLDSGEGEREIEKATAGLNKMGSNSTAELEAAGGDGGGNNGTHMP
                     PTSVMTRLILIMVWRKLIRNPNTYSSLIGLIWALVAYRWHVAMPKILQQSISILSDAG
                     LGMAMFSLGKH"
     gene            183940..184734
                     /locus_tag="AT2G01422"
                     /db_xref="Araport:AT2G01422"
                     /db_xref="TAIR:AT2G01422"
     ncRNA           183940..184734
                     /ncRNA_class="other"
                     /locus_tag="AT2G01422"
                     /product="other RNA"
                     /db_xref="Araport:AT2G01422"
                     /db_xref="TAIR:AT2G01422"
     ncRNA           join(183940..184205,184468..184734)
                     /ncRNA_class="other"
                     /locus_tag="AT2G01422"
                     /product="other RNA"
                     /db_xref="Araport:AT2G01422"
                     /db_xref="TAIR:AT2G01422"
     gene            complement(187608..190369)
                     /gene="HB17"
                     /locus_tag="AT2G01430"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 17"
                     /gene_synonym="ATHB-17"
                     /gene_synonym="ATHB17"
                     /gene_synonym="F2I9.5"
                     /gene_synonym="F2I9_5"
                     /gene_synonym="homeobox-leucine zipper protein 17"
                     /db_xref="Araport:AT2G01430"
                     /db_xref="TAIR:AT2G01430"
     mRNA            complement(join(187608..188056,189398..189477,
                     189598..189788,190072..190369))
                     /gene="HB17"
                     /locus_tag="AT2G01430"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 17"
                     /gene_synonym="ATHB-17"
                     /gene_synonym="ATHB17"
                     /gene_synonym="F2I9.5"
                     /gene_synonym="F2I9_5"
                     /gene_synonym="homeobox-leucine zipper protein 17"
                     /product="homeobox-leucine zipper protein 17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR751688.1,INSD:DR751625.1,INSD:DR751538.1,
                     INSD:DR751539.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AJ431181.1"
                     /db_xref="TAIR:AT2G01430"
                     /db_xref="Araport:AT2G01430"
     mRNA            complement(join(187608..189477,189598..189788,
                     190072..190369))
                     /gene="HB17"
                     /locus_tag="AT2G01430"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 17"
                     /gene_synonym="ATHB-17"
                     /gene_synonym="ATHB17"
                     /gene_synonym="F2I9.5"
                     /gene_synonym="F2I9_5"
                     /gene_synonym="homeobox-leucine zipper protein 17"
                     /product="homeobox-leucine zipper protein 17"
                     /db_xref="Araport:AT2G01430"
                     /db_xref="TAIR:AT2G01430"
     CDS             complement(join(187798..188056,189398..189477,
                     189598..189788,190072..190369))
                     /gene="HB17"
                     /locus_tag="AT2G01430"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 17"
                     /gene_synonym="ATHB-17"
                     /gene_synonym="ATHB17"
                     /gene_synonym="F2I9.5"
                     /gene_synonym="F2I9_5"
                     /gene_synonym="homeobox-leucine zipper protein 17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR751688.1,INSD:DR751625.1,INSD:DR751538.1,
                     INSD:DR751539.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AJ431181.1"
                     /note="homeobox-leucine zipper protein 17 (HB17);
                     FUNCTIONS IN: sequence-specific DNA binding transcription
                     factor activity; INVOLVED IN: regulation of transcription,
                     DNA-dependent, regulation of transcription; LOCATED IN:
                     nucleus; CONTAINS InterPro DOMAIN/s: Homeobox, conserved
                     site (InterPro:IPR017970), Homeobox (InterPro:IPR001356),
                     Homeodomain-like (InterPro:IPR009057), Leucine zipper,
                     homeobox-associated (InterPro:IPR003106),
                     Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis
                     thaliana protein match is: homeobox-leucine zipper protein
                     18 (TAIR:AT1G70920.1); Has 8030 Blast hits to 8017
                     proteins in 519 species: Archae - 0; Bacteria - 0; Metazoa
                     - 5631; Fungi - 276; Plants - 1985; Viruses - 4; Other
                     Eukaryotes - 134 (source: NCBI BLink)."
                     /codon_start=1
                     /product="homeobox-leucine zipper protein 17"
                     /protein_id="AEC05450.1"
                     /db_xref="Araport:AT2G01430"
                     /db_xref="TAIR:AT2G01430"
                     /translation="MIKLLFTYICTYTYKLYALYHMDYACVCMYKYKGIVTLQVCLFY
                     IKLRVFLSNFTFSSSILALKNPNNSLIKIMAILPENSSNLDLTISVPGFSSSPLSDEG
                     SGGGRDQLRLDMNRLPSSEDGDDEEFSHDDGSAPPRKKLRLTREQSRLLEDSFRQNHT
                     LNPKQKEVLAKHLMLRPRQIEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEENHRLH
                     REVEELRAMKVGPTTVNSASSLTMCPRCERVTPAASPSRAVVPVPAKKTFPPQERDR"
     CDS             complement(join(189325..189477,189598..189788,
                     190072..190369))
                     /gene="HB17"
                     /locus_tag="AT2G01430"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 17"
                     /gene_synonym="ATHB-17"
                     /gene_synonym="ATHB17"
                     /gene_synonym="F2I9.5"
                     /gene_synonym="F2I9_5"
                     /gene_synonym="homeobox-leucine zipper protein 17"
                     /codon_start=1
                     /product="homeobox-leucine zipper protein 17"
                     /protein_id="ANM62612.1"
                     /db_xref="Araport:AT2G01430"
                     /db_xref="TAIR:AT2G01430"
                     /translation="MIKLLFTYICTYTYKLYALYHMDYACVCMYKYKGIVTLQVCLFY
                     IKLRVFLSNFTFSSSILALKNPNNSLIKIMAILPENSSNLDLTISVPGFSSSPLSDEG
                     SGGGRDQLRLDMNRLPSSEDGDDEEFSHDDGSAPPRKKLRLTREQSRLLEDSFRQNHT
                     LNPKQKEVLAKHLMLRPRQIEVWFQNRRARYGFIFLFVSFLRDFCFLTSLVGG"
     gene            complement(193164..199280)
                     /locus_tag="AT2G01440"
                     /gene_synonym="F2I9.6"
                     /gene_synonym="F2I9_6"
                     /db_xref="Araport:AT2G01440"
                     /db_xref="TAIR:AT2G01440"
     mRNA            complement(join(193164..194042,194127..194699,
                     194820..194903,195009..195167,195374..195517,
                     195594..195746,195882..195953,196157..196390,
                     196492..196581,196699..196780,197046..197209,
                     197448..197682,197886..197998,198082..198567,
                     198643..198778,198856..198926,199024..199280))
                     /locus_tag="AT2G01440"
                     /gene_synonym="F2I9.6"
                     /gene_synonym="F2I9_6"
                     /product="DEAD/DEAH box RNA helicase family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV547326.1,INSD:EH883228.1,INSD:DR357248.1,
                     INSD:ES189725.1,INSD:EG467201.1,INSD:EL092459.1,
                     INSD:EH920858.1,INSD:DR357247.1,INSD:EH928275.1,
                     INSD:ES157722.1,INSD:EG478873.1,INSD:EH796379.1,
                     INSD:EG467202.1,INSD:ES153997.1,INSD:ES121121.1"
                     /db_xref="TAIR:AT2G01440"
                     /db_xref="Araport:AT2G01440"
     gene            193294..193673
                     /locus_tag="AT2G03995"
                     /db_xref="Araport:AT2G03995"
     ncRNA           193294..193673
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT2G03995"
                     /product="other RNA"
                     /db_xref="Araport:AT2G03995"
     CDS             complement(join(193950..194042,194127..194699,
                     194820..194903,195009..195167,195374..195517,
                     195594..195746,195882..195953,196157..196390,
                     196492..196581,196699..196780,197046..197209,
                     197448..197682,197886..197998,198082..198567,
                     198643..198778,198856..198926,199024..199056))
                     /locus_tag="AT2G01440"
                     /gene_synonym="F2I9.6"
                     /gene_synonym="F2I9_6"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV547326.1,INSD:EH883228.1,INSD:DR357248.1,
                     INSD:ES189725.1,INSD:EG467201.1,INSD:EL092459.1,
                     INSD:EH920858.1,INSD:DR357247.1,INSD:EH928275.1,
                     INSD:ES157722.1,INSD:EG478873.1,INSD:EH796379.1,
                     INSD:EG467202.1,INSD:ES153997.1,INSD:ES121121.1"
                     /note="DEAD/DEAH box RNA helicase family protein;
                     FUNCTIONS IN: ATP-dependent DNA helicase activity,
                     helicase activity, nucleic acid binding, ATP-dependent
                     helicase activity, ATP binding; INVOLVED IN: DNA repair,
                     DNA recombination; EXPRESSED IN: 12 plant structures;
                     EXPRESSED DURING: 6 growth stages; CONTAINS InterPro
                     DOMAIN/s: DNA/RNA helicase, DEAD/DEAH box type, N-terminal
                     (InterPro:IPR011545), Nucleic acid-binding, OB-fold-like
                     (InterPro:IPR016027), DNA helicase, ATP-dependent, RecG
                     (InterPro:IPR004609), DEAD-like helicase, N-terminal
                     (InterPro:IPR014001), DNA/RNA helicase, C-terminal
                     (InterPro:IPR001650), Helicase, superfamily 1/2,
                     ATP-binding domain (InterPro:IPR014021); BEST Arabidopsis
                     thaliana protein match is: DEAD/DEAH box helicase,
                     putative (TAIR:AT3G02060.1); Has 30201 Blast hits to 17322
                     proteins in 780 species: Archae - 12; Bacteria - 1396;
                     Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
                     Other Eukaryotes - 2996 (source: NCBI BLink)."
                     /codon_start=1
                     /product="DEAD/DEAH box RNA helicase family protein"
                     /protein_id="AEC05451.1"
                     /db_xref="Araport:AT2G01440"
                     /db_xref="TAIR:AT2G01440"
                     /translation="MAAVTLSPCSMCCGSRRLRSVIVIQAQRGNWNRIRLSNFFFSKV
                     WNISYRSKHKYSDNLLEQVEKYASARLENQSKLITKVAALMECDNVDDFIDKKSDEQV
                     KKDLVLACKRFPSIILGDSRPVELYSNSKSYGESSSILKTPTDNSFLPTPMHGGWFDP
                     DNLSRTLSSFCPELLQNDDSSDPREDILDDGSSFTSKTATSEVEATSDDVFAAQRFLA
                     TSIDSMPGLSKRHSNQLDSCGFHTMKKLLHHFPRTYADLQNAQVDIEDGQYLIFVGKV
                     LSSKGVRASSSFSFLEVIVSCEVSGRDRTPEDLSHNAEDKAGKSIFLHLKKFFRGTRF
                     TWQPFLNSIQEKHKVGDLVCISGKVKSLRAEDHFEMREYNIDVLKDEEESSHRAQGRP
                     YPIYPSKGGLNPKFLSDVISRALRVLPANMDPIPKEITKVFGLPSLNDAYVGIHEPKT
                     LDEADLARKRLIFDEFFYLQLARLYQMLQSLGTKIEKDVLLEKFRKPVLNSVYIEEWS
                     TLTKSFLKALPYSLTPSQLSAVSEIIWDLKRPVPMNRLLQGDVGCGKTVVAFLACMEV
                     IGSGYQAAFMAPTELLAIQHYEQCRDLLENMEGVSSKPTIGLLTGSTPAKQSRMIRQD
                     LQSGAISFIIGTHSLIAEKIEYSALRIAVVDEQQRFGVIQRGKFNSKLYGTSMISKSG
                     SSDSDDTSKADLSMAPHVLAMSATPIPRSLALALYGDISLTQITGMPLGRIPVETHIF
                     EGNETGIKEVYSMMLEDLKSGGRVYVVYPVIDQSEQLPQLRAASAELEIVTKKFPKYN
                     CGLLHGRMKSDDKEEALNKFRSGETQILLSTQVIEIGVDVPDASMMVVMNAERFGIAQ
                     LHQLRGRVGRGTRKSKCLLVGSSTNSLKRLNMLGKSSDGFYLANIDLLLRGPGDLLGK
                     KQSGHLPEFPVARLEIDGNMLQEAHIAALNVLGDSHDLEKFPALKAELSMRQPLCLLG
                     D"
     gene            complement(199491..203126)
                     /gene="MPK17"
                     /locus_tag="AT2G01450"
                     /gene_synonym="ATMPK17"
                     /gene_synonym="F2I9.7"
                     /gene_synonym="F2I9_7"
                     /gene_synonym="MAP kinase 17"
                     /note="member of MAP Kinase"
                     /db_xref="Araport:AT2G01450"
                     /db_xref="TAIR:AT2G01450"
     mRNA            complement(join(199491..199956,200039..200146,
                     200229..200308,200411..200548,200637..200792,
                     200948..201097,201184..201243,201361..201488,
                     201605..202025,202227..202397))
                     /gene="MPK17"
                     /locus_tag="AT2G01450"
                     /gene_synonym="ATMPK17"
                     /gene_synonym="F2I9.7"
                     /gene_synonym="F2I9_7"
                     /gene_synonym="MAP kinase 17"
                     /product="MAP kinase 17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG450996.1,INSD:BP808830.2,INSD:EG476771.1,
                     INSD:EL224734.1,INSD:AV551027.1,INSD:BP617107.1,
                     INSD:CD534431.1,INSD:BP614449.1,INSD:EG425080.1,
                     INSD:BP612876.1,INSD:EH890182.1,INSD:AV542811.1,
                     INSD:BP645298.1,INSD:EL320294.1,INSD:DR382275.1,
                     INSD:BP614693.1,INSD:DR262107.1,INSD:EL160723.1,
                     INSD:AV550338.1,INSD:BP610323.1,INSD:BP613733.1,
                     INSD:EG450334.1,INSD:BP621076.1,INSD:BP609184.1,
                     INSD:EG450353.1,INSD:BP600289.1,INSD:BP605409.1,
                     INSD:EL987647.1,INSD:DR262108.1,INSD:BP669583.1,
                     INSD:BP657041.1,INSD:BP649376.1,INSD:ES096991.1,
                     INSD:AV527795.1,INSD:BP621466.1,INSD:AV531369.1,
                     INSD:EL263671.1,INSD:AV547858.1,INSD:BU636240.1,
                     INSD:EG502926.1,INSD:ES029766.1,INSD:AV535563.1,
                     INSD:AV539430.1,INSD:EG450332.1,INSD:AV543235.1,
                     INSD:EL121448.1,INSD:BP609911.1,INSD:AU226975.1,
                     INSD:AI997494.1,INSD:ES172967.1,INSD:BP609017.1,
                     INSD:Z18452.1,INSD:BP607130.1,INSD:BP863455.1,
                     INSD:BP640028.1,INSD:EL215606.1,INSD:EH924751.1,
                     INSD:AV521125.1,INSD:BP616037.1,INSD:ES082550.1,
                     INSD:BP670334.1,INSD:AV547086.1,INSD:BP615091.1,
                     INSD:EL044033.1,INSD:BP602328.1,INSD:EH969793.1,
                     INSD:BP795275.1,INSD:BP622662.1,INSD:ES121867.1,
                     INSD:ES085636.1,INSD:ES194436.1,INSD:BP651132.1,
                     INSD:ES163215.1,INSD:BP613398.1,INSD:EH840807.1,
                     INSD:EL177567.1,INSD:DR262105.1,INSD:EL199024.1,
                     INSD:BP613900.1,INSD:DR382927.1,INSD:ES130266.1,
                     INSD:EH836418.1,INSD:BP615084.1,INSD:BP645024.1,
                     INSD:DR262106.1,INSD:BP621415.1,INSD:ES054765.1,
                     INSD:BP783482.1,INSD:EL089391.1,INSD:EL169981.1,
                     INSD:AV532356.1,INSD:BP612094.1,INSD:BP780121.1,
                     INSD:BP614879.1,INSD:BP632966.1,INSD:ES114201.1,
                     INSD:EH973899.1,INSD:DR379452.1,INSD:EL181715.1,
                     INSD:BP620091.1,INSD:BP625712.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BT006469.1"
                     /db_xref="TAIR:AT2G01450"
                     /db_xref="Araport:AT2G01450"
     mRNA            complement(join(199511..199956,200039..200146,
                     200229..200308,200411..200548,200637..200792,
                     200948..201097,201184..201243,201361..201488,
                     201605..202025,203031..203126))
                     /gene="MPK17"
                     /locus_tag="AT2G01450"
                     /gene_synonym="ATMPK17"
                     /gene_synonym="F2I9.7"
                     /gene_synonym="F2I9_7"
                     /gene_synonym="MAP kinase 17"
                     /product="MAP kinase 17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG450996.1,INSD:BP844824.1,INSD:BP808830.2,
                     INSD:EG476771.1,INSD:EL224734.1,INSD:AV551027.1,
                     INSD:BP617107.1,INSD:CD534431.1,INSD:BP614449.1,
                     INSD:EG425080.1,INSD:BP612876.1,INSD:EH890182.1,
                     INSD:AV542811.1,INSD:BP645298.1,INSD:EL320294.1,
                     INSD:DR382275.1,INSD:BP614693.1,INSD:BP808420.2,
                     INSD:DR262107.1,INSD:EL987631.1,INSD:EL160723.1,
                     INSD:AV550338.1,INSD:BP610323.1,INSD:EH863420.1,
                     INSD:BP867324.1,INSD:BP613733.1,INSD:BP856857.2,
                     INSD:EG450334.1,INSD:BP621076.1,INSD:BP609184.1,
                     INSD:EG450353.1,INSD:BP600289.1,INSD:BP605409.1,
                     INSD:EL987647.1,INSD:DR262108.1,INSD:BP669583.1,
                     INSD:BP657041.1,INSD:BP649376.1,INSD:ES096991.1,
                     INSD:BP822958.1,INSD:AV527795.1,INSD:AV531369.1,
                     INSD:BP621466.1,INSD:EL263671.1,INSD:AV526002.1,
                     INSD:AV547858.1,INSD:BU636240.1,INSD:BP819615.1,
                     INSD:EG502926.1,INSD:DR362450.1,INSD:ES029766.1,
                     INSD:AV535563.1,INSD:AV539430.1,INSD:EG450332.1,
                     INSD:AV543235.1,INSD:EL121448.1,INSD:BP609911.1,
                     INSD:AU226975.1,INSD:BP808098.1,INSD:BE521000.1,
                     INSD:AI997494.1,INSD:ES172967.1,INSD:BP609017.1,
                     INSD:Z18452.1,INSD:N96333.1,INSD:BP607130.1,
                     INSD:BP640028.1,INSD:EL215606.1,INSD:AV521125.1,
                     INSD:EH924751.1,INSD:BP616037.1,INSD:AV547086.1,
                     INSD:DR275775.1,INSD:ES082550.1,INSD:BP670334.1,
                     INSD:BP615091.1,INSD:BP840986.2,INSD:EL044033.1,
                     INSD:BP852028.1,INSD:AU236153.1,INSD:BP602328.1,
                     INSD:EH969793.1,INSD:BP805575.1,INSD:BP795275.1,
                     INSD:BP622662.1,INSD:BP850276.1,INSD:ES121867.1,
                     INSD:ES085636.1,INSD:ES194436.1,INSD:BP651132.1,
                     INSD:ES163215.1,INSD:BP807795.1,INSD:BP613398.1,
                     INSD:EL177567.1,INSD:EH840807.1,INSD:DR262105.1,
                     INSD:EL199024.1,INSD:BP613900.1,INSD:DR382927.1,
                     INSD:ES130266.1,INSD:EH836418.1,INSD:BP615084.1,
                     INSD:EG450995.1,INSD:BP645024.1,INSD:DR262106.1,
                     INSD:BP621415.1,INSD:ES054765.1,INSD:BP783482.1,
                     INSD:EL089391.1,INSD:EH940989.1,INSD:EL169981.1,
                     INSD:AV532356.1,INSD:EH816349.1,INSD:BP612094.1,
                     INSD:BP780121.1,INSD:BP614879.1,INSD:BP851693.1,
                     INSD:BP632966.1,INSD:BP807998.1,INSD:BP810358.1,
                     INSD:DR379452.1,INSD:ES114201.1,INSD:EH973899.1,
                     INSD:EL181715.1,INSD:BP620091.1,INSD:BP625712.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AK228266.1,INSD:BX820037.1,INSD:BT006469.1"
                     /db_xref="TAIR:AT2G01450"
                     /db_xref="Araport:AT2G01450"
     mRNA            complement(join(199511..199956,200039..200146,
                     200229..200308,200411..200548,200637..200792,
                     200948..201097,201184..201243,201361..201488,
                     201605..202110,202227..202292))
                     /gene="MPK17"
                     /locus_tag="AT2G01450"
                     /gene_synonym="ATMPK17"
                     /gene_synonym="F2I9.7"
                     /gene_synonym="F2I9_7"
                     /gene_synonym="MAP kinase 17"
                     /product="MAP kinase 17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG450996.1,INSD:BP808830.2,INSD:EG476771.1,
                     INSD:EL224734.1,INSD:AV551027.1,INSD:BP617107.1,
                     INSD:CD534431.1,INSD:BP614449.1,INSD:EG425080.1,
                     INSD:BP612876.1,INSD:EH890182.1,INSD:AV542811.1,
                     INSD:BP645298.1,INSD:EL320294.1,INSD:DR382275.1,
                     INSD:BP614693.1,INSD:DR262107.1,INSD:EL160723.1,
                     INSD:AV550338.1,INSD:BP610323.1,INSD:BP613733.1,
                     INSD:EG450334.1,INSD:BP621076.1,INSD:BP609184.1,
                     INSD:EG450353.1,INSD:BP600289.1,INSD:BP605409.1,
                     INSD:EL987647.1,INSD:DR262108.1,INSD:BP669583.1,
                     INSD:BP657041.1,INSD:BP649376.1,INSD:ES096991.1,
                     INSD:AV527795.1,INSD:BP621466.1,INSD:AV531369.1,
                     INSD:EL263671.1,INSD:BP805944.1,INSD:AV547858.1,
                     INSD:BU636240.1,INSD:EG502926.1,INSD:ES029766.1,
                     INSD:AV535563.1,INSD:AV539430.1,INSD:EG450332.1,
                     INSD:AV543235.1,INSD:EL121448.1,INSD:BP851684.1,
                     INSD:BP609911.1,INSD:AU226975.1,INSD:AI997494.1,
                     INSD:ES172967.1,INSD:BP609017.1,INSD:Z18452.1,
                     INSD:BP846533.1,INSD:BP607130.1,INSD:BP640028.1,
                     INSD:EL215606.1,INSD:EH924751.1,INSD:AV521125.1,
                     INSD:BP616037.1,INSD:AV547086.1,INSD:ES082550.1,
                     INSD:BP670334.1,INSD:BP615091.1,INSD:EL044033.1,
                     INSD:BP602328.1,INSD:EH969793.1,INSD:BP795275.1,
                     INSD:BP622662.1,INSD:ES121867.1,INSD:ES085636.1,
                     INSD:ES194436.1,INSD:BP651132.1,INSD:ES163215.1,
                     INSD:BP613398.1,INSD:EH840807.1,INSD:EL177567.1,
                     INSD:DR262105.1,INSD:EL199024.1,INSD:BP613900.1,
                     INSD:DR382927.1,INSD:ES130266.1,INSD:EH836418.1,
                     INSD:BP615084.1,INSD:BP645024.1,INSD:DR262106.1,
                     INSD:BP621415.1,INSD:ES054765.1,INSD:BP783482.1,
                     INSD:EL089391.1,INSD:EL169981.1,INSD:AV532356.1,
                     INSD:BP612094.1,INSD:BP780121.1,INSD:BP614879.1,
                     INSD:BP632966.1,INSD:ES114201.1,INSD:EH973899.1,
                     INSD:DR379452.1,INSD:EL181715.1,INSD:BP620091.1,
                     INSD:BP625712.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BT006469.1"
                     /db_xref="TAIR:AT2G01450"
                     /db_xref="Araport:AT2G01450"
     mRNA            complement(join(199511..199956,200039..200146,
                     200229..200308,200411..200548,200637..200792,
                     200948..201097,201184..201243,201361..201488,
                     201605..202025,202130..202198))
                     /gene="MPK17"
                     /locus_tag="AT2G01450"
                     /gene_synonym="ATMPK17"
                     /gene_synonym="F2I9.7"
                     /gene_synonym="F2I9_7"
                     /gene_synonym="MAP kinase 17"
                     /product="MAP kinase 17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG450996.1,INSD:BP808830.2,INSD:EG476771.1,
                     INSD:EL224734.1,INSD:AV551027.1,INSD:BP617107.1,
                     INSD:CD534431.1,INSD:BP614449.1,INSD:EG425080.1,
                     INSD:BP612876.1,INSD:EH890182.1,INSD:AV542811.1,
                     INSD:BP645298.1,INSD:EL320294.1,INSD:DR382275.1,
                     INSD:BP614693.1,INSD:DR262107.1,INSD:EL160723.1,
                     INSD:AV550338.1,INSD:BP610323.1,INSD:EH863420.1,
                     INSD:BP613733.1,INSD:EG450334.1,INSD:BP621076.1,
                     INSD:BP609184.1,INSD:EG450353.1,INSD:BP600289.1,
                     INSD:BP605409.1,INSD:EL987647.1,INSD:DR262108.1,
                     INSD:BP669583.1,INSD:BP657041.1,INSD:BP649376.1,
                     INSD:ES096991.1,INSD:AV527795.1,INSD:BP621466.1,
                     INSD:AV531369.1,INSD:EL263671.1,INSD:AV547858.1,
                     INSD:BU636240.1,INSD:EG502926.1,INSD:ES029766.1,
                     INSD:AV535563.1,INSD:AV539430.1,INSD:EG450332.1,
                     INSD:EG476975.1,INSD:AV543235.1,INSD:EL121448.1,
                     INSD:AA713093.1,INSD:BP609911.1,INSD:AU226975.1,
                     INSD:AI997494.1,INSD:ES172967.1,INSD:BP609017.1,
                     INSD:Z18452.1,INSD:BP607130.1,INSD:BP640028.1,
                     INSD:EL215606.1,INSD:EH924751.1,INSD:AV521125.1,
                     INSD:BP616037.1,INSD:AV547086.1,INSD:ES082550.1,
                     INSD:BP670334.1,INSD:BP615091.1,INSD:EL044033.1,
                     INSD:BP602328.1,INSD:EH969793.1,INSD:BP795275.1,
                     INSD:BP622662.1,INSD:ES121867.1,INSD:ES085636.1,
                     INSD:ES194436.1,INSD:BP651132.1,INSD:ES163215.1,
                     INSD:BP809391.1,INSD:BP613398.1,INSD:EH840807.1,
                     INSD:EL177567.1,INSD:DR262105.1,INSD:EL199024.1,
                     INSD:BP613900.1,INSD:DR382927.1,INSD:ES130266.1,
                     INSD:EH836418.1,INSD:BP615084.1,INSD:BP645024.1,
                     INSD:DR262106.1,INSD:BP621415.1,INSD:ES054765.1,
                     INSD:BP783482.1,INSD:EL089391.1,INSD:EH940989.1,
                     INSD:EL169981.1,INSD:AV532356.1,INSD:BP612094.1,
                     INSD:BP780121.1,INSD:AI993802.1,INSD:BP614879.1,
                     INSD:BP632966.1,INSD:EL967069.1,INSD:ES114201.1,
                     INSD:EH973899.1,INSD:DR379452.1,INSD:EL181715.1,
                     INSD:BP620091.1,INSD:BP625712.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BT006469.1"
                     /db_xref="TAIR:AT2G01450"
                     /db_xref="Araport:AT2G01450"
     CDS             complement(join(199722..199956,200039..200146,
                     200229..200308,200411..200548,200637..200792,
                     200948..201097,201184..201243,201361..201488,
                     201605..202010))
                     /gene="MPK17"
                     /locus_tag="AT2G01450"
                     /gene_synonym="ATMPK17"
                     /gene_synonym="F2I9.7"
                     /gene_synonym="F2I9_7"
                     /gene_synonym="MAP kinase 17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG450996.1,INSD:BP844824.1,INSD:BP808830.2,
                     INSD:EG476771.1,INSD:EL224734.1,INSD:AV551027.1,
                     INSD:BP617107.1,INSD:CD534431.1,INSD:BP614449.1,
                     INSD:EG425080.1,INSD:BP612876.1,INSD:EH890182.1,
                     INSD:AV542811.1,INSD:BP645298.1,INSD:EL320294.1,
                     INSD:DR382275.1,INSD:BP614693.1,INSD:BP808420.2,
                     INSD:DR262107.1,INSD:EL987631.1,INSD:EL160723.1,
                     INSD:AV550338.1,INSD:BP610323.1,INSD:EH863420.1,
                     INSD:BP867324.1,INSD:BP613733.1,INSD:BP856857.2,
                     INSD:EG450334.1,INSD:BP621076.1,INSD:BP609184.1,
                     INSD:EG450353.1,INSD:BP600289.1,INSD:BP605409.1,
                     INSD:EL987647.1,INSD:DR262108.1,INSD:BP669583.1,
                     INSD:BP657041.1,INSD:BP649376.1,INSD:ES096991.1,
                     INSD:BP822958.1,INSD:AV527795.1,INSD:AV531369.1,
                     INSD:BP621466.1,INSD:EL263671.1,INSD:AV526002.1,
                     INSD:AV547858.1,INSD:BU636240.1,INSD:BP819615.1,
                     INSD:EG502926.1,INSD:DR362450.1,INSD:ES029766.1,
                     INSD:AV535563.1,INSD:AV539430.1,INSD:EG450332.1,
                     INSD:AV543235.1,INSD:EL121448.1,INSD:BP609911.1,
                     INSD:AU226975.1,INSD:BP808098.1,INSD:BE521000.1,
                     INSD:AI997494.1,INSD:ES172967.1,INSD:BP609017.1,
                     INSD:Z18452.1,INSD:N96333.1,INSD:BP607130.1,
                     INSD:BP640028.1,INSD:EL215606.1,INSD:AV521125.1,
                     INSD:EH924751.1,INSD:BP616037.1,INSD:AV547086.1,
                     INSD:DR275775.1,INSD:ES082550.1,INSD:BP670334.1,
                     INSD:BP615091.1,INSD:BP840986.2,INSD:EL044033.1,
                     INSD:BP852028.1,INSD:AU236153.1,INSD:BP602328.1,
                     INSD:EH969793.1,INSD:BP805575.1,INSD:BP795275.1,
                     INSD:BP622662.1,INSD:BP850276.1,INSD:ES121867.1,
                     INSD:ES085636.1,INSD:ES194436.1,INSD:BP651132.1,
                     INSD:ES163215.1,INSD:BP807795.1,INSD:BP613398.1,
                     INSD:EL177567.1,INSD:EH840807.1,INSD:DR262105.1,
                     INSD:EL199024.1,INSD:BP613900.1,INSD:DR382927.1,
                     INSD:ES130266.1,INSD:EH836418.1,INSD:BP615084.1,
                     INSD:EG450995.1,INSD:BP645024.1,INSD:DR262106.1,
                     INSD:BP621415.1,INSD:ES054765.1,INSD:BP783482.1,
                     INSD:EL089391.1,INSD:EH940989.1,INSD:EL169981.1,
                     INSD:AV532356.1,INSD:EH816349.1,INSD:BP612094.1,
                     INSD:BP780121.1,INSD:BP614879.1,INSD:BP851693.1,
                     INSD:BP632966.1,INSD:BP807998.1,INSD:BP810358.1,
                     INSD:DR379452.1,INSD:ES114201.1,INSD:EH973899.1,
                     INSD:EL181715.1,INSD:BP620091.1,INSD:BP625712.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AK228266.1,INSD:BX820037.1,INSD:BT006469.1"
                     /note="MAP kinase 17 (MPK17); CONTAINS InterPro DOMAIN/s:
                     MAP kinase, conserved site (InterPro:IPR003527), Protein
                     kinase, ATP binding site (InterPro:IPR017441), Protein
                     kinase, catalytic domain (InterPro:IPR000719),
                     Serine/threonine-protein kinase domain
                     (InterPro:IPR002290), Tyrosine-protein kinase, catalytic
                     domain (InterPro:IPR020635), Serine/threonine-protein
                     kinase-like domain (InterPro:IPR017442), Protein
                     kinase-like domain (InterPro:IPR011009); BEST Arabidopsis
                     thaliana protein match is: MAP kinase 9
                     (TAIR:AT3G18040.1); Has 113085 Blast hits to 112072
                     proteins in 3455 species: Archae - 88; Bacteria - 12258;
                     Metazoa - 41885; Fungi - 11781; Plants - 27798; Viruses -
                     485; Other Eukaryotes - 18790 (source: NCBI BLink)."
                     /codon_start=1
                     /product="MAP kinase 17"
                     /protein_id="AEC05452.1"
                     /db_xref="Araport:AT2G01450"
                     /db_xref="TAIR:AT2G01450"
                     /translation="MLEKEFFTEYGEASQYQIQEVVGKGSYGVVASAECPHTGGKVAI
                     KKMTNVFEHVSDAIRILREIKLLRLLRHPDIVEIKHIMLPPCRKEFKDIYVVFELMES
                     DLHHVLKVNDDLTPQHHQFFLYQLLRGLKFMHSAHVFHRDLKPKNILANADCKIKICD
                     LGLARVSFTDSPSAVFWTDYVATRWYRAPELCGSFYSNYTPAIDMWSVGCIFAEMLTG
                     KPLFPGKNVVHQLELVTDLLGTPSPITLSRIRNEKARKYLGNMRRKDPVPFTHKFPNI
                     DPVALKLLQRLIAFDPKDRPSAEEALADPYFQGLANVDYEPSRQPISKLEFEFERRKL
                     TRDDVRELMYREILEYHPQMLQEYLQGEENINSHFLYPSGVDQFKQEFARLEEHNDDE
                     EEHNSPPHQRKYTSLPRERVCSSEDEGSDSVHAQSSSASVVFTPPQTPNTATGLSSQK
                     ASQVDKAATPVKRSACLMRSDSICASRCVGVSSAVS"
     CDS             complement(join(199722..199956,200039..200146,
                     200229..200308,200411..200548,200637..200792,
                     200948..201097,201184..201243,201361..201488,
                     201605..202010))
                     /gene="MPK17"
                     /locus_tag="AT2G01450"
                     /gene_synonym="ATMPK17"
                     /gene_synonym="F2I9.7"
                     /gene_synonym="F2I9_7"
                     /gene_synonym="MAP kinase 17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG450996.1,INSD:BP808830.2,INSD:EG476771.1,
                     INSD:EL224734.1,INSD:AV551027.1,INSD:BP617107.1,
                     INSD:CD534431.1,INSD:BP614449.1,INSD:EG425080.1,
                     INSD:BP612876.1,INSD:EH890182.1,INSD:AV542811.1,
                     INSD:BP645298.1,INSD:EL320294.1,INSD:DR382275.1,
                     INSD:BP614693.1,INSD:DR262107.1,INSD:EL160723.1,
                     INSD:AV550338.1,INSD:BP610323.1,INSD:BP613733.1,
                     INSD:EG450334.1,INSD:BP621076.1,INSD:BP609184.1,
                     INSD:EG450353.1,INSD:BP600289.1,INSD:BP605409.1,
                     INSD:EL987647.1,INSD:DR262108.1,INSD:BP669583.1,
                     INSD:BP657041.1,INSD:BP649376.1,INSD:ES096991.1,
                     INSD:AV527795.1,INSD:BP621466.1,INSD:AV531369.1,
                     INSD:EL263671.1,INSD:BP805944.1,INSD:AV547858.1,
                     INSD:BU636240.1,INSD:EG502926.1,INSD:ES029766.1,
                     INSD:AV535563.1,INSD:AV539430.1,INSD:EG450332.1,
                     INSD:AV543235.1,INSD:EL121448.1,INSD:BP851684.1,
                     INSD:BP609911.1,INSD:AU226975.1,INSD:AI997494.1,
                     INSD:ES172967.1,INSD:BP609017.1,INSD:Z18452.1,
                     INSD:BP846533.1,INSD:BP607130.1,INSD:BP640028.1,
                     INSD:EL215606.1,INSD:EH924751.1,INSD:AV521125.1,
                     INSD:BP616037.1,INSD:AV547086.1,INSD:ES082550.1,
                     INSD:BP670334.1,INSD:BP615091.1,INSD:EL044033.1,
                     INSD:BP602328.1,INSD:EH969793.1,INSD:BP795275.1,
                     INSD:BP622662.1,INSD:ES121867.1,INSD:ES085636.1,
                     INSD:ES194436.1,INSD:BP651132.1,INSD:ES163215.1,
                     INSD:BP613398.1,INSD:EH840807.1,INSD:EL177567.1,
                     INSD:DR262105.1,INSD:EL199024.1,INSD:BP613900.1,
                     INSD:DR382927.1,INSD:ES130266.1,INSD:EH836418.1,
                     INSD:BP615084.1,INSD:BP645024.1,INSD:DR262106.1,
                     INSD:BP621415.1,INSD:ES054765.1,INSD:BP783482.1,
                     INSD:EL089391.1,INSD:EL169981.1,INSD:AV532356.1,
                     INSD:BP612094.1,INSD:BP780121.1,INSD:BP614879.1,
                     INSD:BP632966.1,INSD:ES114201.1,INSD:EH973899.1,
                     INSD:DR379452.1,INSD:EL181715.1,INSD:BP620091.1,
                     INSD:BP625712.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BT006469.1"
                     /note="MAP kinase 17 (MPK17); CONTAINS InterPro DOMAIN/s:
                     Protein kinase, ATP binding site (InterPro:IPR017441),
                     Serine/threonine-protein kinase domain
                     (InterPro:IPR002290), Serine/threonine-protein kinase-like
                     domain (InterPro:IPR017442), Protein kinase-like domain
                     (InterPro:IPR011009), MAP kinase, conserved site
                     (InterPro:IPR003527), Protein kinase, catalytic domain
                     (InterPro:IPR000719), Tyrosine-protein kinase, catalytic
                     domain (InterPro:IPR020635); BEST Arabidopsis thaliana
                     protein match is: MAP kinase 9 (TAIR:AT3G18040.1); Has
                     35333 Blast hits to 34131 proteins in 2444 species: Archae
                     - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991;
                     Plants - 531; Viruses - 0; Other Eukaryotes - 9610
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="MAP kinase 17"
                     /protein_id="AEC05453.1"
                     /db_xref="Araport:AT2G01450"
                     /db_xref="TAIR:AT2G01450"
                     /translation="MLEKEFFTEYGEASQYQIQEVVGKGSYGVVASAECPHTGGKVAI
                     KKMTNVFEHVSDAIRILREIKLLRLLRHPDIVEIKHIMLPPCRKEFKDIYVVFELMES
                     DLHHVLKVNDDLTPQHHQFFLYQLLRGLKFMHSAHVFHRDLKPKNILANADCKIKICD
                     LGLARVSFTDSPSAVFWTDYVATRWYRAPELCGSFYSNYTPAIDMWSVGCIFAEMLTG
                     KPLFPGKNVVHQLELVTDLLGTPSPITLSRIRNEKARKYLGNMRRKDPVPFTHKFPNI
                     DPVALKLLQRLIAFDPKDRPSAEEALADPYFQGLANVDYEPSRQPISKLEFEFERRKL
                     TRDDVRELMYREILEYHPQMLQEYLQGEENINSHFLYPSGVDQFKQEFARLEEHNDDE
                     EEHNSPPHQRKYTSLPRERVCSSEDEGSDSVHAQSSSASVVFTPPQTPNTATGLSSQK
                     ASQVDKAATPVKRSACLMRSDSICASRCVGVSSAVS"
     CDS             complement(join(199722..199956,200039..200146,
                     200229..200308,200411..200548,200637..200792,
                     200948..201097,201184..201243,201361..201488,
                     201605..202010))
                     /gene="MPK17"
                     /locus_tag="AT2G01450"
                     /gene_synonym="ATMPK17"
                     /gene_synonym="F2I9.7"
                     /gene_synonym="F2I9_7"
                     /gene_synonym="MAP kinase 17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG450996.1,INSD:BP808830.2,INSD:EG476771.1,
                     INSD:EL224734.1,INSD:AV551027.1,INSD:BP617107.1,
                     INSD:CD534431.1,INSD:BP614449.1,INSD:EG425080.1,
                     INSD:BP612876.1,INSD:EH890182.1,INSD:AV542811.1,
                     INSD:BP645298.1,INSD:EL320294.1,INSD:DR382275.1,
                     INSD:BP614693.1,INSD:DR262107.1,INSD:EL160723.1,
                     INSD:AV550338.1,INSD:BP610323.1,INSD:EH863420.1,
                     INSD:BP613733.1,INSD:EG450334.1,INSD:BP621076.1,
                     INSD:BP609184.1,INSD:EG450353.1,INSD:BP600289.1,
                     INSD:BP605409.1,INSD:EL987647.1,INSD:DR262108.1,
                     INSD:BP669583.1,INSD:BP657041.1,INSD:BP649376.1,
                     INSD:ES096991.1,INSD:AV527795.1,INSD:BP621466.1,
                     INSD:AV531369.1,INSD:EL263671.1,INSD:AV547858.1,
                     INSD:BU636240.1,INSD:EG502926.1,INSD:ES029766.1,
                     INSD:AV535563.1,INSD:AV539430.1,INSD:EG450332.1,
                     INSD:EG476975.1,INSD:AV543235.1,INSD:EL121448.1,
                     INSD:AA713093.1,INSD:BP609911.1,INSD:AU226975.1,
                     INSD:AI997494.1,INSD:ES172967.1,INSD:BP609017.1,
                     INSD:Z18452.1,INSD:BP607130.1,INSD:BP640028.1,
                     INSD:EL215606.1,INSD:EH924751.1,INSD:AV521125.1,
                     INSD:BP616037.1,INSD:AV547086.1,INSD:ES082550.1,
                     INSD:BP670334.1,INSD:BP615091.1,INSD:EL044033.1,
                     INSD:BP602328.1,INSD:EH969793.1,INSD:BP795275.1,
                     INSD:BP622662.1,INSD:ES121867.1,INSD:ES085636.1,
                     INSD:ES194436.1,INSD:BP651132.1,INSD:ES163215.1,
                     INSD:BP809391.1,INSD:BP613398.1,INSD:EH840807.1,
                     INSD:EL177567.1,INSD:DR262105.1,INSD:EL199024.1,
                     INSD:BP613900.1,INSD:DR382927.1,INSD:ES130266.1,
                     INSD:EH836418.1,INSD:BP615084.1,INSD:BP645024.1,
                     INSD:DR262106.1,INSD:BP621415.1,INSD:ES054765.1,
                     INSD:BP783482.1,INSD:EL089391.1,INSD:EH940989.1,
                     INSD:EL169981.1,INSD:AV532356.1,INSD:BP612094.1,
                     INSD:BP780121.1,INSD:AI993802.1,INSD:BP614879.1,
                     INSD:BP632966.1,INSD:EL967069.1,INSD:ES114201.1,
                     INSD:EH973899.1,INSD:DR379452.1,INSD:EL181715.1,
                     INSD:BP620091.1,INSD:BP625712.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BT006469.1"
                     /note="MAP kinase 17 (MPK17); CONTAINS InterPro DOMAIN/s:
                     Protein kinase, ATP binding site (InterPro:IPR017441),
                     Serine/threonine-protein kinase domain
                     (InterPro:IPR002290), Serine/threonine-protein kinase-like
                     domain (InterPro:IPR017442), Protein kinase-like domain
                     (InterPro:IPR011009), MAP kinase, conserved site
                     (InterPro:IPR003527), Protein kinase, catalytic domain
                     (InterPro:IPR000719), Tyrosine-protein kinase, catalytic
                     domain (InterPro:IPR020635); BEST Arabidopsis thaliana
                     protein match is: MAP kinase 9 (TAIR:AT3G18040.1); Has
                     35333 Blast hits to 34131 proteins in 2444 species: Archae
                     - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991;
                     Plants - 531; Viruses - 0; Other Eukaryotes - 9610
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="MAP kinase 17"
                     /protein_id="AEC05454.1"
                     /db_xref="Araport:AT2G01450"
                     /db_xref="TAIR:AT2G01450"
                     /translation="MLEKEFFTEYGEASQYQIQEVVGKGSYGVVASAECPHTGGKVAI
                     KKMTNVFEHVSDAIRILREIKLLRLLRHPDIVEIKHIMLPPCRKEFKDIYVVFELMES
                     DLHHVLKVNDDLTPQHHQFFLYQLLRGLKFMHSAHVFHRDLKPKNILANADCKIKICD
                     LGLARVSFTDSPSAVFWTDYVATRWYRAPELCGSFYSNYTPAIDMWSVGCIFAEMLTG
                     KPLFPGKNVVHQLELVTDLLGTPSPITLSRIRNEKARKYLGNMRRKDPVPFTHKFPNI
                     DPVALKLLQRLIAFDPKDRPSAEEALADPYFQGLANVDYEPSRQPISKLEFEFERRKL
                     TRDDVRELMYREILEYHPQMLQEYLQGEENINSHFLYPSGVDQFKQEFARLEEHNDDE
                     EEHNSPPHQRKYTSLPRERVCSSEDEGSDSVHAQSSSASVVFTPPQTPNTATGLSSQK
                     ASQVDKAATPVKRSACLMRSDSICASRCVGVSSAVS"
     CDS             complement(join(199722..199956,200039..200146,
                     200229..200308,200411..200548,200637..200792,
                     200948..201097,201184..201243,201361..201488,
                     201605..202010))
                     /gene="MPK17"
                     /locus_tag="AT2G01450"
                     /gene_synonym="ATMPK17"
                     /gene_synonym="F2I9.7"
                     /gene_synonym="F2I9_7"
                     /gene_synonym="MAP kinase 17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG450996.1,INSD:BP808830.2,INSD:EG476771.1,
                     INSD:EL224734.1,INSD:AV551027.1,INSD:BP617107.1,
                     INSD:CD534431.1,INSD:BP614449.1,INSD:EG425080.1,
                     INSD:BP612876.1,INSD:EH890182.1,INSD:AV542811.1,
                     INSD:BP645298.1,INSD:EL320294.1,INSD:DR382275.1,
                     INSD:BP614693.1,INSD:DR262107.1,INSD:EL160723.1,
                     INSD:AV550338.1,INSD:BP610323.1,INSD:BP613733.1,
                     INSD:EG450334.1,INSD:BP621076.1,INSD:BP609184.1,
                     INSD:EG450353.1,INSD:BP600289.1,INSD:BP605409.1,
                     INSD:EL987647.1,INSD:DR262108.1,INSD:BP669583.1,
                     INSD:BP657041.1,INSD:BP649376.1,INSD:ES096991.1,
                     INSD:AV527795.1,INSD:BP621466.1,INSD:AV531369.1,
                     INSD:EL263671.1,INSD:AV547858.1,INSD:BU636240.1,
                     INSD:EG502926.1,INSD:ES029766.1,INSD:AV535563.1,
                     INSD:AV539430.1,INSD:EG450332.1,INSD:AV543235.1,
                     INSD:EL121448.1,INSD:BP609911.1,INSD:AU226975.1,
                     INSD:AI997494.1,INSD:ES172967.1,INSD:BP609017.1,
                     INSD:Z18452.1,INSD:BP607130.1,INSD:BP863455.1,
                     INSD:BP640028.1,INSD:EL215606.1,INSD:EH924751.1,
                     INSD:AV521125.1,INSD:BP616037.1,INSD:ES082550.1,
                     INSD:BP670334.1,INSD:AV547086.1,INSD:BP615091.1,
                     INSD:EL044033.1,INSD:BP602328.1,INSD:EH969793.1,
                     INSD:BP795275.1,INSD:BP622662.1,INSD:ES121867.1,
                     INSD:ES085636.1,INSD:ES194436.1,INSD:BP651132.1,
                     INSD:ES163215.1,INSD:BP613398.1,INSD:EH840807.1,
                     INSD:EL177567.1,INSD:DR262105.1,INSD:EL199024.1,
                     INSD:BP613900.1,INSD:DR382927.1,INSD:ES130266.1,
                     INSD:EH836418.1,INSD:BP615084.1,INSD:BP645024.1,
                     INSD:DR262106.1,INSD:BP621415.1,INSD:ES054765.1,
                     INSD:BP783482.1,INSD:EL089391.1,INSD:EL169981.1,
                     INSD:AV532356.1,INSD:BP612094.1,INSD:BP780121.1,
                     INSD:BP614879.1,INSD:BP632966.1,INSD:ES114201.1,
                     INSD:EH973899.1,INSD:DR379452.1,INSD:EL181715.1,
                     INSD:BP620091.1,INSD:BP625712.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BT006469.1"
                     /note="MAP kinase 17 (MPK17); CONTAINS InterPro DOMAIN/s:
                     MAP kinase, conserved site (InterPro:IPR003527), Protein
                     kinase, ATP binding site (InterPro:IPR017441), Protein
                     kinase, catalytic domain (InterPro:IPR000719),
                     Serine/threonine-protein kinase domain
                     (InterPro:IPR002290), Tyrosine-protein kinase, catalytic
                     domain (InterPro:IPR020635), Serine/threonine-protein
                     kinase-like domain (InterPro:IPR017442), Protein
                     kinase-like domain (InterPro:IPR011009); BEST Arabidopsis
                     thaliana protein match is: MAP kinase 9
                     (TAIR:AT3G18040.1); Has 35333 Blast hits to 34131 proteins
                     in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
                     974; Fungi - 991; Plants - 531; Viruses - 0; Other
                     Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="MAP kinase 17"
                     /protein_id="AEC05455.1"
                     /db_xref="Araport:AT2G01450"
                     /db_xref="TAIR:AT2G01450"
                     /translation="MLEKEFFTEYGEASQYQIQEVVGKGSYGVVASAECPHTGGKVAI
                     KKMTNVFEHVSDAIRILREIKLLRLLRHPDIVEIKHIMLPPCRKEFKDIYVVFELMES
                     DLHHVLKVNDDLTPQHHQFFLYQLLRGLKFMHSAHVFHRDLKPKNILANADCKIKICD
                     LGLARVSFTDSPSAVFWTDYVATRWYRAPELCGSFYSNYTPAIDMWSVGCIFAEMLTG
                     KPLFPGKNVVHQLELVTDLLGTPSPITLSRIRNEKARKYLGNMRRKDPVPFTHKFPNI
                     DPVALKLLQRLIAFDPKDRPSAEEALADPYFQGLANVDYEPSRQPISKLEFEFERRKL
                     TRDDVRELMYREILEYHPQMLQEYLQGEENINSHFLYPSGVDQFKQEFARLEEHNDDE
                     EEHNSPPHQRKYTSLPRERVCSSEDEGSDSVHAQSSSASVVFTPPQTPNTATGLSSQK
                     ASQVDKAATPVKRSACLMRSDSICASRCVGVSSAVS"
     gene            205775..211963
                     /locus_tag="AT2G01460"
                     /gene_synonym="F2I9.8"
                     /gene_synonym="F2I9_8"
                     /db_xref="Araport:AT2G01460"
                     /db_xref="TAIR:AT2G01460"
     mRNA            join(205775..206252,206329..206441,206522..206648,
                     206736..206831,206904..206972,207052..207186,
                     207259..207327,207404..207447,207536..207695,
                     208034..208198,208436..208520,208623..208856,
                     208994..209085,209200..209242,209336..209493,
                     209591..209701,209791..209859,209959..210102,
                     210302..210376,210455..210631,210728..210813,
                     210917..210971,211065..211190,211289..211402,
                     211492..211611,211700..211963)
                     /locus_tag="AT2G01460"
                     /gene_synonym="F2I9.8"
                     /gene_synonym="F2I9_8"
                     /product="P-loop containing nucleoside triphosphate
                     hydrolases superfamily protein"
                     /db_xref="Araport:AT2G01460"
                     /db_xref="TAIR:AT2G01460"
     mRNA            join(205841..206252,206329..206441,206522..206648,
                     206736..206831,206904..206972,207052..207186,
                     207259..207327,207404..207447,207536..207695,
                     208034..208198,208436..208520,208581..208856,
                     208994..209085,209200..209242,209336..209493,
                     209591..209732,209825..209859,209959..210102,
                     210302..210376,210455..210631,210728..210813,
                     210917..210975,211093..211190,211289..211402,
                     211492..211611,211700..211919)
                     /locus_tag="AT2G01460"
                     /gene_synonym="F2I9.8"
                     /gene_synonym="F2I9_8"
                     /product="P-loop containing nucleoside triphosphate
                     hydrolases superfamily protein"
                     /db_xref="TAIR:AT2G01460"
                     /db_xref="Araport:AT2G01460"
     mRNA            join(206136..206252,206329..206441,206522..206648,
                     206736..206831,206904..206972,207052..207186,
                     207259..207327,207404..207447,207536..207695,
                     208034..208198,208436..208520,208581..208856,
                     208994..209085,209200..209242,209336..209493,
                     209591..209701,209791..209859,209959..210102,
                     210302..210376,210455..210631,210728..210813,
                     210917..210975,211093..211190,211289..211402,
                     211492..211611,211700..211919)
                     /locus_tag="AT2G01460"
                     /gene_synonym="F2I9.8"
                     /gene_synonym="F2I9_8"
                     /product="P-loop containing nucleoside triphosphate
                     hydrolases superfamily protein"
                     /inference="Similar to RNA sequence, EST:INSD:ES015702.1"
                     /db_xref="TAIR:AT2G01460"
                     /db_xref="Araport:AT2G01460"
     CDS             join(206136..206252,206329..206441,206522..206648,
                     206736..206831,206904..206972,207052..207186,
                     207259..207327,207404..207447,207536..207695,
                     208034..208198,208436..208520,208581..208856,
                     208994..209085,209200..209242,209336..209493,
                     209591..209732,209825..209859,209959..210102,
                     210302..210376,210455..210631,210728..210813,
                     210917..210975,211093..211190,211289..211402,
                     211492..211611,211700..211765)
                     /locus_tag="AT2G01460"
                     /gene_synonym="F2I9.8"
                     /gene_synonym="F2I9_8"
                     /note="P-loop containing nucleoside triphosphate
                     hydrolases superfamily protein; FUNCTIONS IN:
                     nucleoside-triphosphatase activity, nucleotide binding,
                     kinase activity, phosphotransferase activity, alcohol
                     group as acceptor, ATP binding; INVOLVED IN: biosynthetic
                     process, metabolic process; LOCATED IN: cellular_component
                     unknown; EXPRESSED IN: 6 plant structures; EXPRESSED
                     DURING: 4 anthesis; CONTAINS InterPro DOMAIN/s: ATPase,
                     AAA+ type, core (InterPro:IPR003593),
                     Phosphoribulokinase/uridine kinase (InterPro:IPR006083),
                     Uridine kinase (InterPro:IPR000764); BEST Arabidopsis
                     thaliana protein match is: Phosphoribulokinase / Uridine
                     kinase family (TAIR:AT1G26190.1)."
                     /codon_start=1
                     /product="P-loop containing nucleoside triphosphate
                     hydrolases superfamily protein"
                     /protein_id="AEC05457.1"
                     /db_xref="Araport:AT2G01460"
                     /db_xref="TAIR:AT2G01460"
                     /translation="MDDEVVQRVFQEGGRDFFQQQPSTSSSSSSILQSLPLHVAFDHG
                     YYLLVKSIQELREKKDGIVTVGIGGPSGSGKSSLAEKVASVIGCTVIAMEDYRDSLDD
                     GNELETLDFDALVQNLEDLINGKDTLAPVFDFQQKKRVDSKMVKTSSGVVIVDGTYAL
                     HARLRSLLDIRVAVVGGVHFSLLSKVRYDIGDSCSLDYLIDSIFPLFRKHIEPDLHHA
                     QIRINNSFVSSFREAIYKLKCKTEIVTSFPQESDVQKDNFIEMYLRPPSASEEARIND
                     WIKVRQAGIRYYLSLGDQRIVDKHFIIRPKAEFEVGRMTLGGLLALGYNVVVSYKRAS
                     TAVSYGNLSLSRETIDTLGETFLVLRGTDRKSVGAEALRMGITGPWITKSYLELILES
                     KVQQNLNFCKLTHFAGVPRLNTPPLLQPSPVITNQEKQIVAPKPIRTTPNIVTRLEDL
                     SQPWTRSPTKSQMEPMVATWHFTSYDPPHSVSSVVDSSFRDNMRLVPMPDSYDLDRGL
                     LLSVQAIQALLENKGPPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVK
                     DFKHDDFSSLDLPLLSKNISDITNSRRTKLPIFDLETGTRCGFKELEVPEECGVVSDH
                     SLHISYEIRQSLDLWVAVVGGVHSHLISRVQRDKSRIGCFMSQNEIMMTVFPMFQQHI
                     EPHLVHAHVKIRNDFDPVLSPESSLFVLKSNKQVPYQDILSILDSTKFCSSVQNFIDI
                     YFRLSGLPANGQLSDSDCIRVRICEGRFAVLIREPIREGNFIIQPKVDFDISVSTVAG
                     LLNLGYQAVAYIEASAFIYQDGKVNVPSPYIQIKGANKEAVTAAGSALKLDGSYTTKS
                     YLQIVLERLPPVQRSSSGIHTQQAARLQELVEFIQSQGSSNSVSESSPRRDGSSIDNV
                     LEDMQSRIKRLERWHTINTVLWTFLMSALVGYSLYQRKRQ"
     CDS             join(206136..206252,206329..206441,206522..206648,
                     206736..206831,206904..206972,207052..207186,
                     207259..207327,207404..207447,207536..207695,
                     208034..208198,208436..208520,208581..208856,
                     208994..209085,209200..209242,209336..209493,
                     209591..209701,209791..209859,209959..210102,
                     210302..210376,210455..210631,210728..210813,
                     210917..210975,211093..211190,211289..211402,
                     211492..211611,211700..211765)
                     /locus_tag="AT2G01460"
                     /gene_synonym="F2I9.8"
                     /gene_synonym="F2I9_8"
                     /inference="Similar to RNA sequence, EST:INSD:ES015702.1"
                     /note="P-loop containing nucleoside triphosphate
                     hydrolases superfamily protein; FUNCTIONS IN:
                     nucleoside-triphosphatase activity, kinase activity,
                     nucleotide binding, phosphotransferase activity, alcohol
                     group as acceptor, ATP binding; INVOLVED IN: biosynthetic
                     process, metabolic process; LOCATED IN: cellular_component
                     unknown; EXPRESSED IN: 6 plant structures; EXPRESSED
                     DURING: 4 anthesis; CONTAINS InterPro DOMAIN/s:
                     Phosphoribulokinase/uridine kinase (InterPro:IPR006083),
                     ATPase, AAA+ type, core (InterPro:IPR003593), Uridine
                     kinase (InterPro:IPR000764); BEST Arabidopsis thaliana
                     protein match is: Phosphoribulokinase / Uridine kinase
                     family (TAIR:AT1G26190.1); Has 3953 Blast hits to 3156
                     proteins in 1342 species: Archae - 38; Bacteria - 3073;
                     Metazoa - 244; Fungi - 122; Plants - 227; Viruses - 4;
                     Other Eukaryotes - 245 (source: NCBI BLink)."
                     /codon_start=1
                     /product="P-loop containing nucleoside triphosphate
                     hydrolases superfamily protein"
                     /protein_id="AEC05456.1"
                     /db_xref="Araport:AT2G01460"
                     /db_xref="TAIR:AT2G01460"
                     /translation="MDDEVVQRVFQEGGRDFFQQQPSTSSSSSSILQSLPLHVAFDHG
                     YYLLVKSIQELREKKDGIVTVGIGGPSGSGKSSLAEKVASVIGCTVIAMEDYRDSLDD
                     GNELETLDFDALVQNLEDLINGKDTLAPVFDFQQKKRVDSKMVKTSSGVVIVDGTYAL
                     HARLRSLLDIRVAVVGGVHFSLLSKVRYDIGDSCSLDYLIDSIFPLFRKHIEPDLHHA
                     QIRINNSFVSSFREAIYKLKCKTEIVTSFPQESDVQKDNFIEMYLRPPSASEEARIND
                     WIKVRQAGIRYYLSLGDQRIVDKHFIIRPKAEFEVGRMTLGGLLALGYNVVVSYKRAS
                     TAVSYGNLSLSRETIDTLGETFLVLRGTDRKSVGAEALRMGITGPWITKSYLELILES
                     KVQQNLNFCKLTHFAGVPRLNTPPLLQPSPVITNQEKQIVAPKPIRTTPNIVTRLEDL
                     SQPWTRSPTKSQMEPMVATWHFTSYDPPHSVSSVVDSSFRDNMRLVPMPDSYDLDRGL
                     LLSVQAIQALLENKGPPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVK
                     DFKHDDFSSLDLPLLSKNISDITNSRRTKLPIFDLETGTRCGFKELEVPEECGVIIFE
                     GVYALHPEIRQSLDLWVAVVGGVHSHLISRVQRDKSRIGCFMSQNEIMMTVFPMFQQH
                     IEPHLVHAHVKIRNDFDPVLSPESSLFVLKSNKQVPYQDILSILDSTKFCSSVQNFID
                     IYFRLSGLPANGQLSDSDCIRVRICEGRFAVLIREPIREGNFIIQPKVDFDISVSTVA
                     GLLNLGYQAVAYIEASAFIYQDGKVNVPSPYIQIKGANKEAVTAAGSALKLDGSYTTK
                     SYLQIVLERLPPVQRSSSGIHTQQAARLQELVEFIQSQGSSNSVSESSPRRDGSSIDN
                     VLEDMQSRIKRLERWHTINTVLWTFLMSALVGYSLYQRKRQ"
     CDS             join(206136..206252,206329..206441,206522..206648,
                     206736..206831,206904..206972,207052..207186,
                     207259..207327,207404..207447,207536..207695,
                     208034..208198,208436..208520,208623..208856,
                     208994..209085,209200..209242,209336..209493,
                     209591..209701,209791..209859,209959..210102,
                     210302..210376,210455..210631,210728..210813,
                     210917..210971,211065..211190,211289..211402,
                     211492..211611,211700..211765)
                     /locus_tag="AT2G01460"
                     /gene_synonym="F2I9.8"
                     /gene_synonym="F2I9_8"
                     /codon_start=1
                     /product="P-loop containing nucleoside triphosphate
                     hydrolases superfamily protein"
                     /protein_id="ANM61396.1"
                     /db_xref="Araport:AT2G01460"
                     /db_xref="TAIR:AT2G01460"
                     /translation="MDDEVVQRVFQEGGRDFFQQQPSTSSSSSSILQSLPLHVAFDHG
                     YYLLVKSIQELREKKDGIVTVGIGGPSGSGKSSLAEKVASVIGCTVIAMEDYRDSLDD
                     GNELETLDFDALVQNLEDLINGKDTLAPVFDFQQKKRVDSKMVKTSSGVVIVDGTYAL
                     HARLRSLLDIRVAVVGGVHFSLLSKVRYDIGDSCSLDYLIDSIFPLFRKHIEPDLHHA
                     QIRINNSFVSSFREAIYKLKCKTEIVTSFPQESDVQKDNFIEMYLRPPSASEEARIND
                     WIKVRQAGIRYYLSLGDQRIVDKHFIIRPKAEFEVGRMTLGGLLALGYNVVVSYKRAS
                     TAVSYGNLSLSRETIDTLGETFLVLRGTDRKSVGAEALRMGITGPWITKSYLELILES
                     KGVPRLNTPPLLQPSPVITNQEKQIVAPKPIRTTPNIVTRLEDLSQPWTRSPTKSQME
                     PMVATWHFTSYDPPHSVSSVVDSSFRDNMRLVPMPDSYDLDRGLLLSVQAIQALLENK
                     GPPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKHDDFSSLDLPL
                     LSKNISDITNSRRTKLPIFDLETGTRCGFKELEVPEECGVIIFEGVYALHPEIRQSLD
                     LWVAVVGGVHSHLISRVQRDKSRIGCFMSQNEIMMTVFPMFQQHIEPHLVHAHVKIRN
                     DFDPVLSPESSLFVLKSNKQVPYQDILSILDSTKFCSSVQNFIDIYFRLSGLPANGQL
                     SDSDCIRVRICEGRFAVLIREPIREGNFIIQPKVDFDISVSTVAGLLNLGYQAVAYIE
                     ASAFIYQDGKILIEVDHLQDVPSPYIQIKGANKEAVTAAGSALKLDGSYTTKSYLQIV
                     LERLPPVQRSSSGIHTQQAARLQELVEFIQSQGSSNSVSESSPRRDGSSIDNVLEDMQ
                     SRIKRLERWHTINTVLWTFLMSALVGYSLYQRKRQ"
     gene            complement(211913..214473)
                     /gene="STL2P"
                     /locus_tag="AT2G01470"
                     /gene_synonym="ATSEC12"
                     /gene_synonym="F2I9.9"
                     /gene_synonym="F2I9_9"
                     /gene_synonym="SEC12P-like 2 protein"
                     /note="Sec12p-like protein (GTP exchange protein) that
                     functionally complements yeast sec12 null mutant. Protein
                     is localized to the ER."
                     /db_xref="Araport:AT2G01470"
                     /db_xref="TAIR:AT2G01470"
     mRNA            complement(join(211913..212306,212411..212478,
                     212640..212756,212841..212961,213054..213129,
                     213225..213321,213455..213546,213639..213783,
                     213952..214046,214157..214473))
                     /gene="STL2P"
                     /locus_tag="AT2G01470"
                     /gene_synonym="ATSEC12"
                     /gene_synonym="F2I9.9"
                     /gene_synonym="F2I9_9"
                     /gene_synonym="SEC12P-like 2 protein"
                     /product="SEC12P-like 2 protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES030263.1,INSD:DR213257.1,INSD:DR213258.1,
                     INSD:ES008562.1,INSD:EG512388.1,INSD:BP562342.2,
                     INSD:CD531610.1,INSD:CF652185.1,INSD:CD532155.1,
                     INSD:EL157178.1,INSD:EL979856.1,INSD:EH903967.1,
                     INSD:EL007760.1,INSD:ES053844.1,INSD:ES005893.1,
                     INSD:DR213259.1,INSD:ES012673.1,INSD:EL251228.1,
                     INSD:CD532145.1,INSD:BP560897.1,INSD:EL148539.1,
                     INSD:BP854449.1,INSD:EH875262.1,INSD:DR213260.1,
                     INSD:EL048908.1,INSD:ES099438.1,INSD:AV783710.1,
                     INSD:ES212187.1,INSD:ES026475.1,INSD:EL217298.1,
                     INSD:ES003456.1,INSD:DR379550.1,INSD:EL281828.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY123030.1,INSD:M95796.1,INSD:BX820002.1,
                     INSD:AY074332.1,INSD:AY065198.1"
                     /db_xref="TAIR:AT2G01470"
                     /db_xref="Araport:AT2G01470"
     CDS             complement(join(212215..212306,212411..212478,
                     212640..212756,212841..212961,213054..213129,
                     213225..213321,213455..213546,213639..213783,
                     213952..214046,214157..214435))
                     /gene="STL2P"
                     /locus_tag="AT2G01470"
                     /gene_synonym="ATSEC12"
                     /gene_synonym="F2I9.9"
                     /gene_synonym="F2I9_9"
                     /gene_synonym="SEC12P-like 2 protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES030263.1,INSD:DR213257.1,INSD:DR213258.1,
                     INSD:ES008562.1,INSD:EG512388.1,INSD:BP562342.2,
                     INSD:CD531610.1,INSD:CF652185.1,INSD:CD532155.1,
                     INSD:EL157178.1,INSD:EL979856.1,INSD:EH903967.1,
                     INSD:EL007760.1,INSD:ES053844.1,INSD:ES005893.1,
                     INSD:DR213259.1,INSD:ES012673.1,INSD:EL251228.1,
                     INSD:CD532145.1,INSD:BP560897.1,INSD:EL148539.1,
                     INSD:BP854449.1,INSD:EH875262.1,INSD:DR213260.1,
                     INSD:EL048908.1,INSD:ES099438.1,INSD:AV783710.1,
                     INSD:ES212187.1,INSD:ES026475.1,INSD:EL217298.1,
                     INSD:ES003456.1,INSD:DR379550.1,INSD:EL281828.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY123030.1,INSD:M95796.1,INSD:BX820002.1,
                     INSD:AY074332.1,INSD:AY065198.1"
                     /note="SEC12P-like 2 protein (STL2P); FUNCTIONS IN:
                     nucleotide binding; INVOLVED IN: ER to Golgi
                     vesicle-mediated transport; LOCATED IN: integral to
                     endoplasmic reticulum membrane, endoplasmic reticulum,
                     plasma membrane, membrane; EXPRESSED IN: 25 plant
                     structures; EXPRESSED DURING: 13 growth stages; CONTAINS
                     InterPro DOMAIN/s: WD40 repeat-like-containing domain
                     (InterPro:IPR011046), WD40-repeat-containing domain
                     (InterPro:IPR017986), WD40 repeat (InterPro:IPR001680),
                     WD40/YVTN repeat-like-containing domain
                     (InterPro:IPR015943), WD40 repeat, subgroup
                     (InterPro:IPR019781); BEST Arabidopsis thaliana protein
                     match is: Transducin/WD40 repeat-like superfamily protein
                     (TAIR:AT5G50550.1); Has 6374 Blast hits to 3814 proteins
                     in 364 species: Archae - 22; Bacteria - 2789; Metazoa -
                     1016; Fungi - 1422; Plants - 400; Viruses - 0; Other
                     Eukaryotes - 725 (source: NCBI BLink)."
                     /codon_start=1
                     /product="SEC12P-like 2 protein"
                     /protein_id="AEC05458.1"
                     /db_xref="Araport:AT2G01470"
                     /db_xref="TAIR:AT2G01470"
                     /translation="MANQSTETNQPSNMQTYGVPIYAADWIPEVDVRSKIIMDPEKSE
                     DDDESSSSSSSSRSCIVLSGGGGEGRSGISNVILICRVDLNTNSLSEQPLGRLVVGSD
                     LPYRMAVHPREGGLICALPNSCKLFHWEDIMSREDNQAGESEEVIKELRDVGQQLALA
                     FNPEGSVLAAGAEDGTLRVFKWPSMNTLLNESQAHSSVKCLTFSESGQFLVSLGGPVC
                     RVWDVNASAAVASLSKEKDEMFASCRFSVDSAGNEVLYIAANTERGGSIITCDTKLWK
                     RKWSKPIKKNSISAFNVSADGKLLAIGTLEGDVLILESTRMQTIQVVKKAHLGLVTAL
                     TFSPDSRGLVSVSFDSRARLTMIEQKGDKPGVRWWLLVLLIVLLYVVAYYYMKAKGII
                     P"
     gene            216605..221002
                     /locus_tag="AT2G01480"
                     /gene_synonym="F2I9.10"
                     /gene_synonym="F2I9_10"
                     /db_xref="Araport:AT2G01480"
                     /db_xref="TAIR:AT2G01480"
     mRNA            join(216605..217357,217925..217994,218196..218263,
                     218376..218464,218554..218751,218926..219130,
                     219258..219425,219564..219731,219812..220002,
                     220173..220989)
                     /locus_tag="AT2G01480"
                     /gene_synonym="F2I9.10"
                     /gene_synonym="F2I9_10"
                     /product="O-fucosyltransferase family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP599385.1,INSD:BX837171.1,INSD:EL980113.1,
                     INSD:AV801148.1,INSD:DR364627.1,INSD:DR364630.1,
                     INSD:DR364621.1,INSD:DR364628.1,INSD:DR364632.1,
                     INSD:DR364622.1,INSD:BP601713.1,INSD:DR364625.1,
                     INSD:EH923819.1,INSD:BP807993.1,INSD:DR364629.1,
                     INSD:AV828350.1,INSD:DR364631.1,INSD:DR364624.1,
                     INSD:DR364626.1,INSD:AV813743.1,INSD:DR364623.1,
                     INSD:EH965250.1,INSD:ES147210.1,INSD:BP805071.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AK227124.1,INSD:AY128818.1,INSD:AY093109.1,
                     INSD:BX818819.1"
                     /db_xref="TAIR:AT2G01480"
                     /db_xref="Araport:AT2G01480"
     mRNA            join(216695..217357,217925..217994,218196..218263,
                     218376..218464,218554..218751,218926..219130,
                     219258..219425,219564..219731,219812..221002)
                     /locus_tag="AT2G01480"
                     /gene_synonym="F2I9.10"
                     /gene_synonym="F2I9_10"
                     /product="O-fucosyltransferase family protein"
                     /db_xref="Araport:AT2G01480"
                     /db_xref="TAIR:AT2G01480"
     CDS             join(216980..217357,217925..217994,218196..218263,
                     218376..218464,218554..218751,218926..219130,
                     219258..219425,219564..219731,219812..220002,
                     220173..220341)
                     /locus_tag="AT2G01480"
                     /gene_synonym="F2I9.10"
                     /gene_synonym="F2I9_10"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP599385.1,INSD:BX837171.1,INSD:EL980113.1,
                     INSD:AV801148.1,INSD:DR364627.1,INSD:DR364630.1,
                     INSD:DR364621.1,INSD:DR364628.1,INSD:DR364632.1,
                     INSD:DR364622.1,INSD:BP601713.1,INSD:DR364625.1,
                     INSD:EH923819.1,INSD:BP807993.1,INSD:DR364629.1,
                     INSD:AV828350.1,INSD:DR364631.1,INSD:DR364624.1,
                     INSD:DR364626.1,INSD:AV813743.1,INSD:DR364623.1,
                     INSD:EH965250.1,INSD:ES147210.1,INSD:BP805071.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AK227124.1,INSD:AY128818.1,INSD:AY093109.1,
                     INSD:BX818819.1"
                     /note="O-fucosyltransferase family protein; LOCATED IN:
                     chloroplast; EXPRESSED IN: 23 plant structures; EXPRESSED
                     DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
                     GDP-fucose protein O-fucosyltransferase
                     (InterPro:IPR019378); BEST Arabidopsis thaliana protein
                     match is: O-fucosyltransferase family protein
                     (TAIR:AT1G14970.1); Has 836 Blast hits to 825 proteins in
                     29 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
                     0; Plants - 836; Viruses - 0; Other Eukaryotes - 0
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="O-fucosyltransferase family protein"
                     /protein_id="AEC05459.1"
                     /db_xref="Araport:AT2G01480"
                     /db_xref="TAIR:AT2G01480"
                     /translation="MLAKNRLPGSGHTTPSPPASPRRSPRYRHGRSKAAAGSRFPTVQ
                     PSRTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRRPPPGS
                     VYKSPQVYAKLRPEMDADNSTADAITTIWKHSYKGGEWKPYVNKSTGDLPESNGYIYV
                     EANGGLNQQRTSICNAVAVAGYLNATLVIPNFHYHSIWRDPSKFGDIYDEEFFVSTLS
                     NDVRVVDTIPEYLMERFDHNMTNVYNFRVKAWSPIQYYRDSILPKLLEEKIIRISPFA
                     NRLSFDAPQAVQRLRCLANYEALKFSKTILTLGETLVKRMKEQSANHGAKYVSVHLRF
                     EEDMVAFSCCIFDGGNQEKQDMIAARERGWKGKFTKPGRVIRPGAIRQNGKCPLTPLE
                     VGLMLRGMGFNKSTYIFLASGEIYDANRTMAPLLEMFPNLQTKEMLASEEELAPYKNF
                     SSRMAAIDYTVCLHSEVFVTTQGGNFPHFLMGHRRYMFGGHSKTIRPDKRKLAILFDN
                     PNIGWRSFKRQMLNMRSHSDSKGFELKRPNDSIYTFPCPDCMSRRNKTTTPESRPPPA
                     T"
     CDS             join(216980..217357,217925..217994,218196..218263,
                     218376..218464,218554..218751,218926..219130,
                     219258..219425,219564..219731,219812..220057)
                     /locus_tag="AT2G01480"
                     /gene_synonym="F2I9.10"
                     /gene_synonym="F2I9_10"
                     /codon_start=1
                     /product="O-fucosyltransferase family protein"
                     /protein_id="ANM61935.1"
                     /db_xref="Araport:AT2G01480"
                     /db_xref="TAIR:AT2G01480"
                     /translation="MLAKNRLPGSGHTTPSPPASPRRSPRYRHGRSKAAAGSRFPTVQ
                     PSRTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRRPPPGS
                     VYKSPQVYAKLRPEMDADNSTADAITTIWKHSYKGGEWKPYVNKSTGDLPESNGYIYV
                     EANGGLNQQRTSICNAVAVAGYLNATLVIPNFHYHSIWRDPSKFGDIYDEEFFVSTLS
                     NDVRVVDTIPEYLMERFDHNMTNVYNFRVKAWSPIQYYRDSILPKLLEEKIIRISPFA
                     NRLSFDAPQAVQRLRCLANYEALKFSKTILTLGETLVKRMKEQSANHGAKYVSVHLRF
                     EEDMVAFSCCIFDGGNQEKQDMIAARERGWKGKFTKPGRVIRPGAIRQNGKCPLTPLE
                     VGLMLRGMGFNKSTYIFLASGEIYDANRTMAPLLEMFPNLQTKEMLASEEELAPYKNF
                     SSRMAAIDYTVCLHSEVFVTTQGGNFPHFLMGHRRYMFGGHSKTIRPDKRKLAILFDN
                     PNIGYSLLLLFVFDKPYQIST"
     gene            221013..223809
                     /gene="PAHX"
                     /locus_tag="AT2G01490"
                     /gene_synonym="F2I9.11"
                     /gene_synonym="F2I9_11"
                     /gene_synonym="phytanoyl-CoA 2-hydroxylase"
                     /note="Encodes a phytanoyl-CoA 2-hydroxylase (PAHX)."
                     /db_xref="Araport:AT2G01490"
                     /db_xref="TAIR:AT2G01490"
     mRNA            join(221013..221370,221466..221587,221667..221727,
                     222077..222145,222225..222343,222466..222613,
                     222711..222855,222954..223040,223142..223809)
                     /gene="PAHX"
                     /locus_tag="AT2G01490"
                     /gene_synonym="F2I9.11"
                     /gene_synonym="F2I9_11"
                     /gene_synonym="phytanoyl-CoA 2-hydroxylase"
                     /product="phytanoyl-CoA dioxygenase (PhyH) family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH809619.1,INSD:BP585151.1,INSD:ES174519.1,
                     INSD:EL291262.1,INSD:EL015122.1,INSD:AV522193.1,
                     INSD:DR376769.1,INSD:AV811699.1,INSD:EG445698.1,
                     INSD:EG500619.1,INSD:EL305536.1,INSD:EL138551.1,
                     INSD:BP864505.1,INSD:EL216351.1,INSD:CB264431.1,
                     INSD:BP583686.1,INSD:EH808145.1,INSD:EH962219.1,
                     INSD:BP579035.1,INSD:EL969847.1,INSD:EL291711.1,
                     INSD:AV537561.1,INSD:EL165464.1,INSD:EL243889.1,
                     INSD:BP581271.1,INSD:DR202255.1,INSD:EG451518.1,
                     INSD:EG501335.1,INSD:DR202258.1,INSD:AV814392.1,
                     INSD:EH931517.1,INSD:EL191015.1,INSD:EL173731.1,
                     INSD:EH796194.1,INSD:EL131928.1,INSD:EG501334.1,
                     INSD:EL171984.1,INSD:EL201225.1,INSD:EG445699.1,
                     INSD:EL265385.1,INSD:EL009991.1,INSD:EH950669.1,
                     INSD:EH912110.1,INSD:EL313370.1,INSD:BP574694.1,
                     INSD:BP665839.1,INSD:AV540795.1,INSD:DR202256.1,
                     INSD:CK118570.1,INSD:DR202259.1,INSD:EL247618.1,
                     INSD:BP577227.1,INSD:EL337313.1,INSD:BP628510.1,
                     INSD:EH911644.1,INSD:EG451519.1,INSD:EL122579.1,
                     INSD:AV559846.1,INSD:EH931683.1,INSD:EL129716.1,
                     INSD:BP590608.1,INSD:EH914640.1,INSD:EL186293.1,
                     INSD:R90632.1,INSD:EL321054.1,INSD:EL144460.1,
                     INSD:EL095907.1,INSD:EL265585.1,INSD:BP634017.1,
                     INSD:DR202257.1,INSD:EH970143.1,INSD:EL299877.1,
                     INSD:BP801863.1,INSD:T46060.1,INSD:EL075492.1,
                     INSD:N37203.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY057710.1,INSD:AY088080.1,INSD:AY116965.1"
                     /db_xref="TAIR:AT2G01490"
                     /db_xref="Araport:AT2G01490"
     mRNA            join(221020..221370,221466..221587,221667..221727,
                     222077..222145,222225..222343,222466..222613,
                     222711..222855,222954..223040,223142..223212,
                     223428..223795)
                     /gene="PAHX"
                     /locus_tag="AT2G01490"
                     /gene_synonym="F2I9.11"
                     /gene_synonym="F2I9_11"
                     /gene_synonym="phytanoyl-CoA 2-hydroxylase"
                     /product="phytanoyl-CoA dioxygenase (PhyH) family protein"
                     /db_xref="Araport:AT2G01490"
                     /db_xref="TAIR:AT2G01490"
     CDS             join(221316..221370,221466..221587,221667..221727,
                     222077..222145,222225..222343,222466..222613,
                     222711..222855,222954..223040,223142..223187)
                     /gene="PAHX"
                     /locus_tag="AT2G01490"
                     /gene_synonym="F2I9.11"
                     /gene_synonym="F2I9_11"
                     /gene_synonym="phytanoyl-CoA 2-hydroxylase"
                     /codon_start=1
                     /product="phytanoyl-CoA dioxygenase (PhyH) family protein"
                     /protein_id="ANM62973.1"
                     /db_xref="Araport:AT2G01490"
                     /db_xref="TAIR:AT2G01490"
                     /translation="MGITGSLTPDQLDFFHSQGYLVIESFASEDEIRGLRKRMDELLN
                     QFDCSVSSIFSTKNQKHTTDNYFFESAEKISFFFEEKAFGDDGKLKQPKQLSINKVGH
                     ALHELDPLYKDFTYSSKFSSLASSLGYRRPVVMQSMYIFKQPGIGGEVVPHQDNSFVY
                     TDPQSCTGLWIALEDSTLVNGCLWAIPGSHKNGLVRRFIRGDNGITFDQPSPSYEQKD
                     FVSIEMKAGSLIAIHGDLIHQSFENLSSKSRHAYSLHVVESDGCKWAKDNWIQRAKMP
                     EPLYVLP"
     CDS             join(221316..221370,221466..221587,221667..221727,
                     222077..222145,222225..222343,222466..222613,
                     222711..222855,222954..223040,223142..223187)
                     /gene="PAHX"
                     /locus_tag="AT2G01490"
                     /gene_synonym="F2I9.11"
                     /gene_synonym="F2I9_11"
                     /gene_synonym="phytanoyl-CoA 2-hydroxylase"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH809619.1,INSD:BP585151.1,INSD:ES174519.1,
                     INSD:EL291262.1,INSD:EL015122.1,INSD:AV522193.1,
                     INSD:DR376769.1,INSD:AV811699.1,INSD:EG445698.1,
                     INSD:EG500619.1,INSD:EL305536.1,INSD:EL138551.1,
                     INSD:BP864505.1,INSD:EL216351.1,INSD:CB264431.1,
                     INSD:BP583686.1,INSD:EH808145.1,INSD:EH962219.1,
                     INSD:BP579035.1,INSD:EL969847.1,INSD:EL291711.1,
                     INSD:AV537561.1,INSD:EL165464.1,INSD:EL243889.1,
                     INSD:BP581271.1,INSD:DR202255.1,INSD:EG451518.1,
                     INSD:EG501335.1,INSD:DR202258.1,INSD:AV814392.1,
                     INSD:EH931517.1,INSD:EL191015.1,INSD:EL173731.1,
                     INSD:EH796194.1,INSD:EL131928.1,INSD:EG501334.1,
                     INSD:EL171984.1,INSD:EL201225.1,INSD:EG445699.1,
                     INSD:EL265385.1,INSD:EL009991.1,INSD:EH950669.1,
                     INSD:EH912110.1,INSD:EL313370.1,INSD:BP574694.1,
                     INSD:BP665839.1,INSD:AV540795.1,INSD:DR202256.1,
                     INSD:CK118570.1,INSD:DR202259.1,INSD:EL247618.1,
                     INSD:BP577227.1,INSD:EL337313.1,INSD:BP628510.1,
                     INSD:EH911644.1,INSD:EG451519.1,INSD:EL122579.1,
                     INSD:AV559846.1,INSD:EH931683.1,INSD:EL129716.1,
                     INSD:BP590608.1,INSD:EH914640.1,INSD:EL186293.1,
                     INSD:R90632.1,INSD:EL321054.1,INSD:EL144460.1,
                     INSD:EL095907.1,INSD:EL265585.1,INSD:BP634017.1,
                     INSD:DR202257.1,INSD:EH970143.1,INSD:EL299877.1,
                     INSD:BP801863.1,INSD:T46060.1,INSD:EL075492.1,
                     INSD:N37203.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY057710.1,INSD:AY088080.1,INSD:AY116965.1"
                     /note="phytanoyl-CoA dioxygenase (PhyH) family protein;
                     FUNCTIONS IN: phytanoyl-CoA dioxygenase activity; INVOLVED
                     IN: N-terminal protein myristoylation; LOCATED IN: plasma
                     membrane; EXPRESSED IN: 25 plant structures; EXPRESSED
                     DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
                     Phytanoyl-CoA dioxygenase (InterPro:IPR008775); Has 2926
                     Blast hits to 2921 proteins in 334 species: Archae - 4;
                     Bacteria - 485; Metazoa - 347; Fungi - 101; Plants - 64;
                     Viruses - 0; Other Eukaryotes - 1925 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="phytanoyl-CoA dioxygenase (PhyH) family protein"
                     /protein_id="AEC05460.1"
                     /db_xref="Araport:AT2G01490"
                     /db_xref="TAIR:AT2G01490"
                     /translation="MGITGSLTPDQLDFFHSQGYLVIESFASEDEIRGLRKRMDELLN
                     QFDCSVSSIFSTKNQKHTTDNYFFESAEKISFFFEEKAFGDDGKLKQPKQLSINKVGH
                     ALHELDPLYKDFTYSSKFSSLASSLGYRRPVVMQSMYIFKQPGIGGEVVPHQDNSFVY
                     TDPQSCTGLWIALEDSTLVNGCLWAIPGSHKNGLVRRFIRGDNGITFDQPSPSYEQKD
                     FVSIEMKAGSLIAIHGDLIHQSFENLSSKSRHAYSLHVVESDGCKWAKDNWIQRAKMP
                     EPLYVLP"
     gene            complement(224156..226234)
                     /gene="PFS2"
                     /locus_tag="AT2G01500"
                     /gene_synonym="F2I9.12"
                     /gene_synonym="F2I9_12"
                     /gene_synonym="HIGH EXPRESSION OF OSMOTICALLY RESPONSIVE
                     GENE 9"
                     /gene_synonym="HOS9"
                     /gene_synonym="PRETTY FEW SEEDS 2"
                     /gene_synonym="WOX6"
                     /gene_synonym="WUSCHEL RELATED HOMEOBOX 6"
                     /note="PFS2 encodes a homeodomain gene that is a member of
                     the WUS clade of transcription factors. It delays
                     differentiation and maturation of primordia and regulates
                     ovule patterning. The pfs2 mutant exhibits developmental
                     defects in the maternal integuments and gametophyte,
                     specifically, the boundary between the chalaza and the
                     nucellus shifted towards the distal end of pfs2 ovule
                     primordia. In addition, leaves displayed curling and
                     petals were wavy and crenulated. Overexpression of PFS2
                     affects floral organ and leaf development. Single- and
                     double-mutant analyses reveal that PFS2 activity represses
                     AGAMOUS expression in young floral primordia. Also
                     involved in regulation of response to low temperature."
                     /db_xref="Araport:AT2G01500"
                     /db_xref="TAIR:AT2G01500"
     mRNA            complement(join(224156..224793,225226..225293,
                     225502..225846,225919..226234))
                     /gene="PFS2"
                     /locus_tag="AT2G01500"
                     /gene_synonym="F2I9.12"
                     /gene_synonym="F2I9_12"
                     /gene_synonym="HIGH EXPRESSION OF OSMOTICALLY RESPONSIVE
                     GENE 9"
                     /gene_synonym="HOS9"
                     /gene_synonym="PRETTY FEW SEEDS 2"
                     /gene_synonym="WOX6"
                     /gene_synonym="WUSCHEL RELATED HOMEOBOX 6"
                     /product="Homeodomain-like superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR249923.1,INSD:DR249928.1,INSD:DR372931.1,
                     INSD:DR249927.1,INSD:DR751194.1,INSD:DR249925.1,
                     INSD:DR751195.1,INSD:DR249926.1,INSD:DR249924.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:DQ652945.1,INSD:AY085832.1,INSD:AY885222.1,
                     INSD:AY251399.2,INSD:DQ446451.1"
                     /db_xref="TAIR:AT2G01500"
                     /db_xref="Araport:AT2G01500"
     CDS             complement(join(224470..224793,225226..225293,
                     225502..225846,225919..225997))
                     /gene="PFS2"
                     /locus_tag="AT2G01500"
                     /gene_synonym="F2I9.12"
                     /gene_synonym="F2I9_12"
                     /gene_synonym="HIGH EXPRESSION OF OSMOTICALLY RESPONSIVE
                     GENE 9"
                     /gene_synonym="HOS9"
                     /gene_synonym="PRETTY FEW SEEDS 2"
                     /gene_synonym="WOX6"
                     /gene_synonym="WUSCHEL RELATED HOMEOBOX 6"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR249923.1,INSD:DR249928.1,INSD:DR372931.1,
                     INSD:DR249927.1,INSD:DR751194.1,INSD:DR249925.1,
                     INSD:DR751195.1,INSD:DR249926.1,INSD:DR249924.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:DQ652945.1,INSD:AY085832.1,INSD:AY885222.1,
                     INSD:AY251399.2,INSD:DQ446451.1"
                     /note="PRETTY FEW SEEDS 2 (PFS2); FUNCTIONS IN:
                     sequence-specific DNA binding transcription factor
                     activity; INVOLVED IN: in 9 processes; LOCATED IN: primary
                     endosperm nucleus, nucleus; EXPRESSED IN: 12 plant
                     structures; CONTAINS InterPro DOMAIN/s: Homeobox
                     (InterPro:IPR001356), Homeodomain-like
                     (InterPro:IPR009057); BEST Arabidopsis thaliana protein
                     match is: WUSCHEL related homeobox 1 (TAIR:AT3G18010.1);
                     Has 564 Blast hits to 564 proteins in 49 species: Archae -
                     0; Bacteria - 0; Metazoa - 0; Fungi - 4; Plants - 560;
                     Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Homeodomain-like superfamily protein"
                     /protein_id="AEC05461.1"
                     /db_xref="Araport:AT2G01500"
                     /db_xref="TAIR:AT2G01500"
                     /translation="MGYISNNNLINYLPLSTTQPPLLLTHCDINGNDHHQLITASSGE
                     HDIDERKNNIPAAATLRWNPTPEQITTLEELYRSGTRTPTTEQIQQIASKLRKYGRIE
                     GKNVFYWFQNHKARERLKRRRREGGAIIKPHKDVKDSSSGGHRVDQTKLCPSFPHTNR
                     PQPQHELDPASYNKDNNANNEDHGTTEESDQRASEVGKYATWRNLVTWSITQQPEEIN
                     IDENVNGEEEETRDNRTLNLFPVREYQEKTGRLIEKTKACNYCYYYEFMPLKN"
     gene            complement(228577..229899)
                     /gene="CLE16"
                     /locus_tag="AT2G01505"
                     /gene_synonym="CLAVATA3/ESR-RELATED 16"
                     /note="Member of a large family of putative ligands
                     homologous to the Clavata3 gene. Consists of a single
                     exon."
                     /db_xref="Araport:AT2G01505"
                     /db_xref="TAIR:AT2G01505"
     mRNA            complement(228577..229899)
                     /gene="CLE16"
                     /locus_tag="AT2G01505"
                     /gene_synonym="CLAVATA3/ESR-RELATED 16"
                     /product="CLAVATA3/ESR-RELATED 16"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AI993471.1,INSD:EL096784.1,INSD:EG445747.1,
                     INSD:DR334152.1,INSD:EG445748.1,INSD:EG445745.1,
                     INSD:DR334151.1,INSD:EH822104.1,INSD:EL039731.1,
                     INSD:DR371877.1,INSD:DR334150.1,INSD:BP851261.1,
                     INSD:R30249.1,INSD:EL023545.1,INSD:EL169038.1,
                     INSD:EG445746.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BT011705.1"
                     /db_xref="TAIR:AT2G01505"
                     /db_xref="Araport:AT2G01505"
     CDS             complement(228926..229237)
                     /gene="CLE16"
                     /locus_tag="AT2G01505"
                     /gene_synonym="CLAVATA3/ESR-RELATED 16"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AI993471.1,INSD:EL096784.1,INSD:EG445747.1,
                     INSD:DR334152.1,INSD:EG445748.1,INSD:EG445745.1,
                     INSD:DR334151.1,INSD:EH822104.1,INSD:EL039731.1,
                     INSD:DR371877.1,INSD:DR334150.1,INSD:BP851261.1,
                     INSD:R30249.1,INSD:EL023545.1,INSD:EL169038.1,
                     INSD:EG445746.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BT011705.1"
                     /note="CLAVATA3/ESR-RELATED 16 (CLE16); Has 30201 Blast
                     hits to 17322 proteins in 780 species: Archae - 12;
                     Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants -
                     5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="CLAVATA3/ESR-RELATED 16"
                     /protein_id="AEC05462.1"
                     /db_xref="Araport:AT2G01505"
                     /db_xref="TAIR:AT2G01505"
                     /translation="MEACSRKRRRRRAYTTSTTGYAAVFFCGIFVFAQFGISSSALFA
                     PDHYPSLPRKAGHFHEMASFQAPKATVSFTGQRREEENRDEVYKDDKRLVHTGPNPLH
                     N"
     gene            complement(229567..232540)
                     /locus_tag="AT2G01510"
                     /gene_synonym="F2I9.13"
                     /gene_synonym="F2I9_13"
                     /db_xref="Araport:AT2G01510"
                     /db_xref="TAIR:AT2G01510"
     mRNA            complement(229567..232518)
                     /locus_tag="AT2G01510"
                     /gene_synonym="F2I9.13"
                     /gene_synonym="F2I9_13"
                     /product="Tetratricopeptide repeat (TPR)-like superfamily
                     protein"
                     /inference="Similar to RNA sequence, EST:INSD:EH915509.1"
                     /db_xref="TAIR:AT2G01510"
                     /db_xref="Araport:AT2G01510"
     mRNA            complement(join(229928..230345,230553..232540))
                     /locus_tag="AT2G01510"
                     /gene_synonym="F2I9.13"
                     /gene_synonym="F2I9_13"
                     /product="Tetratricopeptide repeat (TPR)-like superfamily
                     protein"
                     /db_xref="Araport:AT2G01510"
                     /db_xref="TAIR:AT2G01510"
     CDS             complement(230752..232506)
                     /locus_tag="AT2G01510"
                     /gene_synonym="F2I9.13"
                     /gene_synonym="F2I9_13"
                     /codon_start=1
                     /product="Tetratricopeptide repeat (TPR)-like superfamily
                     protein"
                     /protein_id="ANM62267.1"
                     /db_xref="Araport:AT2G01510"
                     /db_xref="TAIR:AT2G01510"
                     /translation="MLAKQTPLTKQMLSELLRASSSKPKQLKKIHAIVLRTGFSEKNS
                     LLTQLLENLVVIGDMCYARQVFDEMHKPRIFLWNTLFKGYVRNQLPFESLLLYKKMRD
                     LGVRPDEFTYPFVVKAISQLGDFSCGFALHAHVVKYGFGCLGIVATELVMMYMKFGEL
                     SSAEFLFESMQVKDLVAWNAFLAVCVQTGNSAIALEYFNKMCADAVQFDSFTVVSMLS
                     ACGQLGSLEIGEEIYDRARKEEIDCNIIVENARLDMHLKCGNTEAARVLFEEMKQRNV
                     VSWSTMIVGYAMNGDSREALTLFTTMQNEGLRPNYVTFLGVLSACSHAGLVNEGKRYF
                     SLMVQSNDKNLEPRKEHYACMVDLLGRSGLLEEAYEFIKKMPVEPDTGIWGALLGACA
                     VHRDMILGQKVADVLVETAPDIGSYHVLLSNIYAAAGKWDCVDKVRSKMRKLGTKKVA
                     AYSSVEFEGKIHFFNRGDKSHPQSKAIYEKLDEILKKIRKMGYVPDTCSVFHDVEMEE
                     KECSLSHHSEKLAIAFGLIKGRPGHPIRVMKNLRTCDDCHAFSKFVSSLTSTEIIMRD
                     KNRFHHFRNGVCSCKEFW"
     CDS             complement(230752..232506)
                     /locus_tag="AT2G01510"
                     /gene_synonym="F2I9.13"
                     /gene_synonym="F2I9_13"
                     /inference="Similar to RNA sequence, EST:INSD:EH915509.1"
                     /note="Tetratricopeptide repeat (TPR)-like superfamily
                     protein; CONTAINS InterPro DOMAIN/s: Pentatricopeptide
                     repeat (InterPro:IPR002885); BEST Arabidopsis thaliana
                     protein match is: Tetratricopeptide repeat (TPR)-like
                     superfamily protein (TAIR:AT4G21065.1); Has 35573 Blast
                     hits to 13630 proteins in 255 species: Archae - 0;
                     Bacteria - 7; Metazoa - 76; Fungi - 94; Plants - 34882;
                     Viruses - 0; Other Eukaryotes - 514 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Tetratricopeptide repeat (TPR)-like superfamily
                     protein"
                     /protein_id="AEC05463.1"
                     /db_xref="Araport:AT2G01510"
                     /db_xref="TAIR:AT2G01510"
                     /translation="MLAKQTPLTKQMLSELLRASSSKPKQLKKIHAIVLRTGFSEKNS
                     LLTQLLENLVVIGDMCYARQVFDEMHKPRIFLWNTLFKGYVRNQLPFESLLLYKKMRD
                     LGVRPDEFTYPFVVKAISQLGDFSCGFALHAHVVKYGFGCLGIVATELVMMYMKFGEL
                     SSAEFLFESMQVKDLVAWNAFLAVCVQTGNSAIALEYFNKMCADAVQFDSFTVVSMLS
                     ACGQLGSLEIGEEIYDRARKEEIDCNIIVENARLDMHLKCGNTEAARVLFEEMKQRNV
                     VSWSTMIVGYAMNGDSREALTLFTTMQNEGLRPNYVTFLGVLSACSHAGLVNEGKRYF
                     SLMVQSNDKNLEPRKEHYACMVDLLGRSGLLEEAYEFIKKMPVEPDTGIWGALLGACA
                     VHRDMILGQKVADVLVETAPDIGSYHVLLSNIYAAAGKWDCVDKVRSKMRKLGTKKVA
                     AYSSVEFEGKIHFFNRGDKSHPQSKAIYEKLDEILKKIRKMGYVPDTCSVFHDVEMEE
                     KECSLSHHSEKLAIAFGLIKGRPGHPIRVMKNLRTCDDCHAFSKFVSSLTSTEIIMRD
                     KNRFHHFRNGVCSCKEFW"
     gene            235925..237253
                     /gene="MLP328"
                     /locus_tag="AT2G01520"
                     /gene_synonym="(Zusammen-CA)-enhanced 1"
                     /gene_synonym="F2I9.14"
                     /gene_synonym="F2I9_14"
                     /gene_synonym="MLP-like protein 328"
                     /gene_synonym="ZCE1"
                     /note="Encodes a cis-cinnamic acid responsive gene that is
                     a member of the major latex protein-like gene family and
                     plays a role in promoting vegetative growth and delaying
                     flowering."
                     /db_xref="Araport:AT2G01520"
                     /db_xref="TAIR:AT2G01520"
     mRNA            join(235925..236178,236613..237253)
                     /gene="MLP328"
                     /locus_tag="AT2G01520"
                     /gene_synonym="(Zusammen-CA)-enhanced 1"
                     /gene_synonym="F2I9.14"
                     /gene_synonym="F2I9_14"
                     /gene_synonym="MLP-like protein 328"
                     /gene_synonym="ZCE1"
                     /product="MLP-like protein 328"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR317371.1,INSD:BP581179.1,INSD:DR317385.1,
                     INSD:DR317378.1,INSD:DR317327.1,INSD:BP801185.1,
                     INSD:DR317290.1,INSD:DR317237.1,INSD:BP582932.1,
                     INSD:DR317286.1,INSD:DR317325.1,INSD:EG446276.1,
                     INSD:DR317387.1,INSD:DR317278.1,INSD:BP579431.1,
                     INSD:DR317293.1,INSD:DR317354.1,INSD:DR317272.1,
                     INSD:DR317222.1,INSD:DR317309.1,INSD:DR317233.1,
                     INSD:DR317342.1,INSD:DR317358.1,INSD:DR317396.1,
                     INSD:DR317346.1,INSD:T43905.1,INSD:DR317285.1,
                     INSD:EG506584.1,INSD:BP781515.1,INSD:DR317219.1,
                     INSD:DR317259.1,INSD:DR317283.1,INSD:DR317262.1,
                     INSD:BP570794.1,INSD:DR317235.1,INSD:DR317294.1,
                     INSD:BP581160.1,INSD:DR317345.1,INSD:BP563471.1,
                     INSD:EH966307.1,INSD:EL167651.1,INSD:DR317248.1,
                     INSD:DR317257.1,INSD:DR317318.1,INSD:BP567681.1,
                     INSD:DR317232.1,INSD:DR317255.1,INSD:DR317264.1,
                     INSD:DR317304.1,INSD:DR317303.1,INSD:BP571179.1,
                     INSD:H36765.1,INSD:DR317273.1,INSD:DR317239.1,
                     INSD:EL273628.1,INSD:DR317284.1,INSD:R90142.1,
                     INSD:BP567730.1,INSD:DR317274.1,INSD:DR317249.1,
                     INSD:DR317302.1,INSD:EG506582.1,INSD:DR317343.1,
                     INSD:DR317231.1,INSD:DR317298.1,INSD:DR317267.1,
                     INSD:DR317256.1,INSD:DR317216.1,INSD:DR317236.1,
                     INSD:DR317312.1,INSD:DR377723.1,INSD:DR317271.1,
                     INSD:DR317317.1,INSD:DR317247.1,INSD:DR317282.1,
                     INSD:AV549086.1,INSD:BP586457.1,INSD:DR317215.1,
                     INSD:DR317340.1,INSD:DR317209.1,INSD:DR317360.1,
                     INSD:DR317348.1,INSD:DR317206.1,INSD:BP572115.1,
                     INSD:DR317337.1,INSD:DR317329.1,INSD:DR317307.1,
                     INSD:DR317211.1,INSD:DR317398.1,INSD:DR317335.1,
                     INSD:BP577079.1,INSD:DR317224.1,INSD:DR317289.1,
                     INSD:BP567703.1,INSD:DR317362.1,INSD:EG528650.1,
                     INSD:DR317394.1,INSD:DR317276.1,INSD:DR317323.1,
                     INSD:DR317244.1,INSD:DR243246.1,INSD:DR317217.1,
                     INSD:EG528651.1,INSD:DR317364.1,INSD:DR317392.1,
                     INSD:DR317322.1,INSD:DR317383.1,INSD:DR317287.1,
                     INSD:EG440929.1,INSD:DR317300.1,INSD:DR317229.1,
                     INSD:BP567604.1,INSD:DR317297.1,INSD:DR317241.1,
                     INSD:DR317384.1,INSD:BP581039.1,INSD:DR317334.1,
                     INSD:AV816654.1,INSD:DR317234.1,INSD:DR317391.1,
                     INSD:R29829.1,INSD:DR317359.1,INSD:DR317266.1,
                     INSD:DR317386.1,INSD:DR317355.1,INSD:DR317373.1,
                     INSD:DR317361.1,INSD:EG446265.1,INSD:DR317226.1,
                     INSD:DR317288.1,INSD:DR317374.1,INSD:EL163623.1,
                     INSD:EG440928.1,INSD:DR317332.1,INSD:DR317375.1,
                     INSD:ES199994.1,INSD:DR317366.1,INSD:DR317242.1,
                     INSD:BP579716.1,INSD:DR317296.1,INSD:DR317221.1,
                     INSD:DR317353.1,INSD:DR317305.1,INSD:DR317228.1,
                     INSD:ES153399.1,INSD:DR205656.1,INSD:DR317326.1,
                     INSD:DR317314.1,INSD:DR317280.1,INSD:DR317310.1,
                     INSD:DR317372.1,INSD:DR317313.1,INSD:DR372753.1,
                     INSD:DR317330.1,INSD:DR317380.1,INSD:T21300.1,
                     INSD:DR317254.1,INSD:DR317218.1,INSD:DR317205.1,
                     INSD:DR317252.1,INSD:DR317397.1,INSD:DR317265.1,
                     INSD:BP583496.1,INSD:T22170.1,INSD:EG480605.1,
                     INSD:DR317268.1,INSD:DR317395.1,INSD:DR317349.1,
                     INSD:BP798756.1,INSD:DR317295.1,INSD:DR317208.1,
                     INSD:BP797003.1,INSD:DR317277.1,INSD:DR317243.1,
                     INSD:DR317291.1,INSD:DR317260.1,INSD:BP563939.1,
                     INSD:DR317367.1,INSD:DR377095.1,INSD:AV553971.1,
                     INSD:DR317331.1,INSD:BP570278.1,INSD:DR317227.1,
                     INSD:DR317270.1,INSD:DR317363.1,INSD:DR317269.1,
                     INSD:T22625.1,INSD:DR317347.1,INSD:CF652448.1,
                     INSD:DR375628.1,INSD:DR317316.1,INSD:EG505336.1,
                     INSD:DR317311.1,INSD:DR317306.1,INSD:DR317341.1,
                     INSD:BP576259.1,INSD:DR317333.1,INSD:DR317328.1,
                     INSD:DR317240.1,INSD:BP586965.1,INSD:EG505335.1,
                     INSD:DR317389.1,INSD:DR317338.1,INSD:DR317279.1,
                     INSD:DR317212.1,INSD:DR317336.1,INSD:DR317379.1,
                     INSD:DR317315.1,INSD:EL045155.1,INSD:DR317365.1,
                     INSD:BP567320.1,INSD:DR317207.1,INSD:DR317253.1,
                     INSD:DR317320.1,INSD:DR317238.1,INSD:DR317393.1,
                     INSD:DR317245.1,INSD:AV545261.1,INSD:DR317213.1,
                     INSD:EL014939.1,INSD:DR317223.1,INSD:DR317352.1,
                     INSD:DR317281.1,INSD:DR317250.1,INSD:DR317261.1,
                     INSD:DR317388.1,INSD:BP571831.1,INSD:DR317382.1,
                     INSD:AV552425.1,INSD:DR317376.1,INSD:DR317246.1,
                     INSD:DR317230.1,INSD:DR317377.1,INSD:EG440930.1,
                     INSD:DR317210.1,INSD:DR317319.1,INSD:ES137213.1,
                     INSD:DR317275.1,INSD:DR317251.1,INSD:DR317214.1,
                     INSD:DR205657.1,INSD:AV799348.1,INSD:DR317225.1,
                     INSD:DR317220.1,INSD:BP571338.1,INSD:DR317263.1,
                     INSD:EG439492.1,INSD:T41926.1,INSD:DR317258.1,
                     INSD:BP803027.1,INSD:W43041.1,INSD:DR317321.1,
                     INSD:DR317308.1,INSD:DR317390.1,INSD:DR317344.1,
                     INSD:DR317381.1,INSD:DR317292.1,INSD:DR317356.1,
                     INSD:DR317339.1,INSD:DR317357.1,INSD:EH875902.1,
                     INSD:DR317351.1,INSD:DR317368.1,INSD:DR317204.1,
                     INSD:DR317350.1,INSD:DR317324.1,INSD:DR377641.1,
                     INSD:EG470171.1,INSD:BP574665.1,INSD:DR317301.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY085745.1,INSD:AF458339.1,INSD:BX821361.1,
                     INSD:AY054247.1"
                     /db_xref="TAIR:AT2G01520"
                     /db_xref="Araport:AT2G01520"
     CDS             join(235992..236178,236613..236881)
                     /gene="MLP328"
                     /locus_tag="AT2G01520"
                     /gene_synonym="(Zusammen-CA)-enhanced 1"
                     /gene_synonym="F2I9.14"
                     /gene_synonym="F2I9_14"
                     /gene_synonym="MLP-like protein 328"
                     /gene_synonym="ZCE1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR317371.1,INSD:BP581179.1,INSD:DR317385.1,
                     INSD:DR317378.1,INSD:DR317327.1,INSD:BP801185.1,
                     INSD:DR317290.1,INSD:DR317237.1,INSD:BP582932.1,
                     INSD:DR317286.1,INSD:DR317325.1,INSD:EG446276.1,
                     INSD:DR317387.1,INSD:DR317278.1,INSD:BP579431.1,
                     INSD:DR317293.1,INSD:DR317354.1,INSD:DR317272.1,
                     INSD:DR317222.1,INSD:DR317309.1,INSD:DR317233.1,
                     INSD:DR317342.1,INSD:DR317358.1,INSD:DR317396.1,
                     INSD:DR317346.1,INSD:T43905.1,INSD:DR317285.1,
                     INSD:EG506584.1,INSD:BP781515.1,INSD:DR317219.1,
                     INSD:DR317259.1,INSD:DR317283.1,INSD:DR317262.1,
                     INSD:BP570794.1,INSD:DR317235.1,INSD:DR317294.1,
                     INSD:BP581160.1,INSD:DR317345.1,INSD:BP563471.1,
                     INSD:EH966307.1,INSD:EL167651.1,INSD:DR317248.1,
                     INSD:DR317257.1,INSD:DR317318.1,INSD:BP567681.1,
                     INSD:DR317232.1,INSD:DR317255.1,INSD:DR317264.1,
                     INSD:DR317304.1,INSD:DR317303.1,INSD:BP571179.1,
                     INSD:H36765.1,INSD:DR317273.1,INSD:DR317239.1,
                     INSD:EL273628.1,INSD:DR317284.1,INSD:R90142.1,
                     INSD:BP567730.1,INSD:DR317274.1,INSD:DR317249.1,
                     INSD:DR317302.1,INSD:EG506582.1,INSD:DR317343.1,
                     INSD:DR317231.1,INSD:DR317298.1,INSD:DR317267.1,
                     INSD:DR317256.1,INSD:DR317216.1,INSD:DR317236.1,
                     INSD:DR317312.1,INSD:DR377723.1,INSD:DR317271.1,
                     INSD:DR317317.1,INSD:DR317247.1,INSD:DR317282.1,
                     INSD:AV549086.1,INSD:BP586457.1,INSD:DR317215.1,
                     INSD:DR317340.1,INSD:DR317209.1,INSD:DR317360.1,
                     INSD:DR317348.1,INSD:DR317206.1,INSD:BP572115.1,
                     INSD:DR317337.1,INSD:DR317329.1,INSD:DR317307.1,
                     INSD:DR317211.1,INSD:DR317398.1,INSD:DR317335.1,
                     INSD:BP577079.1,INSD:DR317224.1,INSD:DR317289.1,
                     INSD:BP567703.1,INSD:DR317362.1,INSD:EG528650.1,
                     INSD:DR317394.1,INSD:DR317276.1,INSD:DR317323.1,
                     INSD:DR317244.1,INSD:DR243246.1,INSD:DR317217.1,
                     INSD:EG528651.1,INSD:DR317364.1,INSD:DR317392.1,
                     INSD:DR317322.1,INSD:DR317383.1,INSD:DR317287.1,
                     INSD:EG440929.1,INSD:DR317300.1,INSD:DR317229.1,
                     INSD:BP567604.1,INSD:DR317297.1,INSD:DR317241.1,
                     INSD:DR317384.1,INSD:BP581039.1,INSD:DR317334.1,
                     INSD:AV816654.1,INSD:DR317234.1,INSD:DR317391.1,
                     INSD:R29829.1,INSD:DR317359.1,INSD:DR317266.1,
                     INSD:DR317386.1,INSD:DR317355.1,INSD:DR317373.1,
                     INSD:DR317361.1,INSD:EG446265.1,INSD:DR317226.1,
                     INSD:DR317288.1,INSD:DR317374.1,INSD:EL163623.1,
                     INSD:EG440928.1,INSD:DR317332.1,INSD:DR317375.1,
                     INSD:ES199994.1,INSD:DR317366.1,INSD:DR317242.1,
                     INSD:BP579716.1,INSD:DR317296.1,INSD:DR317221.1,
                     INSD:DR317353.1,INSD:DR317305.1,INSD:DR317228.1,
                     INSD:ES153399.1,INSD:DR205656.1,INSD:DR317326.1,
                     INSD:DR317314.1,INSD:DR317280.1,INSD:DR317310.1,
                     INSD:DR317372.1,INSD:DR317313.1,INSD:DR372753.1,
                     INSD:DR317330.1,INSD:DR317380.1,INSD:T21300.1,
                     INSD:DR317254.1,INSD:DR317218.1,INSD:DR317205.1,
                     INSD:DR317252.1,INSD:DR317397.1,INSD:DR317265.1,
                     INSD:BP583496.1,INSD:T22170.1,INSD:EG480605.1,
                     INSD:DR317268.1,INSD:DR317395.1,INSD:DR317349.1,
                     INSD:BP798756.1,INSD:DR317295.1,INSD:DR317208.1,
                     INSD:BP797003.1,INSD:DR317277.1,INSD:DR317243.1,
                     INSD:DR317291.1,INSD:DR317260.1,INSD:BP563939.1,
                     INSD:DR317367.1,INSD:DR377095.1,INSD:AV553971.1,
                     INSD:DR317331.1,INSD:BP570278.1,INSD:DR317227.1,
                     INSD:DR317270.1,INSD:DR317363.1,INSD:DR317269.1,
                     INSD:T22625.1,INSD:DR317347.1,INSD:CF652448.1,
                     INSD:DR375628.1,INSD:DR317316.1,INSD:EG505336.1,
                     INSD:DR317311.1,INSD:DR317306.1,INSD:DR317341.1,
                     INSD:BP576259.1,INSD:DR317333.1,INSD:DR317328.1,
                     INSD:DR317240.1,INSD:BP586965.1,INSD:EG505335.1,
                     INSD:DR317389.1,INSD:DR317338.1,INSD:DR317279.1,
                     INSD:DR317212.1,INSD:DR317336.1,INSD:DR317379.1,
                     INSD:DR317315.1,INSD:EL045155.1,INSD:DR317365.1,
                     INSD:BP567320.1,INSD:DR317207.1,INSD:DR317253.1,
                     INSD:DR317320.1,INSD:DR317238.1,INSD:DR317393.1,
                     INSD:DR317245.1,INSD:AV545261.1,INSD:DR317213.1,
                     INSD:EL014939.1,INSD:DR317223.1,INSD:DR317352.1,
                     INSD:DR317281.1,INSD:DR317250.1,INSD:DR317261.1,
                     INSD:DR317388.1,INSD:BP571831.1,INSD:DR317382.1,
                     INSD:AV552425.1,INSD:DR317376.1,INSD:DR317246.1,
                     INSD:DR317230.1,INSD:DR317377.1,INSD:EG440930.1,
                     INSD:DR317210.1,INSD:DR317319.1,INSD:ES137213.1,
                     INSD:DR317275.1,INSD:DR317251.1,INSD:DR317214.1,
                     INSD:DR205657.1,INSD:AV799348.1,INSD:DR317225.1,
                     INSD:DR317220.1,INSD:BP571338.1,INSD:DR317263.1,
                     INSD:EG439492.1,INSD:T41926.1,INSD:DR317258.1,
                     INSD:BP803027.1,INSD:W43041.1,INSD:DR317321.1,
                     INSD:DR317308.1,INSD:DR317390.1,INSD:DR317344.1,
                     INSD:DR317381.1,INSD:DR317292.1,INSD:DR317356.1,
                     INSD:DR317339.1,INSD:DR317357.1,INSD:EH875902.1,
                     INSD:DR317351.1,INSD:DR317368.1,INSD:DR317204.1,
                     INSD:DR317350.1,INSD:DR317324.1,INSD:DR377641.1,
                     INSD:EG470171.1,INSD:BP574665.1,INSD:DR317301.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY085745.1,INSD:AF458339.1,INSD:BX821361.1,
                     INSD:AY054247.1"
                     /note="MLP-like protein 328 (MLP328); FUNCTIONS IN: copper
                     ion binding; INVOLVED IN: response to zinc ion; LOCATED
                     IN: cellular_component unknown; EXPRESSED IN: 13 plant
                     structures; EXPRESSED DURING: 7 growth stages; CONTAINS
                     InterPro DOMAIN/s: Bet v I allergen (InterPro:IPR000916);
                     BEST Arabidopsis thaliana protein match is: Polyketide
                     cyclase/dehydrase and lipid transport superfamily protein
                     (TAIR:AT4G14060.1); Has 369 Blast hits to 340 proteins in
                     40 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
                     0; Plants - 369; Viruses - 0; Other Eukaryotes - 0
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="MLP-like protein 328"
                     /protein_id="AEC05464.1"
                     /db_xref="Araport:AT2G01520"
                     /db_xref="TAIR:AT2G01520"
                     /translation="MATSGTYVTEVPLKGSAEKHYKRWRSENHLFPDAIGHHIQGVTI
                     HDGEWDSHGAIKIWNYTCDGKPEVFKERREIDDENMAVTFRGLEGHVMEQLKVYDVIF
                     QFIQKSPDDIICKITMIWEKQNDDMPEPSNYMKFVKSLAADMDDHVLKA"
     gene            complement(238681..239055)
                     /locus_tag="AT2G04005"
                     /db_xref="Araport:AT2G04005"
     ncRNA           complement(238681..239055)
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT2G04005"
                     /product="other RNA"
                     /db_xref="Araport:AT2G04005"
     gene            239669..240687
                     /gene="MLP329"
                     /locus_tag="AT2G01530"
                     /gene_synonym="(Zusammen-CA)-enhanced 2"
                     /gene_synonym="F2I9.15"
                     /gene_synonym="F2I9_15"
                     /gene_synonym="MLP-like protein 329"
                     /gene_synonym="ZCE2"
                     /db_xref="Araport:AT2G01530"
                     /db_xref="TAIR:AT2G01530"
     mRNA            join(239669..240001,240081..240687)
                     /gene="MLP329"
                     /locus_tag="AT2G01530"
                     /gene_synonym="(Zusammen-CA)-enhanced 2"
                     /gene_synonym="F2I9.15"
                     /gene_synonym="F2I9_15"
                     /gene_synonym="MLP-like protein 329"
                     /gene_synonym="ZCE2"
                     /product="MLP-like protein 329"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG441698.1,INSD:BP806116.1,INSD:DR322388.1,
                     INSD:EG515655.1,INSD:AV548979.1,INSD:BP811544.1,
                     INSD:DR322386.1,INSD:EG513835.1,INSD:DR322396.1,
                     INSD:AV824624.1,INSD:R30617.1,INSD:BP798308.2,
                     INSD:BP568926.1,INSD:N65702.1,INSD:EL092174.1,
                     INSD:DR322392.1,INSD:DR322381.1,INSD:DR322387.1,
                     INSD:AV554525.1,INSD:BP574821.1,INSD:BP574250.1,
                     INSD:BP564339.1,INSD:BP575598.1,INSD:T75987.1,
                     INSD:BP582690.1,INSD:H37454.1,INSD:BP810399.1,
                     INSD:DR322384.1,INSD:DR322400.1,INSD:DR322399.1,
                     INSD:BP570402.1,INSD:BP577791.1,INSD:BP864645.1,
                     INSD:BP611307.1,INSD:BP582573.1,INSD:BP581074.1,
                     INSD:BP571946.1,INSD:EL144290.1,INSD:EH960834.1,
                     INSD:T04583.1,INSD:AV787025.1,INSD:DR322382.1,
                     INSD:BP563126.1,INSD:BP632194.1,INSD:BP808855.1,
                     INSD:EL173782.1,INSD:AV540434.1,INSD:AV537519.1,
                     INSD:DR322389.1,INSD:BP581720.1,INSD:EH973601.1,
                     INSD:BP809162.1,INSD:BP616869.1,INSD:DR322401.1,
                     INSD:BP630081.1,INSD:BP568283.1,INSD:N37670.1,
                     INSD:AV540454.1,INSD:BP863207.1,INSD:DR322391.1,
                     INSD:DR322383.1,INSD:DR322385.1,INSD:DR322393.1,
                     INSD:BP801994.1,INSD:DR322398.1,INSD:BP597982.1,
                     INSD:AV544066.1,INSD:DR322394.1,INSD:BP579444.1,
                     INSD:DR322380.1,INSD:H76182.1,INSD:DR322390.1,
                     INSD:BP670644.1,INSD:DR322395.1,INSD:BP568451.1,
                     INSD:AA067384.1,INSD:DR322402.1,INSD:BP565884.1,
                     INSD:DR373167.1,INSD:EG441710.1,INSD:EG514536.1,
                     INSD:AV549451.1,INSD:BP802834.1,INSD:DR322397.1,
                     INSD:AV537275.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY061925.1,INSD:AY052300.1,INSD:BX820427.1"
                     /db_xref="TAIR:AT2G01530"
                     /db_xref="Araport:AT2G01530"
     CDS             join(239815..240001,240081..240349)
                     /gene="MLP329"
                     /locus_tag="AT2G01530"
                     /gene_synonym="(Zusammen-CA)-enhanced 2"
                     /gene_synonym="F2I9.15"
                     /gene_synonym="F2I9_15"
                     /gene_synonym="MLP-like protein 329"
                     /gene_synonym="ZCE2"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG441698.1,INSD:BP806116.1,INSD:DR322388.1,
                     INSD:EG515655.1,INSD:AV548979.1,INSD:BP811544.1,
                     INSD:DR322386.1,INSD:EG513835.1,INSD:DR322396.1,
                     INSD:AV824624.1,INSD:R30617.1,INSD:BP798308.2,
                     INSD:BP568926.1,INSD:N65702.1,INSD:EL092174.1,
                     INSD:DR322392.1,INSD:DR322381.1,INSD:DR322387.1,
                     INSD:AV554525.1,INSD:BP574821.1,INSD:BP574250.1,
                     INSD:BP564339.1,INSD:BP575598.1,INSD:T75987.1,
                     INSD:BP582690.1,INSD:H37454.1,INSD:BP810399.1,
                     INSD:DR322384.1,INSD:DR322400.1,INSD:DR322399.1,
                     INSD:BP570402.1,INSD:BP577791.1,INSD:BP864645.1,
                     INSD:BP611307.1,INSD:BP582573.1,INSD:BP581074.1,
                     INSD:BP571946.1,INSD:EL144290.1,INSD:EH960834.1,
                     INSD:T04583.1,INSD:AV787025.1,INSD:DR322382.1,
                     INSD:BP563126.1,INSD:BP632194.1,INSD:BP808855.1,
                     INSD:EL173782.1,INSD:AV540434.1,INSD:AV537519.1,
                     INSD:DR322389.1,INSD:BP581720.1,INSD:EH973601.1,
                     INSD:BP809162.1,INSD:BP616869.1,INSD:DR322401.1,
                     INSD:BP630081.1,INSD:BP568283.1,INSD:N37670.1,
                     INSD:AV540454.1,INSD:BP863207.1,INSD:DR322391.1,
                     INSD:DR322383.1,INSD:DR322385.1,INSD:DR322393.1,
                     INSD:BP801994.1,INSD:DR322398.1,INSD:BP597982.1,
                     INSD:AV544066.1,INSD:DR322394.1,INSD:BP579444.1,
                     INSD:DR322380.1,INSD:H76182.1,INSD:DR322390.1,
                     INSD:BP670644.1,INSD:DR322395.1,INSD:BP568451.1,
                     INSD:AA067384.1,INSD:DR322402.1,INSD:BP565884.1,
                     INSD:DR373167.1,INSD:EG441710.1,INSD:EG514536.1,
                     INSD:AV549451.1,INSD:BP802834.1,INSD:DR322397.1,
                     INSD:AV537275.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY061925.1,INSD:AY052300.1,INSD:BX820427.1"
                     /note="MLP-like protein 329 (MLP329); FUNCTIONS IN: copper
                     ion binding; INVOLVED IN: response to biotic stimulus,
                     defense response; LOCATED IN: cellular_component unknown;
                     EXPRESSED IN: hypocotyl, root; CONTAINS InterPro DOMAIN/s:
                     Bet v I allergen (InterPro:IPR000916); BEST Arabidopsis
                     thaliana protein match is: MLP-like protein 328
                     (TAIR:AT2G01520.1); Has 358 Blast hits to 331 proteins in
                     39 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
                     0; Plants - 358; Viruses - 0; Other Eukaryotes - 0
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="MLP-like protein 329"
                     /protein_id="AEC05465.1"
                     /db_xref="Araport:AT2G01530"
                     /db_xref="TAIR:AT2G01530"
                     /translation="MATSGTYVTEVPLKGSADKHYKRWRDENHLFPDAIGHHIQGVTV
                     HDGEWDSHEAIKIWNYTCDGKPEVFKERKEIDDENMVITFRGLEGHVMEQLKVYDLIY
                     QFSQKSPDDIVCKITMIWEKRTDDSPEPSNYMKFLKSVVADMDEHVLKA"
     gene            complement(242041..243649)
                     /locus_tag="AT2G01540"
                     /gene_synonym="F2I9.16"
                     /gene_synonym="F2I9_16"
                     /db_xref="Araport:AT2G01540"
                     /db_xref="TAIR:AT2G01540"
     mRNA            complement(join(242041..242629,242733..242828,
                     243120..243649))
                     /locus_tag="AT2G01540"
                     /gene_synonym="F2I9.16"
                     /gene_synonym="F2I9_16"
                     /product="Calcium-dependent lipid-binding (CaLB domain)
                     family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR211765.1,INSD:BU635837.1,INSD:EH868531.1,
                     INSD:AV520999.1,INSD:EL230272.1,INSD:BP666488.1,
                     INSD:EL012404.1,INSD:BP857145.1,INSD:AV795909.1,
                     INSD:AV826633.1,INSD:EH961005.1,INSD:EL268675.1,
                     INSD:EG492727.1,INSD:DR211767.1,INSD:AI995971.1,
                     INSD:EL016005.1,INSD:EL003277.1,INSD:DR211766.1,
                     INSD:EH929027.1,INSD:EH937257.1,INSD:EH891705.1,
                     INSD:BP868183.1,INSD:BP856974.1,INSD:AV527581.1,
                     INSD:EG492726.1,INSD:DR211764.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY062604.1,INSD:AY093363.1"
                     /db_xref="TAIR:AT2G01540"
                     /db_xref="Araport:AT2G01540"
     CDS             complement(join(242297..242629,242733..242828,
                     243120..243233))
                     /locus_tag="AT2G01540"
                     /gene_synonym="F2I9.16"
                     /gene_synonym="F2I9_16"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR211765.1,INSD:BU635837.1,INSD:EH868531.1,
                     INSD:AV520999.1,INSD:EL230272.1,INSD:BP666488.1,
                     INSD:EL012404.1,INSD:BP857145.1,INSD:AV795909.1,
                     INSD:AV826633.1,INSD:EH961005.1,INSD:EL268675.1,
                     INSD:EG492727.1,INSD:DR211767.1,INSD:AI995971.1,
                     INSD:EL016005.1,INSD:EL003277.1,INSD:DR211766.1,
                     INSD:EH929027.1,INSD:EH937257.1,INSD:EH891705.1,
                     INSD:BP868183.1,INSD:BP856974.1,INSD:AV527581.1,
                     INSD:EG492726.1,INSD:DR211764.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY062604.1,INSD:AY093363.1"
                     /note="Calcium-dependent lipid-binding (CaLB domain)
                     family protein; FUNCTIONS IN: molecular_function unknown;
                     INVOLVED IN: biological_process unknown; LOCATED IN:
                     plasma membrane, vacuole; EXPRESSED IN: 25 plant
                     structures; EXPRESSED DURING: 15 growth stages; CONTAINS
                     InterPro DOMAIN/s: C2 membrane targeting protein
                     (InterPro:IPR018029), C2 calcium/lipid-binding domain,
                     CaLB (InterPro:IPR008973), C2 calcium-dependent membrane
                     targeting (InterPro:IPR000008); BEST Arabidopsis thaliana
                     protein match is: Calcium-dependent lipid-binding (CaLB
                     domain) family protein (TAIR:AT1G70790.1); Has 3447 Blast
                     hits to 2959 proteins in 238 species: Archae - 0; Bacteria
                     - 0; Metazoa - 1768; Fungi - 600; Plants - 764; Viruses -
                     0; Other Eukaryotes - 315 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Calcium-dependent lipid-binding (CaLB domain)
                     family protein"
                     /protein_id="AEC05466.1"
                     /db_xref="Araport:AT2G01540"
                     /db_xref="TAIR:AT2G01540"
                     /translation="MDQKPLGLLTIHVKRGINLAIRDHRSSDPYIVLNVADQTLKTRV
                     VKKNCNPVWNEEMTVAIKDPNVPIRLTVFDWDKFTGDDKMGDANIDIQPYLEALKMGM
                     ELLRLPNGCAIKRVQPSRHNCLSDESSIVWNNGKITQDLILRLNNVECGEIEIMLEWH
                     EGAGCRGITSSSKGGGSSST"
     gene            complement(243918..249049)
                     /locus_tag="AT2G01550"
                     /gene_synonym="F2I9.17"
                     /gene_synonym="F2I9_17"
                     /pseudo
                     /db_xref="Araport:AT2G01550"
                     /db_xref="TAIR:AT2G01550"
     mRNA            complement(<243918..>249049)
                     /locus_tag="AT2G01550"
                     /gene_synonym="F2I9.17"
                     /gene_synonym="F2I9_17"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="Araport:AT2G01550"
                     /db_xref="TAIR:AT2G01550"
     gene            249687..250181
                     /locus_tag="AT2G01554"
                     /db_xref="Araport:AT2G01554"
                     /db_xref="TAIR:AT2G01554"
     mRNA            join(249687..249774,249860..249924,250017..250181)
                     /locus_tag="AT2G01554"
                     /product="hypothetical protein"
                     /db_xref="TAIR:AT2G01554"
                     /db_xref="Araport:AT2G01554"
     CDS             join(249687..249774,249860..249924,250017..250181)
                     /locus_tag="AT2G01554"
                     /note="unknown protein; FUNCTIONS IN: molecular_function
                     unknown; INVOLVED IN: biological_process unknown; LOCATED
                     IN: cellular_component unknown; BEST Arabidopsis thaliana
                     protein match is: unknown protein (TAIR:AT1G70780.1); Has
                     30201 Blast hits to 17322 proteins in 780 species: Archae
                     - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422;
                     Plants - 5037; Viruses - 0; Other Eukaryotes - 2996
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEC05467.1"
                     /db_xref="Araport:AT2G01554"
                     /db_xref="TAIR:AT2G01554"
                     /translation="MLYNNKHQRNQKSKTTNRFLVSINVLGSAGFHFSDQIPAFSDFI
                     ALTVPLKGKIGSTGSRNFVLSNKLETQNLEDSMMTTTTTRKTSGRWKAWLNKSFGLMV
                     PSH"
     gene            complement(250245..251806)
                     /locus_tag="AT2G01560"
                     /gene_synonym="F2I9.18"
                     /gene_synonym="F2I9_18"
                     /db_xref="Araport:AT2G01560"
                     /db_xref="TAIR:AT2G01560"
     mRNA            complement(join(250245..250720,250806..250976,
                     251060..251179,251255..251290,251371..251451,
                     251544..251649,251744..251806))
                     /locus_tag="AT2G01560"
                     /gene_synonym="F2I9.18"
                     /gene_synonym="F2I9_18"
                     /product="Plant protein 1589 of unknown function"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG439001.1,INSD:EG439015.1,INSD:EG439019.1,
                     INSD:EG439000.1,INSD:EG439012.1,INSD:EG439004.1,
                     INSD:EG439018.1,INSD:EG439011.1,INSD:EG495651.1,
                     INSD:EG439003.1,INSD:EG495640.1,INSD:EG439020.1,
                     INSD:EG439013.1,INSD:EG439005.1,INSD:EG495584.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:DQ652946.1,INSD:DQ446452.1"
                     /db_xref="TAIR:AT2G01560"
                     /db_xref="Araport:AT2G01560"
     CDS             complement(join(250392..250720,250806..250976,
                     251060..251179,251255..251290,251371..251451,
                     251544..251649,251744..251806))
                     /locus_tag="AT2G01560"
                     /gene_synonym="F2I9.18"
                     /gene_synonym="F2I9_18"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG439001.1,INSD:EG439015.1,INSD:EG439019.1,
                     INSD:EG439000.1,INSD:EG439012.1,INSD:EG439004.1,
                     INSD:EG439018.1,INSD:EG439011.1,INSD:EG495651.1,
                     INSD:EG439003.1,INSD:EG495640.1,INSD:EG439020.1,
                     INSD:EG439013.1,INSD:EG439005.1,INSD:EG495584.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:DQ652946.1,INSD:DQ446452.1"
                     /note="Plant protein 1589 of unknown function; CONTAINS
                     InterPro DOMAIN/s: Conserved hypothetical protein
                     CHP01589, plant (InterPro:IPR006476); Has 88 Blast hits to
                     88 proteins in 31 species: Archae - 0; Bacteria - 9;
                     Metazoa - 4; Fungi - 11; Plants - 55; Viruses - 0; Other
                     Eukaryotes - 9 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Plant protein 1589 of unknown function"
                     /protein_id="AEC05468.1"
                     /db_xref="Araport:AT2G01560"
                     /db_xref="TAIR:AT2G01560"
                     /translation="MSPHVLDLPKGCEISNDLTDFVHYRVEECIQGYMSKEETASFIF
                     DTFGVSLKFTRFVWYLLEKANPDFFRCFKTHCENIQNAPSEEVTSNVEIENSFEDLAE
                     ASTSFTKPDNKPRAKRSKGKNKQKQHPISPIHSLIETAPNDASSQVPQEAATANSSDT
                     PIPVEKVSSKARRFRARKKAKQEKSQQAPCSPSRGTSADVERAEVPIADAEIILKQIS
                     TRMRLLESIIEQVHKLLSNVLGPPPSAAKALKKQRSWKQVRGDYEQAEMLHDLNQQVQ
                     QEMPRMDIPGNQASDNSNEEDTLYD"
     gene            complement(255247..257568)
                     /gene="RGA1"
                     /locus_tag="AT2G01570"
                     /gene_synonym="F2I9.19"
                     /gene_synonym="F2I9_19"
                     /gene_synonym="REPRESSOR OF GA"
                     /gene_synonym="REPRESSOR OF GA1-3 1"
                     /gene_synonym="RGA"
                     /note="Member of the VHIID/DELLA regulatory family.
                     Contains homopolymeric serine and threonine residues, a
                     putative nuclear localization signal, leucine heptad
                     repeats, and an LXXLL motif. Putative transcriptional
                     regulator repressing the gibberellin response and
                     integration of phytohormone signalling. DELLAs repress
                     cell proliferation and expansion that drives plant growth.
                     The protein undergoes degradation in response to GA via
                     the 26S proteasome. RGA1 binds to PIF3 and inhibits its
                     DNA binding activity and thus affects the expression of
                     PIF3 regulated genes. RGA may be involved in reducing ROS
                     accumulation in response to stress by up-regulating the
                     transcription of superoxide dismutases. Represses
                     GA-induced vegetative growth and floral initiation.
                     Rapidly degraded in response to GA. Involved in fruit and
                     flower development."
                     /db_xref="Araport:AT2G01570"
                     /db_xref="TAIR:AT2G01570"
     mRNA            complement(255247..257568)
                     /gene="RGA1"
                     /locus_tag="AT2G01570"
                     /gene_synonym="F2I9.19"
                     /gene_synonym="F2I9_19"
                     /gene_synonym="REPRESSOR OF GA"
                     /gene_synonym="REPRESSOR OF GA1-3 1"
                     /gene_synonym="RGA"
                     /product="GRAS family transcription factor family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR369791.1,INSD:EH916124.1,INSD:EH882892.1,
                     INSD:BP863879.1,INSD:BP597960.1,INSD:EH814024.1,
                     INSD:DR369792.1,INSD:T45793.1,INSD:ES112797.1,
                     INSD:BP807131.1,INSD:ES089846.1,INSD:BP614514.1,
                     INSD:DR369788.1,INSD:EL206189.1,INSD:EL307980.1,
                     INSD:BP848144.1,INSD:BP599239.1,INSD:ES199090.1,
                     INSD:EG450246.1,INSD:DR369794.1,INSD:ES091333.1,
                     INSD:BP789190.1,INSD:DR369787.1,INSD:EH887134.1,
                     INSD:ES197630.1,INSD:EH947530.1,INSD:ES213666.1,
                     INSD:AV830192.1,INSD:T46205.1,INSD:ES170310.1,
                     INSD:ES210919.1,INSD:ES022487.1,INSD:BP781366.1,
                     INSD:BP561805.1,INSD:EH901253.1,INSD:EG480589.1,
                     INSD:EL115972.1,INSD:BP605910.1,INSD:BP862306.1,
                     INSD:EL203328.1,INSD:EH888231.1,INSD:AV830188.1,
                     INSD:AV811805.1,INSD:BP596466.1,INSD:EH973482.1,
                     INSD:EG476836.1,INSD:BP585260.1,INSD:EH844531.1,
                     INSD:BP782620.1,INSD:EH948775.1,INSD:BP829897.1,
                     INSD:EL070679.1,INSD:DR369789.1,INSD:EH980954.1,
                     INSD:BP579443.1,INSD:EL999844.1,INSD:EL990705.1,
                     INSD:ES207359.1,INSD:BP601743.1,INSD:EL260176.1,
                     INSD:ES054413.1,INSD:AV562629.1,INSD:EL995916.1,
                     INSD:EL213442.1,INSD:EL168603.1,INSD:AV788178.1,
                     INSD:BP589619.1,INSD:AV530438.1,INSD:AV830440.1,
                     INSD:ES173121.1,INSD:ES093076.1,INSD:AV814953.1,
                     INSD:EL981857.1,INSD:EH851095.1,INSD:ES152435.1,
                     INSD:EL157996.1,INSD:EH866984.1,INSD:EL109376.1,
                     INSD:BP861541.1,INSD:EG476835.1,INSD:AI993756.1,
                     INSD:ES204171.1,INSD:AI996746.1,INSD:ES024338.1,
                     INSD:EL138163.1,INSD:BP805683.1,INSD:ES000591.1,
                     INSD:BP804414.1,INSD:EL303132.1,INSD:EL002950.1,
                     INSD:EH828797.1,INSD:EL256312.1,INSD:ES185443.1,
                     INSD:AV789779.1,INSD:EG501584.1,INSD:BP777904.1,
                     INSD:BP845909.1,INSD:ES144992.1,INSD:BP780504.1,
                     INSD:BP655803.1,INSD:EH808120.1,INSD:BP787675.1,
                     INSD:EL233888.1,INSD:EG480588.1,INSD:BP664625.1,
                     INSD:DR369790.1,INSD:ES067741.1,INSD:ES007403.1,
                     INSD:EL280532.1,INSD:ES158064.1,INSD:DR355202.1,
                     INSD:AV520438.1,INSD:ES033316.1,INSD:BP798551.1,
                     INSD:BP865787.1,INSD:AV810561.1,INSD:EL055644.1,
                     INSD:ES054945.1,INSD:EL019213.1,INSD:AV527188.1,
                     INSD:BP861094.1,INSD:DR369795.1,INSD:AV800083.1,
                     INSD:AA404754.1,INSD:EG480715.1,INSD:ES155940.1,
                     INSD:ES004922.1,INSD:EH936156.1,INSD:N96653.1,
                     INSD:EL032229.1,INSD:ES137099.1,INSD:BP782486.1,
                     INSD:BP619636.1,INSD:AV521557.1,INSD:EG480717.1,
                     INSD:ES000741.1,INSD:BP579062.1,INSD:DR384124.1,
                     INSD:EL163014.1,INSD:BP616051.1,INSD:ES018586.1,
                     INSD:EL992188.1,INSD:DR357310.1,INSD:EH815191.1,
                     INSD:BP610058.1,INSD:EH992783.1,INSD:BP594683.1,
                     INSD:EL025446.1,INSD:EH937303.1,INSD:DR369793.1,
                     INSD:ES153115.1,INSD:DR750690.1,INSD:CB256202.1,
                     INSD:CK117784.1,INSD:AV816415.1,INSD:BP609558.1,
                     INSD:BP611999.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY054160.1,INSD:BT010467.1,INSD:BX819848.1,
                     INSD:BX819972.1,INSD:AY052239.1,INSD:Y15194.1,
                     INSD:Y11336.1"
                     /db_xref="TAIR:AT2G01570"
                     /db_xref="Araport:AT2G01570"
     CDS             complement(255581..257344)
                     /gene="RGA1"
                     /locus_tag="AT2G01570"
                     /gene_synonym="F2I9.19"
                     /gene_synonym="F2I9_19"
                     /gene_synonym="REPRESSOR OF GA"
                     /gene_synonym="REPRESSOR OF GA1-3 1"
                     /gene_synonym="RGA"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR369791.1,INSD:EH916124.1,INSD:EH882892.1,
                     INSD:BP863879.1,INSD:BP597960.1,INSD:EH814024.1,
                     INSD:DR369792.1,INSD:T45793.1,INSD:ES112797.1,
                     INSD:BP807131.1,INSD:ES089846.1,INSD:BP614514.1,
                     INSD:DR369788.1,INSD:EL206189.1,INSD:EL307980.1,
                     INSD:BP848144.1,INSD:BP599239.1,INSD:ES199090.1,
                     INSD:EG450246.1,INSD:DR369794.1,INSD:ES091333.1,
                     INSD:BP789190.1,INSD:DR369787.1,INSD:EH887134.1,
                     INSD:ES197630.1,INSD:EH947530.1,INSD:ES213666.1,
                     INSD:AV830192.1,INSD:T46205.1,INSD:ES170310.1,
                     INSD:ES210919.1,INSD:ES022487.1,INSD:BP781366.1,
                     INSD:BP561805.1,INSD:EH901253.1,INSD:EG480589.1,
                     INSD:EL115972.1,INSD:BP605910.1,INSD:BP862306.1,
                     INSD:EL203328.1,INSD:EH888231.1,INSD:AV830188.1,
                     INSD:AV811805.1,INSD:BP596466.1,INSD:EH973482.1,
                     INSD:EG476836.1,INSD:BP585260.1,INSD:EH844531.1,
                     INSD:BP782620.1,INSD:EH948775.1,INSD:BP829897.1,
                     INSD:EL070679.1,INSD:DR369789.1,INSD:EH980954.1,
                     INSD:BP579443.1,INSD:EL999844.1,INSD:EL990705.1,
                     INSD:ES207359.1,INSD:BP601743.1,INSD:EL260176.1,
                     INSD:ES054413.1,INSD:AV562629.1,INSD:EL995916.1,
                     INSD:EL213442.1,INSD:EL168603.1,INSD:AV788178.1,
                     INSD:BP589619.1,INSD:AV530438.1,INSD:AV830440.1,
                     INSD:ES173121.1,INSD:ES093076.1,INSD:AV814953.1,
                     INSD:EL981857.1,INSD:EH851095.1,INSD:ES152435.1,
                     INSD:EL157996.1,INSD:EH866984.1,INSD:EL109376.1,
                     INSD:BP861541.1,INSD:EG476835.1,INSD:AI993756.1,
                     INSD:ES204171.1,INSD:AI996746.1,INSD:ES024338.1,
                     INSD:EL138163.1,INSD:BP805683.1,INSD:ES000591.1,
                     INSD:BP804414.1,INSD:EL303132.1,INSD:EL002950.1,
                     INSD:EH828797.1,INSD:EL256312.1,INSD:ES185443.1,
                     INSD:AV789779.1,INSD:EG501584.1,INSD:BP777904.1,
                     INSD:BP845909.1,INSD:ES144992.1,INSD:BP780504.1,
                     INSD:BP655803.1,INSD:EH808120.1,INSD:BP787675.1,
                     INSD:EL233888.1,INSD:EG480588.1,INSD:BP664625.1,
                     INSD:DR369790.1,INSD:ES067741.1,INSD:ES007403.1,
                     INSD:EL280532.1,INSD:ES158064.1,INSD:DR355202.1,
                     INSD:AV520438.1,INSD:ES033316.1,INSD:BP798551.1,
                     INSD:BP865787.1,INSD:AV810561.1,INSD:EL055644.1,
                     INSD:ES054945.1,INSD:EL019213.1,INSD:AV527188.1,
                     INSD:BP861094.1,INSD:DR369795.1,INSD:AV800083.1,
                     INSD:AA404754.1,INSD:EG480715.1,INSD:ES155940.1,
                     INSD:ES004922.1,INSD:EH936156.1,INSD:N96653.1,
                     INSD:EL032229.1,INSD:ES137099.1,INSD:BP782486.1,
                     INSD:BP619636.1,INSD:AV521557.1,INSD:EG480717.1,
                     INSD:ES000741.1,INSD:BP579062.1,INSD:DR384124.1,
                     INSD:EL163014.1,INSD:BP616051.1,INSD:ES018586.1,
                     INSD:EL992188.1,INSD:DR357310.1,INSD:EH815191.1,
                     INSD:BP610058.1,INSD:EH992783.1,INSD:BP594683.1,
                     INSD:EL025446.1,INSD:EH937303.1,INSD:DR369793.1,
                     INSD:ES153115.1,INSD:DR750690.1,INSD:CB256202.1,
                     INSD:CK117784.1,INSD:AV816415.1,INSD:BP609558.1,
                     INSD:BP611999.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY054160.1,INSD:BT010467.1,INSD:BX819848.1,
                     INSD:BX819972.1,INSD:AY052239.1,INSD:Y15194.1,
                     INSD:Y11336.1"
                     /note="REPRESSOR OF GA1-3 1 (RGA1); CONTAINS InterPro
                     DOMAIN/s: Transcriptional factor DELLA, N-terminal
                     (InterPro:IPR021914), Transcription factor GRAS
                     (InterPro:IPR005202); BEST Arabidopsis thaliana protein
                     match is: GRAS family transcription factor family protein
                     (TAIR:AT1G14920.1); Has 2724 Blast hits to 2666 proteins
                     in 317 species: Archae - 0; Bacteria - 6; Metazoa - 0;
                     Fungi - 4; Plants - 2709; Viruses - 0; Other Eukaryotes -
                     5 (source: NCBI BLink)."
                     /codon_start=1
                     /product="GRAS family transcription factor family protein"
                     /protein_id="AEC05469.1"
                     /db_xref="Araport:AT2G01570"
                     /db_xref="TAIR:AT2G01570"
                     /translation="MKRDHHQFQGRLSNHGTSSSSSSISKDKMMMVKKEEDGGGNMDD
                     ELLAVLGYKVRSSEMAEVALKLEQLETMMSNVQEDGLSHLATDTVHYNPSELYSWLDN
                     MLSELNPPPLPASSNGLDPVLPSPEICGFPASDYDLKVIPGNAIYQFPAIDSSSSSNN
                     QNKRLKSCSSPDSMVTSTSTGTQIGGVIGTTVTTTTTTTTAAGESTRSVILVDSQENG
                     VRLVHALMACAEAIQQNNLTLAEALVKQIGCLAVSQAGAMRKVATYFAEALARRIYRL
                     SPPQNQIDHCLSDTLQMHFYETCPYLKFAHFTANQAILEAFEGKKRVHVIDFSMNQGL
                     QWPALMQALALREGGPPTFRLTGIGPPAPDNSDHLHEVGCKLAQLAEAIHVEFEYRGF
                     VANSLADLDASMLELRPSDTEAVAVNSVFELHKLLGRPGGIEKVLGVVKQIKPVIFTV
                     VEQESNHNGPVFLDRFTESLHYYSTLFDSLEGVPNSQDKVMSEVYLGKQICNLVACEG
                     PDRVERHETLSQWGNRFGSSGLAPAHLGSNAFKQASMLLSVFNSGQGYRVEESNGCLM
                     LGWHTRPLITTSAWKLSTAAY"
     gene            258998..259325
                     /locus_tag="AT2G04015"
                     /db_xref="Araport:AT2G04015"
     ncRNA           258998..259325
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT2G04015"
                     /product="other RNA"
                     /db_xref="Araport:AT2G04015"
     gene            complement(265022..265948)
                     /locus_tag="AT2G01580"
                     /gene_synonym="F2I9.20"
                     /gene_synonym="F2I9_20"
                     /db_xref="Araport:AT2G01580"
                     /db_xref="TAIR:AT2G01580"
     mRNA            complement(265022..265948)
                     /locus_tag="AT2G01580"
                     /gene_synonym="F2I9.20"
                     /gene_synonym="F2I9_20"
                     /product="transmembrane protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV553648.1,INSD:AV545031.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT010851.1,INSD:BX821216.1,INSD:BX821201.1,
                     INSD:BT011322.1"
                     /db_xref="TAIR:AT2G01580"
                     /db_xref="Araport:AT2G01580"
     CDS             complement(265181..265756)
                     /locus_tag="AT2G01580"
                     /gene_synonym="F2I9.20"
                     /gene_synonym="F2I9_20"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV553648.1,INSD:AV545031.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT010851.1,INSD:BX821216.1,INSD:BX821201.1,
                     INSD:BT011322.1"
                     /note="unknown protein; BEST Arabidopsis thaliana protein
                     match is: unknown protein (TAIR:AT3G07510.2); Has 129
                     Blast hits to 129 proteins in 12 species: Archae - 0;
                     Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 129;
                     Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="transmembrane protein"
                     /protein_id="AEC05470.1"
                     /db_xref="Araport:AT2G01580"
                     /db_xref="TAIR:AT2G01580"
                     /translation="MADSDIETSSNQNSNSNTSHSTTSTTSVHVTALDGIVSANSLFT
                     VAVFVGISFDQPSDLTLTDRTECSAGRDVERDLVVFEVISFAFFLFSSLVAQGMKLAI
                     NLLNSKETDEVFKANINRDVLRFGVVGAAGGSILGCVFLLLSIVDVIQLRLGLLSCGN
                     ALAIHTVLVLVVLVSSALSVYIFTVFYSFRK"
     gene            266559..267926
                     /gene="CRR3"
                     /locus_tag="AT2G01590"
                     /gene_synonym="CHLORORESPIRATORY REDUCTION 3"
                     /gene_synonym="F2I9.21"
                     /gene_synonym="F2I9_21"
                     /note="Likely a subunit of the chloroplast NAD(P)H
                     dehydrogenase complex, involved in PSI cyclic electron
                     transport. Located in the membrane fraction of
                     chloroplast. Mutant has impaired NAD(P)H dehydrogenase
                     activity."
                     /db_xref="Araport:AT2G01590"
                     /db_xref="TAIR:AT2G01590"
     mRNA            join(266559..266937,267035..267171,267255..267926)
                     /gene="CRR3"
                     /locus_tag="AT2G01590"
                     /gene_synonym="CHLORORESPIRATORY REDUCTION 3"
                     /gene_synonym="F2I9.21"
                     /gene_synonym="F2I9_21"
                     /product="chlororespiratory reduction 3"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH818958.1,INSD:DR279642.1,INSD:AV786527.1,
                     INSD:EL336160.1,INSD:EL294755.1,INSD:EL273132.1,
                     INSD:EL094840.1,INSD:EH917280.1,INSD:H76228.1,
                     INSD:EL288112.1,INSD:EL257567.1,INSD:AV531816.1,
                     INSD:EL134937.1,INSD:EL137025.1,INSD:EL118193.1,
                     INSD:AV821436.1,INSD:BP627168.1,INSD:EH857812.1,
                     INSD:EH872506.1,INSD:AI995767.1,INSD:EL006162.1,
                     INSD:DR279641.1,INSD:EL132797.1,INSD:EL052686.1,
                     INSD:H76227.1,INSD:EL132596.1,INSD:DR279640.1,
                     INSD:EH898156.1,INSD:EL059894.1,INSD:EH966826.1,
                     INSD:AV796278.1,INSD:CF773455.1,INSD:EL235997.1,
                     INSD:EH991524.1,INSD:EH904827.1,INSD:AV781884.1,
                     INSD:EL178187.1,INSD:EL238448.1,INSD:EL016723.1,
                     INSD:EH848597.1,INSD:EL164946.1,INSD:EL030049.1,
                     INSD:EH825538.1,INSD:EH946723.1,INSD:EL329436.1,
                     INSD:EH905503.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY113895.1,INSD:BX821127.1,INSD:BX821297.1,
                     INSD:AY035185.1"
                     /db_xref="TAIR:AT2G01590"
                     /db_xref="Araport:AT2G01590"
     mRNA            join(266630..266937,267035..267171,267255..267375,
                     267480..267798)
                     /gene="CRR3"
                     /locus_tag="AT2G01590"
                     /gene_synonym="CHLORORESPIRATORY REDUCTION 3"
                     /gene_synonym="F2I9.21"
                     /gene_synonym="F2I9_21"
                     /product="chlororespiratory reduction 3"
                     /db_xref="Araport:AT2G01590"
                     /db_xref="TAIR:AT2G01590"
     CDS             join(266675..266937,267035..267171,267255..267375,
                     267480..267483)
                     /gene="CRR3"
                     /locus_tag="AT2G01590"
                     /gene_synonym="CHLORORESPIRATORY REDUCTION 3"
                     /gene_synonym="F2I9.21"
                     /gene_synonym="F2I9_21"
                     /codon_start=1
                     /product="chlororespiratory reduction 3"
                     /protein_id="ANM62560.1"
                     /db_xref="Araport:AT2G01590"
                     /db_xref="TAIR:AT2G01590"
                     /translation="MAVLSTIYSITRASTPTMASLTNDSPSPLPSSSPSKLPSPTSPS
                     KKPLKLRQVSKQMGSQNQQRRGNKPSIAQIERAFGSGSYRDSEGEMDMNTVFDELLLG
                     HANKFESKIEKKLREIGEIFVARTEPKLRSSGKPVLMFTIQWILPIWIMSLLVACGVI
                     KLPFSIPFLDDLII"
     CDS             join(266675..266937,267035..267171,267255..267379)
                     /gene="CRR3"
                     /locus_tag="AT2G01590"
                     /gene_synonym="CHLORORESPIRATORY REDUCTION 3"
                     /gene_synonym="F2I9.21"
                     /gene_synonym="F2I9_21"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EH818958.1,INSD:DR279642.1,INSD:AV786527.1,
                     INSD:EL336160.1,INSD:EL294755.1,INSD:EL273132.1,
                     INSD:EL094840.1,INSD:EH917280.1,INSD:H76228.1,
                     INSD:EL288112.1,INSD:EL257567.1,INSD:AV531816.1,
                     INSD:EL134937.1,INSD:EL137025.1,INSD:EL118193.1,
                     INSD:AV821436.1,INSD:BP627168.1,INSD:EH857812.1,
                     INSD:EH872506.1,INSD:AI995767.1,INSD:EL006162.1,
                     INSD:DR279641.1,INSD:EL132797.1,INSD:EL052686.1,
                     INSD:H76227.1,INSD:EL132596.1,INSD:DR279640.1,
                     INSD:EH898156.1,INSD:EL059894.1,INSD:EH966826.1,
                     INSD:AV796278.1,INSD:CF773455.1,INSD:EL235997.1,
                     INSD:EH991524.1,INSD:EH904827.1,INSD:AV781884.1,
                     INSD:EL178187.1,INSD:EL238448.1,INSD:EL016723.1,
                     INSD:EH848597.1,INSD:EL164946.1,INSD:EL030049.1,
                     INSD:EH825538.1,INSD:EH946723.1,INSD:EL329436.1,
                     INSD:EH905503.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY113895.1,INSD:BX821127.1,INSD:BX821297.1,
                     INSD:AY035185.1"
                     /note="CHLORORESPIRATORY REDUCTION 3 (CRR3); FUNCTIONS IN:
                     molecular_function unknown; INVOLVED IN: photosynthetic
                     electron transport in photosystem I; LOCATED IN:
                     chloroplast, NAD(P)H dehydrogenase complex
                     (plastoquinone), membrane; EXPRESSED IN: 22 plant
                     structures; EXPRESSED DURING: 15 growth stages; Has 17
                     Blast hits to 17 proteins in 8 species: Archae - 0;
                     Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 17; Viruses
                     - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="chlororespiratory reduction 3"
                     /protein_id="AEC05471.1"
                     /db_xref="Araport:AT2G01590"
                     /db_xref="TAIR:AT2G01590"
                     /translation="MAVLSTIYSITRASTPTMASLTNDSPSPLPSSSPSKLPSPTSPS
                     KKPLKLRQVSKQMGSQNQQRRGNKPSIAQIERAFGSGSYRDSEGEMDMNTVFDELLLG
                     HANKFESKIEKKLREIGEIFVARTEPKLRSSGKPVLMFTIQWILPIWIMSLLVACGVI
                     KLPFSIPFLDDLIM"
     gene            268714..272676
                     /locus_tag="AT2G01600"
                     /gene_synonym="F2I9.22"
                     /gene_synonym="F2I9_22"
                     /db_xref="Araport:AT2G01600"
                     /db_xref="TAIR:AT2G01600"
     mRNA            join(268714..269064,269169..269238,269324..269421,
                     269500..269638,269745..269872,269969..270061,
                     270156..270206,270356..270421,270511..270576,
                     270662..270742,270834..270914,271007..271183,
                     271283..271361,271476..271591,271976..272676)
                     /locus_tag="AT2G01600"
                     /gene_synonym="F2I9.22"
                     /gene_synonym="F2I9_22"
                     /product="ENTH/ANTH/VHS superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AA712916.1,INSD:AV559234.1,INSD:BP781044.1,
                     INSD:BP829746.1,INSD:DR334476.1,INSD:DR375025.1,
                     INSD:EH975491.1,INSD:AV561993.1,INSD:EL210748.1,
                     INSD:EH952713.1,INSD:BP784487.1,INSD:EL086911.1,
                     INSD:EH925811.1,INSD:EL050488.1,INSD:ES041512.1,
                     INSD:EL095086.1,INSD:EL080508.1,INSD:ES097332.1,
                     INSD:BP836125.1,INSD:BP641390.1,INSD:EL179214.1,
                     INSD:ES173084.1,INSD:AV802940.1,INSD:EL041426.1,
                     INSD:BP836004.1,INSD:EH934580.1,INSD:ES008804.1,
                     INSD:EL297205.1,INSD:EL007177.1,INSD:BP598711.1,
                     INSD:AA395302.1,INSD:BP839781.1,INSD:EH939057.1,
                     INSD:AV555330.1,INSD:EH870220.1,INSD:ES118031.1,
                     INSD:DR334477.1,INSD:BP780346.1,INSD:BP651421.1,
                     INSD:EL146707.1,INSD:AV814682.1,INSD:EH872915.1,
                     INSD:R86989.1,INSD:BP619453.1,INSD:EL180839.1,
                     INSD:BP809976.1,INSD:EL321604.1,INSD:EL257993.1,
                     INSD:AV534763.1,INSD:EL216227.1,INSD:ES131582.1,
                     INSD:DR383651.1,INSD:AV559491.1,INSD:BP638064.1,
                     INSD:BP780310.1,INSD:EL190102.1,INSD:BP598356.1,
                     INSD:BP825746.1,INSD:ES174498.1,INSD:EH956383.1,
                     INSD:ES143826.1,INSD:BP814336.1,INSD:BP811092.1,
                     INSD:AV564952.1,INSD:EG499097.1,INSD:EL234008.1,
                     INSD:BP582564.1,INSD:EL197131.1,INSD:ES142926.1,
                     INSD:BP619594.1,INSD:ES080367.1,INSD:AV798468.1,
                     INSD:EL230407.1,INSD:ES072460.1,INSD:EL208025.1,
                     INSD:BP636214.1,INSD:AV801365.1,INSD:EH891195.1,
                     INSD:ES016242.1,INSD:AV558107.1,INSD:EL045728.1,
                     INSD:BP868547.1,INSD:ES093414.1,INSD:DR334478.1,
                     INSD:AV782259.1,INSD:BP864846.1,INSD:BP818586.1,
                     INSD:BP795088.1,INSD:ES066318.1,INSD:BX834190.1,
                     INSD:BP815045.1,INSD:AV828818.1,INSD:AV801660.1,
                     INSD:EH980769.1,INSD:EL016997.1,INSD:BX837018.1,
                     INSD:AV827514.1,INSD:BP781718.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX819725.1,INSD:BX820162.1,INSD:BX821731.1,
                     INSD:AY096639.1,INSD:AY133828.1,INSD:AF424593.1"
                     /db_xref="TAIR:AT2G01600"
                     /db_xref="Araport:AT2G01600"
     CDS             join(268975..269064,269169..269238,269324..269421,
                     269500..269638,269745..269872,269969..270061,
                     270156..270206,270356..270421,270511..270576,
                     270662..270742,270834..270914,271007..271183,
                     271283..271361,271476..271591,271976..272356)
                     /locus_tag="AT2G01600"
                     /gene_synonym="F2I9.22"
                     /gene_synonym="F2I9_22"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AA712916.1,INSD:AV559234.1,INSD:BP781044.1,
                     INSD:BP829746.1,INSD:DR334476.1,INSD:DR375025.1,
                     INSD:EH975491.1,INSD:AV561993.1,INSD:EL210748.1,
                     INSD:EH952713.1,INSD:BP784487.1,INSD:EL086911.1,
                     INSD:EH925811.1,INSD:EL050488.1,INSD:ES041512.1,
                     INSD:EL095086.1,INSD:EL080508.1,INSD:ES097332.1,
                     INSD:BP836125.1,INSD:BP641390.1,INSD:EL179214.1,
                     INSD:ES173084.1,INSD:AV802940.1,INSD:EL041426.1,
                     INSD:BP836004.1,INSD:EH934580.1,INSD:ES008804.1,
                     INSD:EL297205.1,INSD:EL007177.1,INSD:BP598711.1,
                     INSD:AA395302.1,INSD:BP839781.1,INSD:EH939057.1,
                     INSD:AV555330.1,INSD:EH870220.1,INSD:ES118031.1,
                     INSD:DR334477.1,INSD:BP780346.1,INSD:BP651421.1,
                     INSD:EL146707.1,INSD:AV814682.1,INSD:EH872915.1,
                     INSD:R86989.1,INSD:BP619453.1,INSD:EL180839.1,
                     INSD:BP809976.1,INSD:EL321604.1,INSD:EL257993.1,
                     INSD:AV534763.1,INSD:EL216227.1,INSD:ES131582.1,
                     INSD:DR383651.1,INSD:AV559491.1,INSD:BP638064.1,
                     INSD:BP780310.1,INSD:EL190102.1,INSD:BP598356.1,
                     INSD:BP825746.1,INSD:ES174498.1,INSD:EH956383.1,
                     INSD:ES143826.1,INSD:BP814336.1,INSD:BP811092.1,
                     INSD:AV564952.1,INSD:EG499097.1,INSD:EL234008.1,
                     INSD:BP582564.1,INSD:EL197131.1,INSD:ES142926.1,
                     INSD:BP619594.1,INSD:ES080367.1,INSD:AV798468.1,
                     INSD:EL230407.1,INSD:ES072460.1,INSD:EL208025.1,
                     INSD:BP636214.1,INSD:AV801365.1,INSD:EH891195.1,
                     INSD:ES016242.1,INSD:AV558107.1,INSD:EL045728.1,
                     INSD:BP868547.1,INSD:ES093414.1,INSD:DR334478.1,
                     INSD:AV782259.1,INSD:BP864846.1,INSD:BP818586.1,
                     INSD:BP795088.1,INSD:ES066318.1,INSD:BX834190.1,
                     INSD:BP815045.1,INSD:AV828818.1,INSD:AV801660.1,
                     INSD:EH980769.1,INSD:EL016997.1,INSD:BX837018.1,
                     INSD:AV827514.1,INSD:BP781718.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX819725.1,INSD:BX820162.1,INSD:BX821731.1,
                     INSD:AY096639.1,INSD:AY133828.1,INSD:AF424593.1"
                     /note="ENTH/ANTH/VHS superfamily protein; FUNCTIONS IN:
                     phospholipid binding, clathrin binding, binding,
                     phosphatidylinositol binding; INVOLVED IN: N-terminal
                     protein myristoylation, clathrin coat assembly; LOCATED
                     IN: membrane; EXPRESSED IN: 24 plant structures; EXPRESSED
                     DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
                     Epsin-like, N-terminal (InterPro:IPR013809), ANTH
                     (InterPro:IPR011417), ENTH/VHS (InterPro:IPR008942),
                     Clathrin adaptor, phosphoinositide-binding, GAT-like
                     (InterPro:IPR014712); BEST Arabidopsis thaliana protein
                     match is: ENTH/ANTH/VHS superfamily protein
                     (TAIR:AT1G14910.1); Has 1020 Blast hits to 994 proteins in
                     190 species: Archae - 0; Bacteria - 14; Metazoa - 316;
                     Fungi - 202; Plants - 440; Viruses - 0; Other Eukaryotes -
                     48 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ENTH/ANTH/VHS superfamily protein"
                     /protein_id="AEC05472.1"
                     /db_xref="Araport:AT2G01600"
                     /db_xref="TAIR:AT2G01600"
                     /translation="MGTLQSWRKAYGALKDSTKVGLVRVNSEYADLDVAIVKATNHVE
                     CPPKDRHLRKIFAATSVTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREG
                     DPTFREELLNFSQRGRILQLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYD
                     TEAERLPKSNPGQDKGYSRTRDLDGEELLEQLPALQQLLYRLIGCRPEGAANHNHVIQ
                     YALALVLKESFKVYCAINDGIINLIDKFFEMAKHEAITSLEIYKRAGQQARSLSDFYE
                     ACKGLELARNFQFPVLREPPQSFLTTMEEYIKEAPRVVDVPAEPLLLTYRPDDGLTTE
                     DTEPSHEEREMLPSDDVVVVSEETEPSPPPPPSANAQNFIDTDDLWGLNTGAPDTSVI
                     EDQNALALAIVSTDADPPTPHFGQPNNYDPTGWELALVTAPSSDISASTERKLAGGLD
                     TLTLSSLYDDGAYIASQRPVYGAPAPNPFASHDPFASSNGTAPPPQQQAVNNPFGAYQ
                     QTYQHQPQPTYQHQSNPPTNNSNPFGDFGEFPVNPVSQQPNTSGYGDFSVNQHNNPFR
                     STGLI"
     gene            complement(272679..273132)
                     /locus_tag="AT2G04055"
                     /db_xref="Araport:AT2G04055"
     misc_RNA        complement(join(272679..272872,272979..273132))
                     /locus_tag="AT2G04055"
                     /note="novel transcribed region; detected in carpel,
                     receptacle, leaf, dark-grown seedling, light-grown
                     seedling, flower;
                     AT2G04055.1"
                     /db_xref="Araport:AT2G04055"
     gene            complement(273895..275002)
                     /locus_tag="AT2G01610"
                     /gene_synonym="T8O11.22"
                     /gene_synonym="T8O11_22"
                     /db_xref="Araport:AT2G01610"
                     /db_xref="TAIR:AT2G01610"
     mRNA            complement(273895..275002)
                     /locus_tag="AT2G01610"
                     /gene_synonym="T8O11.22"
                     /gene_synonym="T8O11_22"
                     /product="Plant invertase/pectin methylesterase inhibitor
                     superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR285838.1,INSD:EH984274.1,INSD:EG474782.1,
                     INSD:EL084725.1,INSD:DR381754.1,INSD:EH886305.1,
                     INSD:EG475782.1,INSD:EL291955.1,INSD:DR285842.1,
                     INSD:DR285841.1,INSD:EG475784.1,INSD:EL978811.1,
                     INSD:BP788564.1,INSD:DR285839.1,INSD:CB258238.1,
                     INSD:BE528816.1,INSD:DR285840.1,INSD:BP788532.1,
                     INSD:BP813167.1,INSD:ES208725.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AK175594.1,INSD:BT030064.1"
                     /db_xref="TAIR:AT2G01610"
                     /db_xref="Araport:AT2G01610"
     CDS             complement(274124..274792)
                     /locus_tag="AT2G01610"
                     /gene_synonym="T8O11.22"
                     /gene_synonym="T8O11_22"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR285838.1,INSD:EH984274.1,INSD:EG474782.1,
                     INSD:EL084725.1,INSD:DR381754.1,INSD:EH886305.1,
                     INSD:EG475782.1,INSD:EL291955.1,INSD:DR285842.1,
                     INSD:DR285841.1,INSD:EG475784.1,INSD:EL978811.1,
                     INSD:BP788564.1,INSD:DR285839.1,INSD:CB258238.1,
                     INSD:BE528816.1,INSD:DR285840.1,INSD:BP788532.1,
                     INSD:BP813167.1,INSD:ES208725.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AK175594.1,INSD:BT030064.1"
                     /note="Plant invertase/pectin methylesterase inhibitor
                     superfamily protein; FUNCTIONS IN: enzyme inhibitor
                     activity, pectinesterase inhibitor activity,
                     pectinesterase activity; INVOLVED IN: biological_process
                     unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 22
                     plant structures; EXPRESSED DURING: 13 growth stages;
                     CONTAINS InterPro DOMAIN/s: Pectinesterase inhibitor
                     (InterPro:IPR006501); BEST Arabidopsis thaliana protein
                     match is: Plant invertase/pectin methylesterase inhibitor
                     superfamily protein (TAIR:AT1G14890.1); Has 850 Blast hits
                     to 843 proteins in 42 species: Archae - 0; Bacteria - 0;
                     Metazoa - 0; Fungi - 0; Plants - 850; Viruses - 0; Other
                     Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Plant invertase/pectin methylesterase inhibitor
                     superfamily protein"
                     /protein_id="AEC05473.1"
                     /db_xref="Araport:AT2G01610"
                     /db_xref="TAIR:AT2G01610"
                     /translation="MVTVSQSHTTTFLFFTTFLLIFGSISAVRLLPRPNTTTTNDLDF
                     IRTSCNATLYPDVCFTSLSGYASAVQDSPARLAKLAIGVSLSQAKSTAAFLSKLSRSA
                     AKYSGDGHQTASAVIRDCVSNVEDAVDEMRGSLRQLRDMNGRGGGTAARRSVETFRFQ
                     MSNVQTWMSAALTDEDTCTDGFEDMDEGGLIKTTVCDRLEEVKRLTSNALALVNTYAN
                     NGAP"
     gene            278124..279296
                     /gene="MEE11"
                     /locus_tag="AT2G01620"
                     /gene_synonym="maternal effect embryo arrest 11"
                     /gene_synonym="T8O11.21"
                     /gene_synonym="T8O11_21"
                     /db_xref="Araport:AT2G01620"
                     /db_xref="TAIR:AT2G01620"
     mRNA            join(278124..278536,278600..278836,278918..279296)
                     /gene="MEE11"
                     /locus_tag="AT2G01620"
                     /gene_synonym="maternal effect embryo arrest 11"
                     /gene_synonym="T8O11.21"
                     /gene_synonym="T8O11_21"
                     /product="RNI-like superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:CB260499.1,INSD:ES144014.1,INSD:EL274766.1,
                     INSD:EL206683.1,INSD:DR276373.1,INSD:ES154548.1,
                     INSD:ES033634.1,INSD:EL059810.1,INSD:AI997687.1,
                     INSD:EG495896.1,INSD:EL085680.1,INSD:EL063914.1,
                     INSD:EL024764.1,INSD:DR276374.1,INSD:EL080607.1,
                     INSD:EH824602.1,INSD:EL212896.1,INSD:EL037925.1,
                     INSD:ES039151.1,INSD:EH874077.1,INSD:EL067654.1,
                     INSD:EG479807.1,INSD:DR276375.1,INSD:DR381142.1,
                     INSD:EH903255.1,INSD:AU238495.1,INSD:ES152197.1,
                     INSD:EH816480.1,INSD:EL058273.1,INSD:DR276372.1,
                     INSD:EL154959.1,INSD:EL123717.1,INSD:DR276371.1,
                     INSD:AU229687.1,INSD:EH959511.1,INSD:ES197691.1,
                     INSD:EL103506.1,INSD:EH994872.1,INSD:T46400.1,
                     INSD:EH942495.1,INSD:ES123739.1,INSD:EG495897.1,
                     INSD:EL150588.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT005175.1,INSD:AK117653.1,INSD:AY084339.1"
                     /db_xref="TAIR:AT2G01620"
                     /db_xref="Araport:AT2G01620"
     CDS             join(278204..278536,278600..278836,278918..279226)
                     /gene="MEE11"
                     /locus_tag="AT2G01620"
                     /gene_synonym="maternal effect embryo arrest 11"
                     /gene_synonym="T8O11.21"
                     /gene_synonym="T8O11_21"
                     /inference="Similar to RNA sequence,
                     EST:INSD:CB260499.1,INSD:ES144014.1,INSD:EL274766.1,
                     INSD:EL206683.1,INSD:DR276373.1,INSD:ES154548.1,
                     INSD:ES033634.1,INSD:EL059810.1,INSD:AI997687.1,
                     INSD:EG495896.1,INSD:EL085680.1,INSD:EL063914.1,
                     INSD:EL024764.1,INSD:DR276374.1,INSD:EL080607.1,
                     INSD:EH824602.1,INSD:EL212896.1,INSD:EL037925.1,
                     INSD:ES039151.1,INSD:EH874077.1,INSD:EL067654.1,
                     INSD:EG479807.1,INSD:DR276375.1,INSD:DR381142.1,
                     INSD:EH903255.1,INSD:AU238495.1,INSD:ES152197.1,
                     INSD:EH816480.1,INSD:EL058273.1,INSD:DR276372.1,
                     INSD:EL154959.1,INSD:EL123717.1,INSD:DR276371.1,
                     INSD:AU229687.1,INSD:EH959511.1,INSD:ES197691.1,
                     INSD:EL103506.1,INSD:EH994872.1,INSD:T46400.1,
                     INSD:EH942495.1,INSD:ES123739.1,INSD:EG495897.1,
                     INSD:EL150588.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT005175.1,INSD:AK117653.1,INSD:AY084339.1"
                     /note="maternal effect embryo arrest 11 (MEE11); BEST
                     Arabidopsis thaliana protein match is: Ribonuclease
                     inhibitor (TAIR:AT3G26000.1); Has 234 Blast hits to 230
                     proteins in 61 species: Archae - 0; Bacteria - 0; Metazoa
                     - 139; Fungi - 2; Plants - 81; Viruses - 0; Other
                     Eukaryotes - 12 (source: NCBI BLink)."
                     /codon_start=1
                     /product="RNI-like superfamily protein"
                     /protein_id="AEC05474.1"
                     /db_xref="Araport:AT2G01620"
                     /db_xref="TAIR:AT2G01620"
                     /translation="MKTELEEEEEEEWRSVHEVLLIVLPYLHSLFELLSMIRVSRSLR
                     DAIRDETALWTKLVIEPPLSSRLTDDILSEFSSKSAGKLKTLILRQCLMVTNKGLRRV
                     VDANPLITKIIVPGCSGLTPEGIMECVESLSKNNHKLETLHINGVNGFTKQHLSALYT
                     YLSSEGTIDLEVCPKCDEVRMIPSCSRESCNQKQRKCRGCWLCIPRCAECAVCLVGSD
                     TESQEAACGNDDVLCLECWLVLPKCRFCNKPYCTNHSSRRHEIAITDAASRPSFECEA
                     CYYRAGTNPYEVDYQI"
     gene            complement(279282..282123)
                     /locus_tag="AT2G01630"
                     /gene_synonym="T8O11.20"
                     /gene_synonym="T8O11_20"
                     /db_xref="Araport:AT2G01630"
                     /db_xref="TAIR:AT2G01630"
     mRNA            complement(join(279282..279706,279804..279831,
                     279936..281189,281898..282123))
                     /locus_tag="AT2G01630"
                     /gene_synonym="T8O11.20"
                     /gene_synonym="T8O11_20"
                     /product="O-Glycosyl hydrolases family 17 protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL274766.1,INSD:EL039359.1,INSD:ES162060.1,
                     INSD:ES154548.1,INSD:DR252557.1,INSD:EL059810.1,
                     INSD:DR379027.1,INSD:AI993072.1,INSD:EG495896.1,
                     INSD:EL065914.1,INSD:EL173184.1,INSD:BX835984.1,
                     INSD:DR252558.1,INSD:DR252556.1,INSD:T42658.1,
                     INSD:CB263219.1,INSD:ES039151.1,INSD:EG479807.1,
                     INSD:EL118534.1,INSD:DR381142.1,INSD:EH895545.1,
                     INSD:BX841121.1,INSD:T21851.1,INSD:AV533477.1,
                     INSD:EL057748.1,INSD:ES188148.1,INSD:AA585729.1,
                     INSD:AI100379.1,INSD:BX840014.1,INSD:AU229687.1,
                     INSD:EH930803.1,INSD:EG495897.1,INSD:EH928709.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX819571.1,INSD:AY085500.1,INSD:BX819636.1"
                     /db_xref="TAIR:AT2G01630"
                     /db_xref="Araport:AT2G01630"
     mRNA            complement(join(279325..279583,280092..281189,
                     281898..282123))
                     /locus_tag="AT2G01630"
                     /gene_synonym="T8O11.20"
                     /gene_synonym="T8O11_20"
                     /product="O-Glycosyl hydrolases family 17 protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL039359.1,INSD:EL118534.1,INSD:ES154548.1,
                     INSD:DR252557.1,INSD:AI993072.1,INSD:EH895545.1,
                     INSD:BX841121.1,INSD:EG495896.1,INSD:T21851.1,
                     INSD:AV533477.1,INSD:EL065914.1,INSD:EL173184.1,
                     INSD:EL057748.1,INSD:DR252558.1,INSD:AA585729.1,
                     INSD:AI100379.1,INSD:BX840014.1,INSD:T42658.1,
                     INSD:CB263219.1,INSD:EH930803.1,INSD:EG495897.1,
                     INSD:ES039151.1,INSD:EH928709.1"
                     /db_xref="TAIR:AT2G01630"
                     /db_xref="Araport:AT2G01630"
     mRNA            complement(join(279325..279706,279804..281189,
                     281898..282123))
                     /locus_tag="AT2G01630"
                     /gene_synonym="T8O11.20"
                     /gene_synonym="T8O11_20"
                     /product="O-Glycosyl hydrolases family 17 protein"
                     /db_xref="Araport:AT2G01630"
                     /db_xref="TAIR:AT2G01630"
     CDS             complement(join(279541..279706,279804..279831,
                     279936..281189,281898..281955))
                     /locus_tag="AT2G01630"
                     /gene_synonym="T8O11.20"
                     /gene_synonym="T8O11_20"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL274766.1,INSD:EL039359.1,INSD:ES162060.1,
                     INSD:ES154548.1,INSD:DR252557.1,INSD:EL059810.1,
                     INSD:DR379027.1,INSD:AI993072.1,INSD:EG495896.1,
                     INSD:EL065914.1,INSD:EL173184.1,INSD:BX835984.1,
                     INSD:DR252558.1,INSD:DR252556.1,INSD:T42658.1,
                     INSD:CB263219.1,INSD:ES039151.1,INSD:EG479807.1,
                     INSD:EL118534.1,INSD:DR381142.1,INSD:EH895545.1,
                     INSD:BX841121.1,INSD:T21851.1,INSD:AV533477.1,
                     INSD:EL057748.1,INSD:ES188148.1,INSD:AA585729.1,
                     INSD:AI100379.1,INSD:BX840014.1,INSD:AU229687.1,
                     INSD:EH930803.1,INSD:EG495897.1,INSD:EH928709.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX819571.1,INSD:AY085500.1,INSD:BX819636.1"
                     /note="O-Glycosyl hydrolases family 17 protein; FUNCTIONS
                     IN: cation binding, hydrolase activity, hydrolyzing
                     O-glycosyl compounds, catalytic activity; INVOLVED IN:
                     carbohydrate metabolic process; LOCATED IN: anchored to
                     plasma membrane, plasma membrane, anchored to membrane;
                     EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13
                     growth stages; CONTAINS InterPro DOMAIN/s: X8
                     (InterPro:IPR012946), Glycoside hydrolase, catalytic core
                     (InterPro:IPR017853), Glycoside hydrolase, family 17
                     (InterPro:IPR000490), Glycoside hydrolase, subgroup,
                     catalytic core (InterPro:IPR013781); BEST Arabidopsis
                     thaliana protein match is: O-Glycosyl hydrolases family 17
                     protein (TAIR:AT1G66250.1); Has 2926 Blast hits to 2856
                     proteins in 173 species: Archae - 0; Bacteria - 0; Metazoa
                     - 3; Fungi - 93; Plants - 2819; Viruses - 0; Other
                     Eukaryotes - 11 (source: NCBI BLink)."
                     /codon_start=1
                     /product="O-Glycosyl hydrolases family 17 protein"
                     /protein_id="AEC05475.1"
                     /db_xref="Araport:AT2G01630"
                     /db_xref="TAIR:AT2G01630"
                     /translation="MAALLLLFLFLFASSALSQDSLIGVNIGTEVTNMPSPTQVVALL
                     KSQNINRVRLYDADRSMLLAFAHTGVQVIISVPNDQLLGISQSNATAANWVTRNVAAY
                     YPATNITTIAVGSEVLTSLTNAASVLVSALKYIQAALVTANLDRQIKVSTPHSSTIIL
                     DSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYPYFDYVQSNGVIPLDYALFQP
                     LQANKEAVDANTLLHYTNVFDAIVDAAYFAMSYLNFTNIPIVVTESGWPSKGGPSEHD
                     ATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNEDTRPGPVSEKNWGLFYT
                     NGTPVYTLRLAGAGAILANDTTNQTFCIAKEKVDRKMLQAALDWACGPGKVDCSALMQ
                     GESCYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKGVATVTTTDPSRGTCVFPGSAKS
                     NQTLGNNTSALAPSANSTTSGCIPKYYHHPHASFGDLTLLSLLLIIALVFL"
     CDS             complement(join(279564..279583,280092..281189,
                     281898..281955))
                     /locus_tag="AT2G01630"
                     /gene_synonym="T8O11.20"
                     /gene_synonym="T8O11_20"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL039359.1,INSD:EL118534.1,INSD:ES154548.1,
                     INSD:DR252557.1,INSD:AI993072.1,INSD:EH895545.1,
                     INSD:BX841121.1,INSD:EG495896.1,INSD:T21851.1,
                     INSD:AV533477.1,INSD:EL065914.1,INSD:EL173184.1,
                     INSD:EL057748.1,INSD:DR252558.1,INSD:AA585729.1,
                     INSD:AI100379.1,INSD:BX840014.1,INSD:T42658.1,
                     INSD:CB263219.1,INSD:EH930803.1,INSD:EG495897.1,
                     INSD:ES039151.1,INSD:EH928709.1"
                     /note="O-Glycosyl hydrolases family 17 protein; FUNCTIONS
                     IN: cation binding, hydrolase activity, hydrolyzing
                     O-glycosyl compounds, catalytic activity; INVOLVED IN:
                     carbohydrate metabolic process; LOCATED IN: plasma
                     membrane, anchored to membrane; EXPRESSED IN: 21 plant
                     structures; EXPRESSED DURING: 13 growth stages; CONTAINS
                     InterPro DOMAIN/s: Glycoside hydrolase, catalytic core
                     (InterPro:IPR017853), Glycoside hydrolase, family 17
                     (InterPro:IPR000490), Glycoside hydrolase, subgroup,
                     catalytic core (InterPro:IPR013781); BEST Arabidopsis
                     thaliana protein match is: O-Glycosyl hydrolases family 17
                     protein (TAIR:AT1G66250.1); Has 2147 Blast hits to 2131
                     proteins in 127 species: Archae - 0; Bacteria - 0; Metazoa
                     - 3; Fungi - 5; Plants - 2133; Viruses - 0; Other
                     Eukaryotes - 6 (source: NCBI BLink)."
                     /codon_start=1
                     /product="O-Glycosyl hydrolases family 17 protein"
                     /protein_id="AEC05476.1"
                     /db_xref="Araport:AT2G01630"
                     /db_xref="TAIR:AT2G01630"
                     /translation="MAALLLLFLFLFASSALSQDSLIGVNIGTEVTNMPSPTQVVALL
                     KSQNINRVRLYDADRSMLLAFAHTGVQVIISVPNDQLLGISQSNATAANWVTRNVAAY
                     YPATNITTIAVGSEVLTSLTNAASVLVSALKYIQAALVTANLDRQIKVSTPHSSTIIL
                     DSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYPYFDYVQSNGVIPLDYALFQP
                     LQANKEAVDANTLLHYTNVFDAIVDAAYFAMSYLNFTNIPIVVTESGWPSKGGPSEHD
                     ATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNEDTRPGPVSEKNWGLFYT
                     NGTPVYTLRLAGAGAILANDTTNQTFCIAKEKVDRKMLQAALDWACGPGKVDYSPFY"
     CDS             complement(join(279928..281189,281898..281955))
                     /locus_tag="AT2G01630"
                     /gene_synonym="T8O11.20"
                     /gene_synonym="T8O11_20"
                     /codon_start=1
                     /product="O-Glycosyl hydrolases family 17 protein"
                     /protein_id="ANM61539.1"
                     /db_xref="Araport:AT2G01630"
                     /db_xref="TAIR:AT2G01630"
                     /translation="MAALLLLFLFLFASSALSQDSLIGVNIGTEVTNMPSPTQVVALL
                     KSQNINRVRLYDADRSMLLAFAHTGVQVIISVPNDQLLGISQSNATAANWVTRNVAAY
                     YPATNITTIAVGSEVLTSLTNAASVLVSALKYIQAALVTANLDRQIKVSTPHSSTIIL
                     DSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYPYFDYVQSNGVIPLDYALFQP
                     LQANKEAVDANTLLHYTNVFDAIVDAAYFAMSYLNFTNIPIVVTESGWPSKGGPSEHD
                     ATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNEDTRPGPVSEKNWGLFYT
                     NGTPVYTLRLAGAGAILANDTTNQTFCIAKEKVDRKMLQAALDWACGPGKVDCSALMQ
                     GESCYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKGVATVTTTDPSM"
     gene            281598..281921
                     /locus_tag="AT2G04065"
                     /note="Natural antisense transcript overlaps with
                     AT2G01630"
                     /db_xref="Araport:AT2G04065"
     ncRNA           281598..281921
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT2G04065"
                     /product="other RNA"
                     /db_xref="Araport:AT2G04065"
     gene            282830..284598
                     /locus_tag="AT2G01640"
                     /gene_synonym="T8O11.19"
                     /gene_synonym="T8O11_19"
                     /db_xref="Araport:AT2G01640"
                     /db_xref="TAIR:AT2G01640"
     mRNA            join(282830..283104,283212..283270,283360..283409,
                     283618..283766,283842..284311)
                     /locus_tag="AT2G01640"
                     /gene_synonym="T8O11.19"
                     /gene_synonym="T8O11_19"
                     /product="ribosome biogenesis protein"
                     /db_xref="TAIR:AT2G01640"
                     /db_xref="Araport:AT2G01640"
     mRNA            join(282969..283104,283212..283270,283360..283409,
                     283618..283766,283842..284076,284449..284598)
                     /locus_tag="AT2G01640"
                     /gene_synonym="T8O11.19"
                     /gene_synonym="T8O11_19"
                     /product="ribosome biogenesis protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG430351.1,INSD:EG525420.1,INSD:DR319523.1,
                     INSD:EG521945.1,INSD:AU230474.1,INSD:EG525421.1,
                     INSD:BP563054.3,INSD:DR319520.1,INSD:BP657549.1,
                     INSD:ES001863.1,INSD:EG521612.1,INSD:DR371534.1,
                     INSD:DR319519.1,INSD:AI995483.1,INSD:DR319521.1,
                     INSD:EG430362.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY088767.1,INSD:AK118334.1,INSD:BT005605.1"
                     /db_xref="TAIR:AT2G01640"
                     /db_xref="Araport:AT2G01640"
     CDS             join(283085..283104,283212..283270,283360..283409,
                     283618..283766,283842..284034)
                     /locus_tag="AT2G01640"
                     /gene_synonym="T8O11.19"
                     /gene_synonym="T8O11_19"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG430351.1,INSD:EG525420.1,INSD:DR319523.1,
                     INSD:EG521945.1,INSD:AU230474.1,INSD:EG525421.1,
                     INSD:BP563054.3,INSD:DR319520.1,INSD:BP657549.1,
                     INSD:ES001863.1,INSD:EG521612.1,INSD:DR371534.1,
                     INSD:DR319519.1,INSD:AI995483.1,INSD:DR319521.1,
                     INSD:EG430362.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY088767.1,INSD:AK118334.1,INSD:BT005605.1"
                     /note="unknown protein; Has 51 Blast hits to 51 proteins
                     in 21 species: Archae - 0; Bacteria - 0; Metazoa - 1;
                     Fungi - 2; Plants - 41; Viruses - 0; Other Eukaryotes - 7
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="ribosome biogenesis protein"
                     /protein_id="AEC05477.1"
                     /db_xref="Araport:AT2G01640"
                     /db_xref="TAIR:AT2G01640"
                     /translation="MGKPSKGSEVTTKSDKKFEKKLQFYTKVKDTVTSLSVQKEIGKK
                     KKIRSRQKKLKAYDLTNLSEFLPEFNALQKSALPAPELKMNCKRRQKLVLTEGERLNK
                     VLDHPAFQADPVGSIFQHLLSQQPPVEEKPKKKTNTNGSKKRNKKKGKTDSMDF"
     CDS             join(283085..283104,283212..283270,283360..283409,
                     283618..283766,283842..284034)
                     /locus_tag="AT2G01640"
                     /gene_synonym="T8O11.19"
                     /gene_synonym="T8O11_19"
                     /note="unknown protein; FUNCTIONS IN: molecular_function
                     unknown; INVOLVED IN: biological_process unknown; LOCATED
                     IN: cellular_component unknown; EXPRESSED IN: 22 plant
                     structures; EXPRESSED DURING: 13 growth stages."
                     /codon_start=1
                     /product="ribosome biogenesis protein"
                     /protein_id="AEC05478.1"
                     /db_xref="Araport:AT2G01640"
                     /db_xref="TAIR:AT2G01640"
                     /translation="MGKPSKGSEVTTKSDKKFEKKLQFYTKVKDTVTSLSVQKEIGKK
                     KKIRSRQKKLKAYDLTNLSEFLPEFNALQKSALPAPELKMNCKRRQKLVLTEGERLNK
                     VLDHPAFQADPVGSIFQHLLSQQPPVEEKPKKKTNTNGSKKRNKKKGKTDSMDF"
     gene            complement(284509..286529)
                     /gene="PUX2"
                     /locus_tag="AT2G01650"
                     /gene_synonym="plant UBX domain-containing protein 2"
                     /gene_synonym="T8O11.18"
                     /gene_synonym="T8O11_18"
                     /note="encodes a peripheral membrane protein that contains
                     UBX domain and interacts with AtCDC48 in vitro and
                     co-fractionates with membrane-associated but not soluble
                     AtCDC48 in vivo."
                     /db_xref="Araport:AT2G01650"
                     /db_xref="TAIR:AT2G01650"
     mRNA            complement(join(284509..284592,284676..285084,
                     285167..285445,285531..286515))
                     /gene="PUX2"
                     /locus_tag="AT2G01650"
                     /gene_synonym="plant UBX domain-containing protein 2"
                     /gene_synonym="T8O11.18"
                     /gene_synonym="T8O11_18"
                     /product="plant UBX domain-containing protein 2"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP804447.1,INSD:BP667235.1,INSD:DR292870.1,
                     INSD:EG473802.1,INSD:EL137284.1,INSD:EL258852.1,
                     INSD:EL186574.1,INSD:EH900865.1,INSD:EL091383.1,
                     INSD:DR292868.1,INSD:BX840502.1,INSD:EG509642.1,
                     INSD:N37890.1,INSD:EH810151.1,INSD:EG525487.1,
                     INSD:AA650852.1,INSD:EH873707.1,INSD:BP848912.1,
                     INSD:EG473803.1,INSD:BP846487.1,INSD:EL312932.1,
                     INSD:EH864920.1,INSD:CD530492.1,INSD:EH801016.1,
                     INSD:AU239794.1,INSD:EH972947.1,INSD:DR292869.1,
                     INSD:BU635942.1,INSD:EH917648.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX818883.1,INSD:AK118911.1,INSD:AY084317.1,
                     INSD:BT005408.1,INSD:AY572782.1,INSD:BX820565.1,
                     INSD:BX820882.1,INSD:BX820048.1"
                     /db_xref="TAIR:AT2G01650"
                     /db_xref="Araport:AT2G01650"
     mRNA            complement(join(284597..285084,285167..285445,
                     285531..286529))
                     /gene="PUX2"
                     /locus_tag="AT2G01650"
                     /gene_synonym="plant UBX domain-containing protein 2"
                     /gene_synonym="T8O11.18"
                     /gene_synonym="T8O11_18"
                     /product="plant UBX domain-containing protein 2"
                     /db_xref="Araport:AT2G01650"
                     /db_xref="TAIR:AT2G01650"
     mRNA            complement(join(284646..285445,285531..286515))
                     /gene="PUX2"
                     /locus_tag="AT2G01650"
                     /gene_synonym="plant UBX domain-containing protein 2"
                     /gene_synonym="T8O11.18"
                     /gene_synonym="T8O11_18"
                     /product="plant UBX domain-containing protein 2"
                     /db_xref="Araport:AT2G01650"
                     /db_xref="TAIR:AT2G01650"
     CDS             complement(join(284851..285084,285167..285445,
                     285531..286394))
                     /gene="PUX2"
                     /locus_tag="AT2G01650"
                     /gene_synonym="plant UBX domain-containing protein 2"
                     /gene_synonym="T8O11.18"
                     /gene_synonym="T8O11_18"
                     /codon_start=1
                     /product="plant UBX domain-containing protein 2"
                     /protein_id="ANM61337.1"
                     /db_xref="Araport:AT2G01650"
                     /db_xref="TAIR:AT2G01650"
                     /translation="MDDVKDKLKGFMKKVNLSSSSGKFKGQGRVLGSSSSSSAPPVNP
                     IQNRFNSSQAPNPTPRPKPNPNPLPEKPLSSSDQKISGSTRNPDHDPVRAPQDGFDPY
                     GAFITSSNRSQNGYSLSMFECPICKNPFTSEEEVSVHVESCLGDTNGDESSFEKDNND
                     NDKSEMEKLVVVYLSGKPSESSIDVLLRLFKNIVKEPENAKFRKVRMSNAKIKEAIGD
                     VAGGVELLELVGFELKEENDEIWAVMDVPSEEQSILINKVVGYLEKRKTESSGSSAQV
                     MEPVAPKKIDREIRVFFSVSENVASRIEVPDSFYSLSADEIKREADLRRKKIAESQLL
                     IPRSYKEKQAKAARKRYKRSMIRVQFPDGVVLQGVFAPWEPTFALYEFVSSALKEPSL
                     QFELLDPVLVKRRVIPHTPAPGQKPITLEDEELVPSALIRFRPIETDSLVFTGLRNEL
                     LEISEPLS"
     CDS             complement(join(284851..285084,285167..285445,
                     285531..286394))
                     /gene="PUX2"
                     /locus_tag="AT2G01650"
                     /gene_synonym="plant UBX domain-containing protein 2"
                     /gene_synonym="T8O11.18"
                     /gene_synonym="T8O11_18"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP804447.1,INSD:BP667235.1,INSD:DR292870.1,
                     INSD:EG473802.1,INSD:EL137284.1,INSD:EL258852.1,
                     INSD:EL186574.1,INSD:EH900865.1,INSD:EL091383.1,
                     INSD:DR292868.1,INSD:BX840502.1,INSD:EG509642.1,
                     INSD:N37890.1,INSD:EH810151.1,INSD:EG525487.1,
                     INSD:AA650852.1,INSD:EH873707.1,INSD:BP848912.1,
                     INSD:EG473803.1,INSD:BP846487.1,INSD:EL312932.1,
                     INSD:EH864920.1,INSD:CD530492.1,INSD:EH801016.1,
                     INSD:AU239794.1,INSD:EH972947.1,INSD:DR292869.1,
                     INSD:BU635942.1,INSD:EH917648.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX818883.1,INSD:AK118911.1,INSD:AY084317.1,
                     INSD:BT005408.1,INSD:AY572782.1,INSD:BX820565.1,
                     INSD:BX820882.1,INSD:BX820048.1"
                     /note="plant UBX domain-containing protein 2 (PUX2);
                     CONTAINS InterPro DOMAIN/s: PUB domain
                     (InterPro:IPR018997), UBX (InterPro:IPR001012), PUG domain
                     (InterPro:IPR006567); BEST Arabidopsis thaliana protein
                     match is: ubiquitin-associated (UBA)/TS-N
                     domain-containing protein (TAIR:AT1G04850.1); Has 563
                     Blast hits to 563 proteins in 115 species: Archae - 0;
                     Bacteria - 15; Metazoa - 269; Fungi - 22; Plants - 176;
                     Viruses - 0; Other Eukaryotes - 81 (source: NCBI BLink)."
                     /codon_start=1
                     /product="plant UBX domain-containing protein 2"
                     /protein_id="AEC05479.1"
                     /db_xref="Araport:AT2G01650"
                     /db_xref="TAIR:AT2G01650"
                     /translation="MDDVKDKLKGFMKKVNLSSSSGKFKGQGRVLGSSSSSSAPPVNP
                     IQNRFNSSQAPNPTPRPKPNPNPLPEKPLSSSDQKISGSTRNPDHDPVRAPQDGFDPY
                     GAFITSSNRSQNGYSLSMFECPICKNPFTSEEEVSVHVESCLGDTNGDESSFEKDNND
                     NDKSEMEKLVVVYLSGKPSESSIDVLLRLFKNIVKEPENAKFRKVRMSNAKIKEAIGD
                     VAGGVELLELVGFELKEENDEIWAVMDVPSEEQSILINKVVGYLEKRKTESSGSSAQV
                     MEPVAPKKIDREIRVFFSVSENVASRIEVPDSFYSLSADEIKREADLRRKKIAESQLL
                     IPRSYKEKQAKAARKRYKRSMIRVQFPDGVVLQGVFAPWEPTFALYEFVSSALKEPSL
                     QFELLDPVLVKRRVIPHTPAPGQKPITLEDEELVPSALIRFRPIETDSLVFTGLRNEL
                     LEISEPLS"
     CDS             complement(join(285155..285445,285531..286394))
                     /gene="PUX2"
                     /locus_tag="AT2G01650"
                     /gene_synonym="plant UBX domain-containing protein 2"
                     /gene_synonym="T8O11.18"
                     /gene_synonym="T8O11_18"
                     /codon_start=1
                     /product="plant UBX domain-containing protein 2"
                     /protein_id="ANM61338.1"
                     /db_xref="Araport:AT2G01650"
                     /db_xref="TAIR:AT2G01650"
                     /translation="MDDVKDKLKGFMKKVNLSSSSGKFKGQGRVLGSSSSSSAPPVNP
                     IQNRFNSSQAPNPTPRPKPNPNPLPEKPLSSSDQKISGSTRNPDHDPVRAPQDGFDPY
                     GAFITSSNRSQNGYSLSMFECPICKNPFTSEEEVSVHVESCLGDTNGDESSFEKDNND
                     NDKSEMEKLVVVYLSGKPSESSIDVLLRLFKNIVKEPENAKFRKVRMSNAKIKEAIGD
                     VAGGVELLELVGFELKEENDEIWAVMDVPSEEQSILINKVVGYLEKRKTESSGSSAQV
                     MEPVAPKKIDREIRVFFSVSENVASRIEVPDSFYSLSADEIKREADLRRKKIAESQLL
                     IPRSYKEKQAKAARKRYKRSMIRVQFPDGVVLQGVFAPWEPTFALYEVNI"
     gene            289115..289752
                     /locus_tag="AT2G04085"
                     /db_xref="Araport:AT2G04085"
     ncRNA           289115..289752
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT2G04085"
                     /product="other RNA"
                     /db_xref="Araport:AT2G04085"
     gene            complement(289115..289465)
                     /locus_tag="AT2G04075"
                     /db_xref="Araport:AT2G04075"
     ncRNA           complement(289115..289465)
                     /ncRNA_class="lncRNA"
                     /locus_tag="AT2G04075"
                     /product="other RNA"
                     /db_xref="Araport:AT2G04075"
     gene            complement(290573..292688)
                     /gene="PDLP6"
                     /locus_tag="AT2G01660"
                     /gene_synonym="plasmodesmata-located protein 6"
                     /gene_synonym="T8O11.17"
                     /gene_synonym="T8O11_17"
                     /note="Encodes a plasmodesmal protein that may be involved
                     in the intercellular movement of molecules through the
                     plasmodesmata. The protein has two DUF26 domains and a
                     single transmembrane domain."
                     /db_xref="Araport:AT2G01660"
                     /db_xref="TAIR:AT2G01660"
     mRNA            complement(join(290573..290983,291156..291287,
                     291773..292688))
                     /gene="PDLP6"
                     /locus_tag="AT2G01660"
                     /gene_synonym="plasmodesmata-located protein 6"
                     /gene_synonym="T8O11.17"
                     /gene_synonym="T8O11_17"
                     /product="plasmodesmata-located protein 6"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AU235552.1,INSD:DR297650.1,INSD:EL224162.1,
                     INSD:DR381480.1,INSD:AV545548.1,INSD:BP827352.1,
                     INSD:AV823917.1,INSD:AV803942.1,INSD:BP793350.1,
                     INSD:BP648890.1,INSD:AV554304.1,INSD:DR297651.1,
                     INSD:DR297649.1,INSD:AU226278.1,INSD:AV785002.1,
                     INSD:BP657339.1,INSD:EL235840.1,INSD:BP840362.1,
                     INSD:DR297648.1,INSD:EL341790.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY062817.1,INSD:BX822025.1,INSD:AY086022.1,
                     INSD:BX821362.1,INSD:BX820238.1,INSD:AK227616.1"
                     /db_xref="TAIR:AT2G01660"
                     /db_xref="Araport:AT2G01660"
     mRNA            complement(join(290573..291287,291773..292688))
                     /gene="PDLP6"
                     /locus_tag="AT2G01660"
                     /gene_synonym="plasmodesmata-located protein 6"
                     /gene_synonym="T8O11.17"
                     /gene_synonym="T8O11_17"
                     /product="plasmodesmata-located protein 6"
                     /db_xref="Araport:AT2G01660"
                     /db_xref="TAIR:AT2G01660"
     mRNA            complement(join(290603..290983,291156..292624))
                     /gene="PDLP6"
                     /locus_tag="AT2G01660"
                     /gene_synonym="plasmodesmata-located protein 6"
                     /gene_synonym="T8O11.17"
                     /gene_synonym="T8O11_17"
                     /product="plasmodesmata-located protein 6"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR297651.1,INSD:DR297649.1,INSD:EL996548.1,
                     INSD:DR297650.1,INSD:AU226278.1,INSD:ES017197.1,
                     INSD:EL224162.1,INSD:BP657339.1,INSD:EL235840.1,
                     INSD:AV545548.1,INSD:BP827352.1,INSD:AV823917.1,
                     INSD:DR297648.1,INSD:BP840362.1,INSD:EL341790.1,
                     INSD:AV803942.1,INSD:BP648890.1,INSD:AV554304.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BX820946.1"
                     /db_xref="TAIR:AT2G01660"
                     /db_xref="Araport:AT2G01660"
     CDS             complement(join(290973..290983,291156..291287,
                     291773..292496))
                     /gene="PDLP6"
                     /locus_tag="AT2G01660"
                     /gene_synonym="plasmodesmata-located protein 6"
                     /gene_synonym="T8O11.17"
                     /gene_synonym="T8O11_17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AU235552.1,INSD:DR297650.1,INSD:EL224162.1,
                     INSD:DR381480.1,INSD:AV545548.1,INSD:BP827352.1,
                     INSD:AV823917.1,INSD:AV803942.1,INSD:BP793350.1,
                     INSD:BP648890.1,INSD:AV554304.1,INSD:DR297651.1,
                     INSD:DR297649.1,INSD:AU226278.1,INSD:AV785002.1,
                     INSD:BP657339.1,INSD:EL235840.1,INSD:BP840362.1,
                     INSD:DR297648.1,INSD:EL341790.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY062817.1,INSD:BX822025.1,INSD:AY086022.1,
                     INSD:BX821362.1,INSD:BX820238.1,INSD:AK227616.1"
                     /note="plasmodesmata-located protein 6 (PDLP6); CONTAINS
                     InterPro DOMAIN/s: Protein of unknown function DUF26
                     (InterPro:IPR002902); BEST Arabidopsis thaliana protein
                     match is: plasmodesmata-located protein 7
                     (TAIR:AT5G37660.2); Has 1458 Blast hits to 1310 proteins
                     in 27 species: Archae - 0; Bacteria - 0; Metazoa - 0;
                     Fungi - 0; Plants - 1458; Viruses - 0; Other Eukaryotes -
                     0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="plasmodesmata-located protein 6"
                     /protein_id="AEC05480.1"
                     /db_xref="Araport:AT2G01660"
                     /db_xref="TAIR:AT2G01660"
                     /translation="MFATKTVLFIAVVSLLGTFSSAAVDTFIYGGCSQEKYFPGSPYE
                     SNVNSLLTSFVSSASLYTYNNFTTNGISGDSSSVYGLYQCRGDLSSGSGDCARCVARA
                     VSRLGSLCAMASGGALQLEGCFVKYDNTTFLGVEDKTVVVRRCGPPVGYNSDEMTRRD
                     SVVGSLAASSGGSYRVGVSGELQGVAQCTGDLSATECQDCLMEAIGRLRTDCGGAAWG
                     DVYLAKCYARYSARGGHSRANGYGGNRNNNDDDEIEKTLAIIVGLIAGVTLLVVFLSF
                     MAKSCERGKGGK"
     CDS             complement(join(291148..291287,291773..292496))
                     /gene="PDLP6"
                     /locus_tag="AT2G01660"
                     /gene_synonym="plasmodesmata-located protein 6"
                     /gene_synonym="T8O11.17"
                     /gene_synonym="T8O11_17"
                     /codon_start=1
                     /product="plasmodesmata-located protein 6"
                     /protein_id="ANM62558.1"
                     /db_xref="Araport:AT2G01660"
                     /db_xref="TAIR:AT2G01660"
                     /translation="MFATKTVLFIAVVSLLGTFSSAAVDTFIYGGCSQEKYFPGSPYE
                     SNVNSLLTSFVSSASLYTYNNFTTNGISGDSSSVYGLYQCRGDLSSGSGDCARCVARA
                     VSRLGSLCAMASGGALQLEGCFVKYDNTTFLGVEDKTVVVRRCGPPVGYNSDEMTRRD
                     SVVGSLAASSGGSYRVGVSGELQGVAQCTGDLSATECQDCLMEAIGRLRTDCGGAAWG
                     DVYLAKCYARYSARGGHSRANGYGGNRNNNDDDEIEKTLAIIVGLIAGVTLLVVFLSF
                     MAKSCERGKGK"
     CDS             complement(291717..292496)
                     /gene="PDLP6"
                     /locus_tag="AT2G01660"
                     /gene_synonym="plasmodesmata-located protein 6"
                     /gene_synonym="T8O11.17"
                     /gene_synonym="T8O11_17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR297651.1,INSD:DR297649.1,INSD:EL996548.1,
                     INSD:DR297650.1,INSD:AU226278.1,INSD:ES017197.1,
                     INSD:EL224162.1,INSD:BP657339.1,INSD:EL235840.1,
                     INSD:AV545548.1,INSD:BP827352.1,INSD:AV823917.1,
                     INSD:DR297648.1,INSD:BP840362.1,INSD:EL341790.1,
                     INSD:AV803942.1,INSD:BP648890.1,INSD:AV554304.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BX820946.1"
                     /note="plasmodesmata-located protein 6 (PDLP6); CONTAINS
                     InterPro DOMAIN/s: Protein of unknown function DUF26
                     (InterPro:IPR002902); BEST Arabidopsis thaliana protein
                     match is: plasmodesmata-located protein 7
                     (TAIR:AT5G37660.2); Has 35333 Blast hits to 34131 proteins
                     in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
                     974; Fungi - 991; Plants - 531; Viruses - 0; Other
                     Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="plasmodesmata-located protein 6"
                     /protein_id="AEC05481.1"
                     /db_xref="Araport:AT2G01660"
                     /db_xref="TAIR:AT2G01660"
                     /translation="MFATKTVLFIAVVSLLGTFSSAAVDTFIYGGCSQEKYFPGSPYE
                     SNVNSLLTSFVSSASLYTYNNFTTNGISGDSSSVYGLYQCRGDLSSGSGDCARCVARA
                     VSRLGSLCAMASGGALQLEGCFVKYDNTTFLGVEDKTVVVRRCGPPVGYNSDEMTRRD
                     SVVGSLAASSGGSYRVGVSGELQGVAQCTGDLSATECQDCLMEAIGRLRTDCGGAAWG
                     DVYLAKCYARYSARGGHSRANGYGNVFFAPLLFISFIKIFI"
     gene            295455..295556
                     /locus_tag="AT2G01667"
                     /db_xref="Araport:AT2G01667"
                     /db_xref="TAIR:AT2G01667"
     mRNA            295455..295556
                     /locus_tag="AT2G01667"
                     /product="hypothetical protein"
                     /db_xref="TAIR:AT2G01667"
                     /db_xref="Araport:AT2G01667"
     CDS             295455..295556
                     /locus_tag="AT2G01667"
                     /note="unknown protein; Has 30201 Blast hits to 17322
                     proteins in 780 species: Archae - 12; Bacteria - 1396;
                     Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
                     Other Eukaryotes - 2996 (source: NCBI BLink)."
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AEC05482.1"
                     /db_xref="Araport:AT2G01667"
                     /db_xref="TAIR:AT2G01667"
                     /translation="MYFGMEATVESINDSGPSHRGRGHDSPPANGIV"
     gene            complement(296365..298215)
                     /gene="NUDT17"
                     /locus_tag="AT2G01670"
                     /gene_synonym="atnudt17"
                     /gene_synonym="nudix hydrolase homolog 17"
                     /gene_synonym="T8O11.16"
                     /gene_synonym="T8O11_16"
                     /db_xref="Araport:AT2G01670"
                     /db_xref="TAIR:AT2G01670"
     mRNA            complement(join(296365..297032,297124..297252,
                     297347..297430,297526..297631,297733..298215))
                     /gene="NUDT17"
                     /locus_tag="AT2G01670"
                     /gene_synonym="atnudt17"
                     /gene_synonym="nudix hydrolase homolog 17"
                     /gene_synonym="T8O11.16"
                     /gene_synonym="T8O11_16"
                     /product="nudix hydrolase homolog 17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL023033.1,INSD:DR264557.1,INSD:EG522898.1,
                     INSD:EL001887.1,INSD:EL123415.1,INSD:AV798764.1,
                     INSD:DR264554.1,INSD:EL096954.1,INSD:AA586299.1,
                     INSD:BP561292.2,INSD:EG522904.1,INSD:EG522883.1,
                     INSD:EH820495.1,INSD:EG522891.1,INSD:EL130800.1,
                     INSD:AV789523.1,INSD:DR264553.1,INSD:EL222351.1,
                     INSD:EL246932.1,INSD:EG522910.1,INSD:EH832994.1,
                     INSD:BP790151.1,INSD:EG522908.1,INSD:BP778777.1,
                     INSD:EL090963.1,INSD:EH798170.1,INSD:EH827175.1,
                     INSD:EH960342.1,INSD:EL113582.1,INSD:DR264555.1,
                     INSD:BP571547.1,INSD:AV547666.1,INSD:DR371341.1,
                     INSD:EL267983.1,INSD:DR264558.1,INSD:DR264559.1,
                     INSD:EL992994.1,INSD:EG522882.1,INSD:EH993804.1,
                     INSD:EL064877.1,INSD:AV827603.1,INSD:EL131663.1,
                     INSD:EG522909.1,INSD:DR264562.1,INSD:BP780568.1,
                     INSD:EH880933.1,INSD:EH900454.1,INSD:DR264561.1,
                     INSD:EL132479.1,INSD:EH851306.1,INSD:DR264560.1,
                     INSD:ES213263.1,INSD:EL283026.1,INSD:EG522890.1,
                     INSD:EL273222.1,INSD:EG522903.1,INSD:BP650660.1,
                     INSD:EL243195.1,INSD:CB260990.1,INSD:BP819761.1,
                     INSD:EG522893.1,INSD:EG522879.1,INSD:DR264556.1,
                     INSD:BP839817.1,INSD:EH868512.1,INSD:EG522899.1,
                     INSD:EL039171.1,INSD:EH810332.1,INSD:BP839438.1,
                     INSD:EG522877.1,INSD:AV787610.1,INSD:EL330314.1,
                     INSD:EL298638.1,INSD:EL147390.1,INSD:EH857336.1,
                     INSD:EG522902.1,INSD:EL229142.1,INSD:EG522892.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AF412103.1,INSD:AY088595.1,INSD:BX819722.1,
                     INSD:AY051030.1,INSD:AF360131.1,INSD:AF325062.1"
                     /db_xref="TAIR:AT2G01670"
                     /db_xref="Araport:AT2G01670"
     CDS             complement(join(296889..297032,297124..297252,
                     297347..297430,297526..297631,297733..297818))
                     /gene="NUDT17"
                     /locus_tag="AT2G01670"
                     /gene_synonym="atnudt17"
                     /gene_synonym="nudix hydrolase homolog 17"
                     /gene_synonym="T8O11.16"
                     /gene_synonym="T8O11_16"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL023033.1,INSD:DR264557.1,INSD:EG522898.1,
                     INSD:EL001887.1,INSD:EL123415.1,INSD:AV798764.1,
                     INSD:DR264554.1,INSD:EL096954.1,INSD:AA586299.1,
                     INSD:BP561292.2,INSD:EG522904.1,INSD:EG522883.1,
                     INSD:EH820495.1,INSD:EG522891.1,INSD:EL130800.1,
                     INSD:AV789523.1,INSD:DR264553.1,INSD:EL222351.1,
                     INSD:EL246932.1,INSD:EG522910.1,INSD:EH832994.1,
                     INSD:BP790151.1,INSD:EG522908.1,INSD:BP778777.1,
                     INSD:EL090963.1,INSD:EH798170.1,INSD:EH827175.1,
                     INSD:EH960342.1,INSD:EL113582.1,INSD:DR264555.1,
                     INSD:BP571547.1,INSD:AV547666.1,INSD:DR371341.1,
                     INSD:EL267983.1,INSD:DR264558.1,INSD:DR264559.1,
                     INSD:EL992994.1,INSD:EG522882.1,INSD:EH993804.1,
                     INSD:EL064877.1,INSD:AV827603.1,INSD:EL131663.1,
                     INSD:EG522909.1,INSD:DR264562.1,INSD:BP780568.1,
                     INSD:EH880933.1,INSD:EH900454.1,INSD:DR264561.1,
                     INSD:EL132479.1,INSD:EH851306.1,INSD:DR264560.1,
                     INSD:ES213263.1,INSD:EL283026.1,INSD:EG522890.1,
                     INSD:EL273222.1,INSD:EG522903.1,INSD:BP650660.1,
                     INSD:EL243195.1,INSD:CB260990.1,INSD:BP819761.1,
                     INSD:EG522893.1,INSD:EG522879.1,INSD:DR264556.1,
                     INSD:BP839817.1,INSD:EH868512.1,INSD:EG522899.1,
                     INSD:EL039171.1,INSD:EH810332.1,INSD:BP839438.1,
                     INSD:EG522877.1,INSD:AV787610.1,INSD:EL330314.1,
                     INSD:EL298638.1,INSD:EL147390.1,INSD:EH857336.1,
                     INSD:EG522902.1,INSD:EL229142.1,INSD:EG522892.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AF412103.1,INSD:AY088595.1,INSD:BX819722.1,
                     INSD:AY051030.1,INSD:AF360131.1,INSD:AF325062.1"
                     /note="nudix hydrolase homolog 17 (NUDT17); FUNCTIONS IN:
                     hydrolase activity; INVOLVED IN: biological_process
                     unknown; EXPRESSED IN: 23 plant structures; EXPRESSED
                     DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
                     NUDIX hydrolase domain-like (InterPro:IPR015797), NUDIX
                     hydrolase domain (InterPro:IPR000086); BEST Arabidopsis
                     thaliana protein match is: nudix hydrolase homolog 18
                     (TAIR:AT1G14860.1); Has 1036 Blast hits to 1035 proteins
                     in 308 species: Archae - 0; Bacteria - 361; Metazoa - 217;
                     Fungi - 119; Plants - 237; Viruses - 0; Other Eukaryotes -
                     102 (source: NCBI BLink)."
                     /codon_start=1
                     /product="nudix hydrolase homolog 17"
                     /protein_id="AEC05483.1"
                     /db_xref="Araport:AT2G01670"
                     /db_xref="TAIR:AT2G01670"
                     /translation="MGVEKMVCLASRTGRQFQRYNKGRRQVVGCVPYRFKLSNDGKIS
                     DEVEVLVISSQKGHALMFPKGGWELDESVEEAASRECLEEAGVLGNVEHQLGKWDFLS
                     KSRGTYYEGLMFPMLVTEQLELWPEQHVRQRIWMNVTEAREACRDWWMKEALDVLVER
                     LSSPMNQPKEEKTMSISIETMC"
     gene            306251..309267
                     /locus_tag="AT2G01680"
                     /gene_synonym="T8O11.15"
                     /gene_synonym="T8O11_15"
                     /db_xref="Araport:AT2G01680"
                     /db_xref="TAIR:AT2G01680"
     mRNA            join(306251..306918,307056..307465,307561..309267)
                     /locus_tag="AT2G01680"
                     /gene_synonym="T8O11.15"
                     /gene_synonym="T8O11_15"
                     /product="Ankyrin repeat family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL257768.1,INSD:EH809045.1,INSD:EH887419.1,
                     INSD:BP865586.1,INSD:DR352761.1,INSD:EH922934.1,
                     INSD:ES046165.1,INSD:EL152085.1,INSD:DR199184.1,
                     INSD:ES104100.1,INSD:EH881446.1,INSD:DR199182.1,
                     INSD:EL123701.1,INSD:AV441879.1,INSD:EH870840.1,
                     INSD:ES127164.1,INSD:AV439689.1,INSD:AV823873.1,
                     INSD:EL172753.1,INSD:AV561448.1,INSD:CD530898.1,
                     INSD:BP596360.1,INSD:EH925493.1,INSD:DR352760.1,
                     INSD:AV558991.1,INSD:EH952514.1,INSD:AA728512.1,
                     INSD:DR352759.1,INSD:EH919211.1,INSD:AI996553.1,
                     INSD:AV557218.1,INSD:ES206135.1,INSD:R64963.1,
                     INSD:EL178523.1,INSD:EH866452.1,INSD:BP813134.1,
                     INSD:EL038103.1,INSD:DR199180.1,INSD:BP866101.1,
                     INSD:EL042489.1,INSD:DR352757.1,INSD:EH986505.1,
                     INSD:BP846822.1,INSD:DR199186.1,INSD:DR352756.1,
                     INSD:DR199187.1,INSD:EL224858.1,INSD:T43424.1,
                     INSD:EH848357.1,INSD:EG466371.1,INSD:AV784945.1,
                     INSD:CB259678.1,INSD:AI993199.1,INSD:AV787218.1,
                     INSD:T46195.1,INSD:DR352758.1,INSD:DR380302.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AK226418.1,INSD:AK220719.1,INSD:AY084921.1"
                     /db_xref="TAIR:AT2G01680"
                     /db_xref="Araport:AT2G01680"
     CDS             join(306597..306918,307056..307465,307561..308427)
                     /locus_tag="AT2G01680"
                     /gene_synonym="T8O11.15"
                     /gene_synonym="T8O11_15"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL257768.1,INSD:EH809045.1,INSD:EH887419.1,
                     INSD:BP865586.1,INSD:DR352761.1,INSD:EH922934.1,
                     INSD:ES046165.1,INSD:EL152085.1,INSD:DR199184.1,
                     INSD:ES104100.1,INSD:EH881446.1,INSD:DR199182.1,
                     INSD:EL123701.1,INSD:AV441879.1,INSD:EH870840.1,
                     INSD:ES127164.1,INSD:AV439689.1,INSD:AV823873.1,
                     INSD:EL172753.1,INSD:AV561448.1,INSD:CD530898.1,
                     INSD:BP596360.1,INSD:EH925493.1,INSD:DR352760.1,
                     INSD:AV558991.1,INSD:EH952514.1,INSD:AA728512.1,
                     INSD:DR352759.1,INSD:EH919211.1,INSD:AI996553.1,
                     INSD:AV557218.1,INSD:ES206135.1,INSD:R64963.1,
                     INSD:EL178523.1,INSD:EH866452.1,INSD:BP813134.1,
                     INSD:EL038103.1,INSD:DR199180.1,INSD:BP866101.1,
                     INSD:EL042489.1,INSD:DR352757.1,INSD:EH986505.1,
                     INSD:BP846822.1,INSD:DR199186.1,INSD:DR352756.1,
                     INSD:DR199187.1,INSD:EL224858.1,INSD:T43424.1,
                     INSD:EH848357.1,INSD:EG466371.1,INSD:AV784945.1,
                     INSD:CB259678.1,INSD:AI993199.1,INSD:AV787218.1,
                     INSD:T46195.1,INSD:DR352758.1,INSD:DR380302.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AK226418.1,INSD:AK220719.1,INSD:AY084921.1"
                     /note="Ankyrin repeat family protein; INVOLVED IN:
                     biological_process unknown; LOCATED IN: plasma membrane;
                     EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13
                     growth stages; CONTAINS InterPro DOMAIN/s: Ankyrin
                     repeat-containing domain (InterPro:IPR020683), Ankyrin
                     repeat (InterPro:IPR002110); BEST Arabidopsis thaliana
                     protein match is: Ankyrin repeat family protein
                     (TAIR:AT2G31820.1); Has 36872 Blast hits to 17947 proteins
                     in 711 species: Archae - 48; Bacteria - 2509; Metazoa -
                     18623; Fungi - 3211; Plants - 2983; Viruses - 164; Other
                     Eukaryotes - 9334 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Ankyrin repeat family protein"
                     /protein_id="AEC05484.1"
                     /db_xref="Araport:AT2G01680"
                     /db_xref="TAIR:AT2G01680"
                     /translation="MEMKQMKFLTHQAFFSSVRSGDLSQLQQLVDNLTGDELIDESSP
                     CSAVAELMSVQNDAGETAVYISAAENLEDIFRYLIRFSSLETVKIRSKSDMNAFHVAA
                     KRGHLGIVKELLRLWPELCRICDASNTSPLYAAAVQDHLEIVNAMLDVDPSCAMIVRK
                     NGKTSLHTAGRYGLLRIVKALIEKDAAIVGVKDKKGQTALHMAVKGRSLEVVEEILQA
                     DYTILNERDRKGNTALHIATRKARPQITSLLLTFTAIEVNAINNQKETAMDLADKLQY
                     SESALEINEALVEAGAKHGRFIGREDEARALKRAVSDIKHEVQSQLLQNEKTNRRVSG
                     IAKELRKLHREAVQNTTNSITVVAVLFASIAFLAIFNLPGQYFTEGSHVGQANIAGRT
                     GFRVFCLLNATSLFISLAVVVVQITLVAWDTRAQKKVVSVVNKLMWAACACTFGAFLA
                     IAFAVVGKGNSWMAITITLLGAPILVGTLASMCYFVFRQRFRSGNDSQRRIRRGSSKS
                     FSWSYSHHVSDFEDESDFEKIIAL"
     gene            complement(308693..313805)
                     /locus_tag="AT2G01690"
                     /gene_synonym="T8O11.14"
                     /gene_synonym="T8O11_14"
                     /db_xref="Araport:AT2G01690"
                     /db_xref="TAIR:AT2G01690"
     mRNA            complement(join(308693..309308,309472..309759,
                     309861..309929,310009..310137,310225..310386,
                     310564..310684,310766..310881,311007..311072,
                     311164..311245,311332..311423,311515..311622,
                     311740..311826,311992..312086,312184..312326,
                     312421..312449,312533..312652,312738..312827,
                     313014..313079,313197..313310,313410..313805))
                     /locus_tag="AT2G01690"
                     /gene_synonym="T8O11.14"
                     /gene_synonym="T8O11_14"
                     /product="ARM repeat superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV523421.1,INSD:EL300672.1,INSD:ES131909.1,
                     INSD:BE524151.1,INSD:BP782635.1,INSD:BP791717.1,
                     INSD:EH923294.1,INSD:AV826331.1,INSD:ES150598.1,
                     INSD:AV565750.1,INSD:EH935277.1,INSD:BP825429.1,
                     INSD:BP605189.1,INSD:EH799878.1,INSD:BP779287.1,
                     INSD:EH871951.1,INSD:AV548309.1,INSD:EG525643.1,
                     INSD:ES058430.1,INSD:EL001203.1,INSD:AV810768.1,
                     INSD:ES207052.1,INSD:AV795875.1,INSD:AV523475.1,
                     INSD:BP638946.1,INSD:EL014876.1,INSD:ES052702.1,
                     INSD:ES208105.1,INSD:EL993573.1,INSD:EL205158.1,
                     INSD:EL323105.1,INSD:ES091590.1,INSD:ES021353.1,
                     INSD:AA586280.1,INSD:AV560054.1,INSD:T20984.1,
                     INSD:ES108246.1,INSD:BP817129.1,INSD:BP780650.1,
                     INSD:AV790861.1,INSD:ES193167.1,INSD:AV529159.1,
                     INSD:BX841436.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY080803.1,INSD:AK226840.1,INSD:AY056142.1"
                     /db_xref="TAIR:AT2G01690"
                     /db_xref="Araport:AT2G01690"
     mRNA            complement(join(308702..309308,309472..309759,
                     309861..309929,310009..310137,310225..310386,
                     310564..310684,310766..310881,311007..311072,
                     311164..311245,311332..311423,311515..311622,
                     311740..311826,311992..312086,312184..312326,
                     312421..312452,312533..312652,312738..312827,
                     313014..313079,313197..313310,313410..313805))
                     /locus_tag="AT2G01690"
                     /gene_synonym="T8O11.14"
                     /gene_synonym="T8O11_14"
                     /product="ARM repeat superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV523421.1,INSD:EL300672.1,INSD:ES131909.1,
                     INSD:BE524151.1,INSD:BP782635.1,INSD:BP791717.1,
                     INSD:EH923294.1,INSD:AV826331.1,INSD:ES150598.1,
                     INSD:AV565750.1,INSD:EH935277.1,INSD:BP825429.1,
                     INSD:BP605189.1,INSD:EH799878.1,INSD:BP779287.1,
                     INSD:EH871951.1,INSD:AV548309.1,INSD:ES058430.1,
                     INSD:EL001203.1,INSD:ES207052.1,INSD:AV810768.1,
                     INSD:AV795875.1,INSD:AV523475.1,INSD:BP638946.1,
                     INSD:EL014876.1,INSD:ES052702.1,INSD:ES208105.1,
                     INSD:EL993573.1,INSD:EL205158.1,INSD:EL323105.1,
                     INSD:ES091590.1,INSD:ES021353.1,INSD:AA586280.1,
                     INSD:AV560054.1,INSD:T20984.1,INSD:ES108246.1,
                     INSD:BP817129.1,INSD:BP780650.1,INSD:AV790861.1,
                     INSD:ES193167.1,INSD:AV529159.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY080803.1,INSD:AK226840.1"
                     /db_xref="TAIR:AT2G01690"
                     /db_xref="Araport:AT2G01690"
     CDS             complement(join(309144..309308,309472..309759,
                     309861..309929,310009..310137,310225..310386,
                     310564..310684,310766..310881,311007..311072,
                     311164..311245,311332..311423,311515..311622,
                     311740..311826,311992..312086,312184..312326,
                     312421..312449,312533..312652,312738..312827,
                     313014..313079,313197..313310,313410..313499))
                     /locus_tag="AT2G01690"
                     /gene_synonym="T8O11.14"
                     /gene_synonym="T8O11_14"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV523421.1,INSD:EL300672.1,INSD:ES131909.1,
                     INSD:BE524151.1,INSD:BP782635.1,INSD:BP791717.1,
                     INSD:EH923294.1,INSD:AV826331.1,INSD:ES150598.1,
                     INSD:AV565750.1,INSD:EH935277.1,INSD:BP825429.1,
                     INSD:BP605189.1,INSD:EH799878.1,INSD:BP779287.1,
                     INSD:EH871951.1,INSD:AV548309.1,INSD:EG525643.1,
                     INSD:ES058430.1,INSD:EL001203.1,INSD:AV810768.1,
                     INSD:ES207052.1,INSD:AV795875.1,INSD:AV523475.1,
                     INSD:BP638946.1,INSD:EL014876.1,INSD:ES052702.1,
                     INSD:ES208105.1,INSD:EL993573.1,INSD:EL205158.1,
                     INSD:EL323105.1,INSD:ES091590.1,INSD:ES021353.1,
                     INSD:AA586280.1,INSD:AV560054.1,INSD:T20984.1,
                     INSD:ES108246.1,INSD:BP817129.1,INSD:BP780650.1,
                     INSD:AV790861.1,INSD:ES193167.1,INSD:AV529159.1,
                     INSD:BX841436.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY080803.1,INSD:AK226840.1,INSD:AY056142.1"
                     /note="ARM repeat superfamily protein; FUNCTIONS IN:
                     binding; INVOLVED IN: biological_process unknown; LOCATED
                     IN: plasma membrane; EXPRESSED IN: 25 plant structures;
                     EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
                     DOMAIN/s: HEAT (InterPro:IPR000357), Armadillo-like
                     helical (InterPro:IPR011989), Protein of unknown function
                     DUF3434 (InterPro:IPR021841), HEAT, type 2
                     (InterPro:IPR021133), Armadillo-type fold
                     (InterPro:IPR016024); Has 6269 Blast hits to 4446 proteins
                     in 336 species: Archae - 2; Bacteria - 171; Metazoa -
                     2181; Fungi - 947; Plants - 235; Viruses - 11; Other
                     Eukaryotes - 2722 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ARM repeat superfamily protein"
                     /protein_id="AEC05485.1"
                     /db_xref="Araport:AT2G01690"
                     /db_xref="TAIR:AT2G01690"
                     /translation="MSDALSAIPAAVHRNLSDKLYEKRKNAALELENIVKNLTSSGDH
                     DKISKVIEMLIKEFAKSPQANHRKGGLIGLAAVTVGLSTEAAQYLEQIVPPVINSFSD
                     QDSRVRYYACEALYNIAKVVRGDFIIFFNKIFDALCKLSADSDANVQSAAHLLDRLVK
                     DIVTESDQFSIEEFIPLLKERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDG
                     LFNMLSDSSHEIRQQADSALSEFLQEIKNSPSVDYGRMAEILVQRAASPDEFTRLTAI
                     TWINEFVKLGGDQLVRYYADILGAILPCISDKEEKIRVVARETNEELRSIHVEPSDGF
                     DVGAILSVARRQLSSEFEATRIEALNWISTLLNKHRTEVLCFLNDIFDTLLKALSDSS
                     DDVVLLVLEVHAGVAKDPQHFRQLIVFLVHNFRADNSLLERRGALIVRRMCVLLDAER
                     VYRELSTILEGEDNLDFASTMVQALNLILLTSPELSKLRELLKGSLVNREGKELFVAL
                     YTSWCHSPMAIISLCLLAQAYQHASVVIQSLVEEDINVKFLVQLDKLIRLLETPIFTY
                     LRLQLLEPGRYTWLLKTLYGLLMLLPQQSAAFKILRTRLKTVPTYSFSTGNQIGRATS
                     GVPFSQYKHQNEDGDLEDDNINSSHQGINFAVRLQQFENVQNLHRGQARTRVNYSYHS
                     SSSSTSKEVRRSEEQQQQQQQQQQQQQQQQRPPPSSTSSSVADNNRPPSRTSRKGPGQ
                     LQL"
     CDS             complement(join(309144..309308,309472..309759,
                     309861..309929,310009..310137,310225..310386,
                     310564..310684,310766..310881,311007..311072,
                     311164..311245,311332..311423,311515..311622,
                     311740..311826,311992..312086,312184..312326,
                     312421..312452,312533..312652,312738..312827,
                     313014..313079,313197..313310,313410..313499))
                     /locus_tag="AT2G01690"
                     /gene_synonym="T8O11.14"
                     /gene_synonym="T8O11_14"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV523421.1,INSD:EL300672.1,INSD:ES131909.1,
                     INSD:BE524151.1,INSD:BP782635.1,INSD:BP791717.1,
                     INSD:EH923294.1,INSD:AV826331.1,INSD:ES150598.1,
                     INSD:AV565750.1,INSD:EH935277.1,INSD:BP825429.1,
                     INSD:BP605189.1,INSD:EH799878.1,INSD:BP779287.1,
                     INSD:EH871951.1,INSD:AV548309.1,INSD:ES058430.1,
                     INSD:EL001203.1,INSD:ES207052.1,INSD:AV810768.1,
                     INSD:AV795875.1,INSD:AV523475.1,INSD:BP638946.1,
                     INSD:EL014876.1,INSD:ES052702.1,INSD:ES208105.1,
                     INSD:EL993573.1,INSD:EL205158.1,INSD:EL323105.1,
                     INSD:ES091590.1,INSD:ES021353.1,INSD:AA586280.1,
                     INSD:AV560054.1,INSD:T20984.1,INSD:ES108246.1,
                     INSD:BP817129.1,INSD:BP780650.1,INSD:AV790861.1,
                     INSD:ES193167.1,INSD:AV529159.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY080803.1,INSD:AK226840.1"
                     /note="ARM repeat superfamily protein; FUNCTIONS IN:
                     binding; INVOLVED IN: biological_process unknown; LOCATED
                     IN: plasma membrane; EXPRESSED IN: 25 plant structures;
                     EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
                     DOMAIN/s: HEAT (InterPro:IPR000357), Armadillo-like
                     helical (InterPro:IPR011989), Protein of unknown function
                     DUF3434 (InterPro:IPR021841), HEAT, type 2
                     (InterPro:IPR021133), Armadillo-type fold
                     (InterPro:IPR016024); Has 35333 Blast hits to 34131
                     proteins in 2444 species: Archae - 798; Bacteria - 22429;
                     Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
                     Other Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ARM repeat superfamily protein"
                     /protein_id="AEC05486.1"
                     /db_xref="Araport:AT2G01690"
                     /db_xref="TAIR:AT2G01690"
                     /translation="MSDALSAIPAAVHRNLSDKLYEKRKNAALELENIVKNLTSSGDH
                     DKISKVIEMLIKEFAKSPQANHRKGGLIGLAAVTVGLSTEAAQYLEQIVPPVINSFSD
                     QDSRVRYYACEALYNIAKVVRGDFIIFFNKIFDALCKLSADSDANVQSAAHLLDRLVK
                     QDIVTESDQFSIEEFIPLLKERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLD
                     GLFNMLSDSSHEIRQQADSALSEFLQEIKNSPSVDYGRMAEILVQRAASPDEFTRLTA
                     ITWINEFVKLGGDQLVRYYADILGAILPCISDKEEKIRVVARETNEELRSIHVEPSDG
                     FDVGAILSVARRQLSSEFEATRIEALNWISTLLNKHRTEVLCFLNDIFDTLLKALSDS
                     SDDVVLLVLEVHAGVAKDPQHFRQLIVFLVHNFRADNSLLERRGALIVRRMCVLLDAE
                     RVYRELSTILEGEDNLDFASTMVQALNLILLTSPELSKLRELLKGSLVNREGKELFVA
                     LYTSWCHSPMAIISLCLLAQAYQHASVVIQSLVEEDINVKFLVQLDKLIRLLETPIFT
                     YLRLQLLEPGRYTWLLKTLYGLLMLLPQQSAAFKILRTRLKTVPTYSFSTGNQIGRAT
                     SGVPFSQYKHQNEDGDLEDDNINSSHQGINFAVRLQQFENVQNLHRGQARTRVNYSYH
                     SSSSSTSKEVRRSEEQQQQQQQQQQQQQQQQRPPPSSTSSSVADNNRPPSRTSRKGPG
                     QLQL"
     gene            complement(314844..315158)
                     /locus_tag="AT2G01700"
                     /gene_synonym="T8O11.13"
                     /gene_synonym="T8O11_13"
                     /pseudo
                     /db_xref="Araport:AT2G01700"
                     /db_xref="TAIR:AT2G01700"
     mRNA            complement(<314844..>315158)
                     /locus_tag="AT2G01700"
                     /gene_synonym="T8O11.13"
                     /gene_synonym="T8O11_13"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="Araport:AT2G01700"
                     /db_xref="TAIR:AT2G01700"
     gene            315648..316993
                     /locus_tag="AT2G01710"
                     /gene_synonym="T8O11.12"
                     /gene_synonym="T8O11_12"
                     /db_xref="Araport:AT2G01710"
                     /db_xref="TAIR:AT2G01710"
     mRNA            315648..316993
                     /locus_tag="AT2G01710"
                     /gene_synonym="T8O11.12"
                     /gene_synonym="T8O11_12"
                     /product="Chaperone DnaJ-domain superfamily protein"
                     /db_xref="Araport:AT2G01710"
                     /db_xref="TAIR:AT2G01710"
     CDS             315704..316771
                     /locus_tag="AT2G01710"
                     /gene_synonym="T8O11.12"
                     /gene_synonym="T8O11_12"
                     /codon_start=1
                     /product="Chaperone DnaJ-domain superfamily protein"
                     /protein_id="ANM63225.1"
                     /db_xref="Araport:AT2G01710"
                     /db_xref="TAIR:AT2G01710"
                     /translation="MLLFFFPRPFLHTANQSLVSSSLVEAIIFRSAHHFSAIADGRRK
                     MGDNNPNRSEAERLLGIAEKLLESRDLNGSKEFAILAQETEPLLEGTDQILAVVDVLL
                     SSAPENRIKNQPNWYKILQIEDLTESSTDNDLIKKQYRRLALLLHPDKNRFPFADQAF
                     RFVLDAWEVLSTPTKKSQFDGDLNLIFTKVNLNTQKSKKKTTTNEKMSTFWTACPYCY
                     SLHEYPRVYQEYCIRCQNCQRAFHAASIPQLPPLIPGKDEYYCCWGFFPMGFVGGKGG
                     EAAIANGVDAAKFPNWMPPVFSSGGVAAPPSGNGVSFDGWSGGAAKRDNEAVRSNNGV
                     GVNSDGTPKKRGRGRPKKNPV"
     mRNA            315712..316993
                     /locus_tag="AT2G01710"
                     /gene_synonym="T8O11.12"
                     /gene_synonym="T8O11_12"
                     /product="Chaperone DnaJ-domain superfamily protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL254229.1,INSD:EL991484.1,INSD:Z17511.1,
                     INSD:EH798726.1,INSD:AV566075.1,INSD:EH879403.1,
                     INSD:EL322522.1,INSD:AV522251.1,INSD:EH827186.1,
                     INSD:AI995302.1,INSD:ES066237.1,INSD:EG528254.1,
                     INSD:EL006107.1,INSD:ES182777.1,INSD:AV522252.1,
                     INSD:EG528281.1,INSD:EL217739.1,INSD:EL121895.1,
                     INSD:EL338883.1,INSD:BP567641.1,INSD:BE845353.1,
                     INSD:DR193061.1,INSD:DR193059.1,INSD:ES199727.1,
                     INSD:EH889164.1,INSD:EL262892.1,INSD:DR193062.1,
                     INSD:EH919059.1,INSD:DR193060.1,INSD:EG439613.1,
                     INSD:BP810428.1,INSD:ES058175.1,INSD:EH834885.1,
                     INSD:EG518512.1,INSD:BP615176.1,INSD:DR373956.1,
                     INSD:EH833155.1,INSD:AV788141.1,INSD:DR372997.1,
                     INSD:AV563900.1,INSD:EH846901.1,INSD:EH927186.1,
                     INSD:EH838199.1,INSD:BP868091.1,INSD:BP571454.1,
                     INSD:EG439612.1,INSD:EL308287.1,INSD:EH849390.1,
                     INSD:AV526978.1,INSD:EL309394.1,INSD:EL042094.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY085868.1,INSD:AJ276763.1,INSD:AY052228.1,
                     INSD:AY139811.1"
                     /db_xref="TAIR:AT2G01710"
                     /db_xref="Araport:AT2G01710"
     CDS             315836..316771
                     /locus_tag="AT2G01710"
                     /gene_synonym="T8O11.12"
                     /gene_synonym="T8O11_12"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL254229.1,INSD:EL991484.1,INSD:Z17511.1,
                     INSD:EH798726.1,INSD:AV566075.1,INSD:EH879403.1,
                     INSD:EL322522.1,INSD:AV522251.1,INSD:EH827186.1,
                     INSD:AI995302.1,INSD:ES066237.1,INSD:EG528254.1,
                     INSD:EL006107.1,INSD:ES182777.1,INSD:AV522252.1,
                     INSD:EG528281.1,INSD:EL217739.1,INSD:EL121895.1,
                     INSD:EL338883.1,INSD:BP567641.1,INSD:BE845353.1,
                     INSD:DR193061.1,INSD:DR193059.1,INSD:ES199727.1,
                     INSD:EH889164.1,INSD:EL262892.1,INSD:DR193062.1,
                     INSD:EH919059.1,INSD:DR193060.1,INSD:EG439613.1,
                     INSD:BP810428.1,INSD:ES058175.1,INSD:EH834885.1,
                     INSD:EG518512.1,INSD:BP615176.1,INSD:DR373956.1,
                     INSD:EH833155.1,INSD:AV788141.1,INSD:DR372997.1,
                     INSD:AV563900.1,INSD:EH846901.1,INSD:EH927186.1,
                     INSD:EH838199.1,INSD:BP868091.1,INSD:BP571454.1,
                     INSD:EG439612.1,INSD:EL308287.1,INSD:EH849390.1,
                     INSD:AV526978.1,INSD:EL309394.1,INSD:EL042094.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY085868.1,INSD:AJ276763.1,INSD:AY052228.1,
                     INSD:AY139811.1"
                     /note="Chaperone DnaJ-domain superfamily protein;
                     FUNCTIONS IN: unfolded protein binding, heat shock protein
                     binding; INVOLVED IN: protein folding; LOCATED IN:
                     cellular_component unknown; EXPRESSED IN: 22 plant
                     structures; EXPRESSED DURING: 13 growth stages; CONTAINS
                     InterPro DOMAIN/s: Molecular chaperone, heat shock
                     protein, Hsp40, DnaJ (InterPro:IPR015609), Heat shock
                     protein DnaJ, N-terminal (InterPro:IPR001623), Heat shock
                     protein DnaJ (InterPro:IPR003095); BEST Arabidopsis
                     thaliana protein match is: Chaperone DnaJ-domain
                     superfamily protein (TAIR:AT5G64360.1); Has 8537 Blast
                     hits to 8496 proteins in 1861 species: Archae - 67;
                     Bacteria - 3520; Metazoa - 1920; Fungi - 549; Plants -
                     1113; Viruses - 8; Other Eukaryotes - 1360 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="Chaperone DnaJ-domain superfamily protein"
                     /protein_id="AEC05487.1"
                     /db_xref="Araport:AT2G01710"
                     /db_xref="TAIR:AT2G01710"
                     /translation="MGDNNPNRSEAERLLGIAEKLLESRDLNGSKEFAILAQETEPLL
                     EGTDQILAVVDVLLSSAPENRIKNQPNWYKILQIEDLTESSTDNDLIKKQYRRLALLL
                     HPDKNRFPFADQAFRFVLDAWEVLSTPTKKSQFDGDLNLIFTKVNLNTQKSKKKTTTN
                     EKMSTFWTACPYCYSLHEYPRVYQEYCIRCQNCQRAFHAASIPQLPPLIPGKDEYYCC
                     WGFFPMGFVGGKGGEAAIANGVDAAKFPNWMPPVFSSGGVAAPPSGNGVSFDGWSGGA
                     AKRDNEAVRSNNGVGVNSDGTPKKRGRGRPKKNPV"
     gene            complement(317030..320308)
                     /locus_tag="AT2G01720"
                     /gene_synonym="T8O11.11"
                     /gene_synonym="T8O11_11"
                     /db_xref="Araport:AT2G01720"
                     /db_xref="TAIR:AT2G01720"
     mRNA            complement(join(317030..317318,317524..317613,
                     317701..317769,317856..318035,318185..318332,
                     318611..319242,319531..319575,319912..320024,
                     320112..320308))
                     /locus_tag="AT2G01720"
                     /gene_synonym="T8O11.11"
                     /gene_synonym="T8O11_11"
                     /product="Ribophorin I"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL002655.1,INSD:ES174632.1,INSD:AV822938.1,
                     INSD:ES151180.1,INSD:ES205659.1,INSD:ES112391.1,
                     INSD:EH849546.1,INSD:ES204377.1,INSD:ES205711.1,
                     INSD:BP611123.1,INSD:DR367976.1,INSD:EH984614.1,
                     INSD:ES116010.1,INSD:EH895597.1,INSD:BP819538.1,
                     INSD:EG478160.1,INSD:EL981167.1,INSD:EL122975.1,
                     INSD:AV541135.1,INSD:ES144135.1,INSD:BP645957.1,
                     INSD:EL975103.1,INSD:ES055903.1,INSD:ES128069.1,
                     INSD:EH903484.1,INSD:BP610859.1,INSD:EH985267.1,
                     INSD:EG505035.1,INSD:EH957047.1,INSD:EH935618.1,
                     INSD:EL120931.1,INSD:EH886744.1,INSD:BE524466.1,
                     INSD:AV811631.1,INSD:BP574693.1,INSD:DR367972.1,
                     INSD:EH948492.1,INSD:EL210484.1,INSD:ES203802.1,
                     INSD:EH937183.1,INSD:ES179571.1,INSD:ES037583.1,
                     INSD:EG478159.1,INSD:EH884377.1,INSD:EL989369.1,
                     INSD:EL979474.1,INSD:BP610115.1,INSD:EL277333.1,
                     INSD:EL113590.1,INSD:BP603082.1,INSD:ES062439.1,
                     INSD:EH921365.1,INSD:AI996175.1,INSD:AV567346.1,
                     INSD:T42928.1,INSD:ES177367.1,INSD:AV534511.1,
                     INSD:EL181802.1,INSD:EH858598.1,INSD:EL295552.1,
                     INSD:ES135897.1,INSD:BP798951.1,INSD:DR367974.1,
                     INSD:ES166845.1,INSD:EL274140.1,INSD:EL210338.1,
                     INSD:DR367975.1,INSD:AV556779.1,INSD:BP592422.1,
                     INSD:EL162660.1,INSD:DR367968.1,INSD:ES051148.1,
                     INSD:ES215195.1,INSD:BP570480.1,INSD:EL053416.1,
                     INSD:EH902732.1,INSD:ES186416.1,INSD:BP797641.1,
                     INSD:BP603109.1,INSD:ES177660.1,INSD:BX840713.1,
                     INSD:EL089176.1,INSD:EL061308.1,INSD:AV551932.1,
                     INSD:EL249666.1,INSD:ES128188.1,INSD:DR367969.1,
                     INSD:AV563598.1,INSD:EL127941.1,INSD:EL129419.1,
                     INSD:DR367973.1,INSD:ES161598.1,INSD:EL286327.1,
                     INSD:EH880768.1,INSD:EH893832.1,INSD:BP613967.1,
                     INSD:AV783815.1,INSD:ES145832.1,INSD:EL980349.1,
                     INSD:DR383180.1,INSD:BE526223.1,INSD:ES176925.1,
                     INSD:DR367970.1,INSD:AV532181.1,INSD:DR367971.1,
                     INSD:EH826684.1,INSD:BP804652.1,INSD:ES165925.1,
                     INSD:EL313580.1,INSD:EL146077.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820297.1,INSD:BX820629.1,INSD:BX819793.1,
                     INSD:BX820534.1,INSD:BT022017.1,INSD:AK226319.1"
                     /db_xref="TAIR:AT2G01720"
                     /db_xref="Araport:AT2G01720"
     CDS             complement(join(317193..317318,317524..317613,
                     317701..317769,317856..318035,318185..318332,
                     318611..319242,319531..319575,319912..320016))
                     /locus_tag="AT2G01720"
                     /gene_synonym="T8O11.11"
                     /gene_synonym="T8O11_11"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL002655.1,INSD:ES174632.1,INSD:AV822938.1,
                     INSD:ES151180.1,INSD:ES205659.1,INSD:ES112391.1,
                     INSD:EH849546.1,INSD:ES204377.1,INSD:ES205711.1,
                     INSD:BP611123.1,INSD:DR367976.1,INSD:EH984614.1,
                     INSD:ES116010.1,INSD:EH895597.1,INSD:BP819538.1,
                     INSD:EG478160.1,INSD:EL981167.1,INSD:EL122975.1,
                     INSD:AV541135.1,INSD:ES144135.1,INSD:BP645957.1,
                     INSD:EL975103.1,INSD:ES055903.1,INSD:ES128069.1,
                     INSD:EH903484.1,INSD:BP610859.1,INSD:EH985267.1,
                     INSD:EG505035.1,INSD:EH957047.1,INSD:EH935618.1,
                     INSD:EL120931.1,INSD:EH886744.1,INSD:BE524466.1,
                     INSD:AV811631.1,INSD:BP574693.1,INSD:DR367972.1,
                     INSD:EH948492.1,INSD:EL210484.1,INSD:ES203802.1,
                     INSD:EH937183.1,INSD:ES179571.1,INSD:ES037583.1,
                     INSD:EG478159.1,INSD:EH884377.1,INSD:EL989369.1,
                     INSD:EL979474.1,INSD:BP610115.1,INSD:EL277333.1,
                     INSD:EL113590.1,INSD:BP603082.1,INSD:ES062439.1,
                     INSD:EH921365.1,INSD:AI996175.1,INSD:AV567346.1,
                     INSD:T42928.1,INSD:ES177367.1,INSD:AV534511.1,
                     INSD:EL181802.1,INSD:EH858598.1,INSD:EL295552.1,
                     INSD:ES135897.1,INSD:BP798951.1,INSD:DR367974.1,
                     INSD:ES166845.1,INSD:EL274140.1,INSD:EL210338.1,
                     INSD:DR367975.1,INSD:AV556779.1,INSD:BP592422.1,
                     INSD:EL162660.1,INSD:DR367968.1,INSD:ES051148.1,
                     INSD:ES215195.1,INSD:BP570480.1,INSD:EL053416.1,
                     INSD:EH902732.1,INSD:ES186416.1,INSD:BP797641.1,
                     INSD:BP603109.1,INSD:ES177660.1,INSD:BX840713.1,
                     INSD:EL089176.1,INSD:EL061308.1,INSD:AV551932.1,
                     INSD:EL249666.1,INSD:ES128188.1,INSD:DR367969.1,
                     INSD:AV563598.1,INSD:EL127941.1,INSD:EL129419.1,
                     INSD:DR367973.1,INSD:ES161598.1,INSD:EL286327.1,
                     INSD:EH880768.1,INSD:EH893832.1,INSD:BP613967.1,
                     INSD:AV783815.1,INSD:ES145832.1,INSD:EL980349.1,
                     INSD:DR383180.1,INSD:BE526223.1,INSD:ES176925.1,
                     INSD:DR367970.1,INSD:AV532181.1,INSD:DR367971.1,
                     INSD:EH826684.1,INSD:BP804652.1,INSD:ES165925.1,
                     INSD:EL313580.1,INSD:EL146077.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX820297.1,INSD:BX820629.1,INSD:BX819793.1,
                     INSD:BX820534.1,INSD:BT022017.1,INSD:AK226319.1"
                     /note="Ribophorin I; FUNCTIONS IN: oligosaccharyl
                     transferase activity,
                     dolichyl-diphosphooligosaccharide-protein glycotransferase
                     activity; INVOLVED IN: protein amino acid glycosylation;
                     LOCATED IN: endoplasmic reticulum, plasma membrane,
                     plant-type cell wall; EXPRESSED IN: 25 plant structures;
                     EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
                     DOMAIN/s: Ribophorin I (InterPro:IPR007676); BEST
                     Arabidopsis thaliana protein match is: Ribophorin I
                     (TAIR:AT1G76400.1); Has 386 Blast hits to 386 proteins in
                     178 species: Archae - 0; Bacteria - 0; Metazoa - 143;
                     Fungi - 127; Plants - 63; Viruses - 0; Other Eukaryotes -
                     53 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Ribophorin I"
                     /protein_id="AEC05488.1"
                     /db_xref="Araport:AT2G01720"
                     /db_xref="TAIR:AT2G01720"
                     /translation="MAARIGIFSVFVAVLLSISAFSSAQDLQIVNAERRIDLSSHIVK
                     AFLTLKVENIGKDPAAEMLLAFPPTQIKNLAMVQALATTGKKKKKTYLPLDVKPTEQP
                     DAPNDTGYYRVTFISPLGPGETVSLEVLYILTHSLEPFPVEITQSESQLVYYHDSAVI
                     LSPYHVKQQTTFIKTPSTRVESFTSIEPANRAGKEIKYGPYENRASYSYTPVIIHFEN
                     NSPFAVVEELVREIEISHWGSLQITENYRLTHGGARHKGVFSRVDYQSKRSVSGASSF
                     NALLAVLPPRVNSVYYRDEIGNISTSHLRTGFRKSELEFEPRYPLFGGWSATFIIGYR
                     VPLEDYLFEASDGRRYLNFTFGCPLVETIVNKLTIKVVLPEGSKDPSAVLPFTVNQEL
                     QVKYSYLDIVGRTVVVLQKDNVVPTHNVPFQVYYTFKPIYMLAEPFMLVSAFFLVFVA
                     SLAYVHIDLNIVRK"
     gene            320433..323963
                     /gene="CPSF73-II"
                     /locus_tag="AT2G01730"
                     /gene_synonym="ATCPSF73-II"
                     /gene_synonym="cleavage and polyadenylation specificity
                     factor 73 kDa subunit-II"
                     /gene_synonym="CLEAVAGE AND POLYADENYLATION SPECIFICITY
                     FACTOR 73 KDA SUBUNIT-II"
                     /gene_synonym="EDA26"
                     /gene_synonym="embryo sac development arrest 26"
                     /gene_synonym="T8O11.10"
                     /gene_synonym="T8O11_10"
                     /note="a homolog of cleavage and polyadenylation
                     specificity factor that plays an essential role in the
                     development of female gametophyte and embryo"
                     /db_xref="Araport:AT2G01730"
                     /db_xref="TAIR:AT2G01730"
     mRNA            join(320433..320621,320720..321056,321157..321274,
                     321371..321444,321541..321677,321773..321836,
                     322005..322070,322161..322230,322373..322477,
                     322681..322822,322934..323030,323153..323963)
                     /gene="CPSF73-II"
                     /locus_tag="AT2G01730"
                     /gene_synonym="ATCPSF73-II"
                     /gene_synonym="cleavage and polyadenylation specificity
                     factor 73 kDa subunit-II"
                     /gene_synonym="CLEAVAGE AND POLYADENYLATION SPECIFICITY
                     FACTOR 73 KDA SUBUNIT-II"
                     /gene_synonym="EDA26"
                     /gene_synonym="embryo sac development arrest 26"
                     /gene_synonym="T8O11.10"
                     /gene_synonym="T8O11_10"
                     /product="cleavage and polyadenylation specificity factor
                     73 kDa subunit-II"
                     /db_xref="Araport:AT2G01730"
                     /db_xref="TAIR:AT2G01730"
     mRNA            join(320433..320621,320720..320897,320984..321056,
                     321157..321274,321371..321444,321541..321677,
                     321773..321836,322005..322070,322161..322230,
                     322373..322477,322681..322822,322934..323030,
                     323153..323963)
                     /gene="CPSF73-II"
                     /locus_tag="AT2G01730"
                     /gene_synonym="ATCPSF73-II"
                     /gene_synonym="cleavage and polyadenylation specificity
                     factor 73 kDa subunit-II"
                     /gene_synonym="CLEAVAGE AND POLYADENYLATION SPECIFICITY
                     FACTOR 73 KDA SUBUNIT-II"
                     /gene_synonym="EDA26"
                     /gene_synonym="embryo sac development arrest 26"
                     /gene_synonym="T8O11.10"
                     /gene_synonym="T8O11_10"
                     /product="cleavage and polyadenylation specificity factor
                     73 kDa subunit-II"
                     /inference="Similar to RNA sequence, EST:INSD:BP781870.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY168923.1,INSD:AK221561.1"
                     /db_xref="TAIR:AT2G01730"
                     /db_xref="Araport:AT2G01730"
     CDS             join(320597..320621,320720..320897,320984..321056,
                     321157..321274,321371..321444,321541..321677,
                     321773..321836,322005..322070,322161..322230,
                     322373..322477,322681..322822,322934..323030,
                     323153..323845)
                     /gene="CPSF73-II"
                     /locus_tag="AT2G01730"
                     /gene_synonym="ATCPSF73-II"
                     /gene_synonym="cleavage and polyadenylation specificity
                     factor 73 kDa subunit-II"
                     /gene_synonym="CLEAVAGE AND POLYADENYLATION SPECIFICITY
                     FACTOR 73 KDA SUBUNIT-II"
                     /gene_synonym="EDA26"
                     /gene_synonym="embryo sac development arrest 26"
                     /gene_synonym="T8O11.10"
                     /gene_synonym="T8O11_10"
                     /inference="Similar to RNA sequence, EST:INSD:BP781870.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY168923.1,INSD:AK221561.1"
                     /note="cleavage and polyadenylation specificity factor 73
                     kDa subunit-II (CPSF73-II); CONTAINS InterPro DOMAIN/s:
                     RNA-metabolising metallo-beta-lactamase
                     (InterPro:IPR011108), Beta-Casp domain
                     (InterPro:IPR022712), Beta-lactamase-like
                     (InterPro:IPR001279); BEST Arabidopsis thaliana protein
                     match is: cleavage and polyadenylation specificity factor
                     73-I (TAIR:AT1G61010.3); Has 5072 Blast hits to 5039
                     proteins in 1435 species: Archae - 491; Bacteria - 2753;
                     Metazoa - 569; Fungi - 259; Plants - 193; Viruses - 0;
                     Other Eukaryotes - 807 (source: NCBI BLink)."
                     /codon_start=1
                     /product="cleavage and polyadenylation specificity factor
                     73 kDa subunit-II"
                     /protein_id="AEC05489.1"
                     /db_xref="Araport:AT2G01730"
                     /db_xref="TAIR:AT2G01730"
                     /translation="MAIDCLVLGAGQEIGKSCVVVTINGKKIMFDCGMHMGCDDHNRY
                     PNFSLISKSGDFDNAISCIIITHFHMDHVGALPYFTEVCGYNGPIYMSYPTKALSPLM
                     LEDYRRVMVDRRGEEELFTTTHIANCMKKVIAIDLKQTIQVDEDLQIRAYYAGHVLGA
                     VMVYAKMGDAAIVYTGDYNMTTDRHLGAAKIDRLQLDLLISESTYATTIRGSKYPRER
                     EFLQAVHKCVAGGGKALIPSFALGRAQELCMLLDDYWERMNIKVPIYFSSGLTIQANM
                     YYKMLISWTSQNVKEKHNTHNPFDFKNVKDFDRSLIHAPGPCVLFATPGMLCAGFSLE
                     VFKHWAPSPLNLVALPGYSVAGTVGHKLMAGKPTTVDLYNGTKVDVRCKVHQVAFSPH
                     TDAKGIMDLTKFLSPKNVVLVHGEKPSMMILKEKITSELDIPCFVPANGETVSFASTT
                     YIKANASDMFLKSCSNPNFKFSNSTQLRVTDHRTADGVLVIEKSKKAKIVHQDEISEV
                     LHEKNHVVSLAHCCPVKVKGESEDDDVDLIKQLSAKILKTVSGAQIHESENCLQVASF
                     KGSLCLKDKCMHRSSSSSSEAVFLCCNWSIADLELGWEIINAIKLNH"
     CDS             join(320988..321056,321157..321274,321371..321444,
                     321541..321677,321773..321836,322005..322070,
                     322161..322230,322373..322477,322681..322822,
                     322934..323030,323153..323845)
                     /gene="CPSF73-II"
                     /locus_tag="AT2G01730"
                     /gene_synonym="ATCPSF73-II"
                     /gene_synonym="cleavage and polyadenylation specificity
                     factor 73 kDa subunit-II"
                     /gene_synonym="CLEAVAGE AND POLYADENYLATION SPECIFICITY
                     FACTOR 73 KDA SUBUNIT-II"
                     /gene_synonym="EDA26"
                     /gene_synonym="embryo sac development arrest 26"
                     /gene_synonym="T8O11.10"
                     /gene_synonym="T8O11_10"
                     /codon_start=1
                     /product="cleavage and polyadenylation specificity factor
                     73 kDa subunit-II"
                     /protein_id="ANM63148.1"
                     /db_xref="Araport:AT2G01730"
                     /db_xref="TAIR:AT2G01730"
                     /translation="MDHVGALPYFTEVCGYNGPIYMSYPTKALSPLMLEDYRRVMVDR
                     RGEEELFTTTHIANCMKKVIAIDLKQTIQVDEDLQIRAYYAGHVLGAVMVYAKMGDAA
                     IVYTGDYNMTTDRHLGAAKIDRLQLDLLISESTYATTIRGSKYPREREFLQAVHKCVA
                     GGGKALIPSFALGRAQELCMLLDDYWERMNIKVPIYFSSGLTIQANMYYKMLISWTSQ
                     NVKEKHNTHNPFDFKNVKDFDRSLIHAPGPCVLFATPGMLCAGFSLEVFKHWAPSPLN
                     LVALPGYSVAGTVGHKLMAGKPTTVDLYNGTKVDVRCKVHQVAFSPHTDAKGIMDLTK
                     FLSPKNVVLVHGEKPSMMILKEKITSELDIPCFVPANGETVSFASTTYIKANASDMFL
                     KSCSNPNFKFSNSTQLRVTDHRTADGVLVIEKSKKAKIVHQDEISEVLHEKNHVVSLA
                     HCCPVKVKGESEDDDVDLIKQLSAKILKTVSGAQIHESENCLQVASFKGSLCLKDKCM
                     HRSSSSSSEAVFLCCNWSIADLELGWEIINAIKLNH"
     gene            324365..326094
                     /gene="RIE1"
                     /locus_tag="AT2G01735"
                     /gene_synonym="RING-finger protein for embryogenesis"
                     /note="encodes a RING-H2 zinc finger protein essential for
                     seed development."
                     /db_xref="Araport:AT2G01735"
                     /db_xref="TAIR:AT2G01735"
     mRNA            join(324365..325001,325071..325190,325265..325636,
                     325731..326094)
                     /gene="RIE1"
                     /locus_tag="AT2G01735"
                     /gene_synonym="RING-finger protein for embryogenesis"
                     /product="RING-finger protein for embryogenesi"
                     /db_xref="Araport:AT2G01735"
                     /db_xref="TAIR:AT2G01735"
     mRNA            join(324365..325001,325071..325190,325265..325397,
                     325478..325636,325731..326094)
                     /gene="RIE1"
                     /locus_tag="AT2G01735"
                     /gene_synonym="RING-finger protein for embryogenesis"
                     /product="RING-finger protein for embryogenesi"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AU226128.1,INSD:BX836564.1,INSD:BP582909.1,
                     INSD:ES098846.1,INSD:BP799808.1,INSD:BP800407.1,
                     INSD:BP577241.1,INSD:BP797753.1,INSD:BP803937.1,
                     INSD:DR363463.1,INSD:EL285040.1,INSD:EH888508.1,
                     INSD:DR363462.1,INSD:EG494820.1,INSD:BP783353.1,
                     INSD:EL994402.1,INSD:BP577064.1,INSD:AV555346.1,
                     INSD:EL100577.1,INSD:EH811939.1,INSD:CD534642.1,
                     INSD:EH919817.1,INSD:BX835615.1,INSD:ES189311.1,
                     INSD:AU235430.1,INSD:EL028745.1,INSD:EH948816.1,
                     INSD:EH839494.1,INSD:BP597210.1,INSD:EG494821.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AY168924.1"
                     /db_xref="TAIR:AT2G01735"
                     /db_xref="Araport:AT2G01735"
     CDS             join(324499..325001,325071..325190,325265..325397,
                     325478..325636,325731..325895)
                     /gene="RIE1"
                     /locus_tag="AT2G01735"
                     /gene_synonym="RING-finger protein for embryogenesis"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AU226128.1,INSD:BX836564.1,INSD:BP582909.1,
                     INSD:ES098846.1,INSD:BP799808.1,INSD:BP800407.1,
                     INSD:BP577241.1,INSD:BP797753.1,INSD:BP803937.1,
                     INSD:DR363463.1,INSD:EL285040.1,INSD:EH888508.1,
                     INSD:DR363462.1,INSD:EG494820.1,INSD:BP783353.1,
                     INSD:EL994402.1,INSD:BP577064.1,INSD:AV555346.1,
                     INSD:EL100577.1,INSD:EH811939.1,INSD:CD534642.1,
                     INSD:EH919817.1,INSD:BX835615.1,INSD:ES189311.1,
                     INSD:AU235430.1,INSD:EL028745.1,INSD:EH948816.1,
                     INSD:EH839494.1,INSD:BP597210.1,INSD:EG494821.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AY168924.1"
                     /note="RING-finger protein for embryogenesis (RIE1);
                     FUNCTIONS IN: zinc ion binding; LOCATED IN: chloroplast;
                     EXPRESSED IN: 14 plant structures; EXPRESSED DURING: 4
                     anthesis, C globular stage, petal differentiation and
                     expansion stage, E expanded cotyledon stage, D bilateral
                     stage; CONTAINS InterPro DOMAIN/s: Zinc finger, RING-type
                     (InterPro:IPR001841), Zinc finger, C3HC4 RING-type
                     (InterPro:IPR018957); BEST Arabidopsis thaliana protein
                     match is: Zinc finger, C3HC4 type (RING finger) family
                     protein (TAIR:AT1G68070.1); Has 9688 Blast hits to 9662
                     proteins in 283 species: Archae - 0; Bacteria - 6; Metazoa
                     - 2533; Fungi - 743; Plants - 5052; Viruses - 40; Other
                     Eukaryotes - 1314 (source: NCBI BLink)."
                     /codon_start=1
                     /product="RING-finger protein for embryogenesi"
                     /protein_id="AEC05490.1"
                     /db_xref="Araport:AT2G01735"
                     /db_xref="TAIR:AT2G01735"
                     /translation="MSSYSSDSTAARDQHAPLLRPRHDGSFSSSSSSARPTALAVLLG
                     RITGHRAPSMLVRETAARALEERRIDWGYSKPVVAADILWNAALVLASAVMLVGTVEE
                     RPNEPIRVWICVYGLQCLFHVVLVWSEYWRRNSTRRARDLESYDHEDYNIEYDYEQDS
                     DDNSTTYSFVKRCESINTVISFIWWIIGFYWVVEGGDKLLGEAPNLYWLSVIFLAIDV
                     FFAVFCVVLACLVGIALCCCLPCIIALLYAVAGTEGVSEAELGVLPLYKFKAFHSNEK
                     NITGPGKMVPIPINGLCLATERTLLAEDADCCICLSSYEDGAELHALPCNHHFHSTCI
                     VKWLKMRATCPLCKYNILKGTTDQS"
     CDS             join(324499..325001,325071..325190,325265..325403)
                     /gene="RIE1"
                     /locus_tag="AT2G01735"
                     /gene_synonym="RING-finger protein for embryogenesis"
                     /codon_start=1
                     /product="RING-finger protein for embryogenesi"
                     /protein_id="ANM63149.1"
                     /db_xref="Araport:AT2G01735"
                     /db_xref="TAIR:AT2G01735"
                     /translation="MSSYSSDSTAARDQHAPLLRPRHDGSFSSSSSSARPTALAVLLG
                     RITGHRAPSMLVRETAARALEERRIDWGYSKPVVAADILWNAALVLASAVMLVGTVEE
                     RPNEPIRVWICVYGLQCLFHVVLVWSEYWRRNSTRRARDLESYDHEDYNIEYDYEQDS
                     DDNSTTYSFVKRCESINTVISFIWWIIGFYWVVEGGDKLLGEAPNLYWLSVIFLAIDV
                     FFAVFCVVLACLVGIALCCCLPCIIALLYAVAGTV"
     gene            complement(326136..327875)
                     /locus_tag="AT2G01740"
                     /gene_synonym="T8O11.9"
                     /gene_synonym="T8O11_9"
                     /db_xref="Araport:AT2G01740"
                     /db_xref="TAIR:AT2G01740"
     mRNA            complement(326136..327875)
                     /locus_tag="AT2G01740"
                     /gene_synonym="T8O11.9"
                     /gene_synonym="T8O11_9"
                     /product="Tetratricopeptide repeat (TPR)-like superfamily
                     protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BX839445.1,INSD:ES196935.1,INSD:BX836564.1,
                     INSD:EG494820.1,INSD:BX835615.1,INSD:EG494821.1"
                     /db_xref="TAIR:AT2G01740"
                     /db_xref="Araport:AT2G01740"
     CDS             complement(326136..327815)
                     /locus_tag="AT2G01740"
                     /gene_synonym="T8O11.9"
                     /gene_synonym="T8O11_9"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BX839445.1,INSD:ES196935.1,INSD:BX836564.1,
                     INSD:EG494820.1,INSD:BX835615.1,INSD:EG494821.1"
                     /note="Tetratricopeptide repeat (TPR)-like superfamily
                     protein; CONTAINS InterPro DOMAIN/s: Pentatricopeptide
                     repeat (InterPro:IPR002885); BEST Arabidopsis thaliana
                     protein match is: Tetratricopeptide repeat (TPR)-like
                     superfamily protein (TAIR:AT2G02150.1); Has 57588 Blast
                     hits to 14618 proteins in 307 species: Archae - 5;
                     Bacteria - 72; Metazoa - 670; Fungi - 805; Plants - 54302;
                     Viruses - 0; Other Eukaryotes - 1734 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="Tetratricopeptide repeat (TPR)-like superfamily
                     protein"
                     /protein_id="AEC05491.1"
                     /db_xref="Araport:AT2G01740"
                     /db_xref="TAIR:AT2G01740"
                     /translation="MVREALQFLSRLRKSSNLPDPFTCNKHIHQLINSNCGILSLKFL
                     AYLVSRGYTPHRSSFNSVVSFVCKLGQVKFAEDIVHSMPRFGCEPDVISYNSLIDGHC
                     RNGDIRSASLVLESLRASHGFICKPDIVSFNSLFNGFSKMKMLDEVFVYMGVMLKCCS
                     PNVVTYSTWIDTFCKSGELQLALKSFHSMKRDALSPNVVTFTCLIDGYCKAGDLEVAV
                     SLYKEMRRVRMSLNVVTYTALIDGFCKKGEMQRAEEMYSRMVEDRVEPNSLVYTTIID
                     GFFQRGDSDNAMKFLAKMLNQGMRLDITAYGVIISGLCGNGKLKEATEIVEDMEKSDL
                     VPDMVIFTTMMNAYFKSGRMKAAVNMYHKLIERGFEPDVVALSTMIDGIAKNGQLHEA
                     IVYFCIEKANDVMYTVLIDALCKEGDFIEVERLFSKISEAGLVPDKFMYTSWIAGLCK
                     QGNLVDAFKLKTRMVQEGLLLDLLAYTTLIYGLASKGLMVEARQVFDEMLNSGISPDS
                     AVFDLLIRAYEKEGNMAAASDLLLDMQRRGLVTAVSDADCSKQCGNEVNCS"
     gene            328025..332872
                     /gene="MAP70-3"
                     /locus_tag="AT2G01750"
                     /gene_synonym="ATMAP70-3"
                     /gene_synonym="microtubule-associated proteins 70-3"
                     /gene_synonym="T8O11.8"
                     /gene_synonym="T8O11_8"
                     /note="Encodes a microtubule associated protein (MAP70-3).
                     Expressed in all tissues."
                     /db_xref="Araport:AT2G01750"
                     /db_xref="TAIR:AT2G01750"
     mRNA            join(328025..328234,328316..328612,328783..328868,
                     329491..329556,329649..329819,329918..330088,
                     330188..330343,330452..330598,330723..330794,
                     330891..331415,331509..331702,331809..332872)
                     /gene="MAP70-3"
                     /locus_tag="AT2G01750"
                     /gene_synonym="ATMAP70-3"
                     /gene_synonym="microtubule-associated proteins 70-3"
                     /gene_synonym="T8O11.8"
                     /gene_synonym="T8O11_8"
                     /product="microtubule-associated proteins 70-3"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES155961.1,INSD:ES025260.1,INSD:AV562273.1,
                     INSD:AV556892.1,INSD:ES027603.1,INSD:ES019340.1,
                     INSD:BE530552.1,INSD:EG528190.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AM086440.1"
                     /db_xref="TAIR:AT2G01750"
                     /db_xref="Araport:AT2G01750"
     mRNA            join(328089..328234,328316..328612,328783..328868,
                     329491..329556,329649..329819,329918..330088,
                     330188..330343,330452..330598,330723..330794,
                     330891..331415,331509..331702,331806..332113)
                     /gene="MAP70-3"
                     /locus_tag="AT2G01750"
                     /gene_synonym="ATMAP70-3"
                     /gene_synonym="microtubule-associated proteins 70-3"
                     /gene_synonym="T8O11.8"
                     /gene_synonym="T8O11_8"
                     /product="microtubule-associated proteins 70-3"
                     /db_xref="TAIR:AT2G01750"
                     /db_xref="Araport:AT2G01750"
     CDS             join(328351..328612,328783..328868,329491..329556,
                     329649..329819,329918..330088,330188..330343,
                     330452..330598,330723..330794,330891..331415,
                     331509..331702,331806..331848)
                     /gene="MAP70-3"
                     /locus_tag="AT2G01750"
                     /gene_synonym="ATMAP70-3"
                     /gene_synonym="microtubule-associated proteins 70-3"
                     /gene_synonym="T8O11.8"
                     /gene_synonym="T8O11_8"
                     /note="microtubule-associated proteins 70-3 (MAP70-3);
                     FUNCTIONS IN: microtubule binding; INVOLVED IN:
                     cytoskeleton organization; LOCATED IN: microtubule;
                     EXPRESSED IN: 17 plant structures; EXPRESSED DURING: 9
                     growth stages; CONTAINS InterPro DOMAIN/s: Myosin II heavy
                     chain-like (InterPro:IPR009768); BEST Arabidopsis thaliana
                     protein match is: microtubule-associated proteins 70-4
                     (TAIR:AT1G14840.1)."
                     /codon_start=1
                     /product="microtubule-associated proteins 70-3"
                     /protein_id="AEC05493.1"
                     /db_xref="Araport:AT2G01750"
                     /db_xref="TAIR:AT2G01750"
                     /translation="MEEGGYAFEVNNGRPTASEFGTTARISSPSLTMSSSFREGGGGG
                     GSKGLTRRRSMKPSFDADNEFITLLHGSDPVKVELNRLENDVRDKDRELSESQAEIKA
                     LRLSERQREKAVEELTEELGKMSEKLKLTENLLDSKNLEIKKINEEKRASMAAQFAAE
                     ATLRRVHAAQKDDDMPPIEAILAPLEAELKLARHEIVKLQDDNRALDRLTKSKEAALL
                     DAERTVQSALAKASMVDDLQNKNQELMKQIEICQEENRILDKLHRQKVAEVEKFTQTV
                     RELEEAVLAGGTAANAVRDYQRKFQEMNEERRILDRELARAKVSASRVATVVANEWKD
                     GSDKVMPVKQWLEERRFLQGEMQQLRDKLAIADRAAKSEAQLKEKFQLRLRVLEESLR
                     GPSSSGNRSTPEGRSMSNGPSRRQSLGGADIIPKLTSNGFFSKRSPSSQFRSLNASTS
                     TILKHAKGTSRSFDGGSRSLDRSKVLTNEPRSKFPLNQSSEGTSGGGSPNSTKQGDSE
                     KAAGTNNDSVPGVLHDLLQKEVITLRKAANDKDQSLRDKDEAIEMLAKKVETLTKAME
                     VEAKKMRREVAAMEKEVSAMRVDNKGSDSRTRRHSTNSKGASTTAQLLSGSRGSGRMG
                     MTRSTQ"
     CDS             join(328351..328612,328783..328868,329491..329556,
                     329649..329819,329918..330088,330188..330343,
                     330452..330598,330723..330794,330891..331415,
                     331509..331702,331809..331848)
                     /gene="MAP70-3"
                     /locus_tag="AT2G01750"
                     /gene_synonym="ATMAP70-3"
                     /gene_synonym="microtubule-associated proteins 70-3"
                     /gene_synonym="T8O11.8"
                     /gene_synonym="T8O11_8"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES155961.1,INSD:ES025260.1,INSD:AV562273.1,
                     INSD:AV556892.1,INSD:ES027603.1,INSD:ES019340.1,
                     INSD:BE530552.1,INSD:EG528190.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AM086440.1"
                     /note="microtubule-associated proteins 70-3 (MAP70-3);
                     FUNCTIONS IN: microtubule binding; INVOLVED IN:
                     cytoskeleton organization; LOCATED IN: microtubule, plasma
                     membrane; EXPRESSED IN: 17 plant structures; EXPRESSED
                     DURING: 9 growth stages; CONTAINS InterPro DOMAIN/s:
                     Myosin II heavy chain-like (InterPro:IPR009768); BEST
                     Arabidopsis thaliana protein match is:
                     microtubule-associated proteins 70-4 (TAIR:AT1G14840.1);
                     Has 32985 Blast hits to 20590 proteins in 1788 species:
                     Archae - 429; Bacteria - 4222; Metazoa - 17320; Fungi -
                     2752; Plants - 1806; Viruses - 150; Other Eukaryotes -
                     6306 (source: NCBI BLink)."
                     /codon_start=1
                     /product="microtubule-associated proteins 70-3"
                     /protein_id="AEC05492.1"
                     /db_xref="Araport:AT2G01750"
                     /db_xref="TAIR:AT2G01750"
                     /translation="MEEGGYAFEVNNGRPTASEFGTTARISSPSLTMSSSFREGGGGG
                     GSKGLTRRRSMKPSFDADNEFITLLHGSDPVKVELNRLENDVRDKDRELSESQAEIKA
                     LRLSERQREKAVEELTEELGKMSEKLKLTENLLDSKNLEIKKINEEKRASMAAQFAAE
                     ATLRRVHAAQKDDDMPPIEAILAPLEAELKLARHEIVKLQDDNRALDRLTKSKEAALL
                     DAERTVQSALAKASMVDDLQNKNQELMKQIEICQEENRILDKLHRQKVAEVEKFTQTV
                     RELEEAVLAGGTAANAVRDYQRKFQEMNEERRILDRELARAKVSASRVATVVANEWKD
                     GSDKVMPVKQWLEERRFLQGEMQQLRDKLAIADRAAKSEAQLKEKFQLRLRVLEESLR
                     GPSSSGNRSTPEGRSMSNGPSRRQSLGGADIIPKLTSNGFFSKRSPSSQFRSLNASTS
                     TILKHAKGTSRSFDGGSRSLDRSKVLTNEPRSKFPLNQSSEGTSGGGSPNSTKQGDSE
                     KAAGTNNDSVPGVLHDLLQKEVITLRKAANDKDQSLRDKDEAIEMLAKKVETLTKAME
                     VEAKKMRREVAAMEKEVSAMRVDNKGSDSRTRRHSTNSKGASTTAQLLSGRGSGRMGM
                     TRSTQ"
     gene            complement(332188..332808)
                     /locus_tag="AT2G01755"
                     /db_xref="Araport:AT2G01755"
                     /db_xref="TAIR:AT2G01755"
     mRNA            complement(332188..332808)
                     /locus_tag="AT2G01755"
                     /product="hypothetical protein"
                     /db_xref="Araport:AT2G01755"
                     /db_xref="TAIR:AT2G01755"
     mRNA            complement(332194..332781)
                     /locus_tag="AT2G01755"
                     /product="hypothetical protein"
                     /