LOCUS       CP001120             4888768 bp    DNA     circular BCT 31-JAN-2014
DEFINITION  Salmonella enterica subsp. enterica serovar Heidelberg str. SL476,
            complete genome.
ACCESSION   CP001120 ABEM01000000 ABEM01000001-ABEM01000049
VERSION     CP001120.1
DBLINK      BioProject: PRJNA20045
            BioSample: SAMN02604067
KEYWORDS    .
SOURCE      Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
  ORGANISM  Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Salmonella.
REFERENCE   1  (bases 1 to 4888768)
  AUTHORS   Fricke,W.F., Mammel,M.K., McDermott,P.F., Tartera,C., White,D.G.,
            Leclerc,J.E., Ravel,J. and Cebula,T.A.
  TITLE     Comparative genomics of 28 Salmonella enterica isolates: evidence
            for CRISPR-mediated adaptive sublineage evolution
  JOURNAL   J. Bacteriol. 193 (14), 3556-3568 (2011)
   PUBMED   21602358
REFERENCE   2  (bases 1 to 4888768)
  AUTHORS   Ravel,J., Fricke,W.F., White,D., McDermott,P., Mammel,M.,
            Rosovitz,M., Leclerc,J., Cebula,T. and Sebastian,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JUL-2008) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
COMMENT     The sequenced strain has been deposited at the Salmonella Genetic
            Stock Center at the University of Calgary under the care of Dr.
            K.E. Sanderson.
FEATURES             Location/Qualifiers
     source          1..4888768
                     /organism="Salmonella enterica subsp. enterica serovar
                     Heidelberg str. SL476"
                     /mol_type="genomic DNA"
                     /strain="SL476"
                     /serovar="Heidelberg"
                     /sub_species="enterica"
                     /db_xref="taxon:454169"
     misc_feature    184..311
                     /note="Threonine operon leader"
     gene            337..2799
                     /gene="thrA"
                     /locus_tag="SeHA_C0002"
     CDS             337..2799
                     /gene="thrA"
                     /locus_tag="SeHA_C0002"
                     /EC_number="2.7.2.4"
                     /EC_number="1.1.1.3"
                     /note="identified by match to protein family HMM PF00696;
                     match to protein family HMM PF00742; match to protein
                     family HMM PF01842; match to protein family HMM PF03447;
                     match to protein family HMM TIGR00657"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartokinase/homoserine dehydrogenase I"
                     /protein_id="ACF69432.1"
                     /translation="MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKIT
                     NHLVAMIEKTIGGQDALPNISDAERIFSDLLAGLASAQPGFPLARLKMVVEQEFAQIK
                     HVLHGISLLGQCPDSINAALICRGEKMSIAIMAGLLEARGHRVTVIDPVEKLLAVGHY
                     LESTVDIAESTRRIAASQIPADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACL
                     RADCCEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQF
                     QIPCLIKNTGNPQAPGTLIGASSDDDNLPVKGISNLNNMAMFSVSGPGMKGMIGMAAR
                     VFAAMSRAGISVVLITQSSSEYSISFCVPQSDCARARRAMQDEFYLELKEGLLEPLAV
                     TERLAIISVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATT
                     GVRVTHQMLFNTDQVIEVFVIGVGGVGGALLEQLKRQQTWLKNKHIDLRVCGVANSKA
                     LLTNVHGLNLDNWQAELAQANAPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYAD
                     FLREGFHVVTPNKKANTSSMDYYHQLRFAAAQSRRKFLYDTNVGAGLPVIENLQNLLN
                     AGDELQKFSGILSGSLSFIFGKLEEGMSLSQATALAREMGYTEPDPRDDLSGMDVARK
                     LLILARETGRELELSDIVIEPVLPDEFDASGDVTAFMAHLPQLDDAFAARVAKARDEG
                     KVLRYVGNIEEDGVCRVKIAEVDGNDPLFKVKNGENALAFYSHYYQPLPLVLRGYGAG
                     NDVTAAGVFADLLRTLSWKLGV"
     gene            2801..3730
                     /gene="thrB"
                     /locus_tag="SeHA_C0003"
     CDS             2801..3730
                     /gene="thrB"
                     /locus_tag="SeHA_C0003"
                     /EC_number="2.7.1.39"
                     /note="identified by match to protein family HMM PF00288;
                     match to protein family HMM PF08544; match to protein
                     family HMM TIGR00191"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine kinase"
                     /protein_id="ACF69934.1"
                     /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGTLLGDVVSVEAADHF
                     RLHNLGRFADKLPPEPRENIVYQCWERFCQALGKTIPVAMTLEKNMPIGSGLGSSACS
                     VVAALVAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENGI
                     ISQQVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQ
                     PQLAAALMKDVIAEPYRARLLPGFSQARQAVSEIGALASGISGSGPTLFALCDKPETA
                     QRVADWLSKHYLQNQEGFVHICRLDTAGARVVG"
     gene            3734..5020
                     /gene="thrC"
                     /locus_tag="SeHA_C0004"
     CDS             3734..5020
                     /gene="thrC"
                     /locus_tag="SeHA_C0004"
                     /EC_number="4.2.3.1"
                     /note="identified by match to protein family HMM PF00291;
                     match to protein family HMM TIGR00260"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="ACF69112.1"
                     /translation="MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHELPEFSLTEID
                     EMLNQDFVSRSAKILSAFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGP
                     TLAFKDFGGRFMAQMLTHISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRG
                     KISPLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKTALGLNSANSINISR
                     LLAQICYYFEAVAQLPQGARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVN
                     DTVPRFLHDGKWAPKATQATLSNAMDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDT
                     TTQQTMRELKAKGYISEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVESILGE
                     TLALPEALAERADLPLLSHHLPADFAALRKLMMTRQ"
     gene            complement(5113..5886)
                     /locus_tag="SeHA_C0005"
     CDS             complement(5113..5886)
                     /locus_tag="SeHA_C0005"
                     /note="identified by match to protein family HMM PF03883"
                     /codon_start=1
                     /transl_table=11
                     /product="protein YaaA"
                     /protein_id="ACF67852.1"
                     /translation="MLILISPAKTLDYQSPLATTRYTQPELLDHSQQLIQQARQLSAP
                     QISRLMGISDKLADLNATRFHDWQPHFTPDNARQAILAFKGDVYTGLQAETFNDADFD
                     FAQQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENPRGKDLYQFWGDIITDKLNEALE
                     AQGDRVVVNLASEEYFKSVKPKKLNAELIKPVFLDEKNGKFKVVSFYAKKARGLMSRF
                     IIENRLTKPEQLTAFDREGYFFDEETSTQDELVFKRYEQ"
     gene            complement(5965..7422)
                     /locus_tag="SeHA_C0006"
     CDS             complement(5965..7422)
                     /locus_tag="SeHA_C0006"
                     /note="identified by match to protein family HMM PF01235;
                     match to protein family HMM TIGR00835"
                     /codon_start=1
                     /transl_table=11
                     /product="amino-acid carrier protein AlsT"
                     /protein_id="ACF65895.1"
                     /translation="MTASTRGTLMPEFFSFINEILWGSVMIYLLLGAGCWFTWRTGFI
                     QFRYIRQFGRSLKGSLSPQPGGLTSFQALCTSLAARIGSGNLAGVALAIAAGGPGAVF
                     WMWVSAIIGMATSFAECSLAQLYKERDPTGQFRGGPAWYMARGLGMRWMGVVFALFLL
                     VAYGLIFNSVQANAVSRALHFAFNIPPLISGIALALCALLIIIRGIKGVARLMQWLIP
                     IIALLWVAGSVFICLWHIEQMPGVIASIVKSAFGWQEAAAGAAGYTLTQAITSGFQRG
                     MFSNEAGMGSTPNAAAAATSYPPHPVAQGIVQMIGVFSDTIIICTASAMIILLAGNHA
                     SHSSTEGIQLLQHAMVSLTGEWGASFVALIVILFAFSSIVANYIYAENNLFFLRLHNA
                     KAIWLLRLATLGMVIAGTLISFPLIWQLADMIMACMAITNLTAILLLSPVVYTLAGDY
                     LRQRKLGVRPQFDPRRFPDIEPQLAPDTWDATSRD"
     gene            7664..8617
                     /gene="tal2"
                     /locus_tag="SeHA_C0007"
     CDS             7664..8617
                     /gene="tal2"
                     /locus_tag="SeHA_C0007"
                     /EC_number="2.2.1.2"
                     /note="identified by match to protein family HMM PF00923;
                     match to protein family HMM TIGR00874"
                     /codon_start=1
                     /transl_table=11
                     /product="transaldolase"
                     /protein_id="ACF66518.1"
                     /translation="MTDKLTSLRQFTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQ
                     IPEYRKLIDDAVAWAKQQSSDRAQQVVDATDKLAVNIGLEILKLVPGRISTEVDARLS
                     YDTEASIAKAKRIIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFS
                     FAQARACAEAGVYLISPFVGRILDWYKANTDKKDYAPAEDPGVVSVTEIYEYYKQHGY
                     ETVVMGASFRNVGEILELAGCDRLTIAPALLKELAESEGAIERKLSFSGEVKARPERI
                     TEAEFLWQHHQDPMAVDKLADGIRKFAVDQEKLEKMIGDLL"
     gene            8728..9318
                     /gene="mog"
                     /locus_tag="SeHA_C0008"
     CDS             8728..9318
                     /gene="mog"
                     /locus_tag="SeHA_C0008"
                     /note="identified by match to protein family HMM PF00994;
                     match to protein family HMM TIGR00177"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein Mog"
                     /protein_id="ACF67024.1"
                     /translation="MDTLRIGLVSISDRASSGVYQDKGIPALEEWLASALTTPFEVQR
                     RLIPDEQEIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQ
                     MRQISLRFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKADDGSVSVPGIFA
                     SVPYCIQLLDGPYVETAPEVVAAFRPKSARRENMSS"
     gene            complement(9375..9941)
                     /locus_tag="SeHA_C0009"
     CDS             complement(9375..9941)
                     /locus_tag="SeHA_C0009"
                     /note="identified by match to protein family HMM PF01184"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein, GPR1/FUN34/yaaH family"
                     /protein_id="ACF67809.1"
                     /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNAGFFALDGIILAMGIF
                     YGGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKMGLTDAPDAQLLGAY
                     LGLWGVFTLFMFFGTLKAARALQFVFLSLTVLFALLAVGNITGNEAIIHIAGWVGLVC
                     GASAIYLAMGEVLNEQFGRTILPIGEAH"
     gene            complement(10091..10804)
                     /locus_tag="SeHA_C0010"
     CDS             complement(10091..10804)
                     /locus_tag="SeHA_C0010"
                     /note="identified by match to protein family HMM PF03667"
                     /codon_start=1
                     /transl_table=11
                     /product="positive regulator for sigma H"
                     /protein_id="ACF66279.1"
                     /translation="MNVTYLHDEDLDFLQHCSEEQLADFARLLTHNEKGKARLSSVLS
                     HNELFKAMEGHPEQHRRNWQLIAGEFQHYGGDSIANKLRGHGKQYRAILLDVAKRLKL
                     KADKSMSTFEIEQQLLEHFLRHTWQKMDAAHKQEFLQAVDAKVSELEELLPLLMKDRS
                     LAKGVSHLLSTQLTRILRTHAAMSILGHGLLRGAGLGGPVGAALNGVKAMSGSAYRVT
                     IPAVLQIACLRRMMAAVQA"
     gene            complement(10840..11235)
                     /locus_tag="SeHA_C0011"
     CDS             complement(10840..11235)
                     /locus_tag="SeHA_C0011"
                     /codon_start=1
                     /transl_table=11
                     /product="protein YaaI"
                     /protein_id="ACF66434.1"
                     /translation="MLTISASLLFGLALSSVAHANDHKILGVIAMPRNETNDLTLKIP
                     VCRIVKRIQLTADHGDIELSGASVYFKTARSASQSLNVPSSIKEGQTTGWININSDND
                     NKRCVSKITFSGHTVNSSDMARLKVIGDD"
     gene            11299..11424
                     /locus_tag="SeHA_C0012"
     CDS             11299..11424
                     /locus_tag="SeHA_C0012"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF69650.1"
                     /translation="MATIQFCNLFFLLQFFCEWYSFFNLFHEYLSVWFSIAPSRH"
     gene            11593..13509
                     /gene="dnaK"
                     /locus_tag="SeHA_C0013"
     CDS             11593..13509
                     /gene="dnaK"
                     /locus_tag="SeHA_C0013"
                     /note="identified by match to protein family HMM PF00012;
                     match to protein family HMM TIGR02350"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein DnaK"
                     /protein_id="ACF70388.1"
                     /translation="MGKIIGIDLGTTNSCVAIMDGTQARVLENAEGDRTTPSIIAYTQ
                     DGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPYKIIGADNGDAW
                     LDVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRI
                     AGLEVKRIINEPTAAALAYGLDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEV
                     LATNGDTHLGGEDFDTRLINYLVDEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSA
                     QQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDI
                     NDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLL
                     DVTPLSLGIETMGGVMTPLITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASD
                     NKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLN
                     EEEIQKMVRDAEANAESDRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIE
                     SALSALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQAGSADASANNAKDD
                     DVVDAEFEEVKDKK"
     gene            13595..14734
                     /gene="dnaJ"
                     /locus_tag="SeHA_C0014"
     CDS             13595..14734
                     /gene="dnaJ"
                     /locus_tag="SeHA_C0014"
                     /note="identified by match to protein family HMM PF00226;
                     match to protein family HMM PF00684; match to protein
                     family HMM PF01556; match to protein family HMM TIGR02349"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein DnaJ"
                     /protein_id="ACF70074.1"
                     /translation="MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAE
                     AKFKEIKEAYEVLTDAQKRAAYDQYGHAAFEQGGMGGGFGGGFNGGADFSDIFGDVFG
                     DIFGGGRGRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQ
                     PQTCPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVEKSKTLSVK
                     IPAGVDTGDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAM
                     AALGGEIEVPTLDGRVMLKVPSETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPV
                     GLSEKQKQLLKDLQESFGGPTGEKNSPRSKSFFDGVKKFFDDLTR"
     gene            14846..14959
                     /locus_tag="SeHA_C0015"
     CDS             14846..14959
                     /locus_tag="SeHA_C0015"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF69249.1"
                     /translation="MFLLINKLMLISSFVYAYSLKKRDVMTLMIAFLDAVN"
     gene            15015..15962
                     /locus_tag="SeHA_C0016"
     CDS             15015..15962
                     /locus_tag="SeHA_C0016"
                     /note="identified by match to protein family HMM PF00126"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="ACF67691.1"
                     /translation="MGSKGANKSFDYNLIKILDAVILSGNAAMAAKKLGITPAAVSLA
                     LKRLQSYYPEELFSRGKGGLIPTAKAVDIHQNFSQVMKLVDDTFLCNSKKDEAFQITL
                     LGSDIVESYYLSQLYNSDIFDRILINHFTVRNMSREHISELLFTAQGDLLISAEPLLE
                     SGIENQIIDSFKSFVCICSSKHMLSTLSQLSLHHFYSSRHALYQPGMGASVIYHDSEL
                     FKDDLYYTGRRIVGYRSDSLNGLMSMIERTSLIALMPLKLALFYKNHRKYDIKFIQPP
                     PELALKSVQVYASWNKNSRNISTINEMVSMLQTLSSFRR"
     gene            16131..16433
                     /locus_tag="SeHA_C0017"
     CDS             16131..16433
                     /locus_tag="SeHA_C0017"
                     /codon_start=1
                     /transl_table=11
                     /product="putative bacteriophage protein"
                     /protein_id="ACF65879.1"
                     /translation="MELEILLTIISIGAWGGFVSYLLRKDKTEYNSSHESIKYCLTQI
                     VISCFTSFLLSAIAIEKECSFNIVLLAAGLGGVFASPILKILGRRIKKIIEGNNSD"
     gene            complement(16494..17027)
                     /locus_tag="SeHA_C0018"
     CDS             complement(16494..17027)
                     /locus_tag="SeHA_C0018"
                     /note="identified by match to protein family HMM PF05838;
                     match to protein family HMM PF09374"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF67320.1"
                     /translation="MNPIIDGIIALEGGYVFNPKDKGGATHWGITEATARAHGYAGDM
                     RDLTHAEAYAILEEDYWIKPGFDVISTLSWPVSFELCDAAVNIGAYHPSAWLQRWLNV
                     FNHEGKRYPDIHVDGNIGPRTLAALEHYLAWRGQEGEAVLVKALNCSQGTYYLNVAEK
                     NHNNEQFIYGWIKNRVT"
     gene            complement(17044..17487)
                     /locus_tag="SeHA_C0019"
     CDS             complement(17044..17487)
                     /locus_tag="SeHA_C0019"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF69261.1"
                     /translation="MKTYIINSNCIYNEGKYELRTVSNSQVIKMTAMRAKCLSFIIEN
                     AHLEIIERQKITTALWGSRSHYVNDANLTQILYLIRRDLKALGINDLFITIPRQGLKV
                     NSDIAIIATDSETKGRKKQIVRQTIAALTTVFSVTLGSLMYLHIH"
     gene            17868..19967
                     /locus_tag="SeHA_C0020"
     CDS             17868..19967
                     /locus_tag="SeHA_C0020"
                     /note="identified by match to protein family HMM PF00704;
                     match to protein family HMM PF02839"
                     /codon_start=1
                     /transl_table=11
                     /product="exochitinase"
                     /protein_id="ACF69021.1"
                     /translation="MATSKLIQGDTITETTHAANGFDPATSDDKISYTSARVAKPVYN
                     KYKNSTTKPKVFGYYTDWSQYDSRLQGNMSQPGRGYDLTKVSPTAYDKLIFGFVGITG
                     FRKIDTEDRDVVAEAAALCGKVKYEPTFLDPWGDFQSYINLGFDVSGWDVDPKTVTQS
                     NAKGLLGALRDMQAKAKAAGHTLALSMSIGGWSMSNGFHETAASDSSRKIFAKGVVKL
                     FKQFPMFSEVDIDWEYPNNEGAGNPFGPEDGANYALLIAELRKQLDSAGLSNVKISIA
                     ASAVTTIFDYAKVKDLMAAGLYGINLMTYDFFGTPWAETLGHHTNRKALEEGGWAVET
                     IVDHLLAEGFSADRINIGYAGYTRNARQVEIESLSPLKGSYNPGSGPTTGSFESGTSE
                     WYDVIYSYLDLENQKGRNGFNVYTDQVADADYLYSPESKLFLSLDTPRTVKAKGEYAA
                     KLGLGGVFTWTIDQDNGVLVNAVREGLGYEIESEVIDMEPFYFEGINVEKDEEQSDSD
                     DAQKVNHAPKAAIELMVVGGSTVQLSGAGSSDEDNDELSFSWGVPSQIDVADKTAEII
                     EVVVPEVSEKTAFQFTLFVRDCYNEPSSQQRFVLTAVPALSQVQPEPEEEEEIIVPVP
                     DEEEDTTPAEDDTPADDKTSPYAQWDASTVYGANWGSFEIVSWKGHNYQVKWWSMGNQ
                     PDLNCGVGGAWTDLGAY"
     gene            20059..23055
                     /locus_tag="SeHA_C0021"
     CDS             20059..23055
                     /locus_tag="SeHA_C0021"
                     /codon_start=1
                     /transl_table=11
                     /product="putative hydroxymethyltransferase"
                     /protein_id="ACF68383.1"
                     /translation="MTISIHASAFDVNSWYQKITLTFINESGNAVDMNHAAISFTASG
                     HIDPWGNSGGTLKGNLPLTLNDSSYGTLETNNIIINNSDALLLQPGERGTLSFSLAAT
                     QVPVKMSAITLTLASSSSEDAESETPSDQETPAIPAADEQPAEPDVPEKDNDLQERGL
                     TLNVSELNTASWYQRVTFTLTNLYAQAVDLNQLQLNFTASAHPDPYSPFQGTMLGNQA
                     VTLASDGGWPIEKNTITINHDGALMLAAGDTVELQCYLAATQMPVAISDLSATLAHDP
                     ARQGKICVHFPAMTQTVALKPAIELLFPAGETRRFVGEWGEVLTISDLSAGTYRLTVP
                     VLANDEMQIAPVESSFTVTLQSGDAAAQVQVSCLPIVRYASARLMIDAPALGNAKLTV
                     DIADTTQADERTVTLIANQPQLITRLLAGHHYTVNLQPAMINNRFISAPIQLTGFIPA
                     AAQVAEVAVAYQQSALDTASFVTVDATLLGLPDGVAPQRYLFSSGKYQYSLMLESGSD
                     RQTLALRFAPGLYDVQTDDIFIDSVPWRCEQAGPLRLLQKVNHVALEFLPGVTLQVKG
                     WPDYLAHGGVTVNAPETVSLYRDIPFSALFKYDGFDGGGDPVPAAEVDVNGDGFLDYA
                     TLPIHKTVALVRQIEKEAGRSVMPVMVIYTANASGGSALADLQDAQKLRNHFGNFITQ
                     CLAAQSYKDETHPVPATFVLNPDFLGALQQGPYGYTVVRQKNSVPVNAQLAAAIQALP
                     AMAGFIAPSLPTFSDDLYGYIQAVNYLVRQFAPDVAFGWQTNVWATGTADWVLRDTAD
                     PVAEGQAIAEFIHELGVYSGEYAPDFIAFDKFERDCFSPDALAHYGWNATCWLNYLAM
                     VKQVTKSLLTPAMLWQIPGGHMPTVEEGVSKISAAHFASGGTFFMGDARIGSDPDTLS
                     LQLLNTALNSATYGVPTVGDFLRKDKGYDWGQMQALNLPDFNVFSILWGGGSTISITT
                     IHSNGEDGGWLADKMVEYYAAPRYFR"
     gene            23336..24040
                     /locus_tag="SeHA_C0022"
     CDS             23336..24040
                     /locus_tag="SeHA_C0022"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="ACF69327.1"
                     /translation="MKKMMNDAFAKDNNENSLHSFLFSQQAKPHAAIDALFSALLPFG
                     QPFTLGIGDEFYLQANDEHYIVLLESGVVSFCHDDKRLHISSSFAPSVVGMVDSYGAT
                     YNVPARPEHFLLAETVCTGRFVRLPDFIKIADECDLWHDVARCLAYRLMVMSARDREL
                     VGVDSYLKVRALLTEIWAYPQAYRESIIVLNFIQRRTGISRSRTMKILSELKKGGYIH
                     IDNGRLTALGKLPVAY"
     gene            24557..25537
                     /locus_tag="SeHA_C0023"
     CDS             24557..25537
                     /locus_tag="SeHA_C0023"
                     /note="identified by match to protein family HMM PF01609"
                     /codon_start=1
                     /transl_table=11
                     /product="IS5 transposase"
                     /protein_id="ACF66635.1"
                     /translation="MSHQLTFADSEFSTKRRQTRKEIFLSRMEQILPWQNMTAVIEPF
                     YPKAGNGRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDR
                     TTIMNFRHLLEQHQLARQLFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQQR
                     DPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVS
                     ADAGYQGAPQREELAEVDVDWLIAERPGKVKTLKQHPRKNKTAINIEYMKASIRAKVE
                     HPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANLFRVDQMIRQWERSH"
     gene            25693..26211
                     /locus_tag="SeHA_C0024"
     CDS             25693..26211
                     /locus_tag="SeHA_C0024"
                     /note="identified by match to protein family HMM PF00419"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial subunit"
                     /protein_id="ACF66380.1"
                     /translation="MVSAIAFGGMLSTAQADTTTVTGGTVNFVGQVVDAACSVSADSV
                     DQTVTLGQVRASKLTEAGMVANQKEDFTIKLEDCDTQTSQNAAVIFNGQQDANQPGSL
                     ANTAGAGSATNVALQLYGPDGQALNIGESSSTVTLNDGENVIPLSVDYIATGTATAGN
                     VTATATFSMVYS"
     gene            26171..26998
                     /locus_tag="SeHA_C0025"
     CDS             26171..26998
                     /locus_tag="SeHA_C0025"
                     /note="identified by match to protein family HMM PF00345;
                     match to protein family HMM PF02753"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein FimC"
                     /protein_id="ACF66273.1"
                     /translation="MLPRRRHLAWFIPDSLSGFFSRLLGGEKGALRASLRVTNRRHQD
                     ITQMKKNLPIFLRLLLLLSAAGLSFAAQAGGIALGATRVIYPQGSKQTSLPIINSSAS
                     NVFLIQSWVANADGSRSTDFIITPPLFVIQPKKENILRIMYVGPSLPTDRESVFYLNS
                     KAIPSVDKNKLTGNSLQIATQSVIKLFIRPKNLAEAPAHAPSTLRCRNERGQLTITNP
                     SPYYVSMVELYSAGKKLPNTMVPPKGAITLPATPGQVSLRTVNDFGATTPARVCPAS"
     gene            26958..29624
                     /locus_tag="SeHA_C0026"
     CDS             26958..29624
                     /locus_tag="SeHA_C0026"
                     /note="identified by match to protein family HMM PF00577"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane usher protein FimD"
                     /protein_id="ACF67972.1"
                     /translation="MAQRRQHAFVQLHDVMRNQLFMTRYYSSVTKPVLTPLALAIALA
                     PAPGWAENYFNPAFLSDDPSAVADLSTFSRNAQAAGMYRVDVYLNNTFLATRDIAFQA
                     VKTTGKSAPTDDSGLRACLTPEMLKNMGVNTGAFPLLAKAAAGSCPDLASAIPAARTR
                     FDFAQQRLDISIPQAAMVASARGYIPPQYWDEGINALLLNYTFTGANSQDRSPGGSAE
                     NSYFLGLNSGLNLGAWRLRDYSTWNANSGDQNSDSDWQHISTYLERDVVFLQGELTAG
                     DSYTPSALFDSLPFRGLQLASDDNMLPDSMKGFAPTIHGIARSNAQVTIRQNGYIINQ
                     RYVPPGAFTINDLYPTAASGDLTVEVKESDGSINRYNVPYSAVPILQREGRLKYAATV
                     AEYRSDSSQKEKVKFSQATLIWGLPHGFTLYGGTQLSSHYHALAIGSGANLGDWGAVS
                     LDVTQATSTLADNNTYQGQSLRFLYAKSLAQSGTNLQLMGYRYSTSGFYTLDDTTWKR
                     MSGYDDDSRTDSDKSRPEWADYYNLYYTRRGKVQLDINQQLGGLGSLFITGSQQSYWH
                     TDEKDSLLQVGYSDTLAGIAWSVSYNNNKSAGDAERDQIFALNISVPLSQWLQHDDEV
                     TRHHNVYATFSTSTDKQHNVMQNAGLSGTLLDENNLSYNIQQGYQNHGIGESGAASLE
                     YDGTKGNANIGYNVSDNGDYQQVNYGLSGGLVAHAHGVTLSQPLGNTNILIAAPGAAN
                     VGVVDQPGIHTDARGYAVVPYATTYRQNRMALDVNAMADDVDIDDAVTRVVPTEGALV
                     LASFKARVGARALVTLNHNGKPVPFGATVTVNDRHAEAIVDEAGEVYLSGLSAQGVLH
                     VRWGNLPDQQCVASYHLSSSRQILSRQHAECH"
     gene            29625..30632
                     /locus_tag="SeHA_C0027"
     CDS             29625..30632
                     /locus_tag="SeHA_C0027"
                     /note="identified by match to protein family HMM PF00419"
                     /codon_start=1
                     /transl_table=11
                     /product="mannose binding protein FimH"
                     /protein_id="ACF67346.1"
                     /translation="MKIPLLFALLAGSVVSQYAFADVCKNVNGVPSSINYDLTTTLTA
                     EQNQVGKTVQLEKSQEVNVQAVCPAGAATYSQTYRSYVSPYPVVETSGNWKYLKLDPD
                     YLEGGMRIEDSSAGDIYPPMNNVLMGYDENVKAGQPFYVRDSNLEFQLKIVKPFVGTV
                     NISPKTMFNVYVMTAAGDPLTDVVYSILYSGTVTVPQSCEINAGQTILVNFGALYSGN
                     FNHAGQKPEGVRAKKFSVPVKCSGLDSQVNLTMRLIATPDSHVPQAIASDNADVGVVV
                     ETDEGNALIPNDAQSVAPFITDSAGRANITLQAYPVSTTGETPAEGAFTALASLRVDF
                     D"
     gene            30663..31178
                     /locus_tag="SeHA_C0028"
     CDS             30663..31178
                     /locus_tag="SeHA_C0028"
                     /note="identified by match to protein family HMM PF00419"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial subunit"
                     /protein_id="ACF69006.1"
                     /translation="MGLMLCPQINASADDLAYNLEFTGTIVAQTCDIDISSLSQSIDL
                     GQFAVGDFPSTGTTTKFKPFNINLKNCSRGIAGAKIWFTGEPDPDNPALLAITDTGMG
                     SGNMLASGVGVEILNDDQDTISINNADSVVYPLKAGRNTLSFYIRYKSTRPTVTSGNA
                     TAVMYFDMQYE"
     gene            31194..31712
                     /locus_tag="SeHA_C0029"
     CDS             31194..31712
                     /locus_tag="SeHA_C0029"
                     /note="identified by match to protein family HMM PF00419"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial subunit"
                     /protein_id="ACF68340.1"
                     /translation="MRNDILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPGSEN
                     INVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTASGVTVSFSGAADSRNTDLLALT
                     AGESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQASAHLQFYARYLADGGAVTPGD
                     ANASATFILAYE"
     gene            31774..32409
                     /locus_tag="SeHA_C0030"
     CDS             31774..32409
                     /locus_tag="SeHA_C0030"
                     /note="identified by match to protein family HMM PF00345;
                     match to protein family HMM PF02753"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial chaparone"
                     /protein_id="ACF69986.1"
                     /translation="MVIGGTRFIYHAGAPALSVPVSNHSEASWLIDTHILPGGRWPGT
                     KNEGNIMPFVVTPPLFMLSARQENSMRVVYTGAPLPADRESLFTLSIAAIPSGKPEAN
                     RVQMAFRSALKLLYRPEGLAGNPQQAYRHLIWSLTPDGATVRNPTPYYVTLFLLRANE
                     RAQDNAGVVAPFATRQTDWCRHTVRCTVRWQSINDYGRVMPAQTVDLTRIH"
     gene            32474..33319
                     /locus_tag="SeHA_C0031"
     CDS             32474..33319
                     /locus_tag="SeHA_C0031"
                     /note="identified by match to protein family HMM PF01323"
                     /codon_start=1
                     /transl_table=11
                     /product="BcfH"
                     /protein_id="ACF66934.1"
                     /translation="MYYHALKISRLAMLTLAGVAVSASAIAADSAPTSQIGPTAEAYI
                     VSHPDKVGEVVATYLAEHPEFLVAASETLHQRHQIAQQQAYVQLALQYRAELLSSSSP
                     SVGPNEAKAAVVMFFDYQCSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGL
                     AARVGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEA
                     QSSGAAHDALLTNQALAQHMDFSGTPAFVVMPQTQNGDVKRVTVIPGSTTQDMLQMAI
                     QKAKG"
     gene            33358..33645
                     /locus_tag="SeHA_C0032"
                     /note="conserved hypothetical protein; this gene contains
                     a frame shift which may be the result of sequencing error"
                     /pseudo
     gene            complement(33745..34194)
                     /locus_tag="SeHA_C0033"
     CDS             complement(33745..34194)
                     /locus_tag="SeHA_C0033"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF67923.1"
                     /translation="MRQHKINNEFIYNESLREITSLRSNAAFKMTFMRAWCLSYLIEN
                     AHQELIIREGVAYAVWGERSQFVSDANLTQLLYLLRRDLQQIGLFELFVTLPRQGIKT
                     DERFIIDAADIPPQAIQYHTHRCNKIISIGIPTLFLLIVLFFLAPFI"
     gene            34942..35154
                     /locus_tag="SeHA_C0034"
                     /note="putative arylsulfatase; this gene contains a
                     premature stop which may be the result of sequencing
                     error"
                     /pseudo
     gene            35179..35526
                     /locus_tag="SeHA_C0035"
                     /note="conserved hypothetical protein; this gene contains
                     a premature stop which may be the result of sequencing
                     error"
                     /pseudo
     gene            complement(35657..35776)
                     /locus_tag="SeHA_C0036"
     CDS             complement(35657..35776)
                     /locus_tag="SeHA_C0036"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF68852.1"
                     /translation="MQLYRCKQYLKTCQHSHHNNGALHHTIIDMTMITCSAMF"
     gene            36110..36874
                     /locus_tag="SeHA_C0037"
     CDS             36110..36874
                     /locus_tag="SeHA_C0037"
                     /note="identified by match to protein family HMM PF07135"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF68408.1"
                     /translation="MSLIKRTVLFSLLLTISTVFSHSVHALEYKNSFGSINAGYADWN
                     SGFVNVHRGEVWKVTADFGVNFKEAEFYSFIESNVLNHAVAGRNHTVSAMTHVRLFDS
                     DYTFFGKIYGQWDNSWGDDLDMFYGAGYLGWSGSWGFFKPYIGLHNQSGDYVSQKYGQ
                     TSGWNGYVIGWTAAYNFNLFGEDFVLSDWNEIELDRNDAYTEQQFGRNGLNGGLTLAW
                     KFYPRWKATVTYRYFANKLGYDGYGDQMIYMVGYSF"
     gene            36895..38388
                     /locus_tag="SeHA_C0038"
     CDS             36895..38388
                     /locus_tag="SeHA_C0038"
                     /note="identified by match to protein family HMM PF00884"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="ACF70050.1"
                     /translation="MKKTVIASMIGLALCATSTLSVVHAAAEKRPNLVFIVADDLGYG
                     DLATYGHQIVKTPNIDRLAKEGVKFTEYYAPAPLCSPSRAGMLTGRMPFRTGVRSWIP
                     EGTNVSIGRNELTIANLLKQQGYDTAMMGKLHLNAGGDRTDQPQPKELGFDYSLVNPA
                     GFVTDATLDNAKERPRYGVVHPTGWMRNGKHIDRADSISGEFVSSEVVNWLDNKKDDK
                     PFFLYVAFTEVHSPLASPKKYLDMYSQYMSEYQKQHPDLFYGDWADKPWRGTGEYYAN
                     ISYMDAQVGKVLDKIKAMGEEDNTIVIFTSDNGPVTREARKVYELNLAGETDGLRGRK
                     DNLWEGGIRVPAIIKYGKHIPQGVVTDTPVYGLDWMPTLANMMDFKLPTDRTYDGQSL
                     VPLLEQKTLKRNKPLIFGIDMPFQDDPTDEWAIRDGDWKMIIDRENKPKYLYNLKKDR
                     FETLNQIGKQPEIEKQLYGKFLKMKQDIDNDSLMKARGDKPTPVTWG"
     gene            38492..39688
                     /locus_tag="SeHA_C0039"
     CDS             38492..39688
                     /locus_tag="SeHA_C0039"
                     /note="identified by match to protein family HMM PF04055"
                     /codon_start=1
                     /transl_table=11
                     /product="chondroitin sulfate/heparin utilization
                     regulation protein"
                     /protein_id="ACF70293.1"
                     /translation="MQRKSCQVMIKPTGSVCNLDCKYCFYLEKEMLYPDRKNHYKMTE
                     ETLALFVQQHIAAQDVDEVIFAWQGGEPTLMGLPFYRQAVALQQRYANGKAIVNTFQT
                     NGILIDDEWARFFRAHDFLVGISIDGDAALHDEWRVTRAGQPTHHKVEQAIKCLASHG
                     VEFNTLTVVSQSNMLHPQRVYAYLKSIGSRYMQFIPLVERAANKDGMLAHPQDEQTAV
                     TPWSVDGLQFGKFLNAIFDIWIREDIGDIGIQLFEQTLAAWCGLPPQVCVFAPVCGSA
                     FAMEMNGDVYNCDHFVYPQYKLGNINDTPLRQMNNSAQNQQFGLDKSRTMAQECHTCP
                     WQFACYGGCPKHRFLPSACGPMKQNYLCAGYQCFFSHTAPMMKAMKTLYVNNLSPAEI
                     RSVFFK"
     gene            39706..40959
                     /locus_tag="SeHA_C0040"
     CDS             39706..40959
                     /locus_tag="SeHA_C0040"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="ACF69642.1"
                     /translation="MFANINVDCCKTPGCKNLGVLNSPDYVRQGKDVLCRECGFLFPV
                     ISAGALNLFRHTVNRGWKGLVKQCPACGSTSLKKYGFSTQGEHRMACSQCRKTFIVPE
                     KAKSDCRQDELATLIEEGTSLAGIRSQLKLDSTGLNRALFKLSRNANLAERCQQFPAF
                     DIALSTRAFRVNYNGGDSSLYVLVTAEEQSGRVVAISSNYSAQPLDKAWQYQSYYEER
                     LPPGTLAHMVQRKEAITARRETLFDIDYGPASLYKNDSGMIVKPVLPAYRHFELVRML
                     TDERSLNVQHYLDHECFILGGCMMANMPHVHQGRCHISFVKERGTTPLQKDIPPRLFL
                     SGGIRNNVWRTFSTRDYAMAVCNLTGNKKITQQRYATLQGATAFINYLYAHPFLAQLN
                     RLSPANVTATLDYLKYEYNQSRKVG"
     gene            41078..41484
                     /locus_tag="SeHA_C0041"
                     /note="putative sulfatase; this gene contains a frame
                     shift which may be the result of sequencing error"
                     /pseudo
     gene            41647..42813
                     /gene="nhaA"
                     /locus_tag="SeHA_C0043"
     CDS             41647..42813
                     /gene="nhaA"
                     /locus_tag="SeHA_C0043"
                     /note="identified by match to protein family HMM PF06965;
                     match to protein family HMM TIGR00773"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ antiporter NhaA"
                     /protein_id="ACF67682.1"
                     /translation="MKHLHRFFSSDASGGIILIIAAALAMLMANMGATSGWYHDFLET
                     PVQLRVGALEINKNMLLWINDALMAVFFLLIGLEVKRELMQGSLASLRQAAFPVIAAI
                     GGMIVPALLYLAFNYSDPVTREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALA
                     IIDDLGAIVIIALFYTSDLSIVSLGVAAFAIAVLALLNLCGVRRTGVYILVGAVLWTA
                     VLKSGVHATLAGVIVGFFIPLKEKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSL
                     QGVTIDGLTSMLPLGIIAGLLIGKPLGISLFCWLALRFKLAHLPQGTTYQQIMAVGIL
                     CGIGFTMSIFIASLAFGNVDPELINWAKLGILIGSLLSAVVGYSWLRARLNAPA"
     gene            42881..43774
                     /locus_tag="SeHA_C0044"
     CDS             42881..43774
                     /locus_tag="SeHA_C0044"
                     /note="identified by match to protein family HMM PF00126"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator protein NhaR"
                     /protein_id="ACF67063.1"
                     /translation="MSHINYNHLYYFWHVYKEGSVVGAAEALFLTPQTITGQIKALEE
                     RLQGKLFKRKGRGLEPSELGELVFRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADA
                     LSKRLVSSVLDAAVVVDEPIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGL
                     FSVKIGECSVSFWCTNPLPEKAFPACLEERRLLVPGRRSMLGRKLLNWFNSQGLQVEI
                     LGEFDDAALMKAFGATHDAIFVAPSLYSLDFYADESVIEIGRVENVMEEYHAIFAERM
                     IQHPAVQRICNADYSALFKLQ"
     gene            complement(43829..45868)
                     /locus_tag="SeHA_C0045"
     CDS             complement(43829..45868)
                     /locus_tag="SeHA_C0045"
                     /note="identified by match to protein family HMM PF01055"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase, family 31"
                     /protein_id="ACF69958.1"
                     /translation="MPFMQQDPRRLVWQQNDRYLWIEPWGENSLRVRSGRHLPVMRNE
                     DWALTEPVAESQCHIDYEHHQATLTNGKIIAIVNQKGQVTFYRHPHKPLLQEFWRLRG
                     EIGEDESSHGQYVSALNLEGREFRPIQGGKYSLKARFEATEGEKIYGMGQYQQANLDL
                     KGCVLELAQRNSQASVPFMLSSLGYGFLWNNPAVGRVTFAQNVTEWEAQVSEQLDYWI
                     TAGDTPAEISRAYALATGTPPMMPDYAMGFWQCKLRYRTQEELLEVAREYKRRNLPIS
                     VIVIDFFHWPNQGDWMFDARDWPDPDAMIAELKSLGIELMVSVWPTVDNRTESYREMR
                     ENGWLVQTERGLPINMDFLGNTTYFDATHPGARDYVWGKAKRNYYDKGVKLFWLDEAE
                     PEFSVYDYDNYRYHAGPVLEVGNIYPRMYAKTFFDGMKADGEDQVINLLRCAWAGSQK
                     FGALVWSGDIHSSFRSLRNQFAAGLNMGIAGIPWWTTDIGGFHGGNIHDPKFHELLIR
                     WFQWGVFSPVMRLHGNRDPQILPAQPYRDGIAQCPTGAPNEVWSYGEEVCEVLTGCLA
                     LREKLKPYIKALMEETHKHNTPVMRPLFFEFPEQETSWAITDQYCFGPDLLIAPVMHE
                     GMRERDIWLPEGETWTDLATGESYSGGQTLHYATPLNRIPVFIREGGQYRSLLNL"
     gene            complement(45908..47281)
                     /locus_tag="SeHA_C0046"
     CDS             complement(45908..47281)
                     /locus_tag="SeHA_C0046"
                     /note="identified by match to protein family HMM
                     TIGR00792"
                     /codon_start=1
                     /transl_table=11
                     /product="xylose-proton symporter"
                     /protein_id="ACF67313.1"
                     /translation="MSSVIEDTQPSGSASLSLLQRISYGSLDVAGNLLYCFGSTYILY
                     FYTDVAGISLAVAGVILLLARIIDGIDAPIWGIIIDKTRSRYGKCRPWFLWLPLPFAV
                     FSALSFWSPDISMTGKAIYAAISYMIASILFTGLNTPLSAILPLMTLSPKERLVLNSW
                     RMTGGQIGVLLMNATALPLVAFLGNGDDHAGFIYTAITFAIISCALTLFAFKNIREMD
                     TDKIQHEPKLPMKKSFAAMKGNWPWILMVLANLIFWIALQQRNTTIVYYLTYNLDRKD
                     LVPLINSLATIQILFIIAIPFFSKYLAKTWIWVGGLLVATFGGVMMWLAADNITFLIA
                     AWILGNIGSGIACSMPFAMLGFAVDFGAWKTGIKATGILIAFGSTFCIKMGSGLGTAF
                     AAWIMNSFGYVPNHAQSAAGLEGIIWAFIWAPALLFALAAIPLLFFRKYEAMEEKIRH
                     DLETVNS"
     gene            complement(47737..48000)
                     /gene="rpsT"
                     /locus_tag="SeHA_C0047"
     CDS             complement(47737..48000)
                     /gene="rpsT"
                     /locus_tag="SeHA_C0047"
                     /note="identified by match to protein family HMM PF01649;
                     match to protein family HMM TIGR00029"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S20"
                     /protein_id="ACF66648.1"
                     /translation="MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDK
                     AAALKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
     gene            48329..49267
                     /gene="ribF"
                     /locus_tag="SeHA_C0048"
     CDS             48329..49267
                     /gene="ribF"
                     /locus_tag="SeHA_C0048"
                     /EC_number="2.7.1.26"
                     /EC_number="2.7.7.2"
                     /note="identified by match to protein family HMM PF01687;
                     match to protein family HMM PF06574; match to protein
                     family HMM TIGR00083"
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin biosynthesis protein RibF"
                     /protein_id="ACF66538.1"
                     /translation="MKLIRGIHNLSQAPHGCVLTIGNFDGVHRGHRALLQGLQEEGRR
                     RGLPVVVMIFEPQPLELFATDKAPARLTRLREKLYYLAQCGVDYVLCVKFDRRFAALT
                     AQTFISELLVERLGVQFLAVGDDFRFGASRAGDFLLLQKAGAEYGFAVSSTQTFCEGG
                     VRISSTAVRQALAEDNLALAESLLGHPFTISGRVVHGDELGRTIGFPTANLPLRRQVS
                     PVKGVYAVEVTGLGDKPLPGVANIGTRPTVAGVRQQLEVHLLDVVMDLYGRHIDVILR
                     KKIRNEQRFASLDELKAQIARDELTARKFFGLAGQV"
     gene            49276..52146
                     /gene="ileS"
                     /locus_tag="SeHA_C0049"
     CDS             49276..52146
                     /gene="ileS"
                     /locus_tag="SeHA_C0049"
                     /EC_number="6.1.1.5"
                     /note="identified by match to protein family HMM PF00133;
                     match to protein family HMM PF06827; match to protein
                     family HMM PF08264; match to protein family HMM PF09334;
                     match to protein family HMM TIGR00392"
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucyl-tRNA synthetase"
                     /protein_id="ACF65953.1"
                     /translation="MFIKPKYGTENLMSDYKSTLNLPETGFPMRGDLAKREPGMLARW
                     TDDDLYGIIRAAKKGKKTFILHDGPPYANGSIHIGHSVNKILKDIIVKSKGLSGFDSP
                     YVPGWDCHGLPIELKVEQEFGKPGEKFTAAEFRAKCREYAATQVDGQRKDFIRLGVLG
                     DWSHPYLTMDFKTEANIIRALGRIIKNGHLHKGAKPVHWCVDCRSALAEAEVEYYDKT
                     SPSIDVAFRAVDQDAVKAKFGLPGVSGPVSLVIWTTTPWTLPANRAISLAPDFDYALV
                     QIDGQAVILAKDLVESVMQRIGAAEYTILGTVKGAELELLRFTHPFMGFDVPAILGDH
                     VTLDAGTGAVHTAPGHGPDDYVIGQKYGLETANPVGPDGAYLPGTYPTLDGVNVFKAN
                     DIVIELLKEKGALLHVEKMQHSYPCCWRHKTPIIFRATPQWFVSMDKEGLRQQSLKEI
                     KGVQWIPDWGQARIESMVANRPDWCISRQRTWGVPMSLFVHKETQELLPIERTLAAME
                     EVAKRVEVDGIQAWWDLDPKEILGEDADQYEKVPDTLDVWFDSGSTSYSVVDARPEFA
                     GHAADMYLEGSDQHRGWFMSSLMISVAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNT
                     VSPQDVMNKLGADILRLWVASTDYTGEMAVSDEILKRAADSYRRIRNTARFLLANLNG
                     FNPATDMVKPEEMVVLDRWAVGCAKTAQQEILKAYEAYDFHEVVQRLMRFCSVEMGSF
                     YLDIIKDRQYTAKADSVARRSCQTALYHIAEALVRWMAPIMSFTADEIWGYLPGEREK
                     YVFTGEWYDGLFGLEENEEFNDAFWDDVRYIKDQVNKELENQKANGIKSNLEAKVTLK
                     YADDANGTIKKLKLLGEEVRFIFITSQFVISEQAGGIDDENIQYNAGNTTVQAVVTRA
                     EGDKCPRCWHYTTDVGKVAEHADICGRCVSNIAGNGEQRKFA"
     gene            52146..52646
                     /gene="lspA"
                     /locus_tag="SeHA_C0050"
     CDS             52146..52646
                     /gene="lspA"
                     /locus_tag="SeHA_C0050"
                     /EC_number="3.4.23.36"
                     /note="identified by match to protein family HMM PF01252;
                     match to protein family HMM TIGR00077"
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase II"
                     /protein_id="ACF67840.1"
                     /translation="MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFP
                     SLNLHYARNYGAAFSFLADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYA
                     LIIGGALGNLFDRLWHGFVVDMIDFYVGNWHFATFNLADSAICIGAALIVLEGFLPKP
                     TAKEQA"
     gene            52660..52791
                     /locus_tag="SeHA_C0051"
     CDS             52660..52791
                     /locus_tag="SeHA_C0051"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF67176.1"
                     /translation="MALIRFCRPGKRSAIRQTWCRMAVKTPYPAYGFIVLYASGQNT"
     gene            52801..53250
                     /gene="fkpB"
                     /locus_tag="SeHA_C0052"
     CDS             52801..53250
                     /gene="fkpB"
                     /locus_tag="SeHA_C0052"
                     /EC_number="5.2.1.8"
                     /note="identified by match to protein family HMM PF00254"
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type 16 kDa peptidyl-prolyl cis-trans
                     isomerase"
                     /protein_id="ACF69102.1"
                     /translation="MSKSVQSNSAILVHFTLKLDDGSTAESTRNNGKPALFRLGDTSL
                     SEGLEQQLLGLKEGEKKAFSLEPDAAFGVPSPDLIQYFSRREFMAAGEPEVGAIMLFT
                     AMDGSEMPGVIREINGDSITVDFNHPLAGHTVHFDIEVLEIDPALEA"
     gene            53253..54203
                     /gene="ispH"
                     /locus_tag="SeHA_C0053"
     CDS             53253..54203
                     /gene="ispH"
                     /locus_tag="SeHA_C0053"
                     /EC_number="1.17.1.2"
                     /note="identified by match to protein family HMM PF02401;
                     match to protein family HMM TIGR00216"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /protein_id="ACF68506.1"
                     /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRY
                     VVDSLRQRGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKV
                     HMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGK
                     LSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVL
                     VVGSKNSSNSNRLAELAQRMGRTAFLIDDAADIQEAWVKEAACVGVTAGASAPDILVQ
                     NVIARLREFGGGEAVTLEGREENIVFEVPKELRVDVREVE"
     gene            54403..55605
                     /locus_tag="SeHA_C0054"
     CDS             54403..55605
                     /locus_tag="SeHA_C0054"
                     /codon_start=1
                     /transl_table=11
                     /product="putative nitrite reductase"
                     /protein_id="ACF70479.1"
                     /translation="MGKIKYGLPTLLAIGFWMDATSATVLELPAWERNYTGTIAGKPV
                     NVNITRFGNSLNGYYCYEPCNQHKAVIVLRGSLQDKEVHLEERVKALSGYWNAEISSS
                     EIKGEWTSADKKRHFPVALIYYKPKNSPDIVLVTNTNDAGGYDPSKEIDCGNTPAISA
                     IKLYRDGKLIQTLDTASVGTCSPFMPQWGDVNFDGYPDLSIVTELLAGPDAPVQTWLY
                     DPAKQRYVDAPASYQEITSPEIDAEHKQIVSYWRGGCCSHGVNVYRWKGKTIELIDRG
                     ESYFQPVISKGKMYNCYMTPSYADGRIIYPLVRKNGHLTPPLSLDGTCQSFWLTGNVR
                     TVIQAEKPGAEPESLEIQWQENKASPGRFCPLVPFVEGDKLSPRLVTDDDVPDACISR
                     AEYEDIKQ"
     gene            55621..56541
                     /locus_tag="SeHA_C0055"
     CDS             55621..56541
                     /locus_tag="SeHA_C0055"
                     /EC_number="3.2.-.-"
                     /note="identified by match to protein family HMM PF01156"
                     /codon_start=1
                     /transl_table=11
                     /product="Non-specific ribonucleoside hydrolase RihC"
                     /protein_id="ACF70008.1"
                     /translation="MTASLHIILDTDPGIDDAAAIAAALFAPQLDLQLITTVAGNVSV
                     EKTTRNALQLLHFWNSDIPLAQGAATPLLRPLRDAAYVHGESGMEGYDFVDHQRQPLA
                     KPAFIAIRDVLMNAPEPMTLVAIGPLTNIALLLMHYPECACNIRRLVLMGGSAGRGNF
                     TPNAEFNIAVDPEAAALVFRSGLEIVMCGLDVTNQAMLSPDFLNKLPALNRTGKMLHS
                     LFNHYRSGSMRTGVRMHDLCAIAWLVRPELFTLQSCFVAVETQGQYTAGTTVVDIEGR
                     LGQPANAQVALALDVDGFRQWVAEVFACAP"
     gene            complement(56563..57249)
                     /locus_tag="SeHA_C0056"
     CDS             complement(56563..57249)
                     /locus_tag="SeHA_C0056"
                     /note="identified by match to protein family HMM PF00072"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulatory protein CitB"
                     /protein_id="ACF66836.1"
                     /translation="MDSITTLIVEDEPMLAEILVDTIKLFPQFSIVGIADKLESAKKQ
                     IRLYQPQLILLDNFLPDGKGIDLIRHTISTNYTGRIIFITADNHMDTISDALRMGVFD
                     YLIKPVHYQRLQHTLERFTRYRSSLRSSEQANQTHVDALFNIQAKEQTAEPNSGLRGI
                     DENTFNRVRQIFADPQAVHTADTLAQILGSSKTTARRYLEQGVKNNFLEAEISYGKVG
                     RPERLYRGKV"
     gene            complement(57251..58909)
                     /locus_tag="SeHA_C0057"
     CDS             complement(57251..58909)
                     /locus_tag="SeHA_C0057"
                     /EC_number="2.7.13.3"
                     /note="identified by match to protein family HMM PF02518"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor kinase DpiB"
                     /protein_id="ACF66636.1"
                     /translation="MQENTVIKYLNTNMFIREITRWFARRSFQNRIFLLILFTSTIVM
                     LAITWYLTDITKERLHYQVGQRALIQAMQISAMPELVEAVEAHDLSRIKALIDPMRSF
                     SDATYITVGNEKGQRLYHVNPDEIGKYMEGGDSDDALYNAKSYVSVRKGSLGSSLRGK
                     SPIQDSTGKVIGIVSVGYTLEQLESWLNLQISSLLFPMALLLLVLLYCARRFSLHIKK
                     QMLNMEPQQLSQLLIQQSVLFESVFEGLIAIDSHHRITAINQTARRLLNLSQPESELI
                     GYAIHHIVLPEAFFYDAPQKNKKDEIVTFNQMKVIASRMAVIIDNQPQGWVISFRNKD
                     DINTLSLQLSQVRQYADNLRAVQHEHRNLISTIAGLLFLKRYDNALALIQQQSESHQK
                     VLDFISHNFRDHHLAGLLIGKYYRAKELGLELIFDPSSFVEHLPSSLSHNEWISIVGN
                     LLDNAYNATLLNREGSRQIECLINSEGNEVIIEVADQGCGIDENIRQHIFERGVTTHN
                     NGDHGIGLWLVHSYVKQANGDIIVDNNNPFGTIFTLYIPFTREE"
     gene            complement(59005..60306)
                     /locus_tag="SeHA_C0058"
     CDS             complement(59005..60306)
                     /locus_tag="SeHA_C0058"
                     /EC_number="4.1.1.3"
                     /note="identified by match to protein family HMM PF03977;
                     match to protein family HMM TIGR01109"
                     /codon_start=1
                     /transl_table=11
                     /product="oxaloacetate decarboxylase beta chain"
                     /protein_id="ACF66672.1"
                     /translation="MESLNALLQGMGLMHLGAGQAIMLLVSLLLLWLAIAKKFEPLLL
                     LPIGFGGLLSNIPEAGMALTALESLLAHHDAGQLAVIAAKLNCAPDVHAIKEALALAL
                     PSVQGQMENLAVDMGYTPGVLALFYKVAIGSGVAPLVIFMGVGAMTDFGPLLANPRTL
                     LLGAAAQFGIFATVLGALTLNYFGIISFTLPQAAAIGIIGGADGPTAIYLSGKLAPEL
                     LGAIAVAAYSYMALVPLIQPPIMRALTTETERKIRMVQLRTVSKREKILFPVVLLLLV
                     ALLLPDAAPLLGMFCFGNLMRESGVVERLSDTVQNGLINIVTIFLGLSVGAKLVADKF
                     LQPQTLGILLLGVVAFGIGTAAGVLMAKLLNLCSKNKINPLIGSAGVSAVPMAARVSN
                     KVGLESDPQNFLLMHAMGPNVAGVIGSAIAAGVMLKYVLAM"
     gene            complement(60319..62094)
                     /gene="oadA"
                     /locus_tag="SeHA_C0059"
     CDS             complement(60319..62094)
                     /gene="oadA"
                     /locus_tag="SeHA_C0059"
                     /EC_number="4.1.1.3"
                     /note="identified by match to protein family HMM PF00364;
                     match to protein family HMM PF00682; match to protein
                     family HMM PF02436; match to protein family HMM TIGR01108"
                     /codon_start=1
                     /transl_table=11
                     /product="oxaloacetate decarboxylase alpha subunit"
                     /protein_id="ACF69364.1"
                     /translation="MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAALDDVGYGSLEC
                     WGGATFDACIRFLGEDPWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVE
                     RAVKNGMDVFRVFDAMNDPRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTE
                     QLLETGVDSIAIKDMSGILTPMAAYELVSEIKKRYDVRLHLHCHATTGMAEMALLKAI
                     EAGVDGVDTAISSMSATYGHPATEALVATLAGTKYDTGLDILKLENIAAYFREVRKKY
                     HAFEGQLKGYDSRILVAQVPGGMLTNLESQLKQQNAADRLDQVLAEIPRVREDLGFIP
                     LVTPTSQIVGTQAVLNVLTGERYKTIAKETAGILKGEYGHTPVPVNAGLQARVLEGGA
                     PVTCRPADLLKPELAELEADVRRQAQEKGIQLAGNAIDDVLTVALFPQIGLKFLENRH
                     NPAAFEPLPQAEAAQPVAKAEKSAASGIYTVEVEGKVFVVKVSDGGDISQLTAAVPAA
                     SSAPVQAAAPAGAGTPVTAPLAGNIWKVIATEGQTVAEGDVLLILEAMKMETEIRAAQ
                     AGTVRGIAVKSGDAVSVGDTLMTLA"
     gene            complement(62111..62350)
                     /locus_tag="SeHA_C0060"
     CDS             complement(62111..62350)
                     /locus_tag="SeHA_C0060"
                     /EC_number="4.1.1.3"
                     /note="identified by match to protein family HMM PF04277;
                     match to protein family HMM TIGR01195"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF66121.1"
                     /translation="MNEAVLLGEGFTLMFLGMGFVLSFLFLLIFAIRGMSAVITRFFS
                     EPVAAPAPRAVPVVDDFTRLKPVIAAAIHHHRHHV"
     gene            complement(62509..63849)
                     /locus_tag="SeHA_C0061"
     CDS             complement(62509..63849)
                     /locus_tag="SeHA_C0061"
                     /note="identified by match to protein family HMM PF03390;
                     match to protein family HMM TIGR00783"
                     /codon_start=1
                     /transl_table=11
                     /product="citrate-sodium symporter"
                     /protein_id="ACF66024.1"
                     /translation="MTNMTQASATEKKGASDLLRFKIFGMPLPLYAFALITLLLSHFY
                     NAIPTDLVGGFALMFVMGAIFGEIGKRLPIFNKYIGGAPVMIFLVAAYFVYAGIFTQK
                     EIDAISNVMDKSNFLNLFIAVLITGAILSVNRKLLLKSLLGYIPTILAGIVGASLFGI
                     VIGLCFGIPVDRIMMLYVLPIMGGGNGAGAVPLSEIYHSVTGRSREEYYSTAIAILTI
                     ANIFAIIFAALLDMIGKKYTWLSGEGELVRKASFKTEDDEKAGQITHRETAVGMVLST
                     TCFLLAYVVAKKILPSIGGVSIHYFAWMVLIVAALNASGLCSPEIKAGAKRLSDFFSK
                     QLLWVLMVGVGVCYTDLQEIIDALTFANVVIAAIIVVGAVVGAAIGGWLIGFYPIESS
                     ITAGLCMANRGGSGDLEVLSACNRMNLISYAQISSRLGGGIVLVIASIVFSMMV"
     gene            64106..65137
                     /gene="citC"
                     /locus_tag="SeHA_C0062"
     CDS             64106..65137
                     /gene="citC"
                     /locus_tag="SeHA_C0062"
                     /EC_number="6.2.1.22"
                     /note="identified by match to protein family HMM PF00583;
                     match to protein family HMM PF08218; match to protein
                     family HMM TIGR00124; match to protein family HMM
                     TIGR00125"
                     /codon_start=1
                     /transl_table=11
                     /product="[citrate (pro-3S)-lyase] ligase"
                     /protein_id="ACF67502.1"
                     /translation="MNLIFKRIYLQKDVLRRESVAMFLEGVGLALEDDCEIAVCAYWQ
                     GEIVGCGSLAGNVLKCIAVSPVLQGEGLSLKLLTELLTLAYELNRSELFLFTKPQNRL
                     LFSGAGFWPIAQAGELAVLMENSSERLARFCRQLALYRQPGKTIGAIVMNANPFTLGH
                     RYLVEQAAAACDWLHLFVVKEDASFFSYTDRWALIEQGIAGIDNVTLHSGSAYMISRA
                     TFPGYFLKEKGVVDDCHCQIDLQLFREHLAPALGITHRFVGSEPFCPLTCAYNQRMHD
                     ILHDPKRSGPVIEVVELARVEKNGTAISASRVRKLYSERNWPAISALVPAGTLAYLQR
                     HAARHTETI"
     gene            65167..65460
                     /gene="citD"
                     /locus_tag="SeHA_C0063"
     CDS             65167..65460
                     /gene="citD"
                     /locus_tag="SeHA_C0063"
                     /EC_number="4.1.3.6"
                     /note="identified by match to protein family HMM PF04953;
                     match to protein family HMM TIGR01608"
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase acyl carrier protein"
                     /protein_id="ACF68149.1"
                     /translation="MKIIKDALAGTLESSDVMIRIGPSSEPGIRLELESLVKQQFGAA
                     IEQVVRETLAKLGVERALVSVDDKGALECILRARVQAAALRAAEQTEIQWSAL"
     gene            65457..66326
                     /gene="citE"
                     /locus_tag="SeHA_C0064"
     CDS             65457..66326
                     /gene="citE"
                     /locus_tag="SeHA_C0064"
                     /EC_number="4.1.3.6"
                     /note="identified by match to protein family HMM PF03328;
                     match to protein family HMM TIGR01588"
                     /codon_start=1
                     /transl_table=11
                     /product="citrate (pro-3S)-lyase, beta subunit"
                     /protein_id="ACF68231.1"
                     /translation="MRPRRSMLFIPGANAAMLSTSFVYGADAVMFDLEDAVALREKDT
                     ARLLVHHALQHPFYQDVEKVVRINPLNTPFGLADLEAVVRGGADIVRLPKTDSKNDVL
                     ELEAQVERIERECGRAVGSTRLMAAIESAKGVVNAVDIATSSPRMVAIALAAFDYVMD
                     MGTCRGDGTELFYARCAVLHAARVAGIAAYDVVWSDINNEEGFLKEVQLAKGLGFNGK
                     SLVNPRQIELLHQAYSPTRKEVEHAYEVIAAAEEAESRGLGVVSLNGKMIDGPIIDHA
                     RKVVALSASGIRD"
     gene            66337..67857
                     /gene="citF"
                     /locus_tag="SeHA_C0065"
     CDS             66337..67857
                     /gene="citF"
                     /locus_tag="SeHA_C0065"
                     /EC_number="2.8.3.10"
                     /note="identified by match to protein family HMM PF04223;
                     match to protein family HMM TIGR01584"
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase, alpha subunit"
                     /protein_id="ACF68365.1"
                     /translation="MKETVTMLNQQYVVPEGLQPYQGVTANSPWLASETEKRRRKICD
                     SLEEAIRRSGLKNGMTISFHHAFRGGDKVVNMVMAKLAEMGFRDLTLASSSLIDAHWP
                     LIEHIKNGVVRQIYTSGLRGKLGEEISAGLMENPVQIHSHGGRVKLIQSGELNIDVAF
                     LGVPCCDEFGNANGFSGKSRCGSLGYAQVDAQYAKCVVLLTEEWVEFPNYPASIAQDQ
                     VDLIVQVDEVGDPEKITAGAIRLSSNPRELLIARQAANVIEHSGYFCDGFSLQTGTGG
                     ASLAVTRFLEDKMRRHNITASFGLGGITGTMVDLHEKGLIKALLDTQSFDGDAARSLA
                     QNPHHIEISTNQYANPVSKGAACERLNVVMLSALEIDVNFNVNVMTGSNGVLRGASGG
                     HSDTAAGADLTIITAPLVRGRIPCVVEKVLTTVTPGASVDVLVTDHGIAVNPARQDLL
                     DNLRAAGVALMTIEQLQQRAEQLTGKPQPIEFTDRVVAVVRYRDGSVIDVIRQVKG"
     gene            67857..68408
                     /gene="citX"
                     /locus_tag="SeHA_C0066"
     CDS             67857..68408
                     /gene="citX"
                     /locus_tag="SeHA_C0066"
                     /EC_number="2.7.7.61"
                     /note="identified by match to protein family HMM PF03802;
                     match to protein family HMM TIGR03124"
                     /codon_start=1
                     /transl_table=11
                     /product="holo-ACP synthase CitX"
                     /protein_id="ACF70307.1"
                     /translation="MKGTDLLYQGQAVTLEEMLQARDKRAARQRQALNCYRLPLISLT
                     LVAPGAVKNSAVWRRVADYAIAEILALCEQKEWVNVWEMQVNERSGPEWMAAVCAPAM
                     ALKQHMSTLEMSHPLGRLWDIDIIDSDGKSLSRRELGYPARPCLICQQDAHLCARGKH
                     HTLDLLLDEIARRIECYERERCD"
     gene            68386..69294
                     /gene="citG"
                     /locus_tag="SeHA_C0067"
     CDS             68386..69294
                     /gene="citG"
                     /locus_tag="SeHA_C0067"
                     /EC_number="2.4.2.52"
                     /note="identified by match to protein family HMM PF01874;
                     match to protein family HMM TIGR03125"
                     /codon_start=1
                     /transl_table=11
                     /product="triphosphoribosyl-dephospho-CoA synthase CitG"
                     /protein_id="ACF67343.1"
                     /translation="MNVSVVTERRTPAYSSLAAGELNGLVARALLTEARLTPKPGLVD
                     IRNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAALAAENVLVMLRPLGMACEND
                     MLQATNGVNTHRGAIFAFGLLSAAIGRLLARGEPLEQNRICDQVARLSRNIVAHELSA
                     KKAGKLTKSETHFQCYGLSGARGEAESGFRTVRTQALPVFNRVVQEHDDTHLALLQTL
                     LHLMAWNDDTNLVSRGGLEGLYYVQQQAQKLLWQGGVLVEGGIEAMQSLDDELILRNL
                     SPGGSADLLAVTWFLSHFPAGSLYPE"
     gene            69474..70295
                     /gene="dapB"
                     /locus_tag="SeHA_C0068"
     CDS             69474..70295
                     /gene="dapB"
                     /locus_tag="SeHA_C0068"
                     /EC_number="1.17.1.8"
                     /note="identified by match to protein family HMM PF01113;
                     match to protein family HMM PF05173; match to protein
                     family HMM TIGR00036"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate reductase"
                     /protein_id="ACF69200.1"
                     /translation="MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSL
                     LGSDAGELAGAGKSGVIVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIG
                     TTGFDDAGKQAIREASQEIAIVFAANFSVGVNVMLKLLEKAAKVMGDYSDIEIIEAHH
                     RHKVDAPSGTALAMGEAIAGALDKNLKDCAVYSREGYTGERVPGTIGFATVRAGDIVG
                     EHTAMFADIGERVEITHKASSRMTFANGALRSALWLKTKKNGLFDMRDVLGLDVL"
     gene            complement(70771..70917)
                     /locus_tag="SeHA_C0069"
     CDS             complement(70771..70917)
                     /locus_tag="SeHA_C0069"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF66253.1"
                     /translation="MSSKKTGWHDKKWTKWSNFTLKQQKTTIKIHLITINAIKCIKIQ
                     NKEN"
     gene            71131..72306
                     /gene="carA"
                     /locus_tag="SeHA_C0070"
     CDS             71131..72306
                     /gene="carA"
                     /locus_tag="SeHA_C0070"
                     /EC_number="6.3.5.5"
                     /note="identified by match to protein family HMM PF00117;
                     match to protein family HMM PF00988; match to protein
                     family HMM TIGR01368"
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyl-phosphate synthase, small subunit"
                     /protein_id="ACF67083.1"
                     /translation="MSEYSLEGVLIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTS
                     MTGYQEILTDPSYSRQIVTLTYPHIGNVGTNEADEESSQVHAQGLVIRDLPLIASNFR
                     NTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDSPDAKLALEKAKAFP
                     GLNGMDLAKEVTTTETYRWTQGSWTLKDGLPEAKSEDDLPFHVVAYDFGAKRNILRML
                     VDRGCRLTVVPAQTSAEEVLKMNPDGIFLSNGPGDPAPCDYAIEAIKKFLQTDIPVFG
                     ICLGHQLLALASGAKTVKMKFGHHGGNHPVKDMDRNVVMITAQNHGFAVDEDSLPANL
                     RVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRQSAK"
     gene            72325..75552
                     /gene="carB"
                     /locus_tag="SeHA_C0071"
     CDS             72325..75552
                     /gene="carB"
                     /locus_tag="SeHA_C0071"
                     /EC_number="6.3.5.5"
                     /note="identified by match to protein family HMM PF00289;
                     match to protein family HMM PF02142; match to protein
                     family HMM PF02786; match to protein family HMM PF02787;
                     match to protein family HMM TIGR01369"
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyl-phosphate synthase, large subunit"
                     /protein_id="ACF66407.1"
                     /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRV
                     ILVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALEL
                     ERQGVLEEFGVTMIGATADAIDKAEDRRRFDIAMKKIGLDTARSGIAHTMEEALAVAA
                     DVGFPCIIRPSFTMGGTGGGIAYNREEFEEICERGLDLSPTNELLIDESLIGWKEYEM
                     EVVRDKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIG
                     VETGGSNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDE
                     LMNDITGGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQ
                     ESLQKALRGLEVGATGFDPKVSLDDPEALTKIRRELKDAGADRIWYIADAFRAGLSVD
                     GVFNLTNIDRWFLVQIEELVRLEEKVTEVGITGLNADFLRQLKRKGFADARLAKLAGV
                     REAEIRKLRDQYDLHPVYKRVDTCAAEFATDTAYMYSTYEDECEANPSVDRDKIMVLG
                     GGPNRIGQGIEFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLE
                     DVLEIVRIEKPKGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAV
                     DRLKLKQPANATVTAIEQAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQT
                     AVSVSNDAPVLLDRFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPA
                     YTLSQEIQDVMRQQVQKLAFELQVRGLMNVQFAVKDNEVYLIEVNPRAARTVPFVSKA
                     TGVPLAKVAARVMAGKSLTEQGVTQEIIPPYYSVKEVVLPFNKFPGVDPLLGPEMRST
                     GEVMGVGRTFAEAFAKAQLGSNSTMKKQGRALLSVREGDKERVVDLAAKLLKQGFELD
                     ATHGTAIVLGEAGINPRLVNKVHEGRPHIQDRIKNGEYTYIINTTAGRRAIEDSRVIR
                     RSALQYKVHYDTTLNGGFATTMALNADATEKVTSVQEMHAQIKKS"
     gene            75826..76221
                     /locus_tag="SeHA_C0072"
                     /note="transcriptional activatory protein CaiF; this gene
                     contains a frame shift which may be the result of
                     sequencing error"
                     /pseudo
     gene            complement(76299..76895)
                     /locus_tag="SeHA_C0073"
     CDS             complement(76299..76895)
                     /locus_tag="SeHA_C0073"
                     /note="identified by match to protein family HMM PF00132"
                     /codon_start=1
                     /transl_table=11
                     /product="carnitine operon protein CaiE"
                     /protein_id="ACF70308.1"
                     /translation="MSYYAFEGLIPVVHPDAFVHPSAVLIGDVIVGAGVYIGPLASLR
                     GDYGRLILEAGSNLQDGCIMHGYCDTDTIVHENGHIGHGAILHGCVVGRDALVGMNSV
                     IMDGAVIGEESIVAAMSFVKAGFQGEARQLLVGSPARVLRQVTDQELHWKRLNTKEYQ
                     DLAIRCRTGLSETKPLTQVEENRPRLKGTTDVKPKSAQ"
     gene            complement(76993..77778)
                     /locus_tag="SeHA_C0074"
     CDS             complement(76993..77778)
                     /locus_tag="SeHA_C0074"
                     /EC_number="4.2.1.-"
                     /note="identified by match to protein family HMM PF00378"
                     /codon_start=1
                     /transl_table=11
                     /product="carnitinyl-CoA dehydratase"
                     /protein_id="ACF69676.1"
                     /translation="MSESLHLTRNGPILEITLDRPKANAIDAKTSFAMGEAFLNFRDD
                     PELRVAIITGGGEKFFSAGWDLKAAAEGEAPDADFGPGGFAGLTEIFDLDKPVIAAVN
                     GYAFGGGFELALAADFIVCAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVM
                     TGRRMSAEEALRWGVVNRVVSQSELMESARELAQQLVNSAPLAIAALKEIYRATSEMP
                     VEEGYRYIRSGVLKHYPSVLHSEDALEGPQAFAEKRDPVWKGR"
     gene            complement(77832..79385)
                     /locus_tag="SeHA_C0075"
     CDS             complement(77832..79385)
                     /locus_tag="SeHA_C0075"
                     /EC_number="6.2.1.-"
                     /note="identified by match to protein family HMM PF00501"
                     /codon_start=1
                     /transl_table=11
                     /product="probable crotonobetaine/carnitine-CoA ligase"
                     /protein_id="ACF69449.1"
                     /translation="MDIVGGQNLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLN
                     EEINRTANLFYSLGIRKGDRVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESA
                     WILQNSQVSLLVTSAQFYPMYREIRQDNSTPLNHICLIGEQLPADDGVSHFTQLQARQ
                     SATLCYTPVLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQIALRDDDVYM
                     TVMPAFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTL
                     MVQPAAPTDRQHHLREVMFYLNLSEQEKDDFTERFGVRLLTSYGMTETIVGIIGDRPG
                     DKRRWPSIGRVGFSYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATAK
                     ALEPEGWLHTGDSGYQDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIV
                     VVGIKDAIRDEAIKAFIVLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCS
                     GKIIKKNLK"
     gene            complement(79448..80719)
                     /locus_tag="SeHA_C0076"
     CDS             complement(79448..80719)
                     /locus_tag="SeHA_C0076"
                     /EC_number="2.8.3.-"
                     /note="identified by match to protein family HMM PF02515"
                     /codon_start=1
                     /transl_table=11
                     /product="crotonobetainyl-CoA:carnitine CoA-transferase"
                     /protein_id="ACF69029.1"
                     /translation="MALCLSGLHTAKNARRKMMNHLPMPTFGPLAGVRVVFSGIEIAG
                     PFAGQMFAEWGAEVIWIENVAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLK
                     LMETTDIFIEASKGPAFARRGITDEVLWEHNPKLVIAHLSGFGQYGTEEYTNLPAYNT
                     IAQAFSGYLIQNGDVDQPMPAFPYTADYFSGMTATTAALAALHKVRETGKGESIDIAM
                     YEVMLRMGQYFMMDYFNGGEICPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINE
                     CFKDIGLAHILGTPEVPEGTQLIHRVECPYGPLVEEKLDAWLATHTIADVQARFAELN
                     IACAKVLTIPELEGNPQYVARESITQWQTMDGRTCKGPNIMPKFKNNPGKIWRGMPSH
                     GMDTAAILKNIGYSEADIKELVGKGLAKVED"
     gene            complement(80777..81919)
                     /gene="caiA"
                     /locus_tag="SeHA_C0077"
     CDS             complement(80777..81919)
                     /gene="caiA"
                     /locus_tag="SeHA_C0077"
                     /EC_number="1.3.99.-"
                     /note="identified by match to protein family HMM PF00441;
                     match to protein family HMM PF02770; match to protein
                     family HMM PF02771; match to protein family HMM PF08028"
                     /codon_start=1
                     /transl_table=11
                     /product="crotonobetainyl-CoA dehydrogenase"
                     /protein_id="ACF69378.1"
                     /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVK
                     ALADMGIDSLLIPEEHGGLEAGFVTVAAVWMELGRLGAPTYVLYQLPGGFNTFLREGT
                     QEQIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRKNGKVYLNGSKCFITSSA
                     YTPYIVVMARDGASPDKPVYTEWFVDMSKAGIKVNKLEKLGLRMDSCCEITFDDVELD
                     EKDMFGREGNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRF
                     QLIQEKFAHMAIKLNSMKNMLLEAAWKADNGTITSGDAAMCKYFCANAAFEVVDTAMQ
                     VLGGVGIAGNHRITRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
     gene            complement(81954..83471)
                     /gene="caiT"
                     /locus_tag="SeHA_C0078"
     CDS             complement(81954..83471)
                     /gene="caiT"
                     /locus_tag="SeHA_C0078"
                     /note="identified by match to protein family HMM PF02028;
                     match to protein family HMM TIGR00842"
                     /codon_start=1
                     /transl_table=11
                     /product="L-carnitine/gamma-butyrobetaine antiporter"
                     /protein_id="ACF70289.1"
                     /translation="MKNEKKKSGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVF
                     SYVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLGDEKPEFSTASWIFMMFASCTSA
                     AVLFWGSIEIYYYISTPPFGLEPNSTGAKEIGLAYSLFHWGPLPWATYSFLSVAFAYF
                     FFVRKMDVIRPSSTLVPLVGEKHAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTEC
                     MQWLFGIPHTLQLDAIIITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIV
                     SGASFIMNYFTDSVGMLLMHLPRMLFYTDAIGKGGFPQGWTVFYWAWWVIYAIQMSIF
                     LARISRGRTVRELCFGMVMGLTASTWILWTVLGSNTLLLMDKNILNIPQLIEQHGVAR
                     AIIETWAALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCREVRDGEEPPLLVRI
                     GWSVLVGIIGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWKDK"
     gene            83613..83729
                     /locus_tag="SeHA_C0079"
     CDS             83613..83729
                     /locus_tag="SeHA_C0079"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF66161.1"
                     /translation="MILLSSSHFFALIILCLNFDFCFIYQLIGCGFLTFLSI"
     gene            83699..83884
                     /locus_tag="SeHA_C0080"
     CDS             83699..83884
                     /locus_tag="SeHA_C0080"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF66925.1"
                     /translation="MWFFNFFKYLTFNIVEPANNIENFHIWHISFNIGEVRNTIESYE
                     YQCVTFSILVIKVLFPN"
     gene            83952..84722
                     /gene="fixA"
                     /locus_tag="SeHA_C0081"
     CDS             83952..84722
                     /gene="fixA"
                     /locus_tag="SeHA_C0081"
                     /note="identified by match to protein family HMM PF01012"
                     /codon_start=1
                     /transl_table=11
                     /product="protein FixA"
                     /protein_id="ACF67463.1"
                     /translation="MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEA
                     ACQLKQQLGDAQVVAMSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQHTAT
                     ALAAAAQKSGFDLLICGDGSSDLYAQQVGLLVGEALNIPAINGVSKILSLTDSTLTVE
                     RELEDEVETLSIPLPAVIAVSTDINIPQIPSMKAILGAAKKPVQVWSPADIGLNSVSA
                     YSAQQVAAPKQRERQRVVIEGDGEEQIAAFVENLRKII"
     gene            84738..85679
                     /gene="fixB"
                     /locus_tag="SeHA_C0082"
     CDS             84738..85679
                     /gene="fixB"
                     /locus_tag="SeHA_C0082"
                     /note="identified by match to protein family HMM PF00766;
                     match to protein family HMM PF01012"
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein, alpha subunit"
                     /protein_id="ACF68256.1"
                     /translation="MNKFSSVWVFSDTPSRLPELMSGAQAVGEKVNAFVLNEADSATA
                     CHLGADHVWLLSGKPEDRMIEDYAAAMAETIRQHSEGGAVLLPNTRRGKLLAAKLGYR
                     LSAAVSNDASEVALQDGKAAVKHMVYGGLAIGAESIASPFAVITLSSGTFDAQDPDTS
                     RSGEMHTVQWQAPAITVTRTATQARQSNSVDLDKARLVVSVGRGIGSKENISLAEALC
                     QTIGAELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANGAQT
                     IFAINKDKNAPIFQYADFGIVGDALKILPALTAALAR"
     gene            85729..87015
                     /gene="fixC"
                     /locus_tag="SeHA_C0083"
     CDS             85729..87015
                     /gene="fixC"
                     /locus_tag="SeHA_C0083"
                     /note="identified by match to protein family HMM PF01266;
                     match to protein family HMM PF01494; match to protein
                     family HMM PF03486"
                     /codon_start=1
                     /transl_table=11
                     /product="protein FixC"
                     /protein_id="ACF68751.1"
                     /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKN
                     VTGGRLYAHSLERIIPGFADQAPIERMITHEKLAFMTDNGAMTIDYCNGEDASASQVS
                     YSVLRSKFDAWLMEQAEEAGAQLITGIRVDNVVQRDGKVVGVEADGDILEAKVVILAD
                     GVNSLLAEKLGMAKRVEASHVAVGVKELIELPKSVIEDRFQLQGNEGAACLFAGAPTD
                     GLMGGGFLYTNETTLSLGLVCGLHHLKDAKKSVPQMLEDFKQHPTVAPLIAGGKLVEY
                     AAHVVPEAGMNMQPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAISAGEAAAKTVLSA
                     MKRDDFSKQSLGEYRQHLDEGPMRDMRMYQKLPAFLDNPRMFTAYPEMAVNIARDLFT
                     VDGSAPVPMRKKILRHAKKVGFINLMKDGLKGVTVL"
     gene            87012..87299
                     /locus_tag="SeHA_C0084"
     CDS             87012..87299
                     /locus_tag="SeHA_C0084"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /protein_id="ACF68261.1"
                     /translation="MTSPVNVDVKLGVNKFNVDEDSPHIILKTDPDKQALEVLIKACP
                     AGLYKKQDDGSVRFDYAGCLECGTCRILGLDTALEKWEYPRGTFGVEFRYG"
     gene            87380..88786
                     /locus_tag="SeHA_C0085"
     CDS             87380..88786
                     /locus_tag="SeHA_C0085"
                     /note="identified by match to protein family HMM PF00083;
                     match to protein family HMM PF07690"
                     /codon_start=1
                     /transl_table=11
                     /product="putative metabolite transport protein YaaU"
                     /protein_id="ACF66622.1"
                     /translation="MAAETPYPAYRCALPVLKQDITMQQPRNFDDLKFSSIHRRIMLW
                     GSGGPFLDGYVLVIIGVALEQLTPLLHLDAEWIGALGAATLAGLFIGTSLFGYICDKV
                     GRRKMFLLDIIAIGVISVATMFVSTPLELLVMRVLIGIVIGADYPIATSMITEFSNTR
                     QRAFSIGFIAAMWYVGATCANLVGYWLYDMEGGWRWMLGSAFIPCLIILIGRFDLPES
                     PRWLLRKGRVKECEQMMIKLFGEPVCFDDEPPQETRFLQLFNRRHFPFVLFVAAIWTC
                     QVIPMFAIYTFGPQIVGLLGWEQGRNAALGNVVISLFFMLGCIPAMFWLNSIGRRPLL
                     IGSFAMMTIALALLGLVSNLGIILVVVAFAVYAFFSGGPGILQWLYPNELFPTDIRAS
                     AVGVIMSLSRIGTIISTWALPIFITRYGINNVMLIGALISLVGLGVSVMFAPETRGLT
                     LTQTGNMTLRGTPSDNPR"
     gene            88875..89105
                     /locus_tag="SeHA_C0086"
     CDS             88875..89105
                     /locus_tag="SeHA_C0086"
                     /note="identified by match to protein family HMM PF06004"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF67167.1"
                     /translation="MQKRLMTALFTAATLFTVAGCSSNQAVETTDGKTIVTDGKPEVD
                     NDTGMVSYKNAATGKTEQINRDQLKNMSELDN"
     gene            89385..89801
                     /locus_tag="SeHA_C0087"
     CDS             89385..89801
                     /locus_tag="SeHA_C0087"
                     /codon_start=1
                     /transl_table=11
                     /product="probable secreted protein"
                     /protein_id="ACF67724.1"
                     /translation="MKLIPFYLLALFSAASGATEINACKDLIGTWKTTADNPPYTMTI
                     LPPVEGCGEKCVKLNVQYELDVTHRNALYCHEGQEGVKGQGPMVIAFEGAYGGHAIGT
                     YNRQLQLLWAGVIPKNKKGKWITKMENYWFRQVKAH"
     gene            complement(90025..90315)
                     /locus_tag="SeHA_C0088"
     CDS             complement(90025..90315)
                     /locus_tag="SeHA_C0088"
                     /note="identified by match to protein family HMM PF07338"
                     /codon_start=1
                     /transl_table=11
                     /product="probable secreted protein"
                     /protein_id="ACF68865.1"
                     /translation="MKKRIIAAALLATVASFSTLAAEQVSKQEISHFKLVKVGTINVS
                     QSGEQISSPSDLREKLSELADAKGGKYYHIIAAREHGPNFEAVAEVYNDATK"
     gene            91213..93102
                     /locus_tag="SeHA_C0089"
     CDS             91213..93102
                     /locus_tag="SeHA_C0089"
                     /note="identified by match to protein family HMM PF00884;
                     match to protein family HMM TIGR01409"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="ACF69541.1"
                     /translation="MSNKKNLSAEETDLTRRKLLTSAGILAAGGMLSGAVKADEKCAV
                     KAKPAWDKPFTGEIPEKLPEGYNILLVVTDQERFFPTFPFPVPGRERLMKTGVTFCNH
                     QNTSNVCTPSRSVLYTGLHMPQTKMFDNLGLPWMPYDLDPALGTTGHMMRELGYYTAY
                     KGKWHLTEKLEKPLPDEKDEDIDVGDIPEPELHKIMEKYGFADYHGIGDIIGHSKGGY
                     FYDSTTTAQTINWLRCKGQPLNDQHKPWFLAVNLVNPHDVMFIDTDKEGEKVQWRGEL
                     DQDDNTLAPTQPPENELYQASWPNYPLPANRHQSFNEQGRPPAHLEYQTARAALEGQF
                     PDEDRRWRKLLDYYFNCIRDCDTHLDRILNELDALKLTDKTIVVFTADHGELGGSHQM
                     HGKGASVYKEQIHVPMIISHPAYPGNKKCQALTCHLDIAPTLVGLTGLPEEKQHQALG
                     NRKGVNFSGLLKNPESVAVNAVRNASLYCYGMILYTDAHYLHRVIALQRDKQKTVAQI
                     KQEISHLHPDFSHRSGTRMINDGRYKFARYFSLREHNTPETWEDLIKYNDLELYDLKN
                     DPDENHNLAADKQKYQDLILTMNEKLNKIIKDEIGVDDGSFMPDAAHEPWDLTIEQFN
                     RMAKD"
     gene            93656..94186
                     /gene="kefF"
                     /locus_tag="SeHA_C0090"
     CDS             93656..94186
                     /gene="kefF"
                     /locus_tag="SeHA_C0090"
                     /note="identified by match to protein family HMM PF02525"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-regulated potassium-efflux system
                     ancillary protein kefF"
                     /protein_id="ACF70177.1"
                     /translation="MILIIYAHPYPHHSHANKRMLEQAGTLENVEIRSLYHLYPDFNI
                     DVAAEQEALSRASLIVWQHPMQWYSVPPLLKLWMDKVLTHGWAYGHGGTALHGKHLLW
                     AVTTGGGENHFAIGSHPGFDVLSQPLQATALYCGLKWLPPFAMHCTFICDDDTLQAQA
                     RQYKQRLLAWQEVNHG"
     gene            94179..96041
                     /locus_tag="SeHA_C0091"
     CDS             94179..96041
                     /locus_tag="SeHA_C0091"
                     /note="identified by match to protein family HMM PF00999;
                     match to protein family HMM PF02254; match to protein
                     family HMM TIGR00932"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-regulated potassium-efflux system
                     protein KefC"
                     /protein_id="ACF66119.1"
                     /translation="MDSHTLLQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPW
                     GLRLVTDAESILHFAEIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMVVCGGLIG
                     LFCMFLGLRWQVAELIGMTLALSSTAIAMQAMNERNLTVSQVGRSAFAVLLFQDIAAI
                     PLVAMIPLLAASGASTTLGAFALSALKVAGALALVVLLGRYVTRPALRFVARSGLREV
                     FSAVALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLF
                     FIGVGMSIDFGTLVENPLRILLLLAGFLAIKIVMLWLVARPLGVPAKQRRWFAVLLGQ
                     GSEFAFVVFGAAQMAGVLEPEWAKALTLAVALSMAATPIFLMLLTRMEKTEKGEAREA
                     DEIDEEQPRVIVAGFGRFGQIAGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDA
                     TRMDLLESAGAAKAEVLINAIDDPQTNLQLSELVKSHFPHLQIIARARDVDHYIRLRQ
                     AGVAMPERETFEGALKSGRQALEALGLGRYEARERADLFRHFNTRMVEEMAKGENDPL
                     SRAAAYKRTSAMLSEIITEDREHLSLIQRHGWQGTAEGKHSGEAADEPEVKPSI"
     gene            complement(96038..96163)
                     /locus_tag="SeHA_C0092"
     CDS             complement(96038..96163)
                     /locus_tag="SeHA_C0092"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF66720.1"
                     /translation="MSTKIFRSAGDATHLMWSASITVVQKQPISSKVCRTSHFLL"
     gene            96239..96718
                     /gene="folA"
                     /locus_tag="SeHA_C0093"
     CDS             96239..96718
                     /gene="folA"
                     /locus_tag="SeHA_C0093"
                     /EC_number="1.5.1.3"
                     /note="identified by match to protein family HMM PF00186"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="ACF66823.1"
                     /translation="MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGR
                     HTWESIGRPLPGRKNIVISSQPGTDDRVQWVKSVDEAIAACGDAPEIMVIGGGRVYEQ
                     FLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR"
     gene            complement(96824..97672)
                     /locus_tag="SeHA_C0094"
     CDS             complement(96824..97672)
                     /locus_tag="SeHA_C0094"
                     /EC_number="3.6.1.41"
                     /note="identified by match to protein family HMM PF00149;
                     match to protein family HMM TIGR00668"
                     /codon_start=1
                     /transl_table=11
                     /product="bis(5'-nucleosyl)-tetraphosphatase
                     (symmetrical)"
                     /protein_id="ACF67517.1"
                     /translation="MATYLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPG
                     SLDVLRYVKSLGNSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWL
                     RRQPLLQVDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMP
                     NNWSPELSGLARLRFITNAFTRMRYCFPNGQLDMYSKASPENAPAPLKPWFAIPGPVS
                     EAYSIAFGHWASLEGKGTPEGIYALDTGCCWGGELTCLRWEDKQYFVQPSNRQMDMGE
                     GEAVNA"
     gene            complement(97683..98060)
                     /gene="apaG"
                     /locus_tag="SeHA_C0095"
     CDS             complement(97683..98060)
                     /gene="apaG"
                     /locus_tag="SeHA_C0095"
                     /note="identified by match to protein family HMM PF04379"
                     /codon_start=1
                     /transl_table=11
                     /product="protein ApaG"
                     /protein_id="ACF68143.1"
                     /translation="MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQ
                     LLGRYWLITNGHGRETEVQGEGVVGVQPRIAPGEEYQYTSGAVIETPLGTMQGHYEMI
                     DENGDAFTIDIPVFRLAVPTLIH"
     gene            complement(98063..98884)
                     /gene="ksgA"
                     /locus_tag="SeHA_C0096"
     CDS             complement(98063..98884)
                     /gene="ksgA"
                     /locus_tag="SeHA_C0096"
                     /EC_number="2.1.1.-"
                     /note="identified by match to protein family HMM PF00398;
                     match to protein family HMM TIGR00755"
                     /codon_start=1
                     /transl_table=11
                     /product="dimethyladenosine transferase"
                     /protein_id="ACF68749.1"
                     /translation="MNNRVHQGHLARKRFGQNFLNDRFVIDSIVSAINPQKGQAMVEI
                     GPGLAALTEPVGERLDKLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELSA
                     QLGQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRL
                     SVMAQYYCQVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPYPVKDIRVLSRITTEAF
                     NQRRKTIRNSLGNLFSVETLTEMGIDPAMRAENISVAQYCQMANYLSENAPLKES"
     gene            complement(98881..99870)
                     /gene="pdxA"
                     /locus_tag="SeHA_C0097"
     CDS             complement(98881..99870)
                     /gene="pdxA"
                     /locus_tag="SeHA_C0097"
                     /EC_number="1.1.1.262"
                     /note="identified by match to protein family HMM PF04166;
                     match to protein family HMM TIGR00557"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase"
                     /protein_id="ACF69313.1"
                     /translation="MSSAQRVVITPGEPAGIGPDLVVQLAQRAWPIELVVCADGALLT
                     ERAAMLGLPLSLLPYSPDVPAAPQPAGTLTLLPVSLRAPAISGQLTVENGPYVVETLA
                     RACDGCLNGEFAALITGPVHKGVINDAGISFTGHTEFFEERSQAKKVVMMLATEELRV
                     ALATTHLPLRAIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHM
                     GTEEIDTIIPVLDELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQ
                     GFGRGVNITLGLPFIRTSVDHGTALELAGRGKADVGSFITALNLAIKMIVNTQ"
     gene            complement(99870..101156)
                     /gene="surA"
                     /locus_tag="SeHA_C0098"
     CDS             complement(99870..101156)
                     /gene="surA"
                     /locus_tag="SeHA_C0098"
                     /EC_number="5.2.1.8"
                     /note="identified by match to protein family HMM PF00639;
                     match to protein family HMM PF09312"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone/peptidyl-prolyl cis-trans isomerase
                     SurA"
                     /protein_id="ACF70147.1"
                     /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDG
                     LMQSVKLNAGQAGQQLPDDATLRHQILERLIMDQIILQMGQKMGVKITDEQLDQAIAN
                     IAKQNNMTMDQMRSRLAYDGLNYSTYRNQIRKEMIISEVRNNEVRRRITVLPQEVDAL
                     AKQIGTQNDASTELNLSHILIALPENPTSEQVNDAQRQAESIVEEARNGADFGKLAIT
                     YSADQQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGQ
                     SQSISVTEVHARHILLKPSPIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGS
                     ANQGGDLGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKVDKTDAA
                     QKDRAYRMLMNRKFSEEAATWMQEQRASAYVKILSN"
     gene            complement(101210..103570)
                     /gene="imp"
                     /locus_tag="SeHA_C0099"
     CDS             complement(101210..103570)
                     /gene="imp"
                     /locus_tag="SeHA_C0099"
                     /note="identified by match to protein family HMM PF03968;
                     match to protein family HMM PF04453"
                     /codon_start=1
                     /transl_table=11
                     /product="LPS-assembly protein"
                     /protein_id="ACF69433.1"
                     /translation="MKKRIPTLLATMIASALYSHQGLAADLASQCMLGVPSYDRPLVK
                     GDTNDLPVTINADNAKGNYPDDAVFTGNVDIMQGNSRLQADEVQLHQKQAEGQPEPVR
                     TVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGEN
                     RYTILENGSFTSCLPGSDTWSVVGSEVIHDREEQVAEIWNARFKVGPVPIFYSPYLQL
                     PVGDKRRSGFLIPNAKYTTKNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEF
                     RYLTQAGEGVMELDYLPSDKVYEDDHPKEGDKHRWLFYWQHSGVMDQVWRFNVDYTKV
                     SDSSYFNDFDSKYGSSTDGYATQKFSVGYAVQNFDATVSTKQFQVFNDQNTSSYSAEP
                     QLDVNYYHNDLGPFDTRIYGQAVHFVNTKDNMPEATRVHLEPTINLPLSNRWGSLNTE
                     AKLMATHYQQTNLDSYNSDPNNKNKLEDSVNRVMPQFKVDGKLIFERDMAMLAPGYTQ
                     TLEPRVQYLYVPYRDQSGIYNYDSSLLQSDYNGLFRDRTYGGLDRIASANQVTTGVTT
                     RIYDDAAVERFNVSVGQIYYFTESRTGDDNIKWENDDKTGSLVWAGDTYWRISERWGL
                     RSGVQYDTRLDSVATSSSSLEYRRDQDRLVQLNYRYASPEYIQATLPSYYSTAEQYKN
                     GINQVGAVASWPIADRWSIVGAYYFDTNSSKPADQMLGLQYNSCCYAIRVGYERKLNG
                     WDNDKQHAIYDNAIGFNIELRGLSSNYGLGTQEMLRSNILPYQSSM"
     gene            complement(103580..103741)
                     /locus_tag="SeHA_C0100"
     CDS             complement(103580..103741)
                     /locus_tag="SeHA_C0100"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF70153.1"
                     /translation="MWDIAYNLHYHTCHSMPCLTPQTLNGRINTGAAKMSKLGCDRLS
                     RATLPMMEQ"
     gene            103824..104636
                     /locus_tag="SeHA_C0101"
     CDS             103824..104636
                     /locus_tag="SeHA_C0101"
                     /note="identified by match to protein family HMM PF00226"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaJ domain protein"
                     /protein_id="ACF69499.1"
                     /translation="MQYWGKIIGVAVALMMGGGFWGVVLGLLVGHMFDKARSRKMAWF
                     ANQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGDSRTAAQNAFR
                     VGKADNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNEREVLYVIAEE
                     LGISRVQFDQFLRMMQGGAQFGGGYHQQSGGGWQQAQRGPTLEDACNVLGVKTTDDAT
                     TIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAYELIKEQKGFK"
     gene            complement(104731..105390)
                     /locus_tag="SeHA_C0102"
     CDS             complement(104731..105390)
                     /locus_tag="SeHA_C0102"
                     /note="identified by match to protein family HMM PF00849"
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase, RluA family"
                     /protein_id="ACF66807.1"
                     /translation="MGMENYNPPQEPWLVILYQDEHIMVVNKPSGLLSVPGRLEAHKD
                     SIMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFREREPKKQYVARVWG
                     HPSPAEGLVDLPLICDWPNRPKQKVCYETGKPAQTEYNVVEFAADNTARVVLKPITGR
                     SHQLRVHMLALGHPILGDRFYASPEALSLAPRLQLHAEMLTITHPAYGNSMTFKVPAD
                     F"
     gene            complement(105402..108236)
                     /gene="rapA"
                     /locus_tag="SeHA_C0103"
     CDS             complement(105402..108236)
                     /gene="rapA"
                     /locus_tag="SeHA_C0103"
                     /EC_number="3.6.1.-"
                     /note="identified by match to protein family HMM PF00176;
                     match to protein family HMM PF00271; match to protein
                     family HMM PF04851"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase associated protein RapA"
                     /protein_id="ACF66171.1"
                     /translation="MDARTVTLLFPSTGENRLYARSDSPVTRVMFNPGDTITSHEGWQ
                     LHIDEVKEENGLLVYVGTRLDTEETNVTLREVLLDSKLVFSKPQDRLFAGQIDRMDRF
                     ALRYRARKFQSEQYRMPYSGLRGQRTNLIPHQLNIAHDVGRRHAPRVLLADEVGLGKT
                     IEAGMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRRFNLRFALFDDERYTEAQHDA
                     YNPFETEQLVICSLDFARRNKQRLEHLCDAEWDLLVVDEAHHLVWSTDAPSREYMAIE
                     QLAERVPGVLLLTATPEQLGMESHFARLRLLDPNRFHDFEQFVEEQKNYRPVADAVAM
                     LLAGNKLSNDELNRLGDLIGEQDIEPLLQAANSDRDDAQAARDELVSMLMDRHGTSRV
                     LFRNTRNGVKGFPKRELHTVKLPLPTQYQTAIKVSGIMGARKSAEDRARDMLYPEQIY
                     QEFEGDTGTWWNFDPRVEWLMGYLTSHRSQKVLVICAKATTALQLEQVLREREGIRAA
                     VFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFASNLVMFDLPFNPDLL
                     EQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHTCPTGRAIYDSAYA
                     SLINYLAAPEETDGFDDLIKSCREQHEALKAQLEQGRDRLLEIHSNGGEKAQQLAQSI
                     EEQDDDTNLIAFAMNLFDIVGINQDDRGDNLIVLTPSDHMLVPDFPGLPEDGCTITFE
                     RDVALSREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVGTLLVELVYVV
                     EAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQVEFETFNRQLSAVNRHTGSKLVNAV
                     QQDVHAILQLGETQIEKSARALIDNARREADEKLSGELSRLEALRAVNPNIRDDELAA
                     IDSNRQQVLESLNQAGWRLDALRLIVVTHQ"
     gene            complement(108482..110833)
                     /locus_tag="SeHA_C0104"
     CDS             complement(108482..110833)
                     /locus_tag="SeHA_C0104"
                     /EC_number="2.7.7.7"
                     /note="identified by match to protein family HMM PF00136;
                     match to protein family HMM PF03104"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase II"
                     /protein_id="ACF68161.1"
                     /translation="MAQAGFILTRHWRDTPQGTEVSFWLATDNGPVQATLAPQESVAF
                     IPTSQTSRAASLLQAEKDYRLTPLQLRDFHRQPVSGLYCRTHRQLMRMEKLLRENGVT
                     VYEADVRPPERYLMERFITSPVWVDGEMRNGVIRNARLKPHSDYRPPLKWVSLDIETT
                     RHGELYCIGLEGCGQRTVYMLGPANGDDHQLDFELVYVASRPQLLEKLNAWFAEHDPD
                     VIIGWNVVQFDLRMLQKHAERYRIPLRLGRDNSELEWREHGFKNGVFFAQARGRVIID
                     GIDALKSAFWNFSSFSLEAVSQELLGEGKSIDNPWDRMDEIDRRFAQDKPALATYNLK
                     DCELVTRIFHKTEIMPFLLERATINGLPVDRHGGSVAAFGHLYFPRMHRAGYVAPNLG
                     EVPPLASPGGYVMDSQPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGMAQPDPEHS
                     TEGFLDAWFSREKHCLPEIVSQIWHGRDEAKRQGNKPLSQALKIIMNAFYGVLGTTAC
                     RFFDPRLASSITMRGHAIMRQTKALIEAQGYDVIYGDTDSTFVWLRRAHSEADAAEIG
                     HRLVRHVNEWWAQTLQQQNLTSALELEFETHFCRFLMPTIRGADTGSKKRYAGLIQEG
                     DSQRMVFKGLETVRTDWTPLAQRFQQELYLRVFRNEPYQDYVRETIDKLMAGELDAQL
                     VYRKRLRRPLHEYQRNVPPHVRAARLADEQNLKQGRPAQYQNRGAIKYVWTVNGPEPV
                     DYQQSPLDYEHYLTRQLQPVAEGILPFVEDNFATLLTGQLGLF"
     gene            complement(110877..111626)
                     /locus_tag="SeHA_C0105"
     CDS             complement(110877..111626)
                     /locus_tag="SeHA_C0105"
                     /note="identified by match to protein family HMM PF02698"
                     /codon_start=1
                     /transl_table=11
                     /product="putative secreted protein"
                     /protein_id="ACF67367.1"
                     /translation="MIISAVYTGIIILINIRQQKYLTLKALLSLKYPLHPSRGTNSFM
                     KYRYIIRIAAGIILIMATVFIHNAIAIYQFSQQNQTRVADCAIVAGAGVSGKTPSPVF
                     QARLDHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERST
                     VTRENIRYAKQILRQQQWRTALLVSDPLHMLRLKTIAQDNGIDSRSSPTRSTRYKSWW
                     AQTRFLLRETFYYSGYRLLRYMPVQNNSITP"
     gene            112015..112434
                     /locus_tag="SeHA_C0106"
     CDS             112015..112434
                     /locus_tag="SeHA_C0106"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="ACF69285.1"
                     /translation="MNVSMQARLVGNDRYLFVNTQRANPSIKTVSRFFEYKTWTEQIW
                     RTEIIENGNAFFHWQGHDRKNGHRDTIINYLLNGQRWQSTIEDYIFFHALEGKAWQGH
                     YDNIIEYVSSDHYVYQSAFAEYITDQIHQRAPHGTRF"
     gene            complement(112440..113135)
                     /gene="araD"
                     /locus_tag="SeHA_C0107"
     CDS             complement(112440..113135)
                     /gene="araD"
                     /locus_tag="SeHA_C0107"
                     /EC_number="5.1.3.4"
                     /note="identified by match to protein family HMM PF00596;
                     match to protein family HMM TIGR00760"
                     /codon_start=1
                     /transl_table=11
                     /product="L-ribulose-5-phosphate 4-epimerase"
                     /protein_id="ACF68473.1"
                     /translation="MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVLVIKPS
                     GVDYSVMTADDMVVVSLESGEVVEGHKKPSSDTPTHRLLYQAFPTIGGIVHTHSRHAT
                     IWAQAGQPIPATGTTHADYFYGTIPCTRKMTEAEINGEYEWETGNVIVETFEKQGIDA
                     AQMPGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQSLLDKH
                     YLRKHGAKAYYGQ"
     gene            complement(113276..114778)
                     /gene="araA"
                     /locus_tag="SeHA_C0108"
     CDS             complement(113276..114778)
                     /gene="araA"
                     /locus_tag="SeHA_C0108"
                     /EC_number="5.3.1.4"
                     /note="identified by match to protein family HMM PF02610"
                     /codon_start=1
                     /transl_table=11
                     /product="L-arabinose isomerase"
                     /protein_id="ACF68797.1"
                     /translation="MTIFDNYEVWFVIGSQHLYGAETLRQVTQHAEHVVNALNTEAKL
                     PCKLVLKPLGTSPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLSILNKPLLQ
                     FHTQFNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKEAHTRI
                     GAWMRQAVSKQDTRQLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVV
                     NSIGDGDINALIDEYESSYTLTPATQIHGDKRQNVREAARIELGMKRFLEQGGFHAFT
                     TTFEDLHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMED
                     YTYHFEKGNDLVLGSHMLEVCPSIAVEEKPILDVQHLGIGGKEDPARLIFNTQTGPAI
                     VASLIDLGDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHH
                     TVFSHALDLNDMRQFAEIHDIEIAVIDNDTHLPAFKDALRWNEVYYGFKR"
     gene            complement(114789..116498)
                     /gene="araB"
                     /locus_tag="SeHA_C0109"
     CDS             complement(114789..116498)
                     /gene="araB"
                     /locus_tag="SeHA_C0109"
                     /EC_number="2.7.1.16"
                     /note="identified by match to protein family HMM PF00370;
                     match to protein family HMM PF02782; match to protein
                     family HMM TIGR01234"
                     /codon_start=1
                     /transl_table=11
                     /product="L-ribulokinase"
                     /protein_id="ACF68318.1"
                     /translation="MAIAIGLDFGSDSVRALAVDCATGDEIATSIEWYPRWQEGRYCD
                     GPNNQFRHHPRDYMESMEAALKAVLAQLSAAQRANVVGIGVDSTGSTPAPIDADGNVL
                     ALRPEFAENPNAMFVLWKDHTAVEEADEITRLCHKPGKVDYSRYIGGIYSSEWFWAKI
                     LHVTRQDSAVAQAAVSWIELCDWVPALLSGTTRPQDIRRGRCSAGHKTLWHESWGGLP
                     PASFFDELDPCINRHLRYPLFSETFTADLPVGTLCAEWAQRLDLPESVVISGGAFDCH
                     MGAVGAGAQPNTLVKVIGTSTCDILIADKQSVGDRAVKGICGQVDGSVVPNFIGLEAG
                     QSAFGDIYAWFSRVLSWPLEQLAAQHPELKPQINASQKQLLPALTDAWAKNPSLDHLP
                     VVLDWFNGRRTPNANQRLKGVITDLNLATDAPALFGGLVASTAFGARAIQECFTDQGI
                     AVNNVMALGGIARKNQVIMQVCCDVLNRPLQIVASDQCCALGAAIFAAVAAKVHADIP
                     AAQQSMASAVERTLRPHPEQAQRFEQLYRRYQQWALSAEQHYLPTAAPAPTTPANQAI
                     LTH"
     gene            116839..117684
                     /locus_tag="SeHA_C0110"
     CDS             116839..117684
                     /locus_tag="SeHA_C0110"
                     /note="identified by match to protein family HMM PF00165;
                     match to protein family HMM PF02311"
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose operon regulatory protein"
                     /protein_id="ACF70114.1"
                     /translation="MAETQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKG
                     YILNLTIRGEGVINNNGEQFVCRPGDILLFPPGEIHHYGRHPDASEWYHQWVYFRPRA
                     YWQEWLTWPTIFAQTGFFRPDEARQPHFSELFGQIISAGQGEGRYSELLAINLLEQLL
                     LRRMAVINESLHPPMDSRVRDACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQ
                     LGISVLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEF
                     RAGCE"
     gene            117803..118570
                     /locus_tag="SeHA_C0111"
     CDS             117803..118570
                     /locus_tag="SeHA_C0111"
                     /note="identified by match to protein family HMM PF09335"
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane protein YabI"
                     /protein_id="ACF69575.1"
                     /translation="MQALLEHFITQSTLYSLIAVLLVAFLESLALVGLILPGTVLMAG
                     LGALIGSGELNFWHAWLVGIIGCLMGDWISFWLGWRFKKPLHRWSFMKKNKSLLDKTE
                     HALHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFIGPNLIGCLLWPPFYFLPGI
                     LAGAAIDIPSDMQSGDFKWLLLATALLLWVGGWLCWRLWRSGKAAVDRLTAYFPRSRL
                     LYLAPLTLGIGVVALVVLVRHPLMPVYIDILRKVVGY"
     gene            complement(118609..119316)
                     /gene="thiQ"
                     /locus_tag="SeHA_C0112"
     CDS             complement(118609..119316)
                     /gene="thiQ"
                     /locus_tag="SeHA_C0112"
                     /note="identified by match to protein family HMM PF00005;
                     match to protein family HMM TIGR01277"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine ABC transporter, ATP-binding protein"
                     /protein_id="ACF66203.1"
                     /translation="MLKLIDITWLYHHLPMRFTLAVERGEQVAILGPSGAGKSTLLNL
                     IAGFLAPASGTLLIAGDDHTLTPPSRRPVSMLFQENNLFSHLNVQQNIGLGLNPGLTL
                     NASQREKRDAIAHQMGIESLMTRLPGELSGGQRQRVALARCLVREQPVLLLDEPFSAL
                     DPALRQEMLTLVSDICRERQLTLLMVSHSVEDAARIAPRSIVVADGRIAWQGKTDELL
                     SGQASASALLGIKSHIL"
     gene            complement(119300..120910)
                     /gene="thiP"
                     /locus_tag="SeHA_C0113"
     CDS             complement(119300..120910)
                     /gene="thiP"
                     /locus_tag="SeHA_C0113"
                     /note="identified by match to protein family HMM PF00528;
                     match to protein family HMM TIGR01253"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine/thiamine pyrophosphate ABC transporter,
                     permease protein"
                     /protein_id="ACF67761.1"
                     /translation="MATRRQPLIPGWLIPGLCAAALMITVSLAAFLALWLNAPSGAWS
                     TIWRDSYLWHVVRFSFWQAFLSAVLSVVPAVFLARALYRRRFPGRLALLRLCAMTLIL
                     PVLVAVFGILSVYGRQGWLASLWQMLGLQWTFSPYGLQGILLAHVFFNLPMASRLLLQ
                     SLESIPGEQRQLAAQLGMRGWHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLG
                     GGPQATTIELAIFQALSYDYDPARAAMLALIQMVCCLALVLLSQRLSKAIAPGMTLTQ
                     GWRDPDDRLHSRLTDALLIVLALLLLLPPLVAVVVDGVNRSLPEVLAQPILWQAVWTS
                     LRIALAAGVLCVVLTMMLLWSSRELRQRQQLFAGQTLELSGMLILAMPGIVLATGFFL
                     LLNNSVGLPESADGIVIFTNALMAIPYALKVLENPMRDITARYGMLCQSLGIEGWSRL
                     KIVELRALKRPLAQALAFACVLSIGDFGVVALFGNDNFRTLPFYLYQQIGSYRSQDGA
                     VTALILLLLCFTLFTLIEKLPGRHAKTD"
     gene            complement(120886..121869)
                     /gene="thiB"
                     /locus_tag="SeHA_C0114"
     CDS             complement(120886..121869)
                     /gene="thiB"
                     /locus_tag="SeHA_C0114"
                     /note="identified by match to protein family HMM PF01547;
                     match to protein family HMM TIGR01254; match to protein
                     family HMM TIGR01276"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamin/thiamin pyrophosphate ABC transporter,
                     periplasmic thiamin/thiamin pyrophospate-binding protein"
                     /protein_id="ACF67537.1"
                     /translation="MLKKYLPLLLLCAAPAFAKPVLTVYTYDSFAADWGPGPAVKKAF
                     EADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTKLFAKSGVA
                     NEAVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPPKSLKELVESDQKWRVIYQDPRT
                     STPGLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTS
                     PAYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIP
                     TGNWMYPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWISEWQRAVSR"
     misc_binding    complement(121901..122000)
                     /note="TPP riboswitch (THI element)"
                     /bound_moiety="thiamin/thiamin pyrophosphate"
     gene            complement(121914..122033)
                     /locus_tag="SeHA_C0116"
     CDS             complement(121914..122033)
                     /locus_tag="SeHA_C0116"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="ACF67094.1"
                     /translation="MLPGNKITTLTPNSTGCRAHARAEKIPVEPDPDNAGEGI"
     gene            complement(122047..123705)
                     /locus_tag="SeHA_C0117"
     CDS             complement(122047..123705)
                     /locus_tag="SeHA_C0117"
                     /note="identified by match to protein family HMM PF00496"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator SgrR"
                     /protein_id="ACF69389.1"
                     /translation="MPSGRLQQQFIRLWQCCDGKTQDTTLNELADLLNCSRRHMRTLL
                     NTMQARGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKSA
                     VRQMLISHLGRSFRQGRHILRVLYYRPMHNLLPGTALRRSETHIARQIFSSLTRVNEE
                     NGELEADIAHHWQQISPLLWRFYLRPGIHFHHGRELEMEDVISSLTRINTLPLYSHIT
                     KIDSPTAWTLDIHLSQPDRWLPWLLGQVPAMILPREWETLANFASHPIGTGPYAVRRN
                     TPNQLKILAFDDYFGYRALIDEVNVWVLPDISEEPACGLMLEGPIQGGEKAIESRLEE
                     GCYYLLFDARTPRGAHPQVREWVSHVLSPTNLLYHADEPLQQLWFPAYGLLPRWHHAR
                     PGPGEKPAGLETLTLTFYREHIEHRVIARIMSALLAEHQVHLHIQEIDYDQWHAGEIE
                     SDIWLNSANFTLPLDFSLFAHLCEVPLLQNCIPRDWQGDAAQWRAGEMNLANWCQQLL
                     ANKAIVPLIHHWLIIQGQRSMRGLRMNTLGWFDFKSAWFAPPDP"
     gene            123773..124010
                     /locus_tag="SeHA_C0118"
     ncRNA           123773..124010
                     /ncRNA_class="other"
                     /locus_tag="SeHA_C0118"
                     /product="SgrS RNA"
     gene            124122..124235
                     /locus_tag="SeHA_C0120"
     CDS             124122..124235
                     /locus_tag="SeHA_C0120"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF70290.1"
                     /translation="MPEYPRHERLMSNPELDGATLIRPTEYNGNRVILHNL"
     gene            complement(124256..124861)
                     /gene="leuD"
                     /locus_tag="SeHA_C0121"
     CDS             complement(124256..124861)
                     /gene="leuD"
                     /locus_tag="SeHA_C0121"
                     /EC_number="4.2.1.33"
                     /note="identified by match to protein family HMM PF00694;
                     match to protein family HMM TIGR00171"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase, small subunit"
                     /protein_id="ACF69034.1"
                     /translation="MAEKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLF
                     NDWRFLDEKGQQPNPEFVLNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVI
                     APSFADIFYGNSFNNQLLPVTLSDAQVDELFALVKANPGIKFEVDLEAQVVKAGDKTY
                     SFKIDDFRRHCMLNGLDSIGLTLQHEDAIAAYENKQPAFMR"
     gene            complement(124872..126272)
                     /gene="leuC"
                     /locus_tag="SeHA_C0122"
     CDS             complement(124872..126272)
                     /gene="leuC"
                     /locus_tag="SeHA_C0122"
                     /EC_number="4.2.1.33"
                     /note="identified by match to protein family HMM PF00330;
                     match to protein family HMM TIGR00170"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase, large subunit"
                     /protein_id="ACF67336.1"
                     /translation="MAKTLYEKLFDAHVVFEAPNETPLLYIDRHLVHEVTSPQAFDGL
                     RAHHRPVRQPGKTFATMDHNVSTQTKDINASGEMARIQMQELIKNCNEFGVELYDLNH
                     PYQGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQ
                     GRAKTMKIEVTGNAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGDAIRALSMEGRMT
                     LCNMAIEMGAKAGLVAPDETTFNYVKGRLHAPKGRDFDEAVEYWKTLKTDDGATFDTV
                     VALRAEEIAPQVTWGTNPGQVISVTDIIPDPASFSDPVERASAEKALAYMGLQPGVPL
                     TDVAIDKVFIGSCTNSRIEDLRAAAEVAKGRKVAPGVQALVVPGSGPVKAQAEAEGLD
                     KIFIEAGFEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMA
                     AAAAVTGHFADIRSIK"
     gene            complement(126275..127366)
                     /gene="leuB"
                     /locus_tag="SeHA_C0123"
     CDS             complement(126275..127366)
                     /gene="leuB"
                     /locus_tag="SeHA_C0123"
                     /EC_number="1.1.1.85"
                     /note="identified by match to protein family HMM PF00180;
                     match to protein family HMM TIGR00169"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="ACF67971.1"
                     /translation="MSKNYHIAVLPGDGIGPEVMAQALKVMDAVRSRFDMRITTSHYD
                     VGGIAIDNHGHPLPKATVEGCEQADAILFGSVGGPKWENLPPESQPERGALLPLRKHF
                     KLFSNLRPAKLYQGLEAFCPLRADIAANGFDILCVRELTGGIYFGQPKGREGSGQYEK
                     AFDTEVYHRFEIERIARIAFESARKRRRKVTSIDKANVLQSSILWREIVNDVAKTYPD
                     VELAHMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQG
                     FGLYEPAGGSAPDIAGKNIANPIAQILSLALLLRYSLDANDAATAIEQAINRALEEGV
                     RTGDLARGAAAVSTDEMGDIIARYVAEGV"
     gene            complement(127366..128937)
                     /gene="leuA"
                     /locus_tag="SeHA_C0124"
     CDS             complement(127366..128937)
                     /gene="leuA"
                     /locus_tag="SeHA_C0124"
                     /EC_number="2.3.3.13"
                     /note="identified by match to protein family HMM PF00682;
                     match to protein family HMM PF08502; match to protein
                     family HMM TIGR00973"
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="ACF66296.1"
                     /translation="MSQQVIIFDTTLRDGEQALQASLSAKEKLQIALALERMGVDVME
                     VGFPVSSPGDFESVQTIARTIKNSRVCALARCVEKDIDVAAQALKVADAFRIHTFIAT
                     SPMHIATKLRSTLDEVIERAVYMVKRARNYTDDVEFSCEDAGRTPVDDLARVVEAAIN
                     AGARTINIPDTVGYTMPFEFAGIISGLYERVPNIDKAIISVHTHDDLGIAVGNSLAAV
                     HAGARQVEGAMNGIGERAGNCALEEVIMAIKVRKDIMNVHTNINHHEIWRTSQTVSQI
                     CNMPIPANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQIQLNLTSRSGR
                     AAVKHRMEEMGYKDTDYNMDHLYDAFLKLADKKGQVFDYDLEALAFINKQQEEPEHFR
                     LDYFSVQSGSSDIATASVKLACGEEIKAEAANGNGPVDAIYQAINRITGYDVELVKYD
                     LNAKGQGKDALGQVDIVVNHHGRRFHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKE
                     LQRKAQNKENNKETV"
     misc_feature    complement(128978..129125)
                     /note="Leucine operon leader"
     gene            129768..130712
                     /locus_tag="SeHA_C0126"
     CDS             129768..130712
                     /locus_tag="SeHA_C0126"
                     /note="identified by match to protein family HMM PF00126;
                     match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="probable HTH-type transcriptional regulator
                     LeuO"
                     /protein_id="ACF66499.1"
                     /translation="MPEVKTEKPHLLDMGKPQLRMVDLNLLTVFDAVMQEQNITRAAH
                     TLGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARAFQLFGSVRQALQLVQNELPG
                     SGFEPTSSERVFNLCVCSPLDNILTSQIYNRVEKIAPNIHVVFKASLNQNTEHQLRYQ
                     ETEFVISYEEFRRPEFTSVPLFKDEMVLVASRKHPRISGPLLEGDVYNEQHAVVSLDR
                     YASFSQPWYDTPDKQSSVAYQGMALISVLNVVSQTHLVAIAPRWLAEEFAESLDLQIL
                     PLPLKLNSRTCYLSWHEAAGRDKGHQWMEDLLVSVCKR"
     gene            131004..132758
                     /gene="ilvB"
                     /locus_tag="SeHA_C0127"
     CDS             131004..132758
                     /gene="ilvB"
                     /locus_tag="SeHA_C0127"
                     /EC_number="2.2.1.6"
                     /note="identified by match to protein family HMM PF00205;
                     match to protein family HMM PF02775; match to protein
                     family HMM PF02776; match to protein family HMM TIGR00118"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase, large subunit,
                     biosynthetic type"
                     /protein_id="ACF66627.1"
                     /translation="MMTGIKWRQAVEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIY
                     DALHTVGGIDHVLVRHEQAAVHMADGLARATGDVGVVLVTSGPGATNAITGIATAYMD
                     SIPLVILSGQVATSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPLVLKKAFWLAA
                     SGRPGPVVVDLPKDILNPAKKMPYAWPETVSMRSYNPTTSGHKGQIKRALQTLASAKK
                     PVVYVGGGAISAACYAPLRHIIETFNLPVVSSLMGLGAFPATHRQSLGMLGMHGTYEA
                     NMTMHNADVIFAVGVRFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVNADIPVVGDA
                     RLVLEQMLELLAQDAPSQPQDDIRDWWQQIESWRARQCLKYDAESESIKPQAVIETLW
                     RLTKGDAYVTSDVGQHQMFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPKE
                     MVVCVTGDGSIQMNIQELSTALQYELPVLVLNLNNRYLGMVKQWQDMIYSGRHSQSYM
                     QSLPDFVRLAEAYGHVGLQINRPDELESKLSEALEHVRNNRLVFVDVTVDGSEHVYPM
                     QIRGGGMDEMWLSKTERT"
     gene            132758..133252
                     /gene="ilvN"
                     /locus_tag="SeHA_C0128"
     CDS             132758..133252
                     /gene="ilvN"
                     /locus_tag="SeHA_C0128"
                     /EC_number="2.2.1.6"
                     /note="identified by match to protein family HMM PF01842;
                     match to protein family HMM TIGR00119"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase, small subunit"
                     /protein_id="ACF69776.1"
                     /translation="MMRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTL
                     SRMTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGREEV
                     KRNTEIFRGQIIDVTPTLYTVQLAGTSDKLDAFLASLRDVAKIVEVARSGVVGLSRGD
                     KIMR"
     gene            complement(133242..133364)
                     /locus_tag="SeHA_C0129"
     CDS             complement(133242..133364)
                     /locus_tag="SeHA_C0129"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF67636.1"
                     /translation="MADIRQTCLMALRLSDLGQISASRPDKTHARRHPANLLSA"
     gene            133536..134540
                     /gene="fruR"
                     /locus_tag="SeHA_C0130"
     CDS             133536..134540
                     /gene="fruR"
                     /locus_tag="SeHA_C0130"
                     /note="identified by match to protein family HMM PF00356;
                     match to protein family HMM PF00532; match to protein
                     family HMM TIGR02417"
                     /codon_start=1
                     /transl_table=11
                     /product="fructose repressor"
                     /protein_id="ACF66778.1"
                     /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVRE
                     HNYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQ
                     PDNEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVV
                     GADQDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVNFLYAN
                     SYEREAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDH
                     ELLDFLQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIRRNLYRRGILSRS
                     "
     gene            135146..135604
                     /gene="mraZ"
                     /locus_tag="SeHA_C0131"
     CDS             135146..135604
                     /gene="mraZ"
                     /locus_tag="SeHA_C0131"
                     /note="identified by match to protein family HMM PF02381;
                     match to protein family HMM TIGR00242"
                     /codon_start=1
                     /transl_table=11
                     /product="MraZ protein"
                     /protein_id="ACF69144.1"
                     /translation="MFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHHPC
                     LLLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHA
                     GLTKEVMLVGQFNKFELWDETTWYQQVKEDIDAEQSATETLSERLQDLSL"
     gene            135606..136547
                     /gene="mraW"
                     /locus_tag="SeHA_C0132"
     CDS             135606..136547
                     /gene="mraW"
                     /locus_tag="SeHA_C0132"
                     /EC_number="2.1.1.-"
                     /note="identified by match to protein family HMM PF01795;
                     match to protein family HMM TIGR00006"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-methyltransferase MraW"
                     /protein_id="ACF68512.1"
                     /translation="MMENFKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQ
                     LGEEGRLLAIDRDPQAIAVAQTINDPRFSIIHGPFSALADYVAERELTGKIDGILLDL
                     GVSSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTFGEERF
                     AKRIARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEE
                     IEQALKSSLSVLAPGGRLSIISFHSLEDRIVKRFMREQSRGPQVPAGLPMTEAQLKKL
                     GGRELRALGKLMPGEKEVAENPRARSSVLRIAERTNA"
     gene            136544..136909
                     /gene="ftsL"
                     /locus_tag="SeHA_C0133"
     CDS             136544..136909
                     /gene="ftsL"
                     /locus_tag="SeHA_C0133"
                     /note="identified by match to protein family HMM PF04999;
                     match to protein family HMM TIGR02209"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsL"
                     /protein_id="ACF67298.1"
                     /translation="MISRVTEALSKVKGSIGSNERHALPGVIGDDLLRFGKLPLCLFI
                     CIILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIAT
                     EKLQMQHVDPSQENIVVQK"
     gene            136925..138691
                     /gene="ftsI"
                     /locus_tag="SeHA_C0134"
     CDS             136925..138691
                     /gene="ftsI"
                     /locus_tag="SeHA_C0134"
                     /EC_number="2.4.1.129"
                     /note="identified by match to protein family HMM PF00905;
                     match to protein family HMM PF03717"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan synthetase FtsI"
                     /protein_id="ACF68887.1"
                     /translation="MKAAAKTQKSKRQEEQTNFISWRFALLCGCILLALVFLLGRAAW
                     LQIIAPDMLVRQGDMRSLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAG
                     GISVGDRWKALSTALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIH
                     LREESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVI
                     EDISSTDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMA
                     NSPSYNPNNLAGTPKDAMRNRTITDVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPY
                     RINGHEIKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLG
                     LVGERSGLYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVD
                     PPVPGERIFPESTVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYI
                     NKYIAYTAGVAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPD
                     ALATGEKNEFVINQGEGTGGRS"
     gene            138678..140165
                     /gene="murE"
                     /locus_tag="SeHA_C0135"
     CDS             138678..140165
                     /gene="murE"
                     /locus_tag="SeHA_C0135"
                     /EC_number="6.3.2.13"
                     /note="identified by match to protein family HMM PF01225;
                     match to protein family HMM PF02875; match to protein
                     family HMM PF08245; match to protein family HMM TIGR01085"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
                     6-diaminopimelate ligase"
                     /protein_id="ACF67666.1"
                     /translation="MADRNLRDLLAPWVAGLPARELREMTLDSRVAAAGDLFVAVVGH
                     QADGRRYIPQAIAQGVAAIIAEAKDEASDGEIREMHGVPVVYLSQLNERLSALAGRFY
                     HEPSENMRLVAVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTG
                     SAVDVQHVLASLVAQGATFGAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDM
                     AHYEAAKWMLYSTHHHGQAIVNADDEVGRRWLASLPDAVAVSMEGHINPNCHGRWLKA
                     EAVEYHDRGATIRFASSWGEGEIESCLMGAFNVSNLLLALATLLALGYPLTDLLKTAA
                     RLQPVCGRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDK
                     GKRPLMGAIAEEFADIVVVTDDNPRTEEPRAIINDILAGMLDAGQVRVMEGRAEAVTN
                     AIMQAKDNDVVLIAGKGHEDYQIVGTQRLDYSDRVTAARLLGVIA"
     gene            140162..141520
                     /gene="murF"
                     /locus_tag="SeHA_C0136"
     CDS             140162..141520
                     /gene="murF"
                     /locus_tag="SeHA_C0136"
                     /EC_number="6.3.2.10"
                     /note="identified by match to protein family HMM PF01225;
                     match to protein family HMM PF02875; match to protein
                     family HMM PF08245; match to protein family HMM TIGR01143"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-
                     alanine ligase"
                     /protein_id="ACF67115.1"
                     /translation="MISVTLSKIADVLGAEHRGADLTLDTVITDTRKVTPGCLFVALK
                     GERFDAHDFADKAKANGAGALLVSRPLDIDLPQVIVKDTRQAFGQLAAWVRMQVPARV
                     VALTGSSGKTSVKEMTAAILSQCGNTLYTAGNFNNDIGVPITLLRLNHDYDYAVIELG
                     ANHQGAIAWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIYTGLPENGIAIMN
                     ADNNDWLNWQSIIGDRQVWRFSPNAANSDFTAANIHVTSHGTEFTLQTPMGSIDVLLP
                     LPGRHNIANALAAAALSMAVGATLAAIKAGLAALKAVPGRLFPIQLSENQLVLDDAYN
                     ANVGSMTAAVQVLSEMPGYRVLVVGDMAELGAESEACHLQVGEAAKAAGIDRVLSTGK
                     LSQAISHASGVGEHFADKAALIARLHALLQEQPMMTILVKGSRSAAMEDVVHALQEKG
                     SC"
     gene            141514..142596
                     /gene="mraY"
                     /locus_tag="SeHA_C0137"
     CDS             141514..142596
                     /gene="mraY"
                     /locus_tag="SeHA_C0137"
                     /EC_number="2.7.8.13"
                     /note="identified by match to protein family HMM PF00953;
                     match to protein family HMM TIGR00445"
                     /codon_start=1
                     /transl_table=11
                     /product="phospho-N-acetylmuramoyl-pentapeptide-
                     transferase"
                     /protein_id="ACF66589.1"
                     /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRM
                     IARLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVL
                     VVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDTPATQL
                     VVPFFKDVMPQLGLFYILLSYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWA
                     TGNMNFANYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGA
                     LGIIAVLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWP
                     EPRVIVRFWIISLMLVLIGLATLKVR"
     gene            142599..143915
                     /gene="murD"
                     /locus_tag="SeHA_C0138"
     CDS             142599..143915
                     /gene="murD"
                     /locus_tag="SeHA_C0138"
                     /EC_number="6.3.2.9"
                     /note="identified by match to protein family HMM PF02875;
                     match to protein family HMM PF08245; match to protein
                     family HMM TIGR01087"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
                     /protein_id="ACF66628.1"
                     /translation="MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGL
                     DKLPQEVERHVGGLNDEWLLAADLIVASPGIALAHPSLSAAASAGVEIVGDIELFCRE
                     AQAPIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDADRELYVLELS
                     SFQLETTSSLQAAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALT
                     MPVRGADERCVSFGVNMGDYHLNRQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAA
                     LALADAVGLPRASSLKALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGL
                     HVDGTLHLLLGGDGKSADFSPLTRYLTGDRIRLYCFGRDGAQLAALRPEIAQQTETME
                     EAMRLLAPRVQPGDMVLLSPACASLDQFKNFEQRGDVFTRLAKELG"
     gene            143915..145159
                     /gene="ftsW"
                     /locus_tag="SeHA_C0139"
     CDS             143915..145159
                     /gene="ftsW"
                     /locus_tag="SeHA_C0139"
                     /note="identified by match to protein family HMM PF01098;
                     match to protein family HMM TIGR02614"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsW"
                     /protein_id="ACF70190.1"
                     /translation="MRLSLPRLRMPRVPGFGLLAWLFAALKGWVMASRDKDADSLIMY
                     DRTLLWLTFGLAAIGFVMVTSASMPVGQRLANDPFLFAKRDALYIFLAFCLAMVTLRL
                     PMTFWQKYSTTMLIASIIMLLIVLVVGSSVNGASRWIALGPLRIQPAEFTKLSLFCYL
                     ANYLVRKVDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAK
                     LWQFIAIIGMGISAVILLILAEPYRIRRVTSFWNPWEDPFGSGYQLTQSLMAFGRGEI
                     WGQGLGNSVQKLEYLPEAHTDFIFAIIGEELGYIGVVLALLMVFFVAFRAMSIGRKAL
                     EIDHRFSGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIM
                     FLLRIDYETRLEKAQAFTRGSR"
     gene            145156..146223
                     /gene="murG"
                     /locus_tag="SeHA_C0140"
     CDS             145156..146223
                     /gene="murG"
                     /locus_tag="SeHA_C0140"
                     /EC_number="2.4.1.227"
                     /note="identified by match to protein family HMM PF03033;
                     match to protein family HMM PF04101; match to protein
                     family HMM TIGR01133"
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyldiphospho-muramoylpentapeptide
                     beta-N-acetylglucosaminyltransferase"
                     /protein_id="ACF66193.1"
                     /translation="MSGQPKRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADR
                     MEADLVPKHGIDIDFIRISGLRGKGVKALLAAPLRIFNAWRQARAIMKRFKPDVVLGM
                     GGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATTVMQAFPGAFPNAEVVGN
                     PVRTDVLALPLPQVRLAGRDGPIRVLVVGGSQGARVLNQTMPQVAARLGDTVTIWHQS
                     GKGAQLTVEQAYAGAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPA
                     IFVPFQHKDRQQYWNALPLENAGAAKIFEQPQFTVEAVADTLAGWSREALLTMAERAR
                     AVSIPDATERVASEVSRVART"
     gene            146342..147817
                     /gene="murC"
                     /locus_tag="SeHA_C0141"
     CDS             146342..147817
                     /gene="murC"
                     /locus_tag="SeHA_C0141"
                     /EC_number="6.3.2.8"
                     /note="identified by match to protein family HMM PF01225;
                     match to protein family HMM PF02875; match to protein
                     family HMM PF08245; match to protein family HMM TIGR01082"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate--alanine ligase"
                     /protein_id="ACF69235.1"
                     /translation="MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGY
                     QISGSDLAPNPVTQQLTSLGATIFFNHRPENVRDASVVVVSSAISADNPEIVAAHEAR
                     IPVIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAG
                     VHARLGHSRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFL
                     HNLPFYGRAVMCVDDPVIRELLPRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLR
                     QGMPDLHVTLNAPGRHNALNAAAAVAVATEEGIADDAILRALESFQGTGRRFDFLGEF
                     PLEPVNGKAGTAMLVDDYGHHPTEVDATIKAARAGWPDKNLVMLFQPHRYTRTRDLYD
                     DFANVLTQVDALLMLDVYPAGEAPIPGADSRSLCRTIRNRGKIDPILVSDPAQVATML
                     APVLTGNDLILVQGAGNVGKIARYLSEIKLKPQIQEEEQHG"
     gene            147810..148730
                     /gene="ddlB"
                     /locus_tag="SeHA_C0142"
     CDS             147810..148730
                     /gene="ddlB"
                     /locus_tag="SeHA_C0142"
                     /EC_number="6.3.2.4"
                     /note="identified by match to protein family HMM PF01820;
                     match to protein family HMM PF07478; match to protein
                     family HMM TIGR01205"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine--D-alanine ligase B"
                     /protein_id="ACF69851.1"
                     /translation="MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPVDPQE
                     VDVAQLKAMGFQKVFIALHGRGGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKL
                     LWQGAGLPVAPWVALTRAEFEKGLSEEQKARISALGLPLIVKPSREGSSVGMTKVVEE
                     NALQGALSLAFQHDDEILIEKWLCGPEFTVAIVGEEILPSIRIQPAGTFYDYEAKYLS
                     DETQYFCPAGLEASQEAALQSLVLQAWKALGCTGWGRIDVMLDSDGQFYLLEANTSPG
                     MTSHSLVPMAARQAGMSFSQLVVRILELAD"
     gene            148732..149562
                     /gene="ftsQ"
                     /locus_tag="SeHA_C0143"
     CDS             148732..149562
                     /gene="ftsQ"
                     /locus_tag="SeHA_C0143"
                     /note="identified by match to protein family HMM PF03799;
                     match to protein family HMM PF08478"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsQ"
                     /protein_id="ACF68678.1"
                     /translation="MSQAALNTRNSDEETPSSRRNNGTRLAGILFLLTVLCTVFVSGW
                     VVLGWMEDAQRLPLSKLVLTGERHYTRNDDIRQAILALGAPGTFMTQDVNIIQSQIER
                     LPWIKQASVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPSDRIGKQVLPML
                     YGPEGSASEVLQGYREMGQVLAKDKFTLKEAAMTARRSWQLTLNNGIKLNLGRGDTMK
                     RLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESNQQQNQAQAEQQ
                     "
     gene            149559..150821
                     /gene="ftsA"
                     /locus_tag="SeHA_C0144"
     CDS             149559..150821
                     /gene="ftsA"
                     /locus_tag="SeHA_C0144"
                     /note="identified by match to protein family HMM PF02491;
                     match to protein family HMM TIGR01174"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsA"
                     /protein_id="ACF69258.1"
                     /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSR
                     GMDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE
                     EVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHL
                     ITCHNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDI
                     AVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVE
                     VPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVL
                     TGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLN
                     GEAEVEKRVTASVGSWIKRLNSWLRKEF"
     gene            150882..152033
                     /gene="ftsZ"
                     /locus_tag="SeHA_C0145"
     CDS             150882..152033
                     /gene="ftsZ"
                     /locus_tag="SeHA_C0145"
                     /note="identified by match to protein family HMM PF00091;
                     match to protein family HMM PF03953; match to protein
                     family HMM TIGR00065"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsZ"
                     /protein_id="ACF66581.1"
                     /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNT
                     DAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDREALRAALEGADMVFIAA
                     GMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSL
                     ITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMS
                     EMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFE
                     TVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQP
                     VLDRYQQHGMAPLTQEQKTVSKVVNDNTPQAAKEPDYLDIPAFLRKQAD"
     gene            152134..153051
                     /gene="lpxC"
                     /locus_tag="SeHA_C0146"
     CDS             152134..153051
                     /gene="lpxC"
                     /locus_tag="SeHA_C0146"
                     /EC_number="3.5.1.-"
                     /note="identified by match to protein family HMM PF03331;
                     match to protein family HMM TIGR00325"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
                     deacetylase"
                     /protein_id="ACF67043.1"
                     /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDL
                     NPPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPEIP
                     IMDGSAAPFVYLLLDAGIDELNCAKKFVRIKETVRVEDGDKWAEFRPYNGFTLDFTID
                     FNHPAIDSSSQRYAMNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVV
                     DDYRVLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVL
                     AKQEAWEFVTFQDDAELPLAFKAPSTVLA"
     gene            153330..153827
                     /gene="secM"
                     /locus_tag="SeHA_C0147"
                     /note="secretion monitor protein; this gene contains a
                     frame shift which may be the result of sequencing error;
                     identified by match to protein family HMM PF06558"
                     /pseudo
     gene            153889..156594
                     /gene="secA"
                     /locus_tag="SeHA_C0148"
     CDS             153889..156594
                     /gene="secA"
                     /locus_tag="SeHA_C0148"
                     /note="identified by match to protein family HMM PF01043;
                     match to protein family HMM PF02810; match to protein
                     family HMM PF07516; match to protein family HMM PF07517;
                     match to protein family HMM TIGR00963"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase, SecA subunit"
                     /protein_id="ACF69236.1"
                     /translation="MLIKLLTKVFGSRNDRTLRRMRKAVSLINAMEPEMEKLSDDELK
                     AKTNEFRARIEKGESVESLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNDRCIAEM
                     RTGEGKTLTATLPAYLNALSGKGVHVVTVNDYLAQRDAENNRPLFEFLGMSVGINLPG
                     MPAPAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDE
                     ARTPLIISGPAEDSSEMYKKVNKIIPHLIRQEKEDSDTFQGEGHFSVDEKARQVNLTE
                     RGLVLIEELLVQEGIMDEGESLYSPGNIMLMHHVTAALRAHALFTRDVDYIVKDGEVI
                     IVDEHTGRTMQGRRWSDGLHQAVEAKEGVEIQNENQTLASITFQNYFRLYEKLAGMTG
                     TADTEAFEFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTANGQ
                     PVLVGTISIEKSEVVSRELTKAGIKHNVLNAKFHANEAGIVAQAGYPAAVTIATNMAG
                     RGTDIMLGGSWQAEVAALEAPTEEQIAQIKADWQVRHDAVLAAGGLHIIGTERHESRR
                     IDNQLRGRSGRQGDPGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVT
                     KAIANAQRKVESRNFDIRKQLLEYDDVANDQRRAIYTQRNELLDVSDVSDTINSIRED
                     VFKATIDAYIPPQSLEEMWDIPGLQERLKNDFDLEMPIAEWLDKEPELHEETLRERIL
                     AQSIEVYQRKEEVVGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKD
                     PKQEYKRESFAMFAAMLESLKYEVISTLSKVQVRMPEEVEAMEMQRREEAERLAQMQQ
                     LSHQDDDAAVAADLAAQTGERKIGRNDPCPCGSGKKYKQCHGRLS"
     gene            156746..157141
                     /locus_tag="SeHA_C0149"
     CDS             156746..157141
                     /locus_tag="SeHA_C0149"
                     /EC_number="3.6.1.-"
                     /note="identified by match to protein family HMM PF00293;
                     match to protein family HMM TIGR00586"
                     /codon_start=1
                     /transl_table=11
                     /product="mutator MutT protein"
                     /protein_id="ACF66557.1"
                     /translation="MKKLQIAVGIIRNPNDEIFITQRAADAHMANKLEFPGGKIEAGE
                     TPEQALIRELQEEVGITPTQVTLFDTLEYQFPDRHITLWFWLVERWEGEPWGKEGQPG
                     RWIAQNALSTDDFPPANEPIIRKLRQFAL"
     gene            complement(157175..157309)
                     /locus_tag="SeHA_C0150"
     CDS             complement(157175..157309)
                     /locus_tag="SeHA_C0150"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aldo/keto reductase"
                     /protein_id="ACF66077.1"
                     /translation="MDENLGALSLTLSPQELTAIEAVFPHDAAAGPRYWPEIMSTLNR
                     "
     gene            complement(157463..157654)
                     /locus_tag="SeHA_C0151"
     CDS             complement(157463..157654)
                     /locus_tag="SeHA_C0151"
                     /note="identified by match to protein family HMM PF03884"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF67122.1"
                     /translation="MSDVTVVNCPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEE
                     KRIASSGDQSDSDDWSEER"
     gene            complement(157664..158407)
                     /locus_tag="SeHA_C0152"
     CDS             complement(157664..158407)
                     /locus_tag="SeHA_C0152"
                     /note="identified by match to protein family HMM PF07072"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF66572.1"
                     /translation="MHTQVLFEHPLNEKMRTWLRIEFLIQQLSINLPIADHAGALHFF
                     RNISDLLDVFERGEVRTELLKELERQQRKLQAWVEVPGVDQDRIEALRQQLKSAGSVL
                     ISAPRIGQQLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLQQAQRDAQIESWLAS
                     LNPLTQALTLVLDLIRNSAPFRKQTSLNGFYQDNGDDADLLRLMLTLDSQLYPQISGH
                     KSRFAIRFMPLDSENGLVPERLDFELACC"
     gene            complement(158407..159027)
                     /gene="coaE"
                     /locus_tag="SeHA_C0154"
     CDS             complement(158407..159027)
                     /gene="coaE"
                     /locus_tag="SeHA_C0154"
                     /EC_number="2.7.1.24"
                     /note="identified by match to protein family HMM PF01121;
                     match to protein family HMM TIGR00152"
                     /codon_start=1
                     /transl_table=11
                     /product="dephospho-CoA kinase"
                     /protein_id="ACF68430.1"
                     /translation="MRYTVALTGGIGSGKSTVADAFADLGITVIDADIIARQMVEPGQ
                     PALNAIAEHFGSELIAADGTLRRRALRERIFSHPEEKAWLNALLHPLIQQETQRQFQQ
                     ATSPYVLWVVPLLVENRLYQKANRVLVVDVTPETQLIRTMQRDDVTREHVEHILAAQA
                     TREARLAVADDVIDNNGAPDAIASDVARLHASYLKLASQFVSQEKP"
     gene            159253..160296
                     /gene="guaC"
                     /locus_tag="SeHA_C0155"
     CDS             159253..160296
                     /gene="guaC"
                     /locus_tag="SeHA_C0155"
                     /EC_number="1.7.1.7"
                     /note="identified by match to protein family HMM PF00478;
                     match to protein family HMM TIGR01305"
                     /codon_start=1
                     /transl_table=11
                     /product="guanosine monophosphate reductase"
                     /protein_id="ACF69085.1"
                     /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQTW
                     SGVPIIAANMDTVGTFEMAQALAGFDILTAVHKHYTVEEWAAFINTASADVLKHVMVS
                     TGTSDADFEKTVQILALNPALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVV
                     TGEMCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIVS
                     DGGCTMPGDVAKAFGGGADFVMLGGMLAGHEESGGSVVEENGEKFMLFYGMSSESAMN
                     RHVGGVAKYRAAEGKTVKLPLRGPVGNTARDILGGLRSACTYVGASRLKELTKRTTFI
                     RVQEQENRIFNSL"
     gene            complement(160327..161529)
                     /locus_tag="SeHA_C0156"
     CDS             complement(160327..161529)
                     /locus_tag="SeHA_C0156"
                     /note="identified by match to protein family HMM PF00482"
                     /codon_start=1
                     /transl_table=11
                     /product="protein transport protein HofC"
                     /protein_id="ACF68565.1"
                     /translation="MSVKQLWRWQGVNDKGQLEQDVVWADNRLALIITLQHQRIMPLR
                     IKRMGVNAALWKEEQSAEIIHQLATLIHAGLTLSEGLELLAKQHPHRQWQALLRTLAH
                     ELEQGVPFSSALVSWPQVFPPLYQTMIRTGELTGKLAECCFELARQQKAQRQITVSVK
                     KALRYPAIILTMAALVVFAMLHFVLPEFAAIYRSFNTPLPLLTRGIIAIAQWGSAWGW
                     LILFLTMLVAIAHRRVKQKPSWQAQRQRLLLRLPVMGRLIRGQKLAQIFTVLALTQSA
                     GIPFLQGLESAIDSLGCPYWSQRLTQVHQEIAAGNPVWLALKNTQEFSPLCLQLVRTG
                     EASGSLDIMLHNLARHHSETTLALADNLASLLEPALLIITGLIIGTLVVAMYLPIFHL
                     GDAMSGMG"
     gene            complement(161519..162904)
                     /locus_tag="SeHA_C0157"
     CDS             complement(161519..162904)
                     /locus_tag="SeHA_C0157"
                     /note="identified by match to protein family HMM PF00437"
                     /codon_start=1
                     /transl_table=11
                     /product="protein transport protein HofB"
                     /protein_id="ACF70378.1"
                     /translation="MKDAQLNTLCQRHQAVLINSASNSITVAVVDAPSHALLDALHFA
                     TQKQIDIVCWTRQQMENHRHKPDQAPSANAAKGGETAAQLLNQTLRSAMAKRASDIHL
                     EPGASRYRIRLRIDGVLHILQDIAKETGLALTARLKVLGNLDIAEHRLPQDGQFTVDL
                     AGDSISFRIATLPCKEGEKVVLRLLHQVEQTLDLDTLGMYGAQLTAFRQALQQPQGLV
                     LVTGPTGSGKTVTLYSALQTRNTPGINLCSVEDPIEIPLDGINQTQIHPRAGLTFQNV
                     LRALLRQDPDIIMVGEIRDGDTAEIAIKAAQTGHLVLSTLHTNSTSETLIRLQQMGVA
                     RWMISSALTLVVAQRLVRKLCPHCKQRLSDPVVLSPNLWPSALPRWQASGCQHCYHGF
                     YGRTALFEVLTVTPALRQLIASGASAQALEAHLQQTGTGTLFENGCRAVEQGMTSFEE
                     ILRVLGMPHER"
     gene            complement(162914..163351)
                     /locus_tag="SeHA_C0158"
     CDS             complement(162914..163351)
                     /locus_tag="SeHA_C0158"
                     /note="identified by match to protein family HMM PF07963;
                     match to protein family HMM TIGR02532"
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin peptidase dependent protein D"
                     /protein_id="ACF67161.1"
                     /translation="MEKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQ
                     TFVPYRTAVELCALEHGGTSTCDAGVNGIPSPVITRYVSGMSVEKGVITLTGQESLSG
                     LSVIMTPAWDNANGITGWTRNCNIQSDSALQQACEDVFRFDTN"
     gene            complement(163573..164466)
                     /gene="nadC"
                     /locus_tag="SeHA_C0159"
     CDS             complement(163573..164466)
                     /gene="nadC"
                     /locus_tag="SeHA_C0159"
                     /EC_number="2.4.2.19"
                     /note="identified by match to protein family HMM PF01729;
                     match to protein family HMM PF02749; match to protein
                     family HMM TIGR00078"
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide diphosphorylase"
                     /protein_id="ACF66500.1"
                     /translation="MPPRRYNPDDRRDALLERINLDIPAAVAQALREDLGGEVDAGND
                     ITAQLLPADTQAHATVITREDGVFCGKRWVEEVFIQLAGDDVRLTWHVDDGDAIHANQ
                     TVFELNGPARVLLTGERTALNFVQTLSGVASEVRRYVGLLAGTQTQLLDTRKTLPGLR
                     TALKYAVLCGGGANHRLGLTDAFLIKENHIIASGSVRQAVEKAFWLHPDVPVEVEVEN
                     LDELDDALKAGADIIMLDNFNTDQMREAVKRVNGQARLEVSGNVTAETLREFAETGVD
                     FISVGALTKHVRALDLSMRFC"
     gene            164554..165117
                     /locus_tag="SeHA_C0160"
     CDS             164554..165117
                     /locus_tag="SeHA_C0160"
                     /note="identified by match to protein family HMM PF01510"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-anhydromuramyl-L-alanine amidase"
                     /protein_id="ACF65856.1"
                     /translation="MLPDKGWLVEARRVPSPHYDCRPDDEKPSLLVVHNISLPPGEFG
                     GPWIDALFTGTIDPDAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSNY
                     QGRERCNDFSIGIELEGTDTLAYTDAQYQQLAAVTRTLIACYPAIADNMTGHCNIAPD
                     RKTDPGPAFDWPRFRALVALSSHKEMT"
     gene            165114..165968
                     /locus_tag="SeHA_C0161"
     CDS             165114..165968
                     /locus_tag="SeHA_C0161"
                     /codon_start=1
                     /transl_table=11
                     /product="AmpE protein"
                     /protein_id="ACF67949.1"
                     /translation="MTLFTTLLVLIVERLFKLGEHWQLDHRLEALFRRITHFSMLRTM
                     GMTAIAMVVTFLLLQALKGLLFNVPTLVVWILLGVLCIGAGKARVHYHAWLKAASRND
                     PHPCEAMASELTLIHGVPPDCNEREFLRELQNALLWINFRFYLAPLFWFIVGGPWGPV
                     TLVGYAFLRAWQTWLARYQTPHQRLQSGIDAILHVLDWIPVRLAGVVYALLGHGEKAL
                     PAWFASLADLHTSQYQVLTRLAQFSLAREPHTDKVETPKAAVSMAKKASFVVVVIIAL
                     LTIYGALV"
     gene            complement(166060..167010)
                     /locus_tag="SeHA_C0162"
     CDS             complement(166060..167010)
                     /locus_tag="SeHA_C0162"
                     /EC_number="3.2.1.55"
                     /note="identified by match to protein family HMM PF04616"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-N-arabinofuranosidase 2"
                     /protein_id="ACF67148.1"
                     /translation="MANWPNPFIEQRADPFILRDGSDYYFIASVPEYDRLEIRRANSL
                     EGLRAADPVVVWRKPESGPMSQLIWAPEMHRINGKWYIYFAATHTQALDKLGMFQHRM
                     FALECADADPLTGKWTEKGQIKTPFDTFALDATTFYHQGKQWYLWAQKAPDIAGNSNI
                     YLAELENPWTIKGEPVRLSKPEYDWECRGFWVNEGPAVVVHGDKLFISYSASATDENY
                     CMGLLWINVNDDPRDPANWHKSPRPVFTTSYENRQYGPGHNSFTQTPEGEDVLVYHAR
                     NYTEIEGDPLYDPNRHTRLKRVRWDENGMPDFGVPPADTI"
     gene            complement(167010..168416)
                     /locus_tag="SeHA_C0163"
     CDS             complement(167010..168416)
                     /locus_tag="SeHA_C0163"
                     /note="identified by match to protein family HMM PF07690;
                     match to protein family HMM TIGR00792"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/galactoside symporter"
                     /protein_id="ACF69241.1"
                     /translation="MDKGRLSVREKIGYGMGDAGCNIIFGAIMLFVNYFYTDIFGLAP
                     ALVGVLLLSVRVIDAVTDPVMGALADRTQSKYGRFRPWLLWIAFPYALFSVLMFTTPD
                     WGYNSKVVYAFVTYFLLSVTYTAINIPYCSLGGVITNDPKERVACQAYRFVLVGIATL
                     LLSLTLLPMVDWFGGGDKAKGYQLAMTVLAIIGMGMFLFCFASVRERVRPAVPTHDDM
                     KNDFKDVWKNDQWVRILLLTLCNVCPGFIRMAATMYYVTWVMGQSTHFATLFISLGVV
                     GMMIGSMLAKVLTDRWCKLKVFFWTNIALAIFSCAFYFFDPKATVMIVALYFLLNILH
                     QIPSPLHWSLMADVDDYGEWKTGKRITGISFSGNLFFLKLGLAIAGAMVGFLLSWYGY
                     DASAKAQSASAMNGIMLLFTVIPGVGYLITAGVVRLLKVDRELMKKIQDDLEKRRTNY
                     RELSELQDLNAAESVRKA"
     gene            complement(168580..169950)
                     /locus_tag="SeHA_C0164"
     CDS             complement(168580..169950)
                     /locus_tag="SeHA_C0164"
                     /note="identified by match to protein family HMM PF00324"
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic amino acid transport protein AroP"
                     /protein_id="ACF68483.1"
                     /translation="MDSQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAG
                     PGIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGGFAGFASGWNYWVLY
                     VLVAMAELTAVGKYIQFWYPEIPTWASAAAFFVIINAINLTNVKVFGEMEFWFAIIKV
                     IAVIAMILFGAWLLFSDTAGPQATVRNLWEQGGFLPHGWTGLVMMMAIIMFSFGGLEL
                     VGITAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLLPWTRVTADTSPFVLIFH
                     ELGDTFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALLNVDKRGVPVS
                     SILVSAVVTALCVLLNYLAPESAFGLLMALVVSALVINWAMISLAHMMFRRAKQQQGV
                     KTRFPALFYPFGNVLCLLFMAAVLIIMLMTPGMAISVWLIPVWLLILGVGYLCKEKTA
                     KTVKAH"
     gene            170516..171280
                     /locus_tag="SeHA_C0165"
     CDS             170516..171280
                     /locus_tag="SeHA_C0165"
                     /EC_number="1.8.1.4"
                     /note="identified by match to protein family HMM PF00392;
                     match to protein family HMM PF07729"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family"
                     /protein_id="ACF69393.1"
                     /translation="MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQF
                     DVSRPSLREAIQRLEAKGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHPESQFDLLE
                     TRHALEGIAAYYAALRSTDEDKDRIRELHHAIELAQESGDLDAESEAVLQYQIAVTEA
                     AHNVVLLHLLRCMEPMLAQNVRQNFELLYARREMLPLVSTHRTRIFEAIMAGKPEEAR
                     EASHRHLAFIEEIMLDRSREESRRERALRRLEQRKN"
     gene            171440..174103
                     /gene="aceE"
                     /locus_tag="SeHA_C0166"
     CDS             171440..174103
                     /gene="aceE"
                     /locus_tag="SeHA_C0166"
                     /EC_number="1.2.4.1"
                     /note="identified by match to protein family HMM
                     TIGR00759"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase (acetyl-transferring),
                     homodimeric type"
                     /protein_id="ACF69803.1"
                     /translation="MSERFQNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLSEA
                     RKGGVKVAAGAGASNYINTIAVEDEPEYPGNLELERRIRSAIRWNAIMTVLRASKKDL
                     ELGGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGIYARAFLEGRLTQ
                     EQMDNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLK
                     DTSKQTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIV
                     NELEGIFAGAGWNVIKVMWGGRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYV
                     REHFFGKYPETAALVADWTDEQIWALNRGGHDPKKVYAALKKAQETKGKATVILAHTI
                     KGYGMGDTAEGKNIAHQVKKMNMDGVRYVRDRFNVPVADADLEKLPYITFPEGSEEHK
                     YLHERRQALHGYLPSRQPNFTEKLELPQLSDFGALLEEQSKEISTTIAFVRALNVMLK
                     NKSIKDRLVPIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQIL
                     QEGINELGAGASWLAAATSYSTNDLPMIPFYIYYSMFGFQRIGDLCWQAGDQQARGFL
                     IGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEK
                     QENVYYYITTLNENYHMPAMPAGAEEGIRKGIYKLETLEGSKGKVQLLGSGSILRHVR
                     EAAQILAKDYGVGSDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPA
                     VASTDYMKLFAEQVRTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGE
                     LAKRGEIDKKVVADAITKFNIDADKVNPRLA"
     gene            174118..176007
                     /gene="aceF"
                     /locus_tag="SeHA_C0167"
     CDS             174118..176007
                     /gene="aceF"
                     /locus_tag="SeHA_C0167"
                     /EC_number="2.3.1.12"
                     /note="identified by match to protein family HMM PF00198;
                     match to protein family HMM PF00364; match to protein
                     family HMM PF02817; match to protein family HMM TIGR01348"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoyllysine-residue acetyltransferase"
                     /protein_id="ACF66019.1"
                     /translation="MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASM
                     EVPSPQAGVVKEIKVSVGDKTETGALIMIFDSADGAADAAPAKAEEKKEAAPTAAPAA
                     AAAKDVHVPDIGSDEVEVTEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEI
                     KVNTGDKVSTGSLIMVFEVAGEAGAAAPAKAEAAPAAAAPAAATGVKDVNVPDIGGDE
                     VEVTEVMVKVGDKVTAEQSLITVEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIM
                     VFEVEGAAPAAAPAKQEAAAPAPAAKAEKPAAPAAKAEGKSEFAENDAYVHATPLIRR
                     LAREFGVNLAKVKGTGRKGRILREDVQAYVKDAIKRAEAAPAAAGGGIPGMLPWPKVD
                     FSKFGEVEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKR
                     KLDVKYTPVVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVP
                     VFKDVNKKSVTELSRELTTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNA
                     PEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSFDHRVIDGADGARFITIINNMLSDI
                     RRLVM"
     gene            176207..177631
                     /gene="lpdA"
                     /locus_tag="SeHA_C0168"
     CDS             176207..177631
                     /gene="lpdA"
                     /locus_tag="SeHA_C0168"
                     /EC_number="1.8.1.4"
                     /note="identified by match to protein family HMM PF00070;
                     match to protein family HMM PF01134; match to protein
                     family HMM PF02852; match to protein family HMM PF07992;
                     match to protein family HMM TIGR01350"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="ACF70237.1"
                     /translation="MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGV
                     CLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVITQLTGGLA
                     GMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDP
                     RVWDSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDI
                     VKVFTKRISKKFNLMLETKVTAVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPN
                     GKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEV
                     IAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDC
                     ADGMTKLIFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHE
                     SVGLAAEVFEGSITDLPNPKAKKK"
     gene            177709..177837
                     /locus_tag="SeHA_C0169"
     CDS             177709..177837
                     /locus_tag="SeHA_C0169"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF66733.1"
                     /translation="MCQMMAKDNETAKFIVSAAVRFSKLMPSVVPLSVIFDQLIVS"
     gene            177920..178204
                     /locus_tag="SeHA_C0170"
     CDS             177920..178204
                     /locus_tag="SeHA_C0170"
                     /codon_start=1
                     /transl_table=11
                     /product="probable secreted protein"
                     /protein_id="ACF67225.1"
                     /translation="MKLFLTTAALTATLISGMAFASDPVIPWATNSGGTESTHIAAMG
                     EDLNAQHQQITHTHEGVWAANSGSIQADEAALTSNKPPVQGHPELMPHQG"
     gene            complement(178242..179033)
                     /locus_tag="SeHA_C0171"
     CDS             complement(178242..179033)
                     /locus_tag="SeHA_C0171"
                     /codon_start=1
                     /transl_table=11
                     /product="probable secreted protein"
                     /protein_id="ACF67800.1"
                     /translation="MKKVMLSALLLSLPLLGYAQERFPSPEAAASAFAAAVAGKNETQ
                     LTALLGDDWRQFLPPEGADPEAVARFNRDWREGHRIVQKDNTAHLNVGREDWQLPVPM
                     VKETGGWRFDMAAAGNEILTRTIGRNELSTLQAMHAYVDAQQDYYLQNHRWAHRIISS
                     EGQKDGLYWPTKAGDVPSPLGPNFSPAAPDEGYHGYHFRIISDNDGHGAALLAWPMHY
                     GETGVMSFMVNQDDRIYQADLGKETESKVQAITRFAPDAQWQVAE"
     gene            complement(179046..180671)
                     /locus_tag="SeHA_C0172"
     CDS             complement(179046..180671)
                     /locus_tag="SeHA_C0172"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane protein"
                     /protein_id="ACF68300.1"
                     /translation="MTLPFKPHLIALVCSAGLFAASGVLYVKSRAPEAPAQAAAPASE
                     PTQTAVPAPVAKTTFTTAQIDQWVAPVALYPDALLSQVLMASTYPANVVQAVQWSRDN
                     PTLQGDAAIQAVASQPWDPSVKSLVAFPQLMALMGENPQWVQNLGDAFLAQPQDVMDA
                     VQRLRLLAQQTGSLKSTPQQTVTSVPKSSASTAVTTTTTTTSASTPATPSTVIKIEPA
                     NPQVVYVPNYNPATVYGAWPNTAYPPVYLPPPPGQQFADSFVKGFGYSLGVATTYALF
                     SSIDWDDDDHHHHDDDHHDDDYHHGGNGYQHNGDNININVNNFNRISGQNLPGQTMGW
                     QHNPAWRNGVPYPNNTVAQRFHPTNVSGGLSATQQAPVSRDSQRQAAMTQFQQRSHTA
                     NASLPAPGTRDAQRKAASQQLNQIAQRNNYRGYDGTQNSSRREAAQQTLNKSTTQQHR
                     SELKAKAQQHPVSQQQRDTARQRIESSTPQQRQAFRQNMHANVFSGNDSRSPSWQSQQ
                     LRGLESRRGSHLNTEQRAAAREHFSEHHEFHRR"
     gene            181060..183657
                     /gene="acnB"
                     /locus_tag="SeHA_C0173"
     CDS             181060..183657
                     /gene="acnB"
                     /locus_tag="SeHA_C0173"
                     /EC_number="4.2.1.3"
                     /note="identified by match to protein family HMM PF00330;
                     match to protein family HMM PF06434; match to protein
                     family HMM TIGR00117"
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase 2"
                     /protein_id="ACF69414.1"
                     /translation="MLEEYRKHVAERAAQGIVPKPLDATQMAALVELLKTPPVGEEEF
                     LLDLLINRVPPGVDEAAYVKAGFLAAVAKGDTTSPLVSPEKAIELLGTMQGGYNIHPL
                     IDALDDAKLAPIAAKALSHTLLMFDNFYDVEEKAKAGNEYAKQVMQSWADAEWFLSRP
                     PLAEKITVTVFKVTGETNTDDLSPAPDAWSRPDIPLHAQAMLKNAREGIEPDQPGVVG
                     PIKQIEALQKKGYPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPNVPNKRGGGLCLGG
                     KIAPIFFNTMEDAGALPIEVDVSNLNMGDVIDVYPYKGEVRNHETGELLATFELKTDV
                     LIDEVRAGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESSRGFSLAQKMVGRA
                     CGVKGIRPGAYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPK
                     PVDVTTHHTLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISF
                     PAGSGLVAFAAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVE
                     KKGKKNIFSGRILEIEGLPDLKVEQAFELTDASAERSAAGCTIKLNKEPIIEYLTSNI
                     VLLKWMIAEGYGDRRTLERRIQGMEKWLADPQLLEADADAEYAAVIDIDLADIKEPIL
                     CAPNDPDDARLLSDVQGEKIDEVFIGSCMTNIGHFRAAGKLLDSHKGQLPTRLWVAPP
                     TRMDAAQLTEEGYYSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLG
                     TGANVFLASAELAAVAALIGKLPTPEEYQTFVAQVDKTAVDTYRYLNFDQLSQYTEKA
                     DGVIFQTAV"
     gene            complement(183689..184660)
                     /locus_tag="SeHA_C0174"
     CDS             complement(183689..184660)
                     /locus_tag="SeHA_C0174"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF69872.1"
                     /translation="MTYFKWLSVLLCFITSYHAYANDSAVGETNGSIEFLQQNEISMA
                     KERLLIASDRINVDYVFINHSAQDITVPVAFPMPAISQQYMGDRTEGIANFKISVDGK
                     PVKSESRWRVIHDLGGKGEEDITAKLLQTGWTIPQLRHVLNREGKASIEEGYKEGKQQ
                     LPSEWFDDGYLNIAVQQYFIWQQRFPAGKEIVIHHSYTPSTSTGVPDSLDSLLGDELG
                     DQCLTAATRKALKQLDAGIKYKNEDGSANIGWGYLGYILKTGANWKEGVIGDFTLRIH
                     KKDETEVVVPCFNYPLKQIDPLTLEFKQKNFKPDENLDIHFYYDSSL"
     gene            184733..185821
                     /locus_tag="SeHA_C0175"
     CDS             184733..185821
                     /locus_tag="SeHA_C0175"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF70374.1"
                     /translation="MRYYLFLLLIICQNTFAEEIKPLPQGDTWRKYIALSLRDEEGLE
                     DGLFNLRRIEANSSIAYVCGLIKDKNDNFLTDGQNQYHLYDRVMAIGYRWSWGSVVRF
                     DKTIASPQDVHCHYGKNVPLTSALLREQVAAQGRKNICQPVKASNPLRSDILNGLRAS
                     YIGDSNSLTLNGPLPTVKFIVEDLCATEDYAYFLGKATGDKTSFFIHDDANNRLRVVL
                     KKYPDGVWRPQPENNLLTQQSKVSGGYCSDGTLRETDLAQLAQACRVEGDTVNLTGTL
                     RQQGDGESAYWTLTPDNPLACVRDANKQQPGWNQTIQLVLTPQERESLNNLVGKKVSV
                     GGDIFLALSASHHTPLLLDNIFRLTEIK"
     gene            185855..186163
                     /locus_tag="SeHA_C0176"
     CDS             185855..186163
                     /locus_tag="SeHA_C0176"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF66196.1"
                     /translation="MLCGNVDAAAKLQYLHVTNGGMMAFYDDGNAKMCARCEPMVQNL
                     KSMNNKAPYARWKQMGDVIKLKSPNSESDYKFYQQGEILSTWWIFNYKTLHALVDLSE
                     "
     gene            complement(186178..187110)
                     /locus_tag="SeHA_C0177"
     CDS             complement(186178..187110)
                     /locus_tag="SeHA_C0177"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF67419.1"
                     /translation="MKKIAFGFPLLLAVLPHPAQANEAVANSSLHLLAQSDIQLAKER
                     LLIERDRINADYLFVNPTAQDITVPVVFPMPPLSFSDVNEAGEDYIPGIRNIKIRVDG
                     QIVTPQPRWTVVLNAPQEEITDKLQQAGWTVEQLIAALSDGEFSPPADLPALPPEWFK
                     DNQPQFTIQRNFIWQQTFPAGKAVTIHQVYTPSVSLSALMSTDELDNDNTCPTAENRQ
                     QIQQALDQLMTAQGPAGALGQNRMDVVLTGDPAWKEGDIGEFTLRLHGDAITTCFQPP
                     LTRINATTLEFKQKNFRPAENLAVTFYSLSSMYE"
     gene            187185..188324
                     /locus_tag="SeHA_C0178"
     CDS             187185..188324
                     /locus_tag="SeHA_C0178"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF67544.1"
                     /translation="MRYFLLLLMMFCCNLYASDMFPLKPDANPRGAIALTLREEVGLL
                     NARFDIKRIEINETRELAYFCGLLKDTDGQYIKDEDDKYYLFDRILLDSGTEGWVSTV
                     YLDEEFSAPEQAKCHFAGNVDLKSQELRALVKQYGRIAACLPVEKGDPLRTQLLDAVR
                     ENYVGDLNRKTTLNNTPVPSFVVTQLCAAQKYAYFCGEPANADADWYSQDSKKLDVVL
                     VLQKDANNTWWLPVPQFQGISRQSSLAWCNHSTDILPVKTVEEMAKKRQQRCVREGDT
                     VSLRGILAEQKSGAQRYWVVKLEEPLTCVQDADMQTADWNGQVQLLLSDEIIERVKVQ
                     YGDDLLNQEIVVTGDVLLALSSDHHTPLVLENIVKLMPVMEGPGW"
     gene            188326..188505
                     /locus_tag="SeHA_C0179"
     CDS             188326..188505
                     /locus_tag="SeHA_C0179"
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase"
                     /protein_id="ACF67533.1"
                     /translation="MRLPIFNDCVIPAHNKRSSTDRFPASAELAAVDTYRYLNFDQLS
                     QYTEKADGVIFQTAV"
     gene            complement(188545..189009)
                     /locus_tag="SeHA_C0180"
     CDS             complement(188545..189009)
                     /locus_tag="SeHA_C0180"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF68048.1"
                     /translation="MSVFRRIIYHSGWFILFGPLIGAAIAIGIINFLPAIIGGPDSFL
                     LYFCRTIPELVIITGWIYSLLPAWLTGVACALIPLKLYQKIINRMILCAIAGGLITTL
                     FNFARYGFDISILPLIYGEVLIMLIPAIVAGAIMGGVITYLPGLREVKRNNK"
     gene            complement(189427..189750)
                     /locus_tag="SeHA_C0181"
     CDS             complement(189427..189750)
                     /locus_tag="SeHA_C0181"
                     /codon_start=1
                     /transl_table=11
                     /product="low molecular weight phosphotyrosine protein
                     phosphatase"
                     /protein_id="ACF68218.1"
                     /translation="MNVLFICSRNQWRSPTAEQVFRRYPGLSVRSAGTSRNAKKSVSC
                     GLLQWADVICVMEQKHKDRLMAEYRRIIENKPLHVLDIPDDYRYMDPELVRQLEELVP
                     DMLGI"
     gene            190021..190383
                     /locus_tag="SeHA_C0183"
     CDS             190021..190383
                     /locus_tag="SeHA_C0183"
                     /note="identified by match to protein family HMM PF06062"
                     /codon_start=1
                     /transl_table=11
                     /product="protein YacL"
                     /protein_id="ACF70116.1"
                     /translation="MDYEFLRDVTGGVKVRMSMGHEVVGHWFNEEVKDNLSLLDEVEQ
                     AARTVKGSERSWQRAGHEYTIWMDGEEVMIRANQLDFSGDEMEEGMSYYNEESLSLCG
                     MEDFLRVVAAYREFVSKA"
     gene            190618..191571
                     /locus_tag="SeHA_C0184"
     CDS             190618..191571
                     /locus_tag="SeHA_C0184"
                     /note="identified by match to protein family HMM PF03812"
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-3-deoxygluconate permease"
                     /protein_id="ACF66818.1"
                     /translation="MNIKKAIERVPGGMMVVPLVIGAVINTFAPQALEIGGFTTALFK
                     NGAAPLIGAFLLCMGAGISVKAAPQALLQGGTITLTKLLVAIGIGLGVEHLFGAEGIF
                     GLSGVAIIAAMSNSNGGLYAALVGEFGNERDVGAISILSLNDGPFFTMIALGAAGMAN
                     IPIMALVAVLVPLVVGMILGNLDPHMRDFLTKGGPLLIPFFAFALGAGINLEMLLQGG
                     LAGILLGVLTTFVGGFFNIRADRLVGGTGIAGAAASSTAGNAVATPLAIAQADPSLAE
                     VAAAAAPLIAASVITTAILTPVLTSWVAKKQARQASLEKNA"
     gene            191568..192557
                     /locus_tag="SeHA_C0185"
                     /note="YgbK domain protein; this gene contains a premature
                     stop which may be the result of sequencing error;
                     identified by match to protein family HMM PF07005"
                     /pseudo
     gene            192618..192839
                     /locus_tag="SeHA_C0186"
                     /note="conserved hypothetical protein; this gene contains
                     a premature stop which may be the result of sequencing
                     error"
                     /pseudo
     gene            192829..193812
                     /gene="pdxA"
                     /locus_tag="SeHA_C0187"
     CDS             192829..193812
                     /gene="pdxA"
                     /locus_tag="SeHA_C0187"
                     /EC_number="1.1.1.262"
                     /note="identified by match to protein family HMM PF04166;
                     match to protein family HMM TIGR00557"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase"
                     /protein_id="ACF68057.1"
                     /translation="METKTVAITMGDPAGIGPEIIVKALSEDGLNGAPLVVIGCLATL
                     KRLQAKGITPNVELRAIERVAEARFAPGIIHVIDEPLAQPEALEAGKVQAQAGDLAYR
                     CVKRATELALRGDVQAIATAPLNKEALHLAGHNYPGHTELLATLTHSRDYAMVLYTDK
                     LKVIHVSTHIALRKFLDTLSTTRVETVIGIADTFLKRVGYVKPRIAVAGVNPHAGENG
                     LFGDEETRILTPAITDARAKGMDVYGPCPPDTVFLQAYEGQYDMVVAMYHDQGHIPLK
                     LLGFYDGVNITAGLPFIRTSADHGTAFDIAWTGKAKSESMAVSIKLAMQLA"
     gene            193822..194589
                     /locus_tag="SeHA_C0188"
     CDS             193822..194589
                     /locus_tag="SeHA_C0188"
                     /note="identified by match to protein family HMM PF00455;
                     match to protein family HMM PF08220"
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR-family transcriptional regulator"
                     /protein_id="ACF70206.1"
                     /translation="MKGQHRLDLIVAYLKNHTLVTVEQLVEAVDASPATIRRDLIKLD
                     EQGVISRSHGGVALRRFEPAQPTTNEKQLRSPAEKRAIARVAASLVNAGDAVVLDAGT
                     TMMELAKCLTHLPLRVITVDLHIALFLAEFRQIEVTIVGGRIDDSSQSCIGEHGRKLL
                     RSVYPNIAFMSCNSWGVKTGVTTPTEDKAGLKQEIIANAQRKVLLADSSKYGAHSLFN
                     VVPLERFNDVITDVNLPPSAQVELKGRAFALTLVQPE"
     gene            complement(194619..195413)
                     /gene="speD"
                     /locus_tag="SeHA_C0189"
     CDS             complement(194619..195413)
                     /gene="speD"
                     /locus_tag="SeHA_C0189"
                     /EC_number="4.1.1.50"
                     /note="identified by match to protein family HMM PF02675;
                     match to protein family HMM TIGR03331"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine decarboxylase proenzyme"
                     /protein_id="ACF70015.1"
                     /translation="MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYN
                     ANRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVDPKLIDQTEHPGPLP
                     ETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDI
                     VTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVNVYQENIFHTKML
                     LKEFDLKHYMFHTKPEDLTETERQEITAALWKEMREIYYGRNISAV"
     gene            complement(195434..196294)
                     /gene="speE"
                     /locus_tag="SeHA_C0190"
     CDS             complement(195434..196294)
                     /gene="speE"
                     /locus_tag="SeHA_C0190"
                     /EC_number="2.5.1.16"
                     /note="identified by match to protein family HMM PF01564;
                     match to protein family HMM TIGR00417"
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine synthase"
                     /protein_id="ACF68722.1"
                     /translation="MAENTMWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFG
                     RVMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVE
                     TITMVEIDAGVVSFCRQYLPNHNAGSYDDPRFTLVIDDGVNFVNQTHQTFDVIISDCT
                     DPIGPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQDEALDSHRKLSHYFSDVGF
                     YQAAIPTYYGGIMTFAWATDNDALRHLSSEIIQARFHAAGLKCRYYNPAIHAAAFALP
                     QYLHDALSAQ"
     gene            complement(196401..196787)
                     /locus_tag="SeHA_C0191"
     CDS             complement(196401..196787)
                     /locus_tag="SeHA_C0191"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF66653.1"
                     /translation="MLTLTFPDAVVEAMKTFFRPVLFGSLMALCANSYALTESEAEDM
                     ADLTAVFVFLKNDCGYQNLPNSQIRRALVFFAQQNQWDLSNYDTFDMKSLGEDSYRDL
                     SGIGIPVAKKCKALARDSLSLLAYVK"
     gene            196950..198560
                     /locus_tag="SeHA_C0192"
     CDS             196950..198560
                     /locus_tag="SeHA_C0192"
                     /note="identified by match to protein family HMM PF07731;
                     match to protein family HMM PF07732; match to protein
                     family HMM TIGR01409"
                     /codon_start=1
                     /transl_table=11
                     /product="blue copper oxidase CueO"
                     /protein_id="ACF69559.1"
                     /translation="MLRRDFLKYSVALGVASALPLWSRAAFAAERPALPIPDLLTADA
                     SNRMQLIVKAGQSTFAGKNATTWGYNGNLLGPAVQLHKGKSVTVDIHNQLAEDTTLHW
                     HGLEIPGIVDGGPQGIIPAGGTRTVTFTPQQRAATCWIHPHKHGKTGRQVAMGLAGLV
                     LIEDDEIRKLRLPKQWGIDDVPVIIQDKRFSADGQIDYQLDIMTAAVGWFGDTLLTNG
                     AIYPQHSAPKGWLRLRLLNGCNARSLNIAASDNRPLYVIASDGGLLAEPVKVTELPLL
                     MGERFEVLVDISDGKAFDLVTLPVSQMGMAIAPFDKPHPVMRIQPLRITASGTLPDTL
                     TTMPALPSLEGLTVRNLKLSMDPRLDMMGMQMLMKKYGAQAMSGMDHDSMNAHMQGGN
                     MGHGEMDHGNMDHSGMNHGAMGNMNHGGKFDFHNANFINGQVFDMNKPMFAAQKGRHE
                     RWVISGVGDMMLHPFHIHGTQFRILSENGKAPAAHRTGWKDTVRVEGGISEVLVKFDH
                     DAPKEHAYMAHCHLLEHEDTGMMLGFTV"
     gene            complement(198638..200881)
                     /gene="gcd"
                     /locus_tag="SeHA_C0193"
     CDS             complement(198638..200881)
                     /gene="gcd"
                     /locus_tag="SeHA_C0193"
                     /EC_number="1.1.5.2"
                     /note="identified by match to protein family HMM PF01011;
                     match to protein family HMM TIGR03074"
                     /codon_start=1
                     /transl_table=11
                     /product="quinoprotein glucose dehydrogenase"
                     /protein_id="ACF67878.1"
                     /translation="MLVVAGLLWRSKRAALWLYAALLLATMIWGVWEVGFDFWALTPR
                     SDILVFFGIWLILPFVWHRLVVPSSGAVAALVVALLISGGILTWAGFNDPQEINGTLR
                     ADATPAATSSSIADEDWPAYGRNQEGQRYSPLKQITADNVHQLKEAWVFRTGDLKQPN
                     DPGEITNEVTPIKVGDTLYLCTAHQRLFALDAASGKEKWHFDPQLKTDSSFQHVTCRG
                     VSYHEAKADTASPEVIADCPRRIILPVNDGRLFAVNAETGKLCETFANKGVLNLQTNM
                     PDTTPGLYEPTSPPIITDKTIVIAGSVTDNFSTRETSGVIRGFDVNSGKLMWAFDPGA
                     KDPNAIPADEHAFTFNSPNSWAPAAYDAKLDLVYLPMGVTTPDIWGGNRTPEQERYAS
                     SILALNATTGKLAWSYQTVHHDLWDMDLPAQPTLADITVDGTTVPVIYAPAKTGNIFV
                     LDRRNGELVVPAPEKPVPQGAAKGDYVAKTQPFSDLTFRPKKDLSGADMWGATMFDQL
                     VCRVMFHQLRYEGIFTPPSEQGTLVFPGNLGMFEWGGISVDPDRQVAIANPMALPFVS
                     KLIPRGPGNPMEPPKDAKGTGTEAGIQPQYGVPFGVTLNPFLSPFGLPCKQPAWGYIS
                     ALDLKTNEIVWKKRIGTPRDSMPFPMPVPVPFNMGMPMLGGPISTAGNVLFIAATADN
                     YLRAYNMSNGEKLWQGRLPAGGQATPMTYEVNGKQYVVVSAGGHGSFGTKMGDYIVAY
                     ALPDDAK"
     gene            201234..201770
                     /gene="hpt"
                     /locus_tag="SeHA_C0194"
     CDS             201234..201770
                     /gene="hpt"
                     /locus_tag="SeHA_C0194"
                     /EC_number="2.4.2.8"
                     /note="identified by match to protein family HMM PF00156;
                     match to protein family HMM TIGR01203"
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="ACF66732.1"
                     /translation="MKHTVEVMIPEAEIKARIAELGRQITERYKDSGSEMVLVGLLRG
                     SFMFMADLCREVQVPHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDII
                     DSGNTLSKVREILGLREPKSLAICTLLDKPSRREVDVPVEFVGFSIPDEFVVGYGIDY
                     AQRYRHLPYVGKVVVLDE"
     gene            complement(201828..202490)
                     /locus_tag="SeHA_C0195"
     CDS             complement(201828..202490)
                     /locus_tag="SeHA_C0195"
                     /note="identified by match to protein family HMM PF00484"
                     /codon_start=1
                     /transl_table=11
                     /product="carbonate dehydratase"
                     /protein_id="ACF67458.1"
                     /translation="MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSD
                     SRVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHSGCG
                     GIKAAVENPELGLINNWLLHIRDIWLKHSSLLGKMPEEQRLDALYELNVMEQVYNLGH
                     STIMQSAWKRGQNVTIHGWAYSINDGLLRDLDVTATNRETLENGYHKGISALSLKYIP
                     HQ"
     gene            202599..203525
                     /locus_tag="SeHA_C0196"
     CDS             202599..203525
                     /locus_tag="SeHA_C0196"
                     /note="identified by match to protein family HMM PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, ATP-binding protein"
                     /protein_id="ACF68116.1"
                     /translation="MTIALELQQLKKTYPGGVQALRGIDLQVEAGDFYALLGPNGAGK
                     STTIGIISSLVNKTSGRVNVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQ
                     AGYYGVEHKEAVLRSEKYLKQLDLWEKRHERARMLSGGMKRRLMIARALMHEPKLLIL
                     DEPTAGVDIELRRSMWGFLKDLNAKGTTIILTTHYLEEAETLCRNIGIIQHGELVENT
                     SMKNLLSKLKSETFILDLAPKSPLPKLTGYQYRLVDTSTLEVEVLREQGVNSVFSQLS
                     EQGVQVLSMRNKANRLEELFVSLVHEKQGDRA"
     gene            203522..204292
                     /locus_tag="SeHA_C0197"
     CDS             203522..204292
                     /locus_tag="SeHA_C0197"
                     /note="identified by match to protein family HMM PF01061"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, permease protein"
                     /protein_id="ACF69778.1"
                     /translation="MMQLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGN
                     LIGSRIGEMHGFSYMQFIVPGLIMMAVITNSYANVASSFFSAKFQRNIEELLVAPVPT
                     HVIIAGFVGGGVARGLCVGILVTAISLFFVPFQVHSWVFVALTLILTAILFSLAGLLN
                     AVFAKTFDDISLIPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGF
                     LGIHDVPLVTTFGVLVIFIAAFYLLCWSLIQRGRGLRS"
     gene            complement(204409..205488)
                     /locus_tag="SeHA_C0198"
     CDS             complement(204409..205488)
                     /locus_tag="SeHA_C0198"
                     /note="identified by match to protein family HMM PF00419"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fimbrial protein precurosr"
                     /protein_id="ACF69298.1"
                     /translation="MKNLWMLLALSLFSGHALADGTMGNGSGWCQPTSGTHNFFFPLD
                     QTITDTDENQAGKIVKESWSVGGEYSARCDCDNKDYQGVNYFTATTGDLTQKGTYSEA
                     GSNGQQMDFYVLVAGKLEIGTETYIVGNLKQYIPVPFSAISNQDPTAGGCTGADINKM
                     SAGNKGNVRIYITHPLVGEITIPETTIMNLYLSKTPGSSGDNIPPSVPPMAHVTMSGT
                     ITVPQSCSINAGQVIEVRLPDIEGKDIRHLGDSPQNSHVTTQVNFTCSNVADGTNLSM
                     SLNGATDPHNPDYLKTDNENLGIRISDKYDNTIVPGGSAELPIEDYTDGRGSTEFTAA
                     PVNTTGHVPHTGEYQATATLEIQIR"
     gene            complement(205497..208043)
                     /locus_tag="SeHA_C0199"
     CDS             complement(205497..208043)
                     /locus_tag="SeHA_C0199"
                     /note="identified by match to protein family HMM PF00577"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane usher protein FimD"
                     /protein_id="ACF69068.1"
                     /translation="MRKRQHRVFYLSRCAVCIALGSTFAHVAWARDYFNPAFIENHGQ
                     ASRTSVELSTFDNDKSQLPGTYYVTININKTEIGARNVDFQLATLSDGQQALQGCLRL
                     QELKDNGVKTDLFPTLESEKGCVDLSVIPGASQRFDFQQQALSVSIPQLYIANNARGY
                     VPPEKWQEGITALMLNYSFSGYKEYGSSEDSDDAESKYLALQPGFNLGPWRFRNYSNW
                     SSNNGESGSWNSVYNYLQRDIIALKSQFTAGDSNTPSDVFDSVPFRGLQLTSDDQMQP
                     NSQRGYAPTIRGIARSNAQVIVRQNGYIAYQTAVSPGEFEINDMFPTGSNGDYDVTVK
                     ETDGSEQHFIVPYSSLPILQRTGRTKYSVTVGKYRDYNNHTLDDFGQATLLYGLPWGI
                     TLYGGSQIASDKYQSVAFGVGQNMQMLGAISLDGIWSHAKFDDGRKEIGQSWRVRYSK
                     GVVSTGTTFSLAGYRYASENYNSLSEVINPDDDFYDNYGKRHNRFEASVNQQISNTLG
                     SLTLSWVKEDYWHSAQQMESLSASYNNSWGPVSYTLSYSYNKNTYQYRSDNDDDDNDD
                     DRYNQNDRLFTLSLHVPFTVFDSRLYASYMLNTRKHDATVNSTTLSGTALRDRNLNWS
                     LQQSHSTQDGDSGGVNASYKGTYANLNAGYNQSPDSQQVSYGISGGILAHENGITLSQ
                     PITGAAILIKAPGASGVSVENQTGVATDFRGYTVIPNVTPYYRYDISLDSSTFADNVD
                     IPLNNQTVYPTRNAVVRAAYDTHKGYRVLLTLTRSNGEPVPFGATASVDGQDANLASI
                     VGDKGQVFLSGLPEEGLLLVNWGSASCRTDYRLDISKNMNGIVMANAVCQ"
     gene            complement(208070..208753)
                     /locus_tag="SeHA_C0200"
     CDS             complement(208070..208753)
                     /locus_tag="SeHA_C0200"
                     /note="identified by match to protein family HMM PF00345;
                     match to protein family HMM PF02753"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein FimC"
                     /protein_id="ACF67377.1"
                     /translation="MNSLAKAGLLCCLLCGSLAHAAGINIGTTRVIFHGDAKDTSISI
                     SNNDNVPYLIQSWAQSISETGASGDAPFMVTPPLFRLNGGQKNVLRIIRTGGNLPEDR
                     ESLYWLDIKSIPSSNPDNKHNTLMLAVKAEFKLIYRPKALTQKPEEVADRLTWSRQGR
                     TLTVKNPTPYYMNFATLSVGSQKVKAPRYVAPFGNAQYTLPAAASGTIVWSIINDFGG
                     TGPEHKQTP"
     gene            complement(208801..209343)
                     /locus_tag="SeHA_C0201"
     CDS             complement(208801..209343)
                     /locus_tag="SeHA_C0201"
                     /note="identified by match to protein family HMM PF00419"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fimbrial subunit"
                     /protein_id="ACF70241.1"
                     /translation="MKLTLKTLTVALAAITLSPAALADTAKDGTVHITGLIKQNACTV
                     TTDSIDVTLQDEFASLFTAAGQTAGDKGFTIDLENCDANIYSSVQARFEGTLDGTDAT
                     ILKNEGGDATNIGVQILDNADTTMTFNDLQAWSAPVNLPTAEGVTELSMPFTARYIST
                     AVPVKSGTVEATATFYLQYN"
     gene            complement(209557..209670)
                     /locus_tag="SeHA_C0202"
     CDS             complement(209557..209670)
                     /locus_tag="SeHA_C0202"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF68440.1"
                     /translation="MFFWPTTHYDHDHFLFKKFCIIFKIVSSLHRIWPIKG"
     gene            209712..210152
                     /locus_tag="SeHA_C0203"
     CDS             209712..210152
                     /locus_tag="SeHA_C0203"
                     /note="identified by match to protein family HMM PF03610"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIA component"
                     /protein_id="ACF66887.1"
                     /translation="MLGWVISCHDDRAQEMLEGLEKKYGPLAQCRAVNFWRGLSVNML
                     SRMMCDALHATDSGEGVIFLTDISGAAPYRVASLMSHKHSQCEVISGVSYSLMEEMIP
                     WRESMSSSAFRDQIVALGAPDVTSLWHQQQKNPPFVLLHDSYEF"
     gene            210214..211443
                     /locus_tag="SeHA_C0204"
     CDS             210214..211443
                     /locus_tag="SeHA_C0204"
                     /note="identified by match to protein family HMM PF01522"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase domain protein"
                     /protein_id="ACF69734.1"
                     /translation="MVMRVVLILLFFFAGNVLAALPARYMQTTKDAAIWSQIGDKMVT
                     VGNIRAGQILSVTPVAADYYAFKFGFGVGFIDKGHLESVQGKQKVEDGLGDLNKPLSN
                     QNLVTWKDTPVYNAPDISSAPFGVLVDNLRYPIISKLQGRLHQTWYQIRIGDRLAYVS
                     AMDAQEDNGIPILTYHHILRDEENTRFRHTSTTTSVRAFSNQMTWLRDRGYATLTMYQ
                     LEDYIHNRANFPARAVVITFDDGLKSVSRYAYPVLKQYGMKATAFIISSRIKRHPQTW
                     NPRSLQFMSVSELRKISDVFDFQSHTHFLHRVDGHRRPILYSRSYHNILFDFERSRRA
                     LTQFTPHVFYLSYPFGGYNATAIKAAKDAGFHLAVTTVRGKVKPGDNPMLLKRLYILR
                     TDSLETMSRLIVNQPQG"
     gene            complement(211445..212506)
                     /locus_tag="SeHA_C0205"
     CDS             complement(211445..212506)
                     /locus_tag="SeHA_C0205"
                     /note="identified by match to protein family HMM PF00419"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fimbrial protein"
                     /protein_id="ACF65915.1"
                     /translation="MKLFPYLAALLLLSASGVAYGALECKFYNGDTRQIMSPGVQPII
                     TFHPSVQTATLLASGITMELTPEMHSHCAVGDDGENIYQMTDNTLLEGYVDGKALFRT
                     NIPGITYAIGLYPAGKGITGWFPVNPGQYYMTAYADDNEGYFEHEKKWYAVMEIYQMP
                     GFNGVPSGVGFISSIGGPLGHIVLGDPIGSESDHPRPLITISDMMFNIPFSEPTCILT
                     APTTVNLGDWYRSDVEKDQTTEVPFQITGTCTGTIEVSFVAKSSYTNADKNLFTNSIT
                     SNSNVTAAGGVGVKISSPAYSQIHADSSPEVIAVGDIIGRPVTSVNANFKAKLVKTGT
                     EAVTPGIFGSSVTFQVTYE"
     gene            complement(212518..213117)
                     /locus_tag="SeHA_C0206"
     CDS             complement(212518..213117)
                     /locus_tag="SeHA_C0206"
                     /note="identified by match to protein family HMM PF00419"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fimbrial protein"
                     /protein_id="ACF66415.1"
                     /translation="MQQLLFLLRQPSLMLLMGLTGGFWSGISQAGSNLDINLTASIVN
                     STCKLSLENGGEVYLPNVTRAWFYNNDGSSKYAPTDEAGGTPFNVRLEDCADNSSIKQ
                     LMFSFTPQSGFWSNQNQVFKNDATTGAAQNVGIVIFSADYKTNVLNSDGSSNVVYDVS
                     GKSSSLYLTDYQFYARYQNTGAVVSGVVTSNVLVDVSYE"
     gene            complement(213136..213693)
                     /locus_tag="SeHA_C0207"
     CDS             complement(213136..213693)
                     /locus_tag="SeHA_C0207"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fimbrial protein"
                     /protein_id="ACF68323.1"
                     /translation="MKFTSALITLSVSAVLFSGMGRAAITGTDSVQMTFKTTVTTGTC
                     KAIVVNGDGKNVSTIGYGETYKSDLNKKAMPLSIVFSNCSGVTIAEVEAKAGTGGTCS
                     GDNLDGDSYAAGLNTAFEIWGGDADTGVKLSCKTPPAAQEVTITNGAGTYPMTSRIVV
                     ANGKSLSDVTAGDVTAPVTFVVTYP"
     gene            complement(213720..214247)
                     /locus_tag="SeHA_C0208"
     CDS             complement(213720..214247)
                     /locus_tag="SeHA_C0208"
                     /note="identified by match to protein family HMM PF00419"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fimbrial protein"
                     /protein_id="ACF66768.1"
                     /translation="MAASGSALAANSTNLDVNFTATIKETTCDMKLVGGTGSDTVQEL
                     IIGNSSGEVRIDDVRAGTATADFKLVIVECPASLQSLKTSINGTPSGFSTKILTNGIK
                     GSADYIGVSVARASKPDEPFVINSTADSERLVWSEVEINSKEVPLIAIMKETKANSAT
                     TGAFSAVATFVFSYE"
     gene            complement(214327..216924)
                     /locus_tag="SeHA_C0209"
     CDS             complement(214327..216924)
                     /locus_tag="SeHA_C0209"
                     /note="identified by match to protein family HMM PF00577"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane usher protein HtrE"
                     /protein_id="ACF68467.1"
                     /translation="MLFQRSLLCLTIGAALPFSVSAANSAAEKTVVESDEAVEFNEQF
                     LLNSSANIDISRYAYGNPVLAGTYRVKVNLNNALKSTSEITFNENGTPRASACLTPLL
                     LTQAGVDPAAMRDDVEVDDNTTCLDIKKYYPGATANYDSGKQAMDLNFPQIYILKRPA
                     GYVDPSLWEDGVPAAIVSYDMNAWHSEGNGTTSDTAYVGLRYGLNMGPWRLRSRGSLN
                     WNKDTGSEYNNQDVYLQRDITALKAQMVIGDSYTRGDAFDSFSLSGIRMYNDDRMLPM
                     GSSNYAPVIRGVANSNAKVTVMQSGNKIYETTVPPGAFEINDLSTTGYGNDLLVTVEE
                     ADGSKRSFTVPFSSVTQMLRPGATRWDIGVGELNDDSLHDKPQVGYAQFYYGLNNTFT
                     GYIGAQYTDMNFYAGLLGLAMNTGIGAFAFDVTQSHASIDDLGTLSGQSYRLTYSKML
                     EATNTSFNVAAYRFSTEDYLSLNDAASLQDSVKHQQYAQQSYRSGNELYDDYQRTKNQ
                     VQISINQPLNQGETTWGSVYVSGTWQDYWNDAGSTANYSVGYNNSFAYGSYSVSLQRA
                     YDQNGSKDDSVYLSFSIPLSMFSPDGERSGGFSNINMGLRSDMKGGTNVNSTASGNTK
                     DSDISYSVSATSSSGNYGNLNQVSGFGSLNSSYGPLGLSASFGDDNSQQYSASYSGGM
                     VLHSGGVAFAPGSIGETDAVALVKASGAQGAGLGYSSSEIGSSGYGILPYMSAYRENR
                     VSLDISTLEKDVEIKSTSTVTVPRSGAVVLVNFETDEGRSLILELLRSDKGFIPLGAD
                     VLNEKNETVGTVGQAGQAYVRGVEPQGELRVVWGSGKESTCTVRYQLAEITVKAGLTP
                     VLNNQLCHM"
     gene            complement(216992..217744)
                     /locus_tag="SeHA_C0210"
     CDS             complement(216992..217744)
                     /locus_tag="SeHA_C0210"
                     /note="identified by match to protein family HMM PF00345"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein EcpD"
                     /protein_id="ACF70476.1"
                     /translation="MVNTVITKGFKTTCFAAAAFTAFATFQVNADIVISGTRIVYPAS
                     SKDVIVNLDNRGNKPLLVQTWLDDGRDGVDPQELKLPFVITPPVSRIDPQKGQSLRIT
                     YMGSALPQDRESLFWFNVLEIPPKSKAKEGESLNQLQLAFRTRIKLFFRPDGLKGTPG
                     DAAANLKWSQKKEGNTLSLFAQNDSAYNVSISNVKLKVGGKEYTVDSKSVLPFSGVSM
                     PVKGLSNNINGTVIYNTINDNGGTNKREAKID"
     gene            complement(217831..218436)
                     /locus_tag="SeHA_C0211"
     CDS             complement(217831..218436)
                     /locus_tag="SeHA_C0211"
                     /note="identified by match to protein family HMM PF00419"
                     /codon_start=1
                     /transl_table=11
                     /product="major fimbrial subunit"
                     /protein_id="ACF67621.1"
                     /translation="MFFRKYGVAAFIAMTLSAGSAMAADPDTGTITFHGLVSNNTCKI
                     SLDNKIDQDGNDFDITLDTVFVKNFATALGDNSTLGEKQFTLNLSECDNATVKDASAQ
                     FNSWGGSSSTSGGLLVPPANLQGAAENVNLVLANNGNGATDLIKIDQTNNTQKATISA
                     DGTGDLFYRVAYTQGQKWNADTSPVTAGTVQAQVAFTVIYN"
     gene            complement(218714..219094)
                     /gene="panD"
                     /locus_tag="SeHA_C0212"
     CDS             complement(218714..219094)
                     /gene="panD"
                     /locus_tag="SeHA_C0212"
                     /EC_number="4.1.1.11"
                     /note="identified by match to protein family HMM PF02261;
                     match to protein family HMM TIGR00223"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate 1-decarboxylase"
                     /protein_id="ACF67092.1"
                     /translation="MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAI
                     DIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCAEVGDIVIIASFVTMSDEEARTWR
                     PKVAYFEGDNEMKRTAKAIPVQVA"
     gene            complement(219189..220043)
                     /gene="panC"
                     /locus_tag="SeHA_C0213"
     CDS             complement(219189..220043)
                     /gene="panC"
                     /locus_tag="SeHA_C0213"
                     /EC_number="6.3.2.1"
                     /note="identified by match to protein family HMM PF02569;
                     match to protein family HMM TIGR00018; match to protein
                     family HMM TIGR00125"
                     /codon_start=1
                     /transl_table=11
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="ACF67832.1"
                     /translation="MLIIETLPLLRQHIRRLRQEGKRVALVPTMGNLHDGHMKLVDEA
                     KARADVVIVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPHG
                     LEGQTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIR
                     KMVADMSYDIEIVGVPIIRAKDGLALSSRNAYLTAEQRKIAPGLYNVMNSIAEKLIAG
                     NRELQEIIAIAEQELNEKGFRADDIQIRDADTLQELTETSKRAVILAAAWLGQARLID
                     NQSVTLAQ"
     gene            complement(220169..220960)
                     /gene="panB"
                     /locus_tag="SeHA_C0214"
     CDS             complement(220169..220960)
                     /gene="panB"
                     /locus_tag="SeHA_C0214"
                     /EC_number="2.1.2.11"
                     /note="identified by match to protein family HMM PF02548;
                     match to protein family HMM TIGR00222"
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="ACF67119.1"
                     /translation="MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVG
                     DSLGMTIQGHDSTLPVTVEDIAYHTRAVRRGAPNCLLLSDLPFMAYATPEQACENAAI
                     VMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLTPQSVNIFGGYKIQGRGDAGQ
                     VLLDDALALEAAGAQLLVLECVPVELAKRVTEALSIPVIGIGAGNVTDGQILVMHDAF
                     GITGGHIPKFAKNFLAEAGDMRAAVQQYMAEVESGVYPGEEHSFH"
     gene            complement(221081..221560)
                     /gene="folK"
                     /locus_tag="SeHA_C0215"
     CDS             complement(221081..221560)
                     /gene="folK"
                     /locus_tag="SeHA_C0215"
                     /EC_number="2.7.6.3"
                     /note="identified by match to protein family HMM PF01288;
                     match to protein family HMM TIGR01498"
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="ACF66770.1"
                     /translation="MTIAYIALGSNLASPLEQVNAALKAIANIPDSRIVAVSSFYRTP
                     PLGPQDQPDYLNAAVALDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLF
                     GDEVINTDRLTVPHYDMKNRGFMLWPLFEIAPDLIFPDGISLHQHLTHLGAAKPAHW"
     gene            complement(221557..222870)
                     /locus_tag="SeHA_C0216"
     CDS             complement(221557..222870)
                     /locus_tag="SeHA_C0216"
                     /EC_number="2.7.7.19"
                     /note="identified by match to protein family HMM PF01743;
                     match to protein family HMM TIGR01942"
                     /codon_start=1
                     /transl_table=11
                     /product="poly(A) polymerase (PAP) (Plasmid copy number
                     protein)"
                     /protein_id="ACF66098.1"
                     /translation="MTIIPREQHAISRKDISENALKVLYRLNKAGYEAYLVGGGVRDL
                     LLGKKPKDFDVTTNATPDQVRKLFRNCRLVGRRFRLAHVMFGPEIIEVATFRGHHEGS
                     ESDRTTSQRGQNGMLLRDNIFGSIEEDAQRRDFTINSLYYSVADFTVRDYVGGMQDLQ
                     EGVIRLIGNPETRYREDPVRMLRAVRFAAKLNMHISPETAEPIPRLATLLNDIPPARL
                     FEESLKLLQAGNGYETYQQLREYHLFQPLFPTITRYFTENGDSAMERIIAQVLKNTDN
                     RIRNEMRVNPAFLFAAMFWYPLLEMAQKIAQESGLAYYDAFALAMNDVLDEACRSLAI
                     PKRLTTLTRDIWQLQLRMSRRQGKRAWKLMEHPKFRAAFDLLELRAQVENNTELQRLA
                     QWWAEFQASAPPEQKGMLNELDDDPAPRRRRSRPRKRAPRREGTV"
     gene            complement(223116..224057)
                     /locus_tag="SeHA_C0217"
     CDS             complement(223116..224057)
                     /locus_tag="SeHA_C0217"
                     /EC_number="6.1.1.-"
                     /note="identified by match to protein family HMM PF00749"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-Q tRNA"
                     /protein_id="ACF70426.1"
                     /translation="MTGGSFPALFFIARSMTDSHYIGRFAPSPSGELHFGSLIAALGS
                     YLQARAQRGIWRVRIEDIDPPREVPGAAATILRQLEHYGLHWDGEVLWQSQRHEAYRE
                     ALAWLHEQGLSYYCTCPRSRIQRLGGIYDGHCRTLCHGPENAAVRIKQQHPVMRFHDA
                     LRGDIQADPQLASEDFIIHRRDGLFAYNLAVVVDDHFQGVTEIVRGADLIEPTVRQLS
                     LYKQFGWRAPGYVHLPLALNEQGAKLSKQNHAPALATGDPRPVLVQALRFLGQRDVVA
                     WQEMSVEELLRFAVTHWRLTAVPTSANVNPAFSNASR"
     gene            complement(224081..224536)
                     /gene="dksA"
                     /locus_tag="SeHA_C0218"
     CDS             complement(224081..224536)
                     /gene="dksA"
                     /locus_tag="SeHA_C0218"
                     /note="identified by match to protein family HMM PF01258;
                     match to protein family HMM TIGR02420"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase-binding protein DksA"
                     /protein_id="ACF67280.1"
                     /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLSHFKRIL
                     EAWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKT
                     LKKVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
     gene            complement(224713..225417)
                     /gene="sfsA"
                     /locus_tag="SeHA_C0219"
     CDS             complement(224713..225417)
                     /gene="sfsA"
                     /locus_tag="SeHA_C0219"
                     /note="identified by match to protein family HMM PF03749;
                     match to protein family HMM TIGR00230"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar fermentation stimulation protein"
                     /protein_id="ACF70333.1"
                     /translation="MLFSPPLQRATLIQRYKRFLADVITPDGTTLTLHCPNTGAMTGC
                     ATPGDTVWYSTSENTKRKYPHTWELTETQSGAFICVNTLRANQLTKEAIQENRLPALA
                     GYNILKSEVKYGAERSRIDFMLQADFRPDCYIEVKSVTLAEKENGYFPDAITERGQKH
                     LRELMGVAAAGHRAVVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAE
                     LSAQKMELNEPVPITL"
     gene            complement(225434..225964)
                     /locus_tag="SeHA_C0220"
     CDS             complement(225434..225964)
                     /locus_tag="SeHA_C0220"
                     /EC_number="6.5.1.-"
                     /note="identified by match to protein family HMM PF02834;
                     match to protein family HMM TIGR02258"
                     /codon_start=1
                     /transl_table=11
                     /product="2'-5' RNA ligase"
                     /protein_id="ACF69652.1"
                     /translation="MSEPKRLFFAIDLPDDARAQIIAWRAAHFASEDGRPVAAANLHL
                     TLAFLGDVSSDKQRALAQLAGRIRQPGFTLHLDDAGQWLRSRVVWLGMRQPPRGLLQL
                     ANMLRAQAARSGCYQSPQPFHPHITLLRDASHTVAIPPPGFCWSFPVTSFALYASSYG
                     QGRTRYAELQRWTLGE"
     gene            225992..228466
                     /gene="hrpB"
                     /locus_tag="SeHA_C0221"
     CDS             225992..228466
                     /gene="hrpB"
                     /locus_tag="SeHA_C0221"
                     /EC_number="3.6.1.-"
                     /note="identified by match to protein family HMM PF00270;
                     match to protein family HMM PF00271; match to protein
                     family HMM PF04408; match to protein family HMM PF08482;
                     match to protein family HMM TIGR01970"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase HrpB"
                     /protein_id="ACF69273.1"
                     /translation="MLQCGAKKVNPVEPFVTSLPVAAVLPELLTALKTAPQVLLSAPT
                     GAGKSTWLPLQLLQQGPVAGKILLLEPRRLAARNVAQRLAEALNEKPGETVGYRMRAQ
                     SCVGPRTRLEVVTEGVLTRMIQRDPELRGVGLVILDEFHERSLQADLALALLLDIQQG
                     LRDDLRLLIMSATLDNDRLCQRLPDAPTIVSEGRAFPVERRYQPLAAHLRFDEAVAMA
                     TAELLRNENGSLLLFLPGVGEIQRVHEHLASRVGSDVLLCPLYGALSLEAQRKAIVPA
                     PAGMRKVVLATNIAETSLTIEGIRLVVDSAQERVARFDARTGLTRLVTQRISQASMTQ
                     RAGRAGRLAPGICLHLLAKEQAERAAAQSDPEILHSDLSGLLMEVLQWGCHDPTSLFW
                     LDRPPEVNLQAARRLLLMLGALEGERLSARGRKMAAMGNDPRLAAMLVNADEGDSAAT
                     AAMLAAILEDPPRGGGTDLSVVFSRRQPGWQQRSQQLLKRLQVRNGEPDSALIMPLLA
                     RAFSDRIARRRGQEGRYQLANGMGAMLDADDALGRHEWLIAPLLLQGSASPDARILLA
                     QPLDIASLIQACPDLLRQSDTVEWDEAQGTLKAWRRMRIGQLTVSVQPLAKPSEEELH
                     QAMLNGIRDKGLSVLNWTPEAEQFRLRLHCAAKWLPEYDWPAVDEASLLATLENWLLP
                     HMTGVQSLRSLKSLNVTQALRGLLDYAMLQRLDSELPGHYTVPTGSRITIRYHEDNPP
                     ALAVRMQEMFGEAKTPTIAQGRVPLVLELLSPAQRPLQITRDLSAFWQGAYREVQKEM
                     KGRYPKHVWPDDPANTAPTRRTKKYS"
     gene            228607..231129
                     /gene="mrcB"
                     /locus_tag="SeHA_C0222"
     CDS             228607..231129
                     /gene="mrcB"
                     /locus_tag="SeHA_C0222"
                     /note="identified by match to protein family HMM PF00905;
                     match to protein family HMM PF00912; match to protein
                     family HMM TIGR02071"
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 1B"
                     /protein_id="ACF68628.1"
                     /translation="MAGNDREPIGRKGKPSRPVKQKVSRRRQHDDDYDDDYEDEEPMP
                     RKGKGKGRKPRGKRGWLWLLLKLFIVFVVLFAIYGVYLDQKIRSRIDGKVWQLPAAVY
                     GRMVNLEPDMPVSKNEMVKLLEATQYRLVTKMTRPGEFTVQANSIEMIRRPFDFPDSK
                     EGQVRARLTFSDGRLETIVNLDNNRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGFPD
                     LLVDTLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSE
                     RSYWRKANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPV
                     EELSLDQQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQKIIDQELYDMLSAR
                     PLGVQPRGGVISPQPAFMQMVRQELQAKLGDKIKDLSGVKIFTTFDSVAQDAAEKAVV
                     EGIPALKKQRKLSDLETAMVVVDRFSGEVRAMVGGAEPQYAGYNRAMQARRSIGSLAK
                     PATYLTALSQPNLYRLNTWIADAPISLRQPNGQVWSPQNDDHRYSESGKVMLVDALTR
                     SMNVPTVNLGMALGLPAVTDTWTKLGVPKDQLNPVPAMLLGALNLTPIEVAQAFQTIA
                     SGGNRAPLSALRSVIAEDGKVLYQSYPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLG
                     AKYPGLHLAGKTGTTNNNVDTWFAGIDGSQVTITWVGRDNNQPTKLYGASGAMAIYQR
                     YLANQTPTPLVLTPPEDVVDMGVDYDGNFVCSGGMRTLPVWTDDPNTLCQQGEMMQQQ
                     QQPSGNPFDQSSQPQQPAQQQPPKEEKSDGVAGWIKEMFGGN"
     gene            complement(231268..231408)
                     /locus_tag="SeHA_C0223"
     CDS             complement(231268..231408)
                     /locus_tag="SeHA_C0223"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF69302.1"
                     /translation="MKVNDNVNDNYYYNRSMIGEISSQWQAIRGPTKTKGLRNNQMKR
                     KG"
     gene            231422..233665
                     /gene="fhuA"
                     /locus_tag="SeHA_C0224"
     CDS             231422..233665
                     /gene="fhuA"
                     /locus_tag="SeHA_C0224"
                     /note="identified by match to protein family HMM PF00593;
                     match to protein family HMM PF07715; match to protein
                     family HMM TIGR01783"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrichrome-iron receptor"
                     /protein_id="ACF68652.1"
                     /translation="MARLKTAQPNSSLRKIAVVVATAVSGMSVYAQAAVQPKEETITV
                     TAAPAAQESAWGPAATIAARQSATATKTDTPIQKVPQPISVVTAEEMALHQPKSVKEA
                     LSYTPGVAVGTRGASNTYDYLIIRGFAADGQSQNNYLNGLKMQGNFYNDAVIDPYMLE
                     RAEVMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEIQFKMGTDSLFQTGFDFSDALD
                     EEGVYSYRLTGLARSANAQQDRAEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGY
                     YGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDIFTVRQNLR
                     YAENKVSQNSVYGYGVCSDPANGYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDT
                     QLQSKFATGEVDHTLLTGVDFMRMRNDINAWFGYDDSVPLLDLYNPVYTDFDFASRDP
                     ATSGPYQILNKQKQTGLYVQDQAQWDKVLVTLGGRYDWADQESLNRTTGITSKRDDKQ
                     FTWRGGVNYLFDNGITPYFSYSESFEPASQTGENGKIFAPSKGKQYEAGVKYVPNDRP
                     IVITGAVYQLTKTNNLMADPAGSFFSVEGGEIRARGVELEAKAALSASINVVGSYTYT
                     DAEYTTDTTYKGNTPAQVPKHMASLWGDYTFFDGPLSGLTLGTGGRFTGSSYGDPANS
                     FKVGSYTVVDALVRYDLARVGMAGSNVALHVNNLFDREYVASCFQTYGCFWGAERQVV
                     ATATFRF"
     gene            233714..234511
                     /gene="fhuC"
                     /locus_tag="SeHA_C0225"
     CDS             233714..234511
                     /gene="fhuC"
                     /locus_tag="SeHA_C0225"
                     /note="identified by match to protein family HMM PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrichrome transport ATP-binding protein FhuC"
                     /protein_id="ACF67730.1"
                     /translation="MQENHIHSDTTFALRSVAFRVPGRTLLHPLSLTFPAGRVTGLIG
                     HNGSGKSTLLKMLGRHQPPSEGDILLDNQPLASWSSKAFARKVAYLPQQLPQAEGMTV
                     RELVAIGRYPWHGALGRFGVADREKVDEAITLVGLKPLAHRLVDSLSGGERQRAWIAM
                     LVAQDSRCLLLDEPTSALDIAHQVDVLALVHRLSQQRGLTVVAVLHDINMAARYCDYL
                     VALRGGEMIAQGTPAELMRSDTLEQIYGIPMGILPHPAGAAPVSFVY"
     gene            234511..235401
                     /locus_tag="SeHA_C0226"
     CDS             234511..235401
                     /locus_tag="SeHA_C0226"
                     /note="identified by match to protein family HMM PF01497"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrichrome-binding periplasmic protein"
                     /protein_id="ACF67234.1"
                     /translation="MRDLYPLTRRRLLTAMALSPLLWQMNMAQAAAIDPRRIVALEWL
                     PVELLLALGITPYGVADVPNYKLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVW
                     SAGYGPSPEKLARIAPGRGFDFSDGKKPLAVARRSLVELAQTLNLEAAAEKHLAQYDR
                     FIASQKPHFIRRGGRPLLMTTLIDPRHMLVLGPNCLFQEVLDEYGIVNAWQGETNFWG
                     STAVSIDRLAMYKEADVICFDHGNNTDMNALMATPLWQAMPFVRAGRFHRVPAVWFYG
                     ATLSTMHFVRILDNVLGGKA"
     gene            235398..237455
                     /locus_tag="SeHA_C0227"
     CDS             235398..237455
                     /locus_tag="SeHA_C0227"
                     /note="identified by match to protein family HMM PF01032;
                     match to protein family HMM TIGR01409"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrichrome transport system permease protein
                     FhuB"
                     /protein_id="ACF66668.1"
                     /translation="MSRKREMPDGGAKSALSDLRFGRFVGRIRRSRHPALLLLALFVA
                     ACWLTWVNFSVALPRSQWQQAIWSPDIDIIEQMIFHYSLLPRLAISLLVGAGLGLVGV
                     LFQQVLRNPLAEPTTLGVATGAQLGITVTTLWAIPGALATQFAALTGACIVGALVFGV
                     AWGKRLSPVTLILAGLVVSLYCGAINQLLVIFHHDQLQSMFLWSTGTLTQTDWSGVQR
                     LWPQLLGGVMLTLLLLRPMTLMGLDDGVARNLGLALSLARLAALSLAIVLSALLVNAV
                     GIIGFIGLFAPLLAKMLGARRLLARLMLAPLIGALILWLSDQIILWLTRVWMEVSTGS
                     VTALIGAPLLLWLLPRLKSMSAPDMNASDRVAAERRHVLAFAVAGGALLLLATWGALS
                     FGRDAHGWTWASGTLLEELMPWRWPRILAALMAGVMLAVAGCIIQRLTGNPMASPEVL
                     GISSGAAFGLVLMLFLVPGNAFGWLLPAGSLGAAATLLIIMLAAGRGGFSPQRMLLAG
                     MALSTAFTMLLMMLQASGDPRMAEVLTWIAGSTYNATGGQVTRTAIVMVILLAIVPLC
                     RRWLTILPLGGDAARAVGMALTPSRIALLALAACLTATATMTIGPLSFVGLMAPHIAR
                     MLGFRRTMPHMVISALAGGVLLVFADWCGRMALFPYQIPAGLLSSFIGAPYFIYLLRK
                     QSR"
     gene            complement(237643..237756)
                     /locus_tag="SeHA_C0228"
     CDS             complement(237643..237756)
                     /locus_tag="SeHA_C0228"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF66153.1"
                     /translation="MPQFIINVSGLDMLKLVTLFRRQQRATEIAHDLSIQK"
     gene            complement(237854..237985)
                     /locus_tag="SeHA_C0229"
     CDS             complement(237854..237985)
                     /locus_tag="SeHA_C0229"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF68138.1"
                     /translation="MLNYIFFVYSWQLIYFNRVVFYYFDKKNNILLSKFYNENLLLN"
     gene            238036..238209
                     /locus_tag="SeHA_C0230"
     CDS             238036..238209
                     /locus_tag="SeHA_C0230"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF68804.1"
                     /translation="MLYIQYCNSDLFLFILSCLLLFGLSRLACFVCFLNGKKYLLFNA
                     DDPLNKKHLSLGF"
     gene            238397..238957
                     /locus_tag="SeHA_C0231"
     CDS             238397..238957
                     /locus_tag="SeHA_C0231"
                     /note="identified by match to protein family HMM PF00419"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fimbrial subunit"
                     /protein_id="ACF66797.1"
                     /translation="MNTAVKAAVAAALVMGVSSFANAAGSNTGTVTFTGTIEDSPCSI
                     VVGDEHQTVNLGHIGTGSLMGGKESSKVDFHIGLENCAFTTEKEASTVFSAIGNESSA
                     NPGSVALMRIGGGEMAGSSIVIGNHLGSAIKLGDAYSENLTMNGSVAAAKQTLNFKAW
                     VKGDSAATTIDTGEFSSTVNFTISYL"
     gene            239043..241700
                     /locus_tag="SeHA_C0232"
     CDS             239043..241700
                     /locus_tag="SeHA_C0232"
                     /note="identified by match to protein family HMM PF00577"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial usher protein"
                     /protein_id="ACF67493.1"
                     /translation="MAHYKKFRLSTLAAVVGIVLAVGPENSYAEAPIQFNTRFLDVKD
                     DASLDLSRFSRKGYIMPGSYHLQVLVNQSQIAQDNVITYSVDNNDPDNTYPCLSPELV
                     SLLGLKPEIADKMIWINAGQCLQPDQLEGMETQTDLSQSTLTVIIPQAYLEYSDEEWD
                     PPSRWDEGIPGVLFDYNVNSQWRHAEHDDGDEYDISGNGTVGANLGAWRLRADWQANY
                     RHENDSEDKDNFGSSSEQNWDWNRYYAWRAIPQLRAQLTLGEGSLESDIFDGFNYVGG
                     SLITDDQMLPPNLRGYAPDISGVARTNAKVTVTQRGRVIYESQVPAGPFRIQDINETV
                     SGDLHVKIEEQSGQVQEYDVSTASIPFLTRPGQVRYKLAAGRPQDWDHNMEGGFFTSA
                     EASWGIANGWSLYGGAIGEQDYQALALGLGRDLALLGAFSVDVTHSRATLPEGSAYGD
                     GTIQGNSFRASYAKDFDDIDSRLTFAGYRFSEENYMTMDEFIDTHNDDNDRQRTGHDK
                     EMYTLTYSQNFSAINVNAYINYTHRTYWNQPNQDSYNLTLSHYFDVGEVRGISLSVNG
                     FRNEYDNERDDGVYVSLSIPWGNNRTLSYNGSFSDDNNSNQVGYYERIDDRNNYQINA
                     GRTDNGATLDGYYRHQASYADIDVSANYQEGDYTSGGLNIQGGATLTAKGGALHRTSV
                     NGGSRLLVDVGDEANVPISGYSTPVYTNAFGKAVIVDVNDYYRNQVKIDITQLPEDAE
                     AILSIAQATLTEGAIGYRRMEVLSGKKAMGSIRLRDGGTPPFGAEVYNSRQQQLGIVG
                     EGGSVYLIGINPGERLQVTWEGKTQCEAALPDPLPGDLFSGLLLPCIGDASSPEATQP
                     EEKPLLQLHTQRRTSSTQPEALSSRYPTH"
     gene            241718..242470
                     /locus_tag="SeHA_C0233"
     CDS             241718..242470
                     /locus_tag="SeHA_C0233"
                     /note="identified by match to protein family HMM PF00345"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein PapD"
                     /protein_id="ACF66082.1"
                     /translation="MMSLKRYNLAAVLLLLLGGYGSAQAAIAPDRTRLVFRGEDKSIS
                     VDLKNANSKLPYLAQSWVEDEKGVKITSPLIVVPPVQRIEPSAIGQVKIQGMPALASL
                     PKDRETLFYYNVREIPPQSDKPNTLQIALQTRIKVFYRPQALSKIDMQHPWQYKITLQ
                     RQGNGYQVSNPTGYYVVLSNASNRMDGTPARGFSPLVIAPKSNVTLGGDASELGHSPV
                     LTYVNDYGARLPLIFNCTDNSCAVDEAKSRKS"
     gene            242489..243001
                     /locus_tag="SeHA_C0234"
     CDS             242489..243001
                     /locus_tag="SeHA_C0234"
                     /codon_start=1
                     /transl_table=11
                     /product="putative minor fimbrial subunit"
                     /protein_id="ACF66726.1"
                     /translation="MRQWRLRLGTVTCAAMLSAVSMPLAAGSKTVNMTLTIVVNAAPP
                     CTVTGGEVEFGNVLTTKVDGVNYRQAVGYSLSCNGRVSDYLKLQIQGNAVTINGEPVL
                     QTDVDGLGIRLQTATDGALVSPGNTQWLSFQYSGGSGPAIEAIPVKDNGVTLTGGAFN
                     AGATLVVDYQ"
     gene            242998..243474
                     /locus_tag="SeHA_C0235"
     CDS             242998..243474
                     /locus_tag="SeHA_C0235"
                     /note="identified by match to protein family HMM PF00419"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial subunit"
                     /protein_id="ACF69465.1"
                     /translation="MKKMALMVLISSSFAAQSAENLKFHGTLISPPNCTISHNQTIDV
                     EFGNMLISKIDGTRYAQNVPYEITCDSAVRDDTMTMTLTLSGSVTDFNQAAINTSVAG
                     LGIELRQNDQPFTLGSTITVNEQSAPVLKAIPVKKSGASLTEGDFDATATLQVDYQ"
     gene            243474..244004
                     /locus_tag="SeHA_C0236"
     CDS             243474..244004
                     /locus_tag="SeHA_C0236"
                     /note="identified by match to protein family HMM PF00419"
                     /codon_start=1
                     /transl_table=11
                     /product="minor fimbrial subunit StfG"
                     /protein_id="ACF70057.1"
                     /translation="MVKKQTLLHGVAFILWGTLILPVSAADNLHFSGSLVASPCTLTM
                     QGADIAEVDFSSLDASDFIPGGQSARKPVVFELTDCDSALSNGVQVIFTGTEATGMRG
                     ILAIDSYSGASGIGIGIETLSGVPVGINNESGAVFTLVTGKNTLSLNAWVQRLPGEDL
                     IPGRFSASALATFEYL"
     gene            243991..244125
                     /locus_tag="SeHA_C0237"
     CDS             243991..244125
                     /locus_tag="SeHA_C0237"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF68710.1"
                     /translation="MSIYNENNTDFIFAADCRLWWFGIGQTHAESDVWEHHAILWYWP
                     "
     gene            244208..244849
                     /locus_tag="SeHA_C0238"
     CDS             244208..244849
                     /locus_tag="SeHA_C0238"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF66689.1"
                     /translation="MARKGATATLLSWTGPDPAPTIVLRDFDNSISKSNCKNLPSSWN
                     GCGYYTVDITVQSDNYGCPWLAATHSTAEDLVSGETYSAPDTRSSVCPKIPVDTFDIS
                     WDANVSKQKTTLMLDATGGTVNRTLHTYLMEGGKLCDGSKFDDRGAYCRFVSSGITLN
                     VLGCDQSSVTTSAVDHPITDVELHDINVAVNTRNIGSGQFTSTCSFQYIIDEL"
     gene            complement(244947..246227)
                     /gene="hemL"
                     /locus_tag="SeHA_C0239"
     CDS             complement(244947..246227)
                     /gene="hemL"
                     /locus_tag="SeHA_C0239"
                     /EC_number="5.4.3.8"
                     /note="identified by match to protein family HMM PF00202;
                     match to protein family HMM TIGR00713"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde-2,1-aminomutase"
                     /protein_id="ACF67312.1"
                     /translation="MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYL
                     YDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNL
                     VPTMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTL
                     GQPNSPGVPADFAKHTLTCTYNDLTSVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPE
                     FLPGLRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAF
                     GGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGIHETLDELTTRLAEG
                     LCEAAQEAGIPLVVNHVGGMFGIFFTDAESVTCYQDVMACDVERFKRFFHLMLEEGVY
                     LAPSAFEAGFMSVAHSMDDINNTIDAARRVFATL"
     gene            246397..247818
                     /locus_tag="SeHA_C0240"
     CDS             246397..247818
                     /locus_tag="SeHA_C0240"
                     /note="identified by match to protein family HMM PF00654"
                     /codon_start=1
                     /transl_table=11
                     /product="H(+)/Cl(-) exchange transporter ClcA (ClC-ec1)"
                     /protein_id="ACF67222.1"
                     /translation="MKTDTSTFLAQQIVRLRRRDQIRRLMQRDKTPLAILFMAAVVGT
                     LTGLVGVAFEKAVSWVQNMRIGALVQVADHAFLLWPLAFILSALLAMVGYFLVRKFAP
                     EAGGSGIPEIEGALEELRPVRWWRVLPVKFIGGMGTLGAGMVLGREGPTVQIGGNLGR
                     MVLDVFRMRSAEARHTLLATGAAAGLSAAFNAPLAGILFIIEEMRPQFRYNLISIKAV
                     FTGVIMSSIVFRIFNGEAPIIEVGKLSDAPVNTLWLYLILGIIFGCVGPVFNSLVLRT
                     QDMFQRFHGGEIKKWVLMGGAIGGLCGILGLIEPEAAGGGFNLIPIAAAGNFSVGLLL
                     FIFIARVVTTLLCFSSGAPGGIFAPMLALGTLLGTAFGMAAAVLFPQYHLEAGTFAIA
                     GMGALMAASVRAPLTGIVLVLEMTDNYQLILPMIITCLGATLLAQFLGGKPLYSTILA
                     RTLAKQDAEQAAKNQNAPAGENT"
     gene            247900..248244
                     /gene="yadR"
                     /locus_tag="SeHA_C0241"
     CDS             247900..248244
                     /gene="yadR"
                     /locus_tag="SeHA_C0241"
                     /note="identified by match to protein family HMM PF01521;
                     match to protein family HMM TIGR00049"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster assembly accessory protein
                     YadR"
                     /protein_id="ACF66298.1"
                     /translation="MSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSG
                     FQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNA
                     KSTCGCGSSFSI"
     gene            complement(248345..248968)
                     /locus_tag="SeHA_C0242"
     CDS             complement(248345..248968)
                     /locus_tag="SeHA_C0242"
                     /note="identified by match to protein family HMM PF03458"
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane protein YadS"
                     /protein_id="ACF66785.1"
                     /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGG
                     TIRDMALDNGPVFWVKDPTDLVVAMVTSMLTILLVRQPRRLPKWMLPVLDAVGLAVFV
                     GIGVNKAFLAETGPLVAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIV
                     HATAFYTFSVPLESASMMGMVVTLFIRLAAIRWHLKLPTFALDENGR"
     gene            complement(249005..249793)
                     /locus_tag="SeHA_C0243"
     CDS             complement(249005..249793)
                     /locus_tag="SeHA_C0243"
                     /note="identified by match to protein family HMM PF01497"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin periplasmic binding protein"
                     /protein_id="ACF69386.1"
                     /translation="MFRALVALLLTLPVWLYAAPRVITLSPANTELAFAAGITPVGVS
                     SYSDYPPEAQKIEQVSTWQGMNLERIVALKPDLVVAWRGGNAERQVNQLTSLGIKVMW
                     VDAVSIEQIADTLRQLAAWSPQPEKAQQAAQTLLNEYAALNAEYAGKAKKRVFLQFGM
                     NPLFTSGKGSIQHQVLTTCGGENVFADSRVPWPQVSREQVLARHPQAIIVAGKAGEIL
                     KIEQYWGNLLKIPVIPLNSDWFERASPRIILAAKQLCNALSQVN"
     gene            complement(249798..250496)
                     /gene="mtnN"
                     /locus_tag="SeHA_C0244"
     CDS             complement(249798..250496)
                     /gene="mtnN"
                     /locus_tag="SeHA_C0244"
                     /EC_number="3.2.2.16"
                     /EC_number="3.2.2.9"
                     /note="identified by match to protein family HMM PF01048;
                     match to protein family HMM TIGR01704"
                     /codon_start=1
                     /transl_table=11
                     /product="MTA/SAH nucleosidase"
                     /protein_id="ACF70478.1"
                     /translation="MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVA
                     LLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADV
                     TAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAK
                     IRHNFPDAVAVEMEATAIAHVCYNFSVPFVVVRAISDVADQQSHLSFDEFLAVAAKQS
                     TLMVETLVQKLAHG"
     gene            250539..252098
                     /gene="dgt"
                     /locus_tag="SeHA_C0245"
     CDS             250539..252098
                     /gene="dgt"
                     /locus_tag="SeHA_C0245"
                     /EC_number="3.1.5.1"
                     /note="identified by match to protein family HMM PF01966;
                     match to protein family HMM TIGR01353"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyguanosinetriphosphate triphosphohydrolase"
                     /protein_id="ACF68181.1"
                     /translation="MRLWGSAFLRRGEDMASIDFRNKINWHRRYRSPQGVKTEHEILR
                     IFESDRGRIINSPAIRRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRL
                     KEQNRLEEYGLDALTGPFESIVEMACLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAE
                     SQPLTHDRCVVSSLRLQEGEENLNDIRRKVRQDICHFEGNAQGIRLVHTLMRMNLTWA
                     QVGGILKYTRPAWWRGPVPDSHRYLMKKPGYYLSEEKYIARLRKELQLAPYSRFPLTW
                     IMEAADDISYCVADLEDAVEKRIFSVEQLYHHLYHAWGHHEKDSLFELVVGNAWEKSR
                     ANTLSRSTEDQFFMYLRVNTLNKLVPYAAQRFIDNLPQIFAGTFNQALLEDASGFSRL
                     LELYKNVAVEHVFSHPDVEQLELQGYRVISGLLDIYQPLLSLSLNDFRELVEKERLKR
                     FPIESRLFQKLSTRHRLAYVEVVSKLPTDSAEYPVLEYYYRCRLIQDYISGMTDLYAW
                     DEYRRLMAVEQ"
     gene            252228..253655
                     /gene="degP"
                     /locus_tag="SeHA_C0246"
     CDS             252228..253655
                     /gene="degP"
                     /locus_tag="SeHA_C0246"
                     /EC_number="3.4.21.-"
                     /note="identified by match to protein family HMM PF00089;
                     match to protein family HMM PF00595; match to protein
                     family HMM TIGR02037"
                     /codon_start=1
                     /transl_table=11
                     /product="protease Do"
                     /protein_id="ACF68875.1"
                     /translation="MKKTTLAMSALALSLGLALSPLSATAAETSSSAMTAQQMPSLAP
                     MLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQDGSPFQNSPFCQGGGNG
                     GNGGQQQKFMALGSGVIIDAAKGYVVTNNHVVDNASVIKVQLSDGRKFDAKVVGKDPR
                     SDIALIQIQNPKNLTAIKLADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLN
                     VENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKN
                     LTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAG
                     DVITSLNGKPISSFAALRAQVGTMPVGSKISLGLLREGKAITVNLELQQSSQSQVDSS
                     TIFSGIEGAEMSNKGQDKGVVVSSVKANSPAAQIGLKKGDVIIGANQQPVKNIAELRK
                     ILDSKPSVLALNIQRGDSSIYLLMQ"
     gene            253808..254965
                     /locus_tag="SeHA_C0247"
     CDS             253808..254965
                     /locus_tag="SeHA_C0247"
                     /note="identified by match to protein family HMM PF05651"
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate diacid regulator"
                     /protein_id="ACF66613.1"
                     /translation="MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERI
                     GELHEGALLVLSQGRVVDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPEHLR
                     KYGELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALVEWAQRLGIDL
                     NQPRVAAVVEVDSGQLGVDSAMAELQQLQNALTTPERNNLIAIVSLTEMVVLKPALNS
                     FGRWDAEDHRKRVEQLISRMKENGQLRFRVALGNYFTGPGSIARSYRTARTTMMVGKQ
                     RMPESRSYFYQDLMLPVLLDSLRGGWQANELARPLVKLKAMDNNGLLRRTLTAWFRHN
                     VQPLATSKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVALQLDEQR"
     gene            complement(255054..255440)
                     /locus_tag="SeHA_C0248"
     CDS             complement(255054..255440)
                     /locus_tag="SeHA_C0248"
                     /codon_start=1
                     /transl_table=11
                     /product="protein YaeH"
                     /protein_id="ACF69932.1"
                     /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDRGEFFAK
                     SVKFKYPRQRKTVVADGIGQGYKEVQEISPNLRYVIDELDQICQRDRSELDLKRKILD
                     DLRHLESVVANKISEIEADLDKLTRK"
     gene            255687..256988
                     /locus_tag="SeHA_C0249"
     CDS             255687..256988
                     /locus_tag="SeHA_C0249"
                     /note="identified by match to protein family HMM PF00083;
                     match to protein family HMM PF07690"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate transporter"
                     /protein_id="ACF67661.1"
                     /translation="MSGTYNATIRRVVVSAWIGNSIEYYDFLLYGLASALVFGPLFFP
                     GASPLTATLSSFASFGVGFISRPLGALFFGNRGDTLGRKNTLLITLGGMGAVTFLIGC
                     LPSYASIGALAPALLVILRFLQGFMVGGEWGGAMLMVVEYAAGKHRGRLSALSQTGGL
                     TGQLLATGVFIVVTQLPKEALLSWGWRIPFLLSALLVLPGLYMRHRLDETPVFRAFKK
                     QQAINHRQQREERPVVKVVREQWRSILLIIILRFAESVPFFLATVFAVSWATTQLGIA
                     SLTILYIVMFTCLLAYPMHVLFGIMSDRRGCRQVYIFGALFVAAMAFPFFWLLESRSL
                     ILMTMGYVLLINIGHNSLNAVQPSFFAGLFHPPVRYSGSSIGAQLGAVVAGGFTPFIA
                     KALSAVYDNSWALVAGYVVLTALASAFAAKIAPETVLPHSP"
     gene            complement(257024..257848)
                     /gene="dapD"
                     /locus_tag="SeHA_C0250"
     CDS             complement(257024..257848)
                     /gene="dapD"
                     /locus_tag="SeHA_C0250"
                     /EC_number="2.3.1.117"
                     /note="identified by match to protein family HMM
                     TIGR00965"
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
                     N-succinyltransferase"
                     /protein_id="ACF68461.1"
                     /translation="MQQLQNVIETAFERRADITPANVDTVTREAVNQVISLLDSGALR
                     VAEKIDGQWVTHQWLKKAVLLSFRINDNQVIDGGESRYFDKVPMKFADYDEARFQKEG
                     FRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSG
                     GVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRE
                     TGEVHYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
     gene            complement(257878..260550)
                     /gene="glnD"
                     /locus_tag="SeHA_C0251"
     CDS             complement(257878..260550)
                     /gene="glnD"
                     /locus_tag="SeHA_C0251"
                     /EC_number="2.7.7.59"
                     /note="identified by match to protein family HMM PF01842;
                     match to protein family HMM PF01909; match to protein
                     family HMM PF01966; match to protein family HMM PF08335;
                     match to protein family HMM TIGR01693"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-P-II uridylyltransferase"
                     /protein_id="ACF66615.1"
                     /translation="MNTLPEQHANTALPTLPDQPQNPGVWPRAELTVAGIKARIDIFQ
                     HWLGEAFDSGICAEQLIEARTEFIDQLLQRLWIEAGFGQIADLALVAVGGYGRGELHP
                     LSDIDLLILSRKKLPDEQAQKVGELLTLLWDVKLDVGHSVRTLEECLLEGLSDLTVAT
                     NLIETRLLIGDVALFLALQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPD
                     IKSSPGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTPAERAELNECLHILWRIRFAL
                     HLVVSRYDNRLLFDRQLSVAQRLNYSGEGNDPVERMMKDYFRVTRRVSELNQMLLQLF
                     DEAILALPADEKPRPVDDEFQLRGTLIDLRDDTLFIREPQAILRMFYMMVRNSAITGI
                     YSTTLRHLRHARRHLSQPLCYIPEARTLFLSMLRHPGAVSRGLLPMHRHSVLWAYMPQ
                     WSHIVGQMQFDLFHAYTVDEHTIRVMLKLESFAKEETRQRHPLCVDLWPRLPHPELIL
                     IAALFHDIAKGRGGDHSVLGAQDVLTFAELHGLNSRETQLVAWLVRQHLLMSVTAQRR
                     DIQDPEVIKQFAEEVQTETRLRFLVCLTVADICATNETLWNSWKQSLLRELYFATEKQ
                     LRRGMQNTPDMRERVRHHQLQALALLRMDNIDEAALHKIWTRCRANYFVRHSPNQLAW
                     HARHLLQHDLRQPLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQI
                     FTTRDGMAMDTFIVLEPDGSPLAADRHDVIRTGLEQTITQRSWQPPQPRRQPAKLRHF
                     TVETEVNFLPTHTDRKSFMELIALDQPGLLARVGQIFADLGISLHGARITTIGERVED
                     LFIIATADRRALNNVLQLEVQQRLTAALNPNDKG"
     gene            complement(260788..261582)
                     /gene="map"
                     /locus_tag="SeHA_C0252"
     CDS             complement(260788..261582)
                     /gene="map"
                     /locus_tag="SeHA_C0252"
                     /EC_number="3.4.11.18"
                     /note="identified by match to protein family HMM PF00557;
                     match to protein family HMM TIGR00500"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase, type I"
                     /protein_id="ACF67452.1"
                     /translation="MAISIKTSEDIEKMRVAGRLAAEVLEMIEPYIKPGVTTGELDRI
                     CNDYIVNEQHAISACLGYHGYPKSVCISINEVVCHGIPDDAKHLKDGDIVNIDVTVIK
                     DEFHGDTSKMFIVGKPTILGERLCRVTQESLYLGIKMVKPGIRLRTIGAAIQKYAEGE
                     GFSVVREYCGHGIGRGFHEEPQVLHYDADDGGVVLQPGMTFTIEPMLNAGDYRIRTMK
                     DGWTVKTKDRSLSAQYEHTIVVTENGCEILTLRKDDTIPAIITHDE"
     gene            261866..262004
                     /locus_tag="SeHA_C0253"
     ncRNA           261866..262004
                     /ncRNA_class="other"
                     /locus_tag="SeHA_C0253"
                     /product="t44 RNA"
     gene            262033..262758
                     /gene="rpsB"
                     /locus_tag="SeHA_C0254"
     CDS             262033..262758
                     /gene="rpsB"
                     /locus_tag="SeHA_C0254"
                     /note="identified by match to protein family HMM PF00318;
                     match to protein family HMM TIGR01011"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S2"
                     /protein_id="ACF69750.1"
                     /translation="MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLE
                     KTVPMFNEALAELNKISARKGKILFVGTKRAASEAVKEAANSCDQFFVNHRWLGGMLT
                     NWKTVRQSIKRLKDLETQSQDGTFEKLTKKEALMRTRELEKLENSLGGIKDMGGLPDA
                     LFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVSLYLGAVA
                     ATVREGRSQDLASQAEESFVEAE"
     gene            263016..263867
                     /gene="tsf"
                     /locus_tag="SeHA_C0255"
     CDS             263016..263867
                     /gene="tsf"
                     /locus_tag="SeHA_C0255"
                     /note="identified by match to protein family HMM PF00627;
                     match to protein family HMM PF00889; match to protein
                     family HMM TIGR00116"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor Ts"
                     /protein_id="ACF70250.1"
                     /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKS
                     GAIKAAKKAGNVAADGVIKTKIDGNVAFILEVNCQTDFVAKDAGFQAFADKVLDAAVA
                     GKITDVEVLKAQFEEERVALVAKIGENINIRRVASLEGDVLGSYQHGARIGVLVAAKG
                     ADEELVKQLAMHVAASKPEFVKPEDVSADVVEKEYQVQLDIAMQSGKPKEIAEKMVEG
                     RMKKFTGEVSLTGQPFVMEPSKSVGQLLKEHNADVTGFIRFEVGEGIEKVETDFAAEV
                     AAMSKQS"
     gene            264012..264737
                     /gene="pyrH"
                     /locus_tag="SeHA_C0256"
     CDS             264012..264737
                     /gene="pyrH"
                     /locus_tag="SeHA_C0256"
                     /EC_number="2.7.4.22"
                     /note="identified by match to protein family HMM PF00696;
                     match to protein family HMM TIGR02075"
                     /codon_start=1
                     /transl_table=11
                     /product="UMP kinase"
                     /protein_id="ACF68881.1"
                     /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKEL
                     VELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNA
                     RLMSAIPLNGVCDNYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADV
                     VLKATKVDGVFTADPAKDPSATMYDQLTYSEVLDKELKVMDLAAFTLARDHKLPIRVF
                     NMNKPGALRRVVMGEKEGTLITE"
     gene            264884..265441
                     /gene="frr"
                     /locus_tag="SeHA_C0257"
     CDS             264884..265441
                     /gene="frr"
                     /locus_tag="SeHA_C0257"
                     /note="identified by match to protein family HMM PF01765;
                     match to protein family HMM TIGR00496"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome releasing factor"
                     /protein_id="ACF69213.1"
                     /translation="MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEY
                     YGTPTPLRQLASVTVEDSRTLKINVFDRSMGPAVEKAIMASDLGLNPSSAGTDIRVPL
                     PPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKAISEDDDRRSQEEV
                     QKMTDAAIKKVDAALADKEAELMQF"
     gene            265496..266779
                     /gene="dxr"
                     /locus_tag="SeHA_C0258"
     CDS             265496..266779
                     /gene="dxr"
                     /locus_tag="SeHA_C0258"
                     /EC_number="2.7.4.-"
                     /note="identified by match to protein family HMM PF02670;
                     match to protein family HMM PF08436; match to protein
                     family HMM TIGR00243"
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
                     /protein_id="ACF67056.1"
                     /translation="MYKAPRRRHYQVSCAAFCFLFRFNTSGRFMKQLTILGSTGSIGC
                     STLDVVRHNPDSFRVIALVAGKNVARMAEQCLEFSPRYAVMDDTSSAEQLKIMLQQHG
                     SRTEVLSGQQAACEMAALDEVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTC
                     GRLFMDEVKRSNARLLPVDSEHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGP
                     FRETPMCDLAAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASARQME
                     VLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVTSGAQPLDFCKLSAL
                     TFSAPDYQRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAGLNLAV
                     LERMDLQEPASVEDVLQVDAIAREVARKQVIRLSR"
     gene            267092..267850
                     /gene="uppS"
                     /locus_tag="SeHA_C0259"
     CDS             267092..267850
                     /gene="uppS"
                     /locus_tag="SeHA_C0259"
                     /EC_number="2.5.1.31"
                     /note="identified by match to protein family HMM PF01255;
                     match to protein family HMM TIGR00055"
                     /codon_start=1
                     /transl_table=11
                     /product="di-trans,poly-cis-decaprenylcistransferase"
                     /protein_id="ACF68612.1"
                     /translation="MLSATQPVSENLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKA
                     GAKSVRRAVSFAANNGIDALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRH
                     NVRLRIIGDISRFNSRLQERIRKSEALTAHNTGLTLNIAANYGGRWDIVQGVRQLAEQ
                     VQAGVLRPDQIDEERLGQQICMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDV
                     LWPDFDEQDFEGALHAFANRERRFGGTEPGDDKA"
     gene            267863..268720
                     /gene="cdsA1"
                     /locus_tag="SeHA_C0260"
     CDS             267863..268720
                     /gene="cdsA1"
                     /locus_tag="SeHA_C0260"
                     /EC_number="2.7.7.41"
                     /note="identified by match to protein family HMM PF01148"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="ACF67505.1"
                     /translation="MLKYRLISAFVLIPAVIAALFLLPPVGFAIITLVVCMLAAWEWG
                     QLSGFAARSQRVWLAVLCGLLLALMLFLLPEYHHNIRQPLVEMSLWASLGWWVVALLL
                     VLFYPGSAAIWRNSKTLRLIFGLLTIVPFFWGMLALRAWHYDENHYSGAIWLLYVMIL
                     VWGADSGAYMFGKLFGKHKLAPKVSPGKTWQGFIGGLATAAVISWGYGMWANLNVAPV
                     ILLICSVVAALASVLGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFAC
                     LLLLVFRTL"
     gene            268732..270084
                     /gene="rseP"
                     /locus_tag="SeHA_C0261"
     CDS             268732..270084
                     /gene="rseP"
                     /locus_tag="SeHA_C0261"
                     /EC_number="3.4.24.-"
                     /note="identified by match to protein family HMM PF00595;
                     match to protein family HMM PF02163; match to protein
                     family HMM TIGR00054"
                     /codon_start=1
                     /transl_table=11
                     /product="RIP metalloprotease RseP"
                     /protein_id="ACF67926.1"
                     /translation="MLSILWNLAAFIIALGVLITVHEFGHFWVARRCGVRVERFSIGF
                     GKALWRRTDRYGTEYVIALIPLGGYVKMLDERAEPVAPELRRHAFNNKTVGQRAAIIA
                     AGPVANFIFAIFAYWLVFIIGVPGVRPVIGEITPNSIAAQAQIAPGTELKAVDGIETP
                     DWDAVRLQLVSKIGDQQTTVSVAPFGSDQRQDKTLDLRHWAFEPDKQDPVSSLGIRPR
                     GPQIEPVLSEVQANSAASKAGLQAGDRIVKVDGQPLTQWMKFVTFVRDNPGKPLALEI
                     ERQGSALSLTLTPDTKSVNGKAEGFAGVVPKIIPLPEEYKTIRQYGPFSAILEATDKT
                     WQLMKLTVSMLGKLITGDVKLNNLSGPISIAQGAGMSAEFGVIYYLMFLALISVNLGI
                     INLFPLPVLDGGHLLFLAIEKLKGGPVSERVQDFSYRIGSILLVLLMGLALFNDFSRL
                     "
     gene            270116..272527
                     /gene="yaeT"
                     /locus_tag="SeHA_C0262"
     CDS             270116..272527
                     /gene="yaeT"
                     /locus_tag="SeHA_C0262"
                     /note="identified by match to protein family HMM PF01103;
                     match to protein family HMM PF07244; match to protein
                     family HMM TIGR03303"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly complex, YaeT
                     protein"
                     /protein_id="ACF66187.1"
                     /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALL
                     SMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGN
                     KSVKDDMLKQNLEASGVRVGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPR
                     NRVDLKLVFQEGVSAKIQQINIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQK
                     LAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGN
                     LAGHSAEIENLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKT
                     VKLRVNVDAGNRFYVRKIRFEGNDTSKDSVLRREMRQMEGAWLGSDLVDQGKERLNRL
                     GFFETVDTDTQRVPGSLDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWL
                     GTGYSVGINGTKNDYQTYSELSVTNPYFTVDGVSLGGRIFYNDFEADDADLSDYTNKS
                     YGTDVTLGFPINEYNTLRAGLGYVHNKLSNMQPQIAMDRYLESMGDPDASDFAADDFT
                     FNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVSLDTATYVPIDNDHKWVV
                     LGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYKNGAHTSWDDNDD
                     YEDCTQESGCKSDDAVGGNAMAVASLEFITPTPFISEKYANSVRTSFFWDMGTVWDTN
                     WDPSSAPSDVPDYSDPGNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFN
                     IGKTW"
     gene            272650..273135
                     /gene="skp"
                     /locus_tag="SeHA_C0263"
     CDS             272650..273135
                     /gene="skp"
                     /locus_tag="SeHA_C0263"
                     /note="identified by match to protein family HMM PF03938"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein Skp"
                     /protein_id="ACF65978.1"
                     /translation="MKKWLLAAGLGLAMVTSAQAADKIAIVNMGNLFQQVAQKTGVSN
                     TLENEFKGRAAELQKMETDLQSKMQRLQSMKAGSDRTKLEKDVMSQRQTFAQKAQAFE
                     KDRARRSNEERNKLVTRIQTAVKKVANDQSIDLVVDANTVAYNSSDVKDITADVLKQV
                     K"
     gene            273139..274164
                     /gene="lpxD"
                     /locus_tag="SeHA_C0264"
     CDS             273139..274164
                     /gene="lpxD"
                     /locus_tag="SeHA_C0264"
                     /EC_number="3.1.26.4"
                     /note="identified by match to protein family HMM PF00132;
                     match to protein family HMM PF04613; match to protein
                     family HMM TIGR01853"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
                     N-acyltransferase"
                     /protein_id="ACF68373.1"
                     /translation="MPSIRLADLAEQLDAELHGDGDIVITGVASMQSATTGHITFMVN
                     PKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAA
                     SAVIDATATLGSNVSVGANAVIESGVQLGDNVVIGAGCFVGKNSKIGAGSRLWANVTI
                     YHDIQIGENCLIQSSTVIGADGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRG
                     ALDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGH
                     MEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKAIE
                     RKVNQQD"
     gene            274270..274725
                     /gene="fabZ"
                     /locus_tag="SeHA_C0265"
     CDS             274270..274725
                     /gene="fabZ"
                     /locus_tag="SeHA_C0265"
                     /EC_number="4.2.1.-"
                     /note="identified by match to protein family HMM PF07977;
                     match to protein family HMM TIGR01750"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-hydroxyacyl-(acyl-carrier-protein)
                     dehydratase FabZ"
                     /protein_id="ACF69741.1"
                     /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNV
                     SVNEPFFQGHFPGKPILPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFK
                     RPVVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
     gene            274729..275517
                     /gene="lpxA"
                     /locus_tag="SeHA_C0266"
     CDS             274729..275517
                     /gene="lpxA"
                     /locus_tag="SeHA_C0266"
                     /EC_number="2.3.1.129"
                     /note="identified by match to protein family HMM PF00132;
                     match to protein family HMM TIGR01852"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-[acyl-carrier-protein]-UDP-N-
                     acetylglucosamine O-acyltransferase"
                     /protein_id="ACF67940.1"
                     /translation="MIDKSAFIHPTAIVEDGAVIGANAHIGPFCIVGPQVEIGEGTVL
                     KSHVVVNGQTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGT
                     VQGGGLTKVGSDNLLMINAHVAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVH
                     QFCIIGAHVMVGGCSGVAQDVPPYVVAQGNHATPFGVNIEGLKRRGFSREGLVAIRNA
                     YKLLYRSGKTLDEAKLEIAELAEKHPEVKAFTEFFERSTRGPIR"
     gene            275517..276665
                     /gene="lpxB"
                     /locus_tag="SeHA_C0267"
     CDS             275517..276665
                     /gene="lpxB"
                     /locus_tag="SeHA_C0267"
                     /EC_number="2.4.1.182"
                     /note="identified by match to protein family HMM PF02684;
                     match to protein family HMM TIGR00215"
                     /codon_start=1
                     /transl_table=11
                     /product="lipid-A-disaccharide synthase"
                     /protein_id="ACF68709.1"
                     /translation="MAAQRPLTIALVAGETSGDILGAGLIRALKARVPNARFVGVAGP
                     RMQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRADLTRRFTELKPDVFVGIDAPDF
                     NITLEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRSTHMVLAFLPFEKAFYDKFNVP
                     CRFIGHTMADAMPLDPDKNAARDVLGIPHDAHCLALLPGSRGAEVEMLSADFLKTAQL
                     LRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASG
                     TAALECMLAKCPMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEP
                     QKLAEALLPLLANGKTSHAMHDTFRELHQQIRCNADEQAADAVLELAQ"
     gene            276662..277258
                     /gene="rnhB"
                     /locus_tag="SeHA_C0268"
     CDS             276662..277258
                     /gene="rnhB"
                     /locus_tag="SeHA_C0268"
                     /EC_number="3.1.26.4"
                     /note="identified by match to protein family HMM PF01351"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HII"
                     /protein_id="ACF66364.1"
                     /translation="MIEFVYPHTHLVAGVDEVGRGPLVGAVVTAAVILDPARPIVGLN
                     DSKKLSEKRRLSLYDEIKEKALSWSLGRAEAHEIDELNILHATMLAMQRAVAGLHIAP
                     EYVLIDGNRCPELPVPSMAVVKGDSRVAEISAASILAKVTRDAEMAALDIVFPQYGFA
                     QHKGYPTAFHLEKLAQYGATAHHRRSFAPVKRALGLVS"
     gene            277282..280764
                     /gene="dnaE"
                     /locus_tag="SeHA_C0269"
     CDS             277282..280764
                     /gene="dnaE"
                     /locus_tag="SeHA_C0269"
                     /EC_number="2.7.7.7"
                     /note="identified by match to protein family HMM PF01336;
                     match to protein family HMM PF02811; match to protein
                     family HMM PF07733; match to protein family HMM TIGR00594"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, alpha subunit"
                     /protein_id="ACF67529.1"
                     /translation="MSEPRFVHLRVHSDYSMIDGLAKTGPLVKKAASLGMPALAITDF
                     TNLCGLVKFYGAGHGAGIKPIVGADFNVHNELLGDELTHLTVLAANNTGYQNLTLLIS
                     KAYQRGYGAAGPIIERDWLVELKEGLILISGGRMGDVGRCLLRGNQALVEECVAFYET
                     HFPDRYFLELIRTGRQDEETYLHAAVELAEARGLPVVATNDVRFLESDDFDAHEIRVA
                     IHDGFTLDDPKRPRNYSPQQYMRSEEEMCELFSDIPEALENTVEIAKRCNVTVRLGEY
                     FLPQFPTGDMTTEDYLVKKAKEGLEERLAFLFPDEEERKKRRPEYDERLDIELQVINQ
                     MGFPGYFLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFL
                     NPERVSMPDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLG
                     HPYGFVDRISKLVPPDPGMTLAKAFEAEPQLPEIYEADEEVRALIDMARKLEGVTRNA
                     GKHAGGVVIAPTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIIN
                     WALEMINKRREKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQ
                     PDCFEDMIALVALFRPGPLQSGMVDNFIDRKHGREELSYPDVQWQHESLKPVLEPTYG
                     IILYQEQVMQIAQVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFEEGAKKNGIDGEL
                     AMKIFDLVEKFAGYGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVV
                     GLVDECWRMGLKILPPDINSGLYHFHVNDEGEIVYGIGAIKGVGEGPIEAIIDARNQG
                     GYFRELFDLCARTDTKKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAK
                     AEAIGQADMFGVLAEEPEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKE
                     IERYVGGVRLKDMHPTERGKVTTAAGLVIAARVMVTKRGNRIGICTLDDRSGRLEVML
                     FTDALDKYQQLLEKDRILIVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISL
                     TDRQIDDQLLNRLRQSLEPHRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDL
                     RGLIGSEQVELEFD"
     gene            280777..281736
                     /gene="accA"
                     /locus_tag="SeHA_C0270"
     CDS             280777..281736
                     /gene="accA"
                     /locus_tag="SeHA_C0270"
                     /EC_number="6.4.1.2"
                     /note="identified by match to protein family HMM PF03255;
                     match to protein family HMM TIGR00513"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase, carboxyl transferase,
                     alpha subunit"
                     /protein_id="ACF68366.1"
                     /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLR
                     EKSVELTRKIFADLGAWQVAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIV
                     GGIARLEGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFNMPIITF
                     IDTPGAYPGVGAEERGQSEAIARNLREMSRLNVPVICTVIGEGGSGGALAIGVGDKVN
                     MLQYSTYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAH
                     RNPEAMAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYGYA"
     gene            281916..283679
                     /locus_tag="SeHA_C0271"
     CDS             281916..283679
                     /locus_tag="SeHA_C0271"
                     /note="identified by match to protein family HMM PF00182;
                     match to protein family HMM PF00801"
                     /codon_start=1
                     /transl_table=11
                     /product="endochitinase"
                     /protein_id="ACF70010.1"
                     /translation="MGLQKTLALSAVAAGIMLSLSGAQAAPLLSSSEPMTINASDLAA
                     KEKALTDFPLMEAVKSSIQTLDNSAVEQIEPGRAANPANVKRVESILKEADWDYLFPM
                     RAPEYTYSNFLKAIGKFPAVCGTYTDGRDSDAICRKTLATMFAHFAQETGGHESWRDI
                     PEWRQALVYLREVGWTEGQKGGYNGECNPDVWQGQTWPCGKDKDGDFLSYFGRGAKQL
                     SYNYNYGPFSDAMYGDVRPLLDKPELVADTWMNLASAVFFFVYPQPPKPSMLHVIDGT
                     WQPNDRDKANGLVSGFGVTIQIINGGVECGGADENAQSLNRIAYYKEFANYLKVPVPA
                     DEVLGCKKMKQFDEGGAGALPIYWEQDWGWSADTADGKTYSCQLVGYQTPYTAFKEGD
                     YTKCVQHYFNVNVVDDSGTTEPDVTPTPAPVTDENVAPVARIAGPVGAVEAGSPVSLS
                     AEGSTDANGDKLTYTWMSQDGKTLSGQDKAVVIFNAPDVTQNTQYVVNLTVSDGTLSS
                     TAVYTLNVKAKAAAADDEDKTTSYPAWSSSQKWNPGDIVNSNGALYQCKPFPEGSWCN
                     VAPAYYEPGVGIAWADAWNAL"
     gene            283755..285896
                     /locus_tag="SeHA_C0272"
     CDS             283755..285896
                     /locus_tag="SeHA_C0272"
                     /EC_number="4.1.1.18"
                     /note="identified by match to protein family HMM PF01276;
                     match to protein family HMM PF03709; match to protein
                     family HMM PF03711"
                     /codon_start=1
                     /transl_table=11
                     /product="lysine decarboxylase, constitutive"
                     /protein_id="ACF69666.1"
                     /translation="MNIIAIMGPHGVYYKDEPIKELERALQSLGFQIIWPQNSVDLLK
                     FIEHNPRICGVIFDWDEYSLDLCSEINQLNEYLPLYAFINTNSTLDVSVHDMRMALWF
                     FEYALGLAEDIATRIHQYTNEYLDNITPPFTKALFTYAKEGKYTFCTPGHMAGTAYQK
                     SPPGCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYMVTN
                     GTSTSNKIVGMYAAPAGSTLLIDRNCHKSLAHLLMMSDVVPLWLKPTRNALGILGGIP
                     RREFTRASIESKIEETPQAQWPVHAVITNSTYDGLLYNTNWIKQMLDVPSIHFDSAWV
                     PYTHFHPIYQGKSGMSGDRVPGKVIFETQSTHKMLAAFSQASLIHIKGEYDEETFNEA
                     FMMHTSTSPSYPIVASIETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDSWF
                     FDIWQPEEVDEAECWPVTPGETWHGFADADDDHMFLDPVKVTILTPGMDEQGNMSEEG
                     IPAALVAKFLDERGVVVEKTGPYNLLFLFSIGIDKTRAMGLLRGLTEFKRAYDLNLRV
                     KNMLPDLYAEDPDFYRNMRIQDLAQGIHKLIRQHDLPGLMLRAFEVLPEMIMTPHQAW
                     QRQIKGEVETVALDQLPGRVSANMILPYPPGVPLLMPGERITQQSRAVLDFLLMLCSI
                     GQHYPGFETDIHGAKRNEDGVYQVRVLKHAC"
     gene            285952..286341
                     /locus_tag="SeHA_C0273"
     CDS             285952..286341
                     /locus_tag="SeHA_C0273"
                     /note="identified by match to protein family HMM PF00903"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxylase family protein"
                     /protein_id="ACF70314.1"
                     /translation="MLGLKQVHHIAIIATDYAVSKAFYCDILGFNLLSEAWREERDSW
                     KGDLALNGQYVIELFSFPFPPARPSRPEACGLRHLAFSVENVENAVAHLEKHQVKCEP
                     IRIDPYTGKRFTFFNDPDGLPLELYEQ"
     gene            286404..287696
                     /locus_tag="SeHA_C0274"
     CDS             286404..287696
                     /locus_tag="SeHA_C0274"
                     /EC_number="6.3.4.-"
                     /note="identified by match to protein family HMM PF01171;
                     match to protein family HMM PF09179; match to protein
                     family HMM TIGR02432; match to protein family HMM
                     TIGR02433"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(Ile)-lysidine synthase
                     (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine
                     synthase)"
                     /protein_id="ACF65993.1"
                     /translation="MTTLTLNTSLLSSCRILAAFSGGLDSTVLLHQLVLWRERHPDVT
                     LRAIHIHHGLSPHADSWVRHCETVCERWQVPLVVERVTLADNGLGIEAHAREARYRAF
                     AQTLLPGEVLATAQHLDDQCETFLLALKRGSGPAGLSAMGECSPFAGTLLLRPLLRET
                     RKTLEQWAVRHGLCWIEDESNQDDAYDRNFLRLRALPLLQQRWPHFPAAVARSATLCA
                     EQERLLDELLASDLTDCITAEGTLRLSPLMLMSDVRRAAILRRWLAMRNAPMPSRDAL
                     ERIWQEVALARDDASPCLRFGDHEIRRYQSQLWWIKTVAGQHETTVVWPVWQTPLALP
                     AGLGTVQLVPGGELRRPREEESVSIRFKAPGVLHIVGRNGGRKLKKIWQEQGIPPWRR
                     DTTPLLFYGETLIAAAGVFVTREGAAEDKEGVSLVWHA"
     gene            complement(287780..288040)
                     /gene="rof"
                     /locus_tag="SeHA_C0275"
     CDS             complement(287780..288040)
                     /gene="rof"
                     /locus_tag="SeHA_C0275"
                     /note="identified by match to protein family HMM PF07073"
                     /codon_start=1
                     /transl_table=11
                     /product="rof protein"
                     /protein_id="ACF66139.1"
                     /translation="MSMNETYQPINCDDYDSLELACMHHLILTLTLKDGEVLQAKAND
                     LILRKNVEYLLAEVSGESCELRLDKIASFSHPEIGTVVVSES"
     gene            complement(288027..288227)
                     /locus_tag="SeHA_C0276"
     CDS             complement(288027..288227)
                     /locus_tag="SeHA_C0276"
                     /note="identified by match to protein family HMM PF06786"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF66284.1"
                     /translation="MEKYCELVRKRYAEIASGDLGYVPDALGCVLKVLNEVAADSALS
                     ESVREKAAYAAANLLVSDYVNE"
     gene            288425..288970
                     /locus_tag="SeHA_C0277"
     CDS             288425..288970
                     /locus_tag="SeHA_C0277"
                     /note="identified by match to protein family HMM PF07152"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF68033.1"
                     /translation="MALKATIYKAVVNVADLDRNRFLDAALTLARHPSETQERMMLRL
                     LAWIKYADERLQFTRGLSAEDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQASDV
                     ALFAYNSRAAQIWWQQHQSKCAQFANLSVWYLDDGQLAQLSEFADRTMTLQATIQDGA
                     IWLSDARNNLEIQLTAWQQPS"
     gene            288967..289389
                     /locus_tag="SeHA_C0278"
     CDS             288967..289389
                     /locus_tag="SeHA_C0278"
                     /note="identified by match to protein family HMM PF00472"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase domain protein"
                     /protein_id="ACF68789.1"
                     /translation="MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIR
                     ASGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQ
                     KSRRATRPTRASKERRLSSKAQKSSVKALRGKVRRPLD"
     gene            289421..290122
                     /locus_tag="SeHA_C0279"
     CDS             289421..290122
                     /locus_tag="SeHA_C0279"
                     /note="identified by match to protein family HMM PF04170"
                     /codon_start=1
                     /transl_table=11
                     /product="copper homeostasis protein CutF"
                     /protein_id="ACF67215.1"
                     /translation="MVRTAILSVAAACTLFALIGCNNRAEVDALQPAQAAELKPMQQS
                     WRGVLPCADCEGIETSLFLEKDGTWVMNERYQGVREEPSSFASYGTWARTADKLVLTD
                     SNGEKSYYRAKGNELEMLDREGNPVASQLNYTLVPVTASLPVTPMPLRGMYVYRADAA
                     TFTDCATGKRLPVASNAQLERGYLAAKGEAEKPVLLTVEGHFVLAANPDTGEPVKTLI
                     ADKNVKFAPGKDCTH"
     gene            complement(290196..291914)
                     /gene="proS"
                     /locus_tag="SeHA_C0280"
     CDS             complement(290196..291914)
                     /gene="proS"
                     /locus_tag="SeHA_C0280"
                     /EC_number="6.1.1.15"
                     /note="identified by match to protein family HMM PF00587;
                     match to protein family HMM PF03129; match to protein
                     family HMM PF04073; match to protein family HMM TIGR00409"
                     /codon_start=1
                     /transl_table=11
                     /product="prolyl-tRNA synthetase"
                     /protein_id="ACF68125.1"
                     /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLP
                     TGLRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGER
                     PFVLGPTHEEVITDLVRNELSSYKQLPLNFFQIQTKFRDEVRPRFGVMRSREFLMKDA
                     YSFHTSQESLQETYDAMYAAYSRIFSRMGLDFRAVQADTGSIGGNASHEFQVLAQSGE
                     DDIVFSDVSDYAANIELAEAIAPQTPRAAATQEMTLVDTPNAKTIAELVEQFNLPIEK
                     TVKTLLVKAVKDSKSPLVALLVRGDHELNEVKAEKLPHVASPLTFATEEEIRAVINAG
                     PGSLGPVNMPIPVIIDRTVAAMSDFAAGANIDGKHYFGINWDRDVATPVVADIRNVVA
                     GDPSPDGQGTLLIKRGIEVGHIFQLGTKYSEALKASVQGEDGRNQILTMGCYGIGVTR
                     VVAAAIEQNFDERGIVWPDAIAPFQVAILPMNMHKSFRVQELAEKLYSELRAQGIEVL
                     MDDRKERPGVMFADMELIGIPHTIVIGDRNLDNDDIEYKYRRSGEKSLIKTGDIVDYL
                     VKAIKG"
     gene            complement(292025..292765)
                     /locus_tag="SeHA_C0281"
     CDS             complement(292025..292765)
                     /locus_tag="SeHA_C0281"
                     /note="identified by match to protein family HMM PF01980;
                     match to protein family HMM TIGR00104"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF68482.1"
                     /translation="MYRVRPEYFGEMSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSAC
                     GELHLIAPYNQADAVRGLEAFSHLWVLFVFHQTMDGGWRPTVRPPRLGGNARMGVFAT
                     RSTFRPNPIGMSLVALKGIECRKESVILKLGSLDLVDGTPVVDIKPYLPFAEALPDAA
                     ASYAQQAPIAEMPVSFTAEVAQQLTTLERRYPQLRTFICDVLAQDPRPAYRKGEETGK
                     TYAVWLHDFNVRWRVVNTGFEVFALEPR"
     gene            complement(292729..293133)
                     /gene="rcsF"
                     /locus_tag="SeHA_C0282"
     CDS             complement(292729..293133)
                     /gene="rcsF"
                     /locus_tag="SeHA_C0282"
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide synthesis regulator RcsF"
                     /protein_id="ACF68237.1"
                     /translation="MRALPICLLALMLGGCSMLSRSPVEPVQSTATPPKAEPEKPKAP
                     RAAPVRIYTNAEDLVGKPFRDLGEVSGESCQATNQDSPPNIPTARKRMQINASKMKAN
                     AVLLHSCEITSGTPGCYRQAVCIGSALNISAK"
     gene            complement(293252..294067)
                     /gene="metQ"
                     /locus_tag="SeHA_C0283"
     CDS             complement(293252..294067)
                     /gene="metQ"
                     /locus_tag="SeHA_C0283"
                     /note="identified by match to protein family HMM PF03180;
                     match to protein family HMM TIGR00363"
                     /codon_start=1
                     /transl_table=11
                     /product="D-methionine ABC transporter, periplasmic
                     D-methionine-binding lipoprotein"
                     /protein_id="ACF68870.1"
                     /translation="MAFKFKTFAAVGALIGSLALAGCGQDEKDPNHIKVGVIVGAEQQ
                     VAEVAQKVAKEKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQIKDRGYK
                     LVSVGKTFVYPIAGYSKKIKSLDELKDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDG
                     VGLLPTSLDIVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGI
                     FVEDKDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
     gene            complement(294106..294759)
                     /gene="metI"
                     /locus_tag="SeHA_C0284"
     CDS             complement(294106..294759)
                     /gene="metI"
                     /locus_tag="SeHA_C0284"
                     /note="identified by match to protein family HMM PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="D-methionine ABC transporter, permease protein"
                     /protein_id="ACF69517.1"
                     /translation="MSEAMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPG
                     QIMENARLYRSLSAVVNIFRSIPFIILLVWMIPFTRIIVGTSIGLQAAIVPLTVGAAP
                     FIARMVENALLEIPAGLIEASRAMGATPLQIVRKILLPEALPGLVNAATITLITLVGY
                     SAMGGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQLSGDRIVRAVTHK"
     gene            complement(294752..295783)
                     /gene="metN"
                     /locus_tag="SeHA_C0285"
     CDS             complement(294752..295783)
                     /gene="metN"
                     /locus_tag="SeHA_C0285"
                     /note="identified by match to protein family HMM PF00005;
                     match to protein family HMM PF09383; match to protein
                     family HMM TIGR02314"
                     /codon_start=1
                     /transl_table=11
                     /product="D-methionine ABC transporter, ATP-binding
                     protein"
                     /protein_id="ACF70139.1"
                     /translation="MIKLSNITKVFQQGTRTIQALNNVSLHVPAGQIYGVIGASGAGK
                     STLIRCVNLLERPTEGSVMVGGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGN
                     VALPLELDNTPKEEIKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARALASNPK
                     VLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGE
                     LIEQDTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQARLKASPETDSVPMLRMEFTGQ
                     SVDAPLLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQEETQAAIAWLQDHH
                     VKVEVLGYV"
     gene            295973..296539
                     /locus_tag="SeHA_C0286"
     CDS             295973..296539
                     /locus_tag="SeHA_C0286"
                     /note="identified by match to protein family HMM PF08645;
                     match to protein family HMM TIGR00213; match to protein
                     family HMM TIGR01656; match to protein family HMM
                     TIGR01662"
                     /codon_start=1
                     /transl_table=11
                     /product="D,D-heptose 1,7-bisphosphate phosphatase"
                     /protein_id="ACF66349.1"
                     /translation="MAKSVPAIFLDRDGTINVDHGYVHEIDAFEFIDGVIDAMRELKK
                     MGYALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSIEE
                     FRQVCDCRKPHPGMLISARDFLHIDMAASYMVGDKLEDMQAAAAANVGTKVLVRTGKP
                     VTAEAENAADWVLNSLADLPSAIKKQQK"
     gene            complement(296610..296732)
                     /locus_tag="SeHA_C0287"
                     /note="conserved hypothetical protein; this gene contains
                     a frame shift which may be the result of sequencing error"
                     /pseudo
     gene            296917..298450
                     /gene="rrs"
                     /locus_tag="SeHA_C0288"
     rRNA            296917..298450
                     /gene="rrs"
                     /locus_tag="SeHA_C0288"
                     /product="16S ribosomal RNA"
     gene            298521..298597
                     /locus_tag="SeHA_C0289"
     tRNA            298521..298597
                     /locus_tag="SeHA_C0289"
                     /product="tRNA-Ile"
     gene            298706..298783
                     /locus_tag="SeHA_C0290"
     tRNA            298706..298783
                     /locus_tag="SeHA_C0290"
                     /product="tRNA-Ala"
     gene            302288..302403
                     /gene="rrf"
                     /locus_tag="SeHA_C0291"
     rRNA            302288..302403
                     /gene="rrf"
                     /locus_tag="SeHA_C0291"
                     /product="5S ribosomal RNA"
     gene            302594..302672
                     /locus_tag="SeHA_C0292"
     tRNA            302594..302672
                     /locus_tag="SeHA_C0292"
                     /product="tRNA-Asp"
     gene            302815..303639
                     /gene="dkgB"
                     /locus_tag="SeHA_C0293"
     CDS             302815..303639
                     /gene="dkgB"
                     /locus_tag="SeHA_C0293"
                     /EC_number="1.1.1.274"
                     /note="identified by match to protein family HMM PF00248"
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-didehydrogluconate reductase B"
                     /protein_id="ACF66558.1"
                     /translation="MIKKRNSMTIPAFGLGTFRLKDDVVIASVKTALELGYRAVDTAQ
                     IYDNEAAVGQAITESGVPRSELYITTKIWIENLSKDKLIPSLKESLKKLRTDYVDLTL
                     IHWPSPGDAVSVEEFMLALLEAKKQGLTREIGISNFTIPLMKKAIAAVGADNIATNQI
                     ELSPYLQNRKVVDWAKAHGIHITSYMTLAYGKALKDEVIARIAAKHNATPAQVILAWA
                     MGEGYSVIPSSTRRENLASNLLAQDLHLDAEDKNAIAALDCNDRLVSPEGLAPAWD"
     gene            complement(303660..304574)
                     /locus_tag="SeHA_C0294"
     CDS             complement(303660..304574)
                     /locus_tag="SeHA_C0294"
                     /note="identified by match to protein family HMM PF00126;
                     match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR substrate binding domain protein"
                     /protein_id="ACF67353.1"
                     /translation="MKATSEELAIFVAVVESGSFSRAAEQLGQANSAVSRAVKKLEMK
                     LGVSLLNRTTRQLSLTEEGERYFRRVQQILQEMAAAETEIMESRNTPRGLLRIDAATP
                     VMLHFLMPLIKPFRERYPEITLSLVSSETFINLIERKVDVAIRAGTLTDSSLRARPLF
                     TSYRKIIASPDYIARFGKPETVEELKRHLCLGFSEPVSLNTWPIACSDGQLHEIKCGI
                     SSNSGETLKQLCLNGNGIACLSDYMIDKEIARGELVELLADKRLPVEMPFSAVYYSDR
                     AVSTRIRAFIDFLSEYIRTAPAGAVKEG"
     gene            304679..305854
                     /locus_tag="SeHA_C0295"
     CDS             304679..305854
                     /locus_tag="SeHA_C0295"
                     /note="identified by match to protein family HMM PF07690"
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane transport protein YdhP"
                     /protein_id="ACF66669.1"
                     /translation="MPLALFALTISAFAIGTTEFVIVGLVPTIAQQLAISLPSAGMLV
                     SIYALGVAIGAPVLTALTGRLPRKQLLVALMVLFTAGNLLAWQAPGYMTLIVARLLTG
                     LAHGVFFSIGSTIATSLVPKEKAASAIAIMFGGLTVALVTGVPLGTFIGQHFGWRETF
                     LAVSLLGVIALMSSQLLIPANIPGRAAASIRDQVKVLTHPRLLLIYAVTALGYGGVFT
                     AFTFLAPMMQDLAGFSPAAVSWILLGYGVSVAIGNIWGGKLADKHGAVPALKFIFAAL
                     FVLLMVFQVTASTQYAALATILVMGVFAFGNVPGLQVYVVQKAEQFTPNAVDVASGLN
                     IAAFNIGIALGSVIGGQTVEHYGLAQTPWIGALIVLVAFLLMGVSGRLDKPVRIALE"
     gene            305986..306786
                     /locus_tag="SeHA_C0296"
     CDS             305986..306786
                     /locus_tag="SeHA_C0296"
                     /note="identified by match to protein family HMM PF03372"
                     /codon_start=1
                     /transl_table=11
                     /product="protein YafD"
                     /protein_id="ACF68372.1"
                     /translation="MRKNTYAMRYVAGQPAERILPPGSFASIGQALPAGEPLSSEERI
                     RILVWNIFKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFV
                     LPQHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNVHAVNF
                     SLGVDVYSKQLLPIGDQIAHHSGPVIMAGDFNAWSRPRMNALYRFAREMSLRQVRFTD
                     DQRRRAFGRPLDFVFYRGLNVNEASVLVTRASDHNPLLVEFSPGKPEQ"
     gene            306864..307634
                     /locus_tag="SeHA_C0297"
     CDS             306864..307634
                     /locus_tag="SeHA_C0297"
                     /note="identified by match to protein family HMM PF01209;
                     match to protein family HMM PF08241; match to protein
                     family HMM PF08242"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase, UbiE/COQ5 family"
                     /protein_id="ACF67699.1"
                     /translation="MTTHSHHDNVEKQFGSQANAYLHSAVHASGRDLARLAQRLSDFS
                     HANVLDMGCGAGHASFVAAQHAYSVVAYDLSASMLEVVAGAAEERHLSNITLRQGYAE
                     KLPFEDASFEVVISRYSAHHWHDVGQALREVYRVLKPGGVLIIMDVMSPGHPVRDIWL
                     QTVEALRDTSHVRNYSSGEWLTMVNNAMLVTNTVITDRLSLEFRSWVTRMRTPAPLVE
                     AIRLYQASAPVEVKRYFELQDDGSFSSDTIMLEAHKAV"
     gene            complement(307690..308910)
                     /gene="mltD"
                     /locus_tag="SeHA_C0298"
     CDS             complement(307690..308910)
                     /gene="mltD"
                     /locus_tag="SeHA_C0298"
                     /EC_number="2.4.-.-"
                     /note="identified by match to protein family HMM PF01464;
                     match to protein family HMM PF01476"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound lytic murein transglycosylase D"
                     /protein_id="ACF66281.1"
                     /translation="MDDGTSIAPDQDLWAFIGDELKMGIPENSRIREQKQKYLRNKSY
                     LHDVTLRAEPYMYWIAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPST
                     GRNYGLKQTRNYDARRDVVASTTAALDMMQRLNKMFDGDWLLTVAAYNSGEGRVMRAI
                     KANKARGKPTDFWSLSLPRETKLYVPKMLALSEILKNSKRYGVRLPTTDESRALARVR
                     LNSPVEMAQVADMAGMSISKLKTFNAGVKGSTLGVSGPQYVMVPKKHAEQLRESLASG
                     EIDAVQSQLIADNTPLNSRSYKVRSGDTLSGIASRLGVSTKDLQQWNNLRGSRLKIGQ
                     SLTVDAGSSAQRLANNSDSITYRVRKGDSLSSIARRHGVNIKDVMRWNHDTDNLQPGD
                     QLTLFVKDNSTPDS"
     gene            complement(309129..309884)
                     /gene="gloB"
                     /locus_tag="SeHA_C0299"
     CDS             complement(309129..309884)
                     /gene="gloB"
                     /locus_tag="SeHA_C0299"
                     /EC_number="3.1.2.6"
                     /note="identified by match to protein family HMM PF00753;
                     match to protein family HMM TIGR03413"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyacylglutathione hydrolase"
                     /protein_id="ACF66976.1"
                     /translation="MNLNSIPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKW
                     MPEAIFLTHHHHDHVGGVKELLQHFPQMTVYGPAETQDKGATHLVGDGDTIRVLGEKF
                     TLFATPGHTLGHVCYFSHPYLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTL
                     ICCAHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLR
                     TEDIDLINEINKETILQQPEARFAWLRSKKDTF"
     gene            309919..310641
                     /locus_tag="SeHA_C0300"
     CDS             309919..310641
                     /locus_tag="SeHA_C0300"
                     /note="identified by match to protein family HMM PF08241"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methyltransferase"
                     /protein_id="ACF65945.1"
                     /translation="MKPARLSQTVVAPGCWGELPWGNYYREALEQQLNPWFAKMYGFH
                     LLKIGNLSAEINSEACAVSHQVNVSSQGSPMQVLADPLHLPFADKSVDVCLLAHTLPW
                     CTDPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVPVLRKTPPYNSRMFTLMRQL
                     DWLSLLNFEVLHYSRFHVLPWKKQGGRLLNTHIPALGCLQLIVARKRTIPLTLNPLRH
                     NKSKTPIRQTVGATRQYRKPDG"
     gene            complement(310638..311105)
                     /gene="rnhA"
                     /locus_tag="SeHA_C0301"
     CDS             complement(310638..311105)
                     /gene="rnhA"
                     /locus_tag="SeHA_C0301"
                     /EC_number="3.1.26.4"
                     /note="identified by match to protein family HMM PF00075"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HI"
                     /protein_id="ACF66340.1"
                     /translation="MLKQVEIFTDGSCLGNPGPGGYGAILRYRGHEKTFSEGYTLTTN
                     NRMELMAAIVALEALKEHCEVTLSTDSQYVRQGITQWIHNWKKRGWKTAEKKPVKNVD
                     LWKRLDAALGQHQIKWVWVKGHAGHPENERCDELARAAAMNPTQEDSGYQAEA"
     gene            311160..311900
                     /gene="dnaQ"
                     /locus_tag="SeHA_C0302"
     CDS             311160..311900
                     /gene="dnaQ"
                     /locus_tag="SeHA_C0302"
                     /EC_number="2.7.7.7"
                     /note="identified by match to protein family HMM PF00929;
                     match to protein family HMM TIGR00573; match to protein
                     family HMM TIGR01406"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, epsilon subunit"
                     /protein_id="ACF68042.1"
                     /translation="MTDMSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVINR
                     RLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPVFADVVDEFLDYIRGAELVIHN
                     ASFDIGFMDYEFGLLKRDIPKTNTFCKVTDSLALARKMFPGKRNSLDALCSRYEIDNS
                     KRTLHGALLDAQILAEVYLAMTGGQTSMTFAMEGETQRQQGEATIQRIVRQASRLRVV
                     FASEEELAAHESRLDLVQKKGGSCLWRA"
     gene            312033..312111
                     /locus_tag="SeHA_C0303"
     tRNA            312033..312111
                     /locus_tag="SeHA_C0303"
                     /product="tRNA-Asp"
     gene            complement(312432..313481)
                     /locus_tag="SeHA_C0304"
     CDS             complement(312432..313481)
                     /locus_tag="SeHA_C0304"
                     /note="identified by match to protein family HMM PF06812"
                     /codon_start=1
                     /transl_table=11
                     /product="ImpA-related N- family protein"
                     /protein_id="ACF67414.1"
                     /translation="MSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVST
                     PEAVNWPEIERDARRLLTRSKDIRVLILLLRSRIQQAGAQGLAEILTQLAELSVIWSD
                     ALHPQLLTGEGASAESIEDAALARSNALAALLDHEGVMADIRGITLSNSAVLRLQVRD
                     VERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQVWARETLGDL
                     APDFSRLRQLLALLPDVVQTTTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPP
                     GISLPHNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVI
                     NEIPVELLEKWDALE"
     gene            complement(313498..314493)
                     /locus_tag="SeHA_C0305"
     CDS             complement(313498..314493)
                     /locus_tag="SeHA_C0305"
                     /note="identified by match to protein family HMM PF06996;
                     match to protein family HMM TIGR03347"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein, family"
                     /protein_id="ACF68477.1"
                     /translation="MTGALDQAQKTPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKF
                     RLGQTPTMTFAPREIAQVSWQDGRLHLSLYSLGLWGPNGPLPLHYTELALNRSESRHD
                     PTLVHFSNIFHHRWLTQFWQAWRSAQSAGGGLDKPEHDRFAFYIASLSGQDLRESAES
                     PLSDHVRLAASAHLVRESRNPDGLAATLAHYFSVPFAVKEFALHWITVANDEITRLGT
                     PAQSSVLGNGALIGQAVPDMQYKFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIG
                     FEYCWEIELQLKPHAAPPAVIGGAQRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH"
     gene            complement(314490..316373)
                     /gene="vasA"
                     /locus_tag="SeHA_C0306"
     CDS             complement(314490..316373)
                     /gene="vasA"
                     /locus_tag="SeHA_C0306"
                     /note="identified by match to protein family HMM PF05947;
                     match to protein family HMM TIGR03359"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein, family"
                     /protein_id="ACF69109.1"
                     /translation="MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQRTDIADP
                     YVERMIEAFSFLSARTQLKIDAEFPRFTQRLLEVVSPNYVTPTPSMAVAKLYPDTQEG
                     DLAKGVTVPRDTAFVSPIPEGENTACQFRSSQDVTLWPLSIEEVRLTAAPPDMPALHR
                     YLPPNIHVAGALRITLRTFGELTFSELAGPARLPFYLCGEERIASHLFELLHTSAVAT
                     LAGEPGHFDGELNVNLQHPVAHEGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFF
                     TPTGLSAGLQKVQGNVAEIVILLNRLPPDWLIHQTDAAQFSLFCTPVINLFPRTTTRI
                     EVTHSVTEQHLVVDRTRPLDYEVFSVQEVEGLEAETTRKMIFRPLYHTRNNDEGNHGR
                     YFSLRREPRRSSENARRYGTRTPYTGSEVFLSLVDQHEAPYPENLRHITVTAMVTNRD
                     LPCLIPRNGRDDLTVDAAIPVAGVGLIRPPRPPQPPLAEREMAWRLIRQLSFNYLPLA
                     DLDHRTGGQALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLVYGRGVS
                     CELTVDEEGFSGISPYLFGLVLEHYIARHVSINTFSQMTLHSMQRGHVMTWPVRTGQR
                     GSV"
     gene            complement(316389..316883)
                     /locus_tag="SeHA_C0307"
     CDS             complement(316389..316883)
                     /locus_tag="SeHA_C0307"
                     /note="identified by match to protein family HMM PF04965;
                     match to protein family HMM TIGR03357"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system lysozyme-related
                     protein"
                     /protein_id="ACF66528.1"
                     /translation="MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEII
                     RRDLSFLLNTISHEGDIDARRYPQAAASVLNYGLPPLAGSFMYEHKWDDISEAIRRAI
                     IRFEPRLNAATLRVTPLLDEARQGSYNTLQFEIRGQILTQPYPTEFLVRSALDMELSR
                     ITFF"
     gene            complement(316880..317704)
                     /locus_tag="SeHA_C0308"
     CDS             complement(316880..317704)
                     /locus_tag="SeHA_C0308"
                     /note="identified by match to protein family HMM PF07024"
                     /codon_start=1
                     /transl_table=11
                     /product="SciE protein"
                     /protein_id="ACF67186.1"
                     /translation="MKKTDTLPATLSALIQEYSFAEGIQMAEQQVRENPAKALCRHSL
                     FQLLCVAGDWSRALHQLQLCARMEANYTQEARLYRELVRCEMFRHTVFQGEQRPGFLL
                     PQPVWVESLLAALACHDDTGEVDKHRNTALEAITDTGGQWNGGAFDWASDSDSRLGPV
                     LELVTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWLFTRYSGSE
                     SASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMAHCTFHAQENDGA"
     gene            complement(317691..318581)
                     /locus_tag="SeHA_C0309"
     CDS             complement(317691..318581)
                     /locus_tag="SeHA_C0309"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="ACF70425.1"
                     /translation="MWELRKIQSQGITDNAQYPAGTYIVFTAAAPYIPLFEQHGKDDI
                     ALSLVRHEEAWWIVNHSDELCCAVNEQVMEPHHRMRLNDGDTIEWGLSSWCLARTNDE
                     SRPDVSFPQLVQSSESVAEYLDLDWFKQQQLNPQNPFDIIPVRETASSYTGHEADSTL
                     HQLYQEYQQALRPSGQEKPLRPKPFPRNEDAVTQDLTSLYDKKGDTDTLQDMVAGAPG
                     IDAILDTLDTTGEGEMHWLAMESMPDILQLLPPEQAGKTAHSEILPDLTRREHRIIGI
                     DSHYRITPTQKNGNTAHEKN"
     gene            318961..321600
                     /gene="clpV"
                     /locus_tag="SeHA_C0310"
     CDS             318961..321600
                     /gene="clpV"
                     /locus_tag="SeHA_C0310"
                     /note="identified by match to protein family HMM PF00004;
                     match to protein family HMM PF07724; match to protein
                     family HMM PF07728; match to protein family HMM TIGR03345"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion ATPase, ClpV1 family"
                     /protein_id="ACF65835.1"
                     /translation="METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWVELTHWLH
                     QLTQQPDNDILHVLRHYQIPLSDVEKALLRQLDMLPAGASAISDFSHHIDLSVEKAWM
                     LASVRYGDNKIRSGWLLLALLTTPELRRVLSSICAPLATLPVDELTEILPSLIETSPE
                     AQERPYDGSGLASAIPGESSQAIPNGGQDGKSALAKYCQDMTAQARDGKIDPVTGREH
                     EIRTMTDILLRRRQNNPLLTGEAGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVG
                     ALLAGASMKGEFESRLKGLLEEAGRSPQPVILFVDEVHTLVGAGGASGTGDAANLLKP
                     ALARGTLRTIGATTWSEYKRHIEKDPALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEK
                     HHNVLILDEAVRAAVQLSHRYIPARQLPDKAISLLDTAAARVALTLHTPPASVQFLRQ
                     QLKAAEMERSLLQKQEKMGIQSDERRDALTARIFSLNNELTASESRWQRELELVHTLQ
                     ELRVAESDADDKTTLQQAETALREWQGDAPVVFPEVSAAVVAAIVADWTGIPAGRMVK
                     DEASQVLELPARLAQRVTGQDGALAQIGERIQTARAGLGDPRKPVGVFMLAGPSGVGK
                     TETALALAEAIYGGEQNLVTINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRH
                     PWSVVLLDEIEKAHHDVHELFYQVFDKGGMEDGEGTHVDFKNTTLLLTTNVGSDLISQ
                     MCEDPALMPDATGLKEALMPELRKHFPAAFLGRVTVIPYLPLDEPSRGVIARLHLDRL
                     VARMGEQHGVTLTYSEELVAHIVACCPMHETGARLLIGYIEQHILPRLSRYWLQAMTE
                     KAAIRQIDIGVNGDEQIVFEIVC"
     gene            321700..322242
                     /locus_tag="SeHA_C0311"
     CDS             321700..322242
                     /locus_tag="SeHA_C0311"
                     /note="identified by match to protein family HMM PF05591;
                     match to protein family HMM TIGR03358"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein, family"
                     /protein_id="ACF69269.1"
                     /translation="MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLA
                     DLAGKPREELPPVTDRKFLDIDIDNFNERMKAIAPRVAFAVPNTLTGEGQLMVDITLE
                     NMDDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKAGAENLVNKLLQDPTLLKTLA
                     NAPKPAATQQGVSADNESAE"
     gene            322266..323774
                     /locus_tag="SeHA_C0312"
     CDS             322266..323774
                     /locus_tag="SeHA_C0312"
                     /note="identified by match to protein family HMM PF05943;
                     match to protein family HMM TIGR03355"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein, EvpB/family"
                     /protein_id="ACF69746.1"
                     /translation="MANSNMQATDAVAQDTVSASGEFDTLLNQAFRPKTTQAAKAVEA
                     AVQTLAQQALANTITVSDDAYKSISAIIAQIDFKLTEQIKLILQHPDWQKLESSWRGM
                     EHLVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWDQSPMFKKLYEAEYGQLGGEP
                     YGCIIADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQELANPRDLT
                     KIVTQNLEYAPWNSLRASEDSRYIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDH
                     TKYVWSNAAYAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCP
                     TEIAISDRREAELAKNGFIPLIHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSAR
                     LPYLFACSRFAHFLKCIVRDKIGSFKEREDMQRWLNEWIMNYVDADPVNSSQETKARR
                     PLAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLTGSLRLVTKLPSVKQGNA"
     gene            324200..324625
                     /locus_tag="SeHA_C0313"
     CDS             324200..324625
                     /locus_tag="SeHA_C0313"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF67842.1"
                     /translation="MQKPILLLNSTCIVGGILWLLPVIVVHADEIVCPAVIHFSQAPI
                     ISSAEGWNVSSRAARMLNDGGFLSSGDPKEQADLKGEDAVVDGKKGRLWEIDPEDNRR
                     GIWFSCSYGQWAVLLARKVQGTVATCWSPDVLPAKLICK"
     gene            324862..325347
                     /locus_tag="SeHA_C0314"
     CDS             324862..325347
                     /locus_tag="SeHA_C0314"
                     /note="identified by match to protein family HMM PF05638;
                     match to protein family HMM TIGR03344"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin-coregulated protein"
                     /protein_id="ACF67933.1"
                     /translation="MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGS
                     GLGSGKVSVTNLDFDHYIDRASPNLFKYCASGKHIPQAILVMRKAGGNPLEYLKYTFT
                     DLIVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKE
                     I"
     gene            325650..326135
                     /locus_tag="SeHA_C0315"
     CDS             325650..326135
                     /locus_tag="SeHA_C0315"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="ACF70196.1"
                     /translation="MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGSYFQNAC
                     PIRMSYVLNATGFPIARNSPYAKVSGADNKFYIYRVNDMIDYLTHTMGKPDLIVNNPK
                     QSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCHLLNDPDNGPFVPEVGTLWIL
                     P"
     gene            326171..326503
                     /locus_tag="SeHA_C0316"
     CDS             326171..326503
                     /locus_tag="SeHA_C0316"
                     /codon_start=1
                     /transl_table=11
                     /product="putative periplasmic protein"
                     /protein_id="ACF69385.1"
                     /translation="MLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKND
                     ARATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNE
                     LIKRRVEK"
     gene            326646..327131
                     /locus_tag="SeHA_C0317"
     CDS             326646..327131
                     /locus_tag="SeHA_C0317"
                     /note="identified by match to protein family HMM PF05638;
                     match to protein family HMM TIGR03344"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin-coregulated protein"
                     /protein_id="ACF68812.1"
                     /translation="MSYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGS
                     GLGSGKVSVTNLSFEHYIDRASPNLFKYCSSGKHIPQAILVMRKAGGNPLEYLKYTFT
                     DLIIAMVSPSGSQGGEIASRESIELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKE
                     I"
     gene            327244..327735
                     /locus_tag="SeHA_C0318"
     CDS             327244..327735
                     /locus_tag="SeHA_C0318"
                     /note="identified by match to protein family HMM
                     TIGR03352"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion lipoprotein, family"
                     /protein_id="ACF69210.1"
                     /translation="MPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAA
                     PIEIRVYELKNDAAFTTADYWSLHDNDKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQ
                     TTAIGVLAGYRNLAKSVWRVTYKIPEAPEKAWYSSFIPGKGKVQLEAELEQSAIVITE
                     RDK"
     gene            327739..329082
                     /locus_tag="SeHA_C0319"
     CDS             327739..329082
                     /locus_tag="SeHA_C0319"
                     /note="identified by match to protein family HMM PF05936;
                     match to protein family HMM TIGR03353"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein, family"
                     /protein_id="ACF68144.1"
                     /translation="MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWG
                     FSHYNIDGEALNIGKLILKEASGIFPDGTPFNAPDHTPLPPPLTILPEHLNQQICLAV
                     PVRAPNSEETTFDNNPESLARFSVHEHDIRDANSLGRGAQLLQLSHLRLRLLPEKAVT
                     GAWIGLPLTRITGLNPDGRIDIDHDLIPPIINYQASSLMCTWLSWINDLIRMRADSLA
                     ERLTGSDNHGHEAAEVSDYLLLQILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELST
                     YVRPQTRRPAEYKEYKHLTPYAGLKSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNA
                     VVAPSDLADFSTLVLAIKASMPTDVLLQHFAAQTKIGPSDRLPELIRSHLPGLALQVL
                     PVPPRQIPFQAGYIYYDIRREGALWEHIARYGGMAMHTAGEFPGLETELWGVRDK"
     gene            329079..330383
                     /locus_tag="SeHA_C0320"
     CDS             329079..330383
                     /locus_tag="SeHA_C0320"
                     /note="identified by match to protein family HMM PF00691;
                     match to protein family HMM TIGR03349; match to protein
                     family HMM TIGR03350"
                     /codon_start=1
                     /transl_table=11
                     /product="SciP protein"
                     /protein_id="ACF67352.1"
                     /translation="MTDSTLTPPAADMMSFLSTTPEHKDSEYETPVHTSQRTELNVIV
                     EDGPDSKLRLAEISAAANPLLAAARPLLCALAAMPAKLDAALVEPYRNLLVREMHLYQ
                     TLCDQANLRREHVLAVRYCLCTALDEAANNTTWGRRGIWAGKSLLVTFHGESEGGIKL
                     FQIIGRLAASFQEHGNVLEVIYHLLGLGFEGRYSVQPDGRKQLDNIRQQLLTQLSQRR
                     DPVMPALSPDFQGAISGRLRRMRRVPVWLSAGIALLAMLTLFGLYSHRMDVQTVTVQQ
                     HIDAIGIKLPPPPVPVHKLRLKILLANEIARGLLTVDEDDQHSRVVFRGDAMFVPGQK
                     TVSDAIRPVINKAAREIARVGGAVTVTGHTDSQPIHSAEFPSNLVLSEKRAAEVAALL
                     TSGGVPAGRVHIVGKGDTVPVADNGSKAGRAKNRRVEILVVE"
     gene            330388..331161
                     /locus_tag="SeHA_C0321"
     CDS             330388..331161
                     /locus_tag="SeHA_C0321"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF66638.1"
                     /translation="MMKKSTYDVSHHSAVCGVTGDYYRISATYHIKRSIRVFLIILCC
                     LLPGGVFAGSLINAGFISPDNVNLSIRDFLGFYASDNLQEKDNTLMYVLGVADATEGK
                     TWCGYGQVDSITINHTVLAWLDRYSVKKPDARASVLIEEALVKNFPCQGTEPSVKIAS
                     RSSPVLSLTPDALNLSGNDFFKFWVSGNQRDKLRAGIYLLGVEDATENKLWCGYALFK
                     TLTLNELVYVSLKNKTNEELNSRAAELIINKLIEYPCKI"
     gene            331439..331795
                     /locus_tag="SeHA_C0322"
     CDS             331439..331795
                     /locus_tag="SeHA_C0322"
                     /codon_start=1
                     /transl_table=11
                     /product="SciR protein"
                     /protein_id="ACF65990.1"
                     /translation="MESSLFDAIKNDLNIDVATIIKDKTKVEILDISPVSKVYAESLA
                     RMDYEKDKAKNKVAILDKKSYFDSYYENQVKSIVAKYTYINKDKEKDIFIASSFMNAD
                     ECSVRFNGYITLSREF"
     gene            331829..335698
                     /gene="icmF"
                     /locus_tag="SeHA_C0323"
     CDS             331829..335698
                     /gene="icmF"
                     /locus_tag="SeHA_C0323"
                     /note="identified by match to protein family HMM PF06744;
                     match to protein family HMM PF06761; match to protein
                     family HMM TIGR03348"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein IcmF"
                     /protein_id="ACF68350.1"
                     /translation="MQKFLSLLFSRRALAIVGVLVLALLVWFVGPLVSFDTLRPLASV
                     GSRVVTIALLLMLLVLWLVNWSMSIIGISVLCLAIGFVTPLLALGDVHPFAPLWVRLT
                     LIGFILLMYALYGLYRLWRALRMDEQLLRRFLHPRGEEVPVAGEIKADLRTVNHIVTQ
                     AIRQLRQLRVDMPGWRKIFEGKRFLYELPWFMVVGSPGDGKTTALLNTGLQFPLAEQM
                     EQTSRILTVPGGGTLHCDWWFTNEAVLIDTAGRYARHDDGGEASAAQRNAGEWQGFLG
                     LLRKHRPGAPLNGVILTLNVADLTAQSPAERLAACAALRARLAELRETLGIRFPVYLV
                     VTKMDLLPGFSEYFRTLTSHLRAQIWGFTLPYSRRRKTGDPQALHAACAQELARLTLR
                     LDQGLDTRLQEEYDLKSLQRLYTFPREFAALGEPLLEAIEQIFLDSKFDATQLNNTLR
                     GVFFTSAAQAQADAVADQLSIWQRFVRAIKTARGESSASLPHALPDGNRSYFLHDLLT
                     QFIFREAHLVEPNLQWAWRYRLLRLGGHLLVLVLAFLLWQGMQTSQQTNGDYLNEISA
                     RATRLDGEVKAYTGKPAMAPVPTLLDSARELSAWPELDPDAPPLTWRYGLYSVPPVTD
                     SVASLYNRLLDQLLLPPLVKRMEYVLADAIARQDSKAAYDALRIYLLLNLDKDHEDKY
                     NAAEIQSWVINDLGNSDSVAGFGGRAAVLTHIEALFDGSRVVHSPYEKNEALIRQARA
                     FLDGHTSTERIYARALAAMESEAPQEFTLVRAVGADAGTVFVRSNGAPLDRGVPGIFT
                     REGYRELFDKRLPEFVAAATANDGWVMGRESTPKKLTDSLRSQIPGQEQSVAREVRRL
                     YLTEYARRWQDFLDSIHSINSAGEEGSSGLAYDLQVLRTLASPDSPLMRLGKAVVEQT
                     TLVPPPDPQARQKQLAQRASGNAGKVVQTAKLFQDIHPEERLEKTLVDDRFAALREVI
                     AGRTDGGQSGGGTMQIASLLTMLNEYYTQLTIADSALAAGTLPARITAADKLQLEAAK
                     LPAPLKNILLDLTKQGTRKINAGTGDVLNTQMEAMMGDDCRDAIDGRYPFADSPQEVS
                     AEDFNRIFASGGVLDAFWSKQLAPLADTASDPWRYKPTEGNMTLQGPDLTPFQQAKQI
                     RSVFFNSEGGKKFSWSMQISVVDMDPAITELVIDIDGQVLRYAHGPDRPLKVTWPGPR
                     NGSMAEITASPRIRQDTSTLLTGGPWALFHLLDAGMVQETAVRGRQLVEYDFDGRRVV
                     LEITAGRDFNPVSRELLQNFSCPARAL"
     gene            335698..336465
                     /locus_tag="SeHA_C0324"
     CDS             335698..336465
                     /locus_tag="SeHA_C0324"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF70300.1"
                     /translation="MRRPAVVSAPAMFGRLPDQRDYVRWRVGAEEGRIWQDWLNRQTW
                     VGSGRHIVLPEGQTTDEERDGWMHLSPRGEHDMPAPEHHPLPWSFVMSPGFLPMGGTT
                     DWLTGVLMASRDSVGRPWPLVIYQRCGREWLDESLQETQGWLYWLARLAAQHITPDTM
                     RRGRLTEQVDQLWAMWQPGPWWAQWLRGLRRTSQRSRELTGLPDEAPVVELPGVRYLP
                     WPGWPGKTLGQATPGQGWFWQQNSEGRYVDALRLAEK"
     gene            337068..337424
                     /locus_tag="SeHA_C0325"
     CDS             337068..337424
                     /locus_tag="SeHA_C0325"
                     /codon_start=1
                     /transl_table=11
                     /product="probable secreted protein"
                     /protein_id="ACF70090.1"
                     /translation="MTKVQAEKLLIIALKYQKYDLSLDGVFVDGDLQDKHGNPPHPGY
                     YDFSLGYDTPTAGAIDYWGLFSVSSQTGDIWEINKCERIIFPQLQKIQQEIMKKTGAT
                     FASEVVQRRGLGCTDE"
     gene            337433..337555
                     /locus_tag="SeHA_C0326"
     CDS             337433..337555
                     /locus_tag="SeHA_C0326"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="ACF69444.1"
                     /translation="MDLPGIRYLPGQGWFWQQNSEGRYVDALRLVDEENRGQML"
     gene            337582..337968
                     /locus_tag="SeHA_C0327"
     CDS             337582..337968
                     /locus_tag="SeHA_C0327"
                     /codon_start=1
                     /transl_table=11
                     /product="putative periplasmic protein"
                     /protein_id="ACF66950.1"
                     /translation="MSACAGMFLPVFAWGETDVNIDNPLAECVDIHPVHRQEMDNLTI
                     LKTTVTLKKSTGECGCFSTLINYTSLLAQDVEGYGRGSAYSLQEGNISLAKMQGRYPF
                     SFVLSVDNQSVRDQKLALMIRCTPPL"
     gene            337995..338513
                     /locus_tag="SeHA_C0328"
     CDS             337995..338513
                     /locus_tag="SeHA_C0328"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="ACF66280.1"
                     /translation="MAVRLTFDGQKLTWPGIGIFKATTGLPDLQWPDKQCVPDAAIPE
                     GNYKLFIQFQGEAPIRNAADCDLGPSWGWSTIPRGQAAGTCEIYWANWGYNRIRLESA
                     DEKTRKACGGKRGGFYIHDSTKGYSHGCIEVEPVFFRILKQETEKENGEKTFTVNVKY
                     VSGQQTNGGTKQ"
     gene            338910..341141
                     /locus_tag="SeHA_C0329"
     CDS             338910..341141
                     /locus_tag="SeHA_C0329"
                     /note="identified by match to protein family HMM PF04524;
                     match to protein family HMM TIGR01646; match to protein
                     family HMM TIGR03361"
                     /codon_start=1
                     /transl_table=11
                     /product="Rhs-family protein"
                     /protein_id="ACF68646.1"
                     /translation="MSFVSTNNKSGIGGLTTTTPPITGESGGVTADSVAGSVADAAEA
                     AVEQAAGSLFGALPEPSGLVKAAVAAAQAAAAGMAQDAVSAIVSAVAGGPGAHNVTVS
                     GSAVPPGALLFASLDGGETLSELFSYVVQLKTPDTLNLGYVSPAANLPLKPMVGKDLC
                     VNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWLKLLTHTSDYKAFQNKSVV
                     DILDEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDS
                     HTLVLADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTK
                     PRSLLANTVANPRETGHATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGN
                     IRTLMTGYTFTLENYPTAEVNQEYLLMQTLLFVQDNAQHSGQDQHFTFSTRFELHPTR
                     EVFRPQRTVSKPHTKGPQSAIVTGPAGQEIWTDQYGRVKVQFGWDRYGKMDENSSCWI
                     RVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWGLPGAATQ
                     SGIYSHTIGGGPTNANALRFEDKPGSEEVWLHAEKDQRIEVNNNESHWVGNNRVKVID
                     QSEIATIGAVRDHKVQYDDTSLAGGNKTIQTVKELYLAAGDSITLSCGDTVLYMSSKG
                     EFYVTCKTFNITATDADGQINTIKGQLDLNMDKREPKVGTFGESEKTAMAAVIKETFP
                     PKE"
     gene            341201..341659
                     /locus_tag="SeHA_C0330"
     CDS             341201..341659
                     /locus_tag="SeHA_C0330"
                     /note="identified by match to protein family HMM PF08786"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF68015.1"
                     /translation="MTNYYINEAILSFSGNISQDSTLNMIRLSDPDAALIISRGKMQD
                     GDELASQVEQQMKKLEKQVKELRYTPAQVVRLGIDGKMEGLEIQSQFIRGNEHVYQYQ
                     AVFVLQSSRVMMALTYARSTALTEADRGRWADIKKNLRFRLDPENTATGQ"
     gene            341675..346381
                     /locus_tag="SeHA_C0331"
     CDS             341675..346381
                     /locus_tag="SeHA_C0331"
                     /note="identified by match to protein family HMM PF03527;
                     match to protein family HMM PF05488; match to protein
                     family HMM PF05593; match to protein family HMM TIGR01643"
                     /codon_start=1
                     /transl_table=11
                     /product="Rhs-family protein"
                     /protein_id="ACF69679.1"
                     /translation="MGEAFWAAREGDALLHTSFLADLVGSALEFAINAVIDFAALAVV
                     ALATGATVATLGCSAVLLVGTVVGATMLLSGAGEKISKACEDIANSLFPPKIEGYILT
                     GSGDTRINSKRAARAAATALSRHDVETLDAQAQAEAEEEKRRQDAKSMWDVAGEYLDA
                     VKGRAENMAKGVVSVVSRMGSAEGWASLGNDALAEAGDMLSDTGHFISEMWQPTVATA
                     YPGSDPKQDDKIDCHKHPSSFTQFMAQKLQALTDDPVGTVLGAMNTFDVLEAGFQAAS
                     ALIGSVSNLFKGDDEPPAAEYIAEGTRDVRINSQPAARSGVRCTCEAKVVDEPENGVH
                     VSGDVRIGGPLLVVRDIKSGKSQITLVTTIALTFMQPGRASAKSACFMMGLGINMMVQ
                     KAGSALNRPVNAATGAKYLAGDDDVDFSLPGHFPLEWQRTYSSRDERTEGMFGRGWSV
                     LYEVCLERTPDNPDENCMTYVSPMGRRIDLQAVEPGSGFYSPGEGLAVRRSEQGHWLI
                     SSDDGVYRLFEADPFSPQRRRLKMLGDRNSNCQHLTYDNHGRLVEISGDRQRPCIRLH
                     YELAAHPQRVTRIFRHYPEGEPELLRRYRYDEAGRLNGVVDNAGQYQREFAYDDNDCM
                     TMHREPGGERYYYSWAWFEGPDDAAWRVTGHHTDSGEQYRLDWNLAERSLCVTDSLGR
                     TRCHWWDAQGLVTAYRDEAGQMTTFRWSDEERLLLGMTDAQGGKWRYVYDRLGHLTET
                     HDPLGRVEQTQWHPVWHQPETEVDAAGAAWRYEYDERGNLQAVSDPLHQRTVYGYDRH
                     GQVVRITDARGGDKYLQWNEDGQLMRHTDCSGSQTAWFYDERTRLERVTDAESNSTRY
                     SYDGNGHLTEVMFADGRTERYQPDAAGRLVKYTSPAGQITRWQRDGQGRVRRQTDATG
                     RRTAYEYDAYGRLTTLTNENGESYRFRYDVLDRVTEQTDPGGSRRAYGYNALNAVTAV
                     IYGGERGGEIRHGLERDAAGRLTVKITPETRTEYRYDAADRLLEIRRRQHDAAEGGEP
                     EVIRFSYDSAGNLLSEETAQGVLQNRYDVQGNRTETQMPDGRTLRYLYYGSGHLQQIN
                     LGRDVISEFTRDHLHREVQRSQGRLDTRRMYDRTGRLTRKLTCKGMRGVVPETFIDRE
                     YAYSGQDELLKKRHSRQGVTDYFYDTTGRITACRNEAYLDSWQYDAAANLLDRRQGET
                     AQAGAGSVVPFNRITSYRGLHYRYDEYGRVVEKRGRNGTQHYRWDAEHRLTEVAVIRG
                     STVRRYGYVYDAPGRRVEKHELDAEGKPYNRTTFLWDGMRLAQECRLGRSSSLYIYSD
                     QGSHEPLARVDRAAPGEADEVLYYHTDVNGAPEEMTDGGGNIVWEAGYQVWGNLTHEK
                     ETRPVQQNLRFQGQYLDRETGLHYNLYRFYDPDIGKFISGDPISLRGGINLYAYAQNP
                     LSWIDPLGLTGEWVNPKDINFSQRTISPHDYAEIMRNGGWDWDRSPLRVIDIDGQLVS
                     YDNRRLDAALEAGLDKVKVIRIDPNAPHPDSSTGKTWLQKFRERFRDRRNIKAGGIVP
                     DKGLNSRPERTSRGCK"
     gene            346378..346812
                     /locus_tag="SeHA_C0332"
     CDS             346378..346812
                     /locus_tag="SeHA_C0332"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF68446.1"
                     /translation="MKNIIQLWEDNLLPIKDAIYFSNGRSFLCKIMDYPTLHIERNGE
                     FDFSAFYEKNKDEVTDIDKFREIKLANNCYCCVGEGSYGSEGFVAYLDENKNLVWVLY
                     SEESNPFINVSEYIPDIIIVESSSNIRLKININNPMDLELVV"
     gene            complement(346859..347122)
                     /locus_tag="SeHA_C0333"
     CDS             complement(346859..347122)
                     /locus_tag="SeHA_C0333"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF65952.1"
                     /translation="MNASGASVRHINSETCMTTCYSQIPSGDCQEEAGFETGASVVVK
                     ISERGLILIAETDEVRDLRKELYQVKKSMKHIKAGVNNVVNGN"
     gene            347184..347303
                     /locus_tag="SeHA_C0334"
     CDS             347184..347303
                     /locus_tag="SeHA_C0334"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF70072.1"
                     /translation="MSEYGRDILALSPPLPGQLRAVMSNRLPGPYFDDETGLH"
     gene            347793..348260
                     /locus_tag="SeHA_C0335"
     CDS             347793..348260
                     /locus_tag="SeHA_C0335"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF69552.1"
                     /translation="MANLIFGEPSLFSINISTDDRFASVSIFCASEEIGDSSEYVLLS
                     TFISLIKNKIDNYDYSLSNELFNLEKNDVFSYVVDGFEKAESWRESQRLESILITLNL
                     APCFDGETFILLSTDEYDRIIWKTFNSEIISEAFLPAGYVLKQFDLLFNNFSN"
     gene            complement(348325..348498)
                     /locus_tag="SeHA_C0336"
     CDS             complement(348325..348498)
                     /locus_tag="SeHA_C0336"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF66783.1"
                     /translation="MARLCGILTAEAGFKTGRGVTVKISQGCIVLMADCNEVQELREQ
                     LYQAKQGIKDVLV"
     gene            complement(348777..349154)
                     /locus_tag="SeHA_C0337"
                     /note="transposition helper protein, IS21 family; this
                     region contains one or more premature stops and/or
                     frameshifts; identified by match to protein family HMM
                     PF01695"
                     /pseudo
     gene            350370..351080
                     /locus_tag="SeHA_C0338"
     CDS             350370..351080
                     /locus_tag="SeHA_C0338"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fimbrial protein"
                     /protein_id="ACF70186.1"
                     /translation="MNFKDTLPGVFLCVAMFACGHARANMLVYPMAAEINSSREEATS
                     LFVYSKSDHVQYIRTRIMRIEHPGMPQEKEVPAGNDIETGLVVSPEKFALSPGTKKTI
                     RVITTQAPEREEAWRVYFEAVPELEDDPQAGGKQNSSVSVNLVWGVLLRVSPSDPRPA
                     LVTDGHHLLNTGNTRLSLIRAGNCDTTCHWQNIGKSIYPGGSADIPAGIKSNAFRVEY
                     RTGANSPVISADLTAAGK"
     gene            351131..351706
                     /locus_tag="SeHA_C0339"
     CDS             351131..351706
                     /locus_tag="SeHA_C0339"
                     /note="identified by match to protein family HMM PF04449"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fimbrial subunit"
                     /protein_id="ACF68075.1"
                     /translation="MYTECTYITVINNKARLFFMNMKTSFIAAAVALATVYSFSVSAV
                     QKDITVTANIDSTLELLQADGSSLPSTMKLDFMPGKGLVHKSLQTRLYSNDQTKSVNV
                     KLLNAPQLINVLDPTKTIDMEVTLGGRSLTTTNSVLEAKTLFPDGKTGDASALLNLDI
                     GQKAGAALQNLPAGEYSGLVSLVISQAVTAG"
     gene            351815..354502
                     /locus_tag="SeHA_C0340"
     CDS             351815..354502
                     /locus_tag="SeHA_C0340"
                     /codon_start=1
                     /transl_table=11
                     /product="TcfC protein"
                     /protein_id="ACF68869.1"
                     /translation="MSRYFWMYYLLGLCSFTSQATLIPPPGFESLLEGQTEQIEVLLP
                     GHSLGLFPVVVKPDTVQFMSPLMVLESSGLAALPVAERQKALAALSRPLLRNSNLVCG
                     VSEAKDSSECGYVATDKEDVAVIFDENNGQLSLFLNRDWLPDEERRDKRWLTPTPEGV
                     SAFIHRQTLYLSDDLHSRNMTLNGSGALGLGDGRYLGGNWAAIWNQSEHYNNSQAWFD
                     NLFVRQDLGNQYYLQAGRMDQRNLSSATGGDFGFSLLPLSRFDGLRTGTTQAYVNHEV
                     DQNATPVMVQVTRNARIDIYRGSELLGSQFLTPGMHTLDTHSLPPGSYPLALRVYEDG
                     ILRRTETQPFSKGGNSFSAQTQWFIQSGLEDTGDKASHYDGETVMAAGFRTGLRKNIS
                     LTEGISLAHEAWYSETRLNSQHAVLDGTLDLSAGILHGTDSTSGNTEQVTYNDGFSAS
                     LWRNHTESDACSGRHPQSVHASMTCQTSMNASLSVPVGNWYALLGYSTSRTEGRPVYR
                     GYDDNSDKENVFWRQAYIPASHRESAQASATYSLNMAGMNINTHGGVWRTRNDGVNDD
                     GLFMSVSVSYASQPPTMTGSNGYTSAGTDIHSSRNQKTQTSWNVNHVRSWQQDLYREL
                     SVGFSGYNDDSWSGSLGGRMSGRMGELSATISNSHQRNAGSASSLTAGYSSSLALSRN
                     GLFWGGGQDGEPASGMAVNVESEGDEGSSGKVVSVRGSSQPFSLGFGQQSLLLMEGYN
                     ATEVTIEDAGVSSQGMAGVKAGGGSRRYFLTPGHLLVHNISASMSRLYVGRVLDKDGR
                     PLLDAQPLNHPFLSLGPSGRFSLQSEHKESSLWLLSKNRILRCPMSVHKRRDVMQVVG
                     DVRCELSDVDALPQALQISPRVIRLLNVAGLLRHSVQEA"
     gene            354552..355604
                     /locus_tag="SeHA_C0341"
     CDS             354552..355604
                     /locus_tag="SeHA_C0341"
                     /note="identified by match to protein family HMM PF07434"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fimbrail protein"
                     /protein_id="ACF66730.1"
                     /translation="MTAYWSAIINFIRKYVYPARIIAILLMAGATLPQVADAITVDLN
                     YDKNNVPVITPVWSQEWSVANVLGGWVCRSNRNENEGACEETHLVWWYAFGAYSKIRL
                     RFREQISHAEITLILLGSVRNACYTGVVNMNAAACQWGRSLKLRIPSEELAKIPTSGT
                     WKATLVLDYLQWGGDDPLGTSTTDITLNVTDHFAENAAIYFPQFGTATPRVDLNLHRL
                     NASQMSGRANLDMCLYDGGVKARSLQMKIEGSNKSGTGFQVIKSDSADTIDYAVSMNY
                     GGRSIPVTRGVEFSLDNVDKAATRPVLLPGQRQAVRCVPVPLTLTTQPFNIREKRSGE
                     YQGTLTVTMLMGTQTP"
     gene            355737..356192
                     /locus_tag="SeHA_C0342"
     CDS             355737..356192
                     /locus_tag="SeHA_C0342"
                     /note="identified by match to protein family HMM PF01037"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ACF66366.1"
                     /translation="MTEYLDDKDKELLKEIQKDCAQTLWQLAYKVGLTPTPCFKRLKK
                     LKDRGVIIGQFALLDKEKLGLSLNVFIMINISEEQYASISEKIKSMPEVIAFYRISGS
                     FNYLMHTVFTDMNDYYSFYEKIILTNSSISGSASSFVLEQIKETNELPV"
     gene            complement(356236..356355)
                     /locus_tag="SeHA_C0344"
     CDS             complement(356236..356355)
                     /locus_tag="SeHA_C0344"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF66451.1"
                     /translation="MHGVIFNHVIFRCVILCRLISPLLIKILVQQPQSAVVVP"
     gene            356332..356949
                     /locus_tag="SeHA_C0343"
     CDS             356332..356949
                     /locus_tag="SeHA_C0343"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF66085.1"
                     /translation="MVKYHPVHVTKNRIKTDDVTDIYFVEPFWKEGENHIIESLMFFE
                     ELQKSFNLFNHKYGLNKYILRIPWEFVLIHMERISKLNSVGLFAVSVDFNNNHKFLSE
                     YIRSRRDYGMEVWFDFCGKHSYSSEIKNLGFFFQACVVPRDPNFISSVYHYHKFQKIL
                     VGDINDVEQRAVYQNEVDYMYGMQWPSSYDGFFFRDHKKNETWCI"
     gene            357327..357485
                     /locus_tag="SeHA_C0345"
     CDS             357327..357485
                     /locus_tag="SeHA_C0345"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF66588.1"
                     /translation="MNSKYFREVFFVSVVVILLFYLVLFAASAHAEGGFSSGGIGLFM
                     TGTREMLL"
     gene            357745..357915
                     /locus_tag="SeHA_C0346"
     CDS             357745..357915
                     /locus_tag="SeHA_C0346"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF67803.1"
                     /translation="MGSRKLSPYQKRCSVLKNGARLHLFNDFLKAQEYSLLISSIAPS
                     GTHRTSYFTDSV"
     gene            complement(357912..358631)
                     /locus_tag="SeHA_C0347"
     CDS             complement(357912..358631)
                     /locus_tag="SeHA_C0347"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF66101.1"
                     /translation="MKNFFAVCIIPLVVAWSATASAKEGIYITGKAGTSVVNVYGINS
                     TFSQDEIVNGHATLPDRTKGVFGGGVAIGYDFYDPFQLPVRLELDTTFRGETDAKGGQ
                     DIIAFGDPVHINVKNQVRMTTYMVNGYYDFHNSTAFTPYISAGVGLAHVKLSNNTIPV
                     GFGINETLSASKNNFAWGAGIGAKYAVTDNIMIDASYKYINAGKVSISKNHYAGDEHT
                     AYDADTKAASNDFMLGITYAF"
     gene            complement(358962..359369)
                     /locus_tag="SeHA_C0348"
     CDS             complement(358962..359369)
                     /locus_tag="SeHA_C0348"
                     /note="identified by match to protein family HMM PF07813"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic protein"
                     /protein_id="ACF67015.1"
                     /translation="MKNFVRTTLLAATLAGVSFGAFATAVPNPPLPAQDPIVQHLKLT
                     NDQITRIKKLHQQLETDVSQISMKGIKDGALIEVIKSGKWDDAAVKQQLAAFSNIEQQ
                     ARYYRVKYYFDLSKVLTPEQRQQVQQDLAQALE"
     gene            complement(359679..360446)
                     /locus_tag="SeHA_C0349"
     CDS             complement(359679..360446)
                     /locus_tag="SeHA_C0349"
                     /EC_number="3.5.-.-"
                     /note="identified by match to protein family HMM PF00795"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase YafV"
                     /protein_id="ACF69339.1"
                     /translation="MSGLKITLLQQPLVWMDGPANLRHFDRQLELVSGRDVIVLPEMF
                     TTGFAMEAANNSLSQDSVITWMQAKARQTDALIAGSAALQTERGAVNRFLLVEPEGKV
                     HLYDKRHLFRMADEHQHYAAGDKRIIVQWRGWRILPLICYDLRFPIWSRNRNDYDLAL
                     YVANWPAPRSLHWQTLLTARAIENQAYVAGCNRVGTDGNGLHYRGDSRIINPQGDIIA
                     TAEPHQATRIDADLSLVALQDYREKFPAWRDADPFTL"
     gene            complement(360555..362999)
                     /gene="fadE"
                     /locus_tag="SeHA_C0350"
                     /note="acyl-coenzyme A dehydrogenase; this gene contains a
                     frame shift which may be the result of sequencing error;
                     identified by match to protein family HMM PF00441; match
                     to protein family HMM PF09317"
                     /pseudo
     gene            363239..363817
                     /gene="gmhA"
                     /locus_tag="SeHA_C0351"
     CDS             363239..363817
                     /gene="gmhA"
                     /locus_tag="SeHA_C0351"
                     /EC_number="5.3.1.-"
                     /note="identified by match to protein family HMM
                     TIGR00441"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoheptose isomerase"
                     /protein_id="ACF70447.1"
                     /translation="MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAG
                     GKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHISCVSNDFGYDYIFS
                     RYVEAVGREGDVLLGISTSGNSGNVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEI
                     RVPHFGYADRIQEIHIKVIHILIQLIEKEMVK"
     gene            364030..364797
                     /locus_tag="SeHA_C0352"
     CDS             364030..364797
                     /locus_tag="SeHA_C0352"
                     /note="identified by match to protein family HMM PF00310"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase, class II"
                     /protein_id="ACF67526.1"
                     /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGK
                     GCRTFKDPQPSYHSPIAKLVQNYPIKSCSVIAHIRQANRGEVALENTHPFTRELWGRN
                     WTYAHNGQLNGYKSLETGNFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMTAVFKYIA
                     TLATVLREKGVFNMLLSDGRYVMAFCSTHLHWITRRAPFGVATLVDQDMEIDFSSQTT
                     PNDVVTVIATQPLTGNETWQKIMPGEWALFCLGERII"
     gene            complement(364768..365508)
                     /locus_tag="SeHA_C0353"
     CDS             complement(364768..365508)
                     /locus_tag="SeHA_C0353"
                     /note="identified by match to protein family HMM PF06104"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF69637.1"
                     /translation="MRKIAFFLAMLLMPCVSFAGLLSSSSPVTPVSKEYKQQLMGSPV
                     YIQIFKEERTLDLYVKMGEQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQRNQ
                     LKPDSRFYKAINIGFPNAYDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTA
                     ALVFGQPSVQVSIYPFRMTDANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPTVSIVD
                     GRYVVSKPLSHEVVQPQLASNYTLSEAK"
     gene            365758..366813
                     /locus_tag="SeHA_C0354"
     CDS             365758..366813
                     /locus_tag="SeHA_C0354"
                     /EC_number="2.7.7.7"
                     /note="identified by match to protein family HMM PF00817"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase IV"
                     /protein_id="ACF68013.1"
                     /translation="MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTA
                     NYPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSL
                     DEAWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNG
                     QYVITPADVPDFLKTLPLAKIPGVGKVSAAKLENIGLRTCGDIQQCDLAMLLKRFGKF
                     GRVLWERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAI
                     VKPDLLIARQGVKLKFNDFQQTTQEHVWPQLNKEDLITTARKTWDERRGERGVRLVGL
                     HVTLLDPQLERQLVLGL"
     gene            367032..368171
                     /locus_tag="SeHA_C0355"
     CDS             367032..368171
                     /locus_tag="SeHA_C0355"
                     /note="identified by match to protein family HMM PF01139;
                     match to protein family HMM TIGR03073"
                     /codon_start=1
                     /transl_table=11
                     /product="release factor H-coupled RctB family protein"
                     /protein_id="ACF67085.1"
                     /translation="MGNYIRPLSDVVFSIASDNLWIEDSAIQQLYTTAKLTGMKRVIG
                     MPDLHPGRGYPIGAAFFSRGRFYPALVGNDIGCGMALWQTDILGRKYNADKLEKRLAS
                     LTDVADAQWLEENVPVAMQHHSWRSALGSIGGGNHFAELQQVDRIVDADSFALSGLQK
                     AQLLLLVHSGSRGLGQAILRRHVEAFSHNGLPEDSDDARRYLAEHDDALAFARSNRAL
                     IARRILQQLRAEGEPRLDVAHNFVEPCTVAGEAGWLHRKGATPDGQGLVIIPGSRGDY
                     SWLVKPVVSEESLFSLAHGAGRKWMRTECKDRLSAKFTPRQLCRTGMGSRVICRDRQL
                     IYEEAPQAYKSIDSVVDCLADAGLITPVACLRPVLTLKTSGEKSA"
     gene            368168..368782
                     /locus_tag="SeHA_C0356"
     CDS             368168..368782
                     /locus_tag="SeHA_C0356"
                     /note="identified by match to protein family HMM PF00472;
                     match to protein family HMM TIGR03072"
                     /codon_start=1
                     /transl_table=11
                     /product="putative peptide chain release factor H"
                     /protein_id="ACF67608.1"
                     /translation="MILLQLSSAQGPDECCLAVKKALDCLTKEAAREKVSLTRLETEP
                     GRLPDTLRSALVSLDGEKAMAFSERWCGTLLWICTSPYRPHHGRKNWYVGIGRFSADE
                     HIQSDEIRFETLRSSGPGGQHVNKTDSAVRATHLVSGISVKVQSERSQHANKRLARLL
                     IAWRLEQQRQNECAALKSERRLFHHQIERGNPLRIFKGMAFTPQ"
     gene            complement(368937..370394)
                     /gene="pepD"
                     /locus_tag="SeHA_C0357"
     CDS             complement(368937..370394)
                     /gene="pepD"
                     /locus_tag="SeHA_C0357"
                     /note="identified by match to protein family HMM PF01546;
                     match to protein family HMM PF07687; match to protein
                     family HMM TIGR01893"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoacyl-histidine dipeptidase"
                     /protein_id="ACF66933.1"
                     /translation="MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEHIVSWAKEKG
                     LYVDRDQVGNILIRKPATAGMENRKPVVLQAHLDMVPQKNSDTVHDFTTDPIQPYIDG
                     EWVKARGTTLGADNGIGMASALAVLADDNVVHGPLEVLLTMTEEAGMDGAFGLQSGWL
                     QADILINTDSEEEGEIYMGCAGGIDFTSNLPLTREAVPAGFACFKLTLKGLKGGHSGG
                     EIHLGLGNANKLLARFLAGHAEELDLRLIDFNGGTLRNAIPREAFATLAVAADNVGAL
                     KTLVNAYQDILKNELAEKEKNLTLQLNEVASDKAALTAPSRDTFVRLLNATPNGVIRN
                     SDVAKGVVETSLNVGVVTMSDANVEIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEA
                     KGSYPGWQPDANSPVMHLVRETYQRLFNKTPNIQIIHAGLECGLFKKPYPDMDMVSIG
                     PTITGPHSPDEQVHIESVGHYWTLLTELLKAIPAK"
     gene            370643..371101
                     /gene="gpt"
                     /locus_tag="SeHA_C0358"
     CDS             370643..371101
                     /gene="gpt"
                     /locus_tag="SeHA_C0358"
                     /EC_number="2.4.2.22"
                     /note="identified by match to protein family HMM PF00156"
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine phosphoribosyltransferase"
                     /protein_id="ACF67330.1"
                     /translation="MSEKYVVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGA
                     LLARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIRE
                     MYPKAHFVTIFAKPAGRPLVDDYVIDIPQNTWIEQPWDMGVVFVPPISGR"
     gene            371190..372434
                     /locus_tag="SeHA_C0359"
     CDS             371190..372434
                     /locus_tag="SeHA_C0359"
                     /EC_number="3.1.-.-"
                     /note="identified by match to protein family HMM PF06500"
                     /codon_start=1
                     /transl_table=11
                     /product="esterase FrsA"
                     /protein_id="ACF70303.1"
                     /translation="MTQANLSETLFKPRFKHTETSTLVRRFNRGSQPPMQSALDGKNV
                     PHWYRMINRLMWIWRGVDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWA
                     KQAMDWQQKACQEQDAMRSGRYWLHASTLYNIAAYPHLKGDELAEQAQALANRAYEEA
                     AQRLPGSLREMEFAVPGGSPVTAFLHMPKGDGPFPTVLMCGGLDAMQTDYYTLYERYF
                     APRGIAMLTLDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGA
                     NVAVRLAYLEAPRLKAVACLGPVVHALLSDPQRQSTVPEMYLDVLASRLGMHDASDEA
                     LRVELNRYSLKVQGLLGRRCPTPMLSGFWKNDPFSPEEESRLITTSSSDGKLIEIPFN
                     PVYRNFDRALQEITDWINHRLC"
     gene            372492..372893
                     /locus_tag="SeHA_C0360"
     CDS             372492..372893
                     /locus_tag="SeHA_C0360"
                     /note="identified by match to protein family HMM PF07417"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma factor-binding protein crl"
                     /protein_id="ACF66013.1"
                     /translation="MTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNV
                     KPAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKEGNWTVVPINETEVVERLEYTLRE
                     FHEKLRDLLISMELALEPSDDFNDEPVKLSA"
     gene            complement(372944..373996)
                     /locus_tag="SeHA_C0361"
     CDS             complement(372944..373996)
                     /locus_tag="SeHA_C0361"
                     /note="identified by match to protein family HMM PF00267"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane pore protein E"
                     /protein_id="ACF68993.1"
                     /translation="MNKSTLAIVVSIIASASVHAAEVYNKNGNKLDVYGKVKAMHYMS
                     DYDSKDGDQSYVRFGFKGETQINDQLTGYGRWEAEFAGNKAESDSSQQKTRLAFAGLK
                     LKDIGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFD
                     IVDGLDLTLQYQGKNEDRDVKKQNGDGFGTSVSYDFGGSDFAVSGAYTLSDRTREQNL
                     QRRGTGDKAEAWATGVKYDANDIYIATFYSETRNMTPVSGGFANKTQNFEAVIQYQFD
                     FGLRPSLGYVLSKGKDIEGVGSEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNTL
                     GINDDDIVAIGLTYQF"
     gene            complement(374062..374214)
                     /locus_tag="SeHA_C0362"
     CDS             complement(374062..374214)
                     /locus_tag="SeHA_C0362"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF69363.1"
                     /translation="MPTTCTRSVKFCCAGSASVAAEFDHFITATIKHIFLKKFSLCHK
                     SFITER"
     gene            374279..375382
                     /gene="proB"
                     /locus_tag="SeHA_C0363"
     CDS             374279..375382
                     /gene="proB"
                     /locus_tag="SeHA_C0363"
                     /EC_number="2.7.2.11"
                     /note="identified by match to protein family HMM PF00696;
                     match to protein family HMM PF01472; match to protein
                     family HMM TIGR01027"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate 5-kinase"
                     /protein_id="ACF68760.1"
                     /translation="MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHR
                     IVIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQML
                     LTRADMEDRERFLNARDTLRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILA
                     GADKLLLLTDQQGLFTADPRSNPQAELIKDVYGVDDALRSIAGDSVSGLGTGGMSTKL
                     QAADVACRAGIDTIIASGSKPGVIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAG
                     EITVDEGATAAMLERGSSLLPKGIKSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDA
                     LRRIAGHHSQQIDAILGYEYGPVAVHRDDMITR"
     gene            375394..376644
                     /gene="proA"
                     /locus_tag="SeHA_C0364"
     CDS             375394..376644
                     /gene="proA"
                     /locus_tag="SeHA_C0364"
                     /EC_number="1.2.1.41"
                     /note="identified by match to protein family HMM
                     TIGR00407"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-5-semialdehyde dehydrogenase"
                     /protein_id="ACF69594.1"
                     /translation="MLEQMGIAAKAASYKLALLSSGEKNRVLEKIADELEAQMESILS
                     ANVQDVEQARANGLSEAMLDRLALTPARLKAIADDVRQVCNLADPVGQVIDGGLLDSG
                     LRLERRRVPLGVVGVIYEARPNVTVDVASLCLKTGNAVILRGGKETHRTNAATVRVIQ
                     KALKACGLPEAAVQAIDNPDRSLVNEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVI
                     TGGIGVCHIFVDSSADIAPALKIIVNAKTQRPSTCNTVETLLVHQDIAERFLPALSKQ
                     MAESGVTLHGDETVMQALHGPAKLVPLKPEELDNEFLSLDLNVVVVENMDGAIAHIRE
                     HGTQHSDAILTCDMHNAARFVNEVDSAAVYVNASTRFTDGGQFGLGAEVAVSTQKLHA
                     RGPMGLEALTTYKWIGFGDGTIRA"
     gene            376760..376835
                     /locus_tag="SeHA_C0365"
     tRNA            376760..376835
                     /locus_tag="SeHA_C0365"
                     /product="tRNA-Thr"
     gene            complement(376850..378013)
                     /locus_tag="SeHA_C0366"
     CDS             complement(376850..378013)
                     /locus_tag="SeHA_C0366"
                     /note="identified by match to protein family HMM PF00589"
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific recombinase, phage integrase
                     family"
                     /protein_id="ACF68935.1"
                     /translation="MSLFRRGETWYASFTLPNGKRFKQSLGTKDKRQATELHDKLKAE
                     AWRVSKLGETPDMTFEGACVRWLEEKAHKKSLDDDKSRIGFWLQHFAGMQLKDITETK
                     IYSAIQKITNRRHEENWKLMDEACRKNGKQPPVFKPKPAAVATKATHLSFIKALLRAA
                     EREWKMLDKAPIIKVPQPKNKRIRWLEPHEAKRLIDECQEPLKSVVEFALSTGLRRSN
                     IINLEWQQIDMQRKVAWIHPEQSKSNHAIGVALNDTACRVLKKQIGNHHKWVFVYKES
                     STKPDGTKSPVVRKMRYDANTAWRAALKRAGIEDFRFHDLRHTWASWLVQAGVPISVL
                     QEMGGWESIEMVRRYAHLAPNHLTEHARQIDSIFGTSVPNMSHSKNKEGTNNT"
     gene            complement(378243..378545)
                     /locus_tag="SeHA_C0367"
     CDS             complement(378243..378545)
                     /locus_tag="SeHA_C0367"
                     /codon_start=1
                     /transl_table=11
                     /product="EaC"
                     /protein_id="ACF68438.1"
                     /translation="MHNANAKLKSLPEWNYYITNHYGIMRTGIGGQSGRGFGFVMLST
                     YGGKHPQRDDCLIFAIPNNKEERHGVVVIPDAFKKITYGQFYDIANAKEDEEETAE"
     gene            complement(379255..379941)
                     /locus_tag="SeHA_C0368"
     CDS             complement(379255..379941)
                     /locus_tag="SeHA_C0368"
                     /note="identified by match to protein family HMM PF04447;
                     match to protein family HMM PF04448"
                     /codon_start=1
                     /transl_table=11
                     /product="Eaa protein"
                     /protein_id="ACF69991.1"
                     /translation="MTTITKERIELFIKNPLENGLTRGEQMELARIALASLKREQIRH
                     EHAKWSDSTFGCVGPIGPLKHLSKEALEAAAEPDDLSEWADMQFLLWDAQRRAGISDA
                     EITAAMEDKLKINMERQWPEPKDGEPRLHIKEPGNSPVITDGWISCSERMPVIGELNW
                     RTSFPLLVTCEIGVMPAYYGFVSVNGDRHYGFMESLKYGDDSGNHPQTNEYGLISNVT
                     HWMPLPEPPL"
     gene            complement(379952..380215)
                     /locus_tag="SeHA_C0369"
     CDS             complement(379952..380215)
                     /locus_tag="SeHA_C0369"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF69452.1"
                     /translation="MATLTKKEQAWLSELQNVLDRCPSPKKIGFYTIGDKSIYLYDLR
                     RMDEIMEALDNRSSMDWCVAVHDMNAGFEEKILFPSSVESTAG"
     gene            complement(380217..380702)
                     /locus_tag="SeHA_C0370"
     CDS             complement(380217..380702)
                     /locus_tag="SeHA_C0370"
                     /note="identified by match to protein family HMM PF04447"
                     /codon_start=1
                     /transl_table=11
                     /product="protein ea22"
                     /protein_id="ACF67333.1"
                     /translation="MSEINYQALREVAERAIPAMERLLMLPADDDLLSEQELKDYGVD
                     IDALNAFKFLTGPETVLALLDERERNRQYIKSRDQENEDIALTVGKLRVELEAEKQRA
                     KDLFMENARLKSGIAGLIHLGIRYADVEVMRIAGDAQLSTPCTDSIINSIATGIRIKG
                     E"
     gene            complement(380699..381316)
                     /locus_tag="SeHA_C0371"
     CDS             complement(380699..381316)
                     /locus_tag="SeHA_C0371"
                     /codon_start=1
                     /transl_table=11
                     /product="Gp37"
                     /protein_id="ACF66993.1"
                     /translation="MSLIEMDGFLKGKCIPRDLKVNETNAEYLVRKFGELESKLETAL
                     RECRSAGITIDNLEAKCTALAAENAGMKSVIEYCINPDNQPEYHDQGMGCGVEDHGYQ
                     RDGYSACYYGWESAMERVYSEVIPDAIPETPATDAFLAEVRAQGVDAAIEAAKNLVAQ
                     EYEYKDFKAAQSDCCMYPGSDLVGKVEMTEWLVDFAAQLRKGGNQ"
     gene            complement(381497..381793)
                     /locus_tag="SeHA_C0372"
     CDS             complement(381497..381793)
                     /locus_tag="SeHA_C0372"
                     /codon_start=1
                     /transl_table=11
                     /product="anti-RecBCD protein 2"
                     /protein_id="ACF68335.1"
                     /translation="MPAPLYGADDPRRCSGNSVSEVLENIKNNIDAFLALPPETKAER
                     KYRRDIQLAEKQEKDRINETAIRPFRKATYTHFPEYIDPRLRNYRSRYGAISND"
     gene            complement(382124..382741)
                     /locus_tag="SeHA_C0373"
     CDS             complement(382124..382741)
                     /locus_tag="SeHA_C0373"
                     /note="identified by match to protein family HMM PF04404"
                     /codon_start=1
                     /transl_table=11
                     /product="essential recombination function protein"
                     /protein_id="ACF68018.1"
                     /translation="MSKEFYARLAEIQEHLNAPKNQYNSFGKYKYRSCEDILEGVKPL
                     LKGLFLSISDEIVLIGDRYYVKATATITDGENSHSASAIAREEENKKGMDAAQVTGAT
                     SSYARKYCLNGLFGIDDAKDADTEEHKQQQNAAPAKQTKSSPSSPAPEQVLKAFSEYA
                     ATETDKKKLIERYQHDWQLLTGHDDEQTKCVQVMNIRINELKQVA"
     gene            complement(382738..382881)
                     /locus_tag="SeHA_C0374"
     CDS             complement(382738..382881)
                     /locus_tag="SeHA_C0374"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF68431.1"
                     /translation="MQHEFSDEEFIALISPEIEEEVEQQINLAAERQNPIIGWDEFAG
                     YYS"
     gene            complement(382871..383059)
                     /locus_tag="SeHA_C0375"
     CDS             complement(382871..383059)
                     /locus_tag="SeHA_C0375"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF67967.1"
                     /translation="MTIVPVNGTILVQQGNREFNKLYEASFPDTKEGNSAAYAWASSI
                     AMGWEDCQDEDWNRNHAA"
     gene            complement(383040..383168)
                     /locus_tag="SeHA_C0376"
     CDS             complement(383040..383168)
                     /locus_tag="SeHA_C0376"
                     /note="identified by match to protein family HMM PF02061"
                     /codon_start=1
                     /transl_table=11
                     /product="lambda phage ciii"
                     /protein_id="ACF68127.1"
                     /translation="MGVSQLHESLLDRITRKLRAGWKRLADILNQPGVPSHDYCAC"
     gene            complement(383284..383511)
                     /locus_tag="SeHA_C0377"
     CDS             complement(383284..383511)
                     /locus_tag="SeHA_C0377"
                     /codon_start=1
                     /transl_table=11
                     /product="superinfection exclusion protein"
                     /protein_id="ACF67245.1"
                     /translation="MMDALADYDAFQYDNNIKPDYCNANGLQMFDESLTDQDLEDMEL
                     DDRWIDWYSECQCYDDPREYLESLKEETTAA"
     gene            complement(383602..383677)
                     /locus_tag="SeHA_C0378"
     ncRNA           complement(383602..383677)
                     /ncRNA_class="other"
                     /locus_tag="SeHA_C0378"
                     /product="suhB"
     gene            complement(383946..384182)
                     /locus_tag="SeHA_C0379"
     CDS             complement(383946..384182)
                     /locus_tag="SeHA_C0379"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF68776.1"
                     /translation="MKDIPHWDVDEDYIVDVTEGHILFSAENANKQEIKLASAAPELL
                     EALLSIIDMEHDVSEWDAVYATARAAIGKALGKE"
     gene            complement(384219..384371)
                     /locus_tag="SeHA_C0380"
     CDS             complement(384219..384371)
                     /locus_tag="SeHA_C0380"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF69089.1"
                     /translation="MKCKGCKLDAECMVKPEEMALVREDGKIVDKWAIRTTEMIAREL
                     EKLKAI"
     gene            384655..385206
                     /locus_tag="SeHA_C0381"
     CDS             384655..385206
                     /locus_tag="SeHA_C0381"
                     /codon_start=1
                     /transl_table=11
                     /product="superinfection exclusion protein B"
                     /protein_id="ACF68586.1"
                     /translation="MRFFLQGMTLKQLIHMLIILIVLIIVMPVSVKEWINLHNPEILP
                     HYWMYYILLFCVSYVLNGVVNSVYHAVTERIEASTAQRRKDREEKVVRDLFDSLTLGE
                     RAYLAFAVAANNQLKTEKGSPEAISLLKKGIITRLPSAIGYPDIDRFIIPEKYFNECY
                     MRFAGKSDILMNELIVQDEQLKK"
     gene            complement(385883..386533)
                     /gene="c2"
                     /locus_tag="SeHA_C0382"
     CDS             complement(385883..386533)
                     /gene="c2"
                     /locus_tag="SeHA_C0382"
                     /note="identified by match to protein family HMM PF00717"
                     /codon_start=1
                     /transl_table=11
                     /product="P22 repressor protein c2"
                     /protein_id="ACF70392.1"
                     /translation="MNTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETE
                     PNGENLLALSKALQCSPDYLLKGDLSQTNVAYHSRHEPRGSYPLISWVSAGQWMEAVE
                     PYHKRAIENWHDTTVDCSEDSFWLDVQGDSMTAPAGLSIPEGMIILVDPEVEPRNGKL
                     VVAKLEGENEATFKKLVMDAGRKFLKPLNPQYPMIEINGNCKIIGVVVDAKLANLP"
     gene            386906..387184
                     /locus_tag="SeHA_C0383"
     CDS             386906..387184
                     /locus_tag="SeHA_C0383"
                     /note="identified by match to protein family HMM PF05269"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator protein C1"
                     /protein_id="ACF69864.1"
                     /translation="MELTSTRKKANAITSSILNRIAIRGQRKVADALGINESQISRWK
                     GDFIPKMGMLLAVLEWGVEDEELAELAKKVAHLLTKEKPQDCGNSFEA"
     gene            387358..388173
                     /locus_tag="SeHA_C0384"
     CDS             387358..388173
                     /locus_tag="SeHA_C0384"
                     /note="identified by match to protein family HMM PF04492;
                     match to protein family HMM TIGR01610"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication protein gp18"
                     /protein_id="ACF66463.1"
                     /translation="MSNLATVTPIKPHLEVVEHRVAELDDGYTRTANTLLEAVMLSGL
                     TQHQLLIVMAVWRKTYGYNKKIDWIGNEQFAELTGMAPTKCSTAKNELIRMGVLTQVG
                     RQVGMNKNISEWKTKVNGFGKTFTRSVKLTFTKSVKTNLPNQSNTKDNIQKTINTNTP
                     LPPKGGCDEGSKPEKRKPTKINYSEYLAAYNEIVGDRLPHAVEVNSERQRKLKKLIDS
                     LATKNIDGFRAYVKAFMAAARPFHFGDNDRDWVANFDYLLRPKVLIAIREGTL"
     gene            388170..389546
                     /locus_tag="SeHA_C0385"
     CDS             388170..389546
                     /locus_tag="SeHA_C0385"
                     /EC_number="3.6.1.-"
                     /note="identified by match to protein family HMM PF00772;
                     match to protein family HMM PF03796"
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="ACF65964.1"
                     /translation="MRQDIEASVIGGLLIGGLTPTASDVLATLEPEAFSIPLYRKAFE
                     VIRKQARNRNLIDGLMVAEECGDEYATAVMMTARSCPSAANLKGYAGMVADSYQRRQV
                     LQLLDEMREPISNGTLDASGRAMDELVKRLSSIRKPRNEVKPVRLGEIINDYTDTLDR
                     RLRNGEESDTLKTGIEELDAITGGMNAEDLVIIAARPGMGKTELALKIAEGVASRVIP
                     GSGVRRGVLIFSMEMSAIQVVERGIAGAGMMSVSVLRNPSRMDDEGWARVASGMKLLA
                     ELDVWVVDASRLSVEEIRSISERHKQEHPNLSLIMADYLGLIEKPKAERNDLAIAHIS
                     GSLKAMAKDLKTPVISLSQLSRDVEKRPNKRPTNADLRDSGSIEQDADSIIMLYREAV
                     YDENSSAAPFAEIIVTKNRFGSLGTVYQRFCNGHFVACDQDEARQICTASNAPAGRRK
                     RYAQGADV"
     gene            390373..390705
                     /locus_tag="SeHA_C0386"
     CDS             390373..390705
                     /locus_tag="SeHA_C0386"
                     /codon_start=1
                     /transl_table=11
                     /product="NinX"
                     /protein_id="ACF66858.1"
                     /translation="MDYSQLSDFEINKRVAIATGHKKFNGLGWQGTQEDSCSAVIVRG
                     PTKIGAFDPCNNPADAWPIIEKYRISFLDQLTEWCVDAKGVSPIFDIRPLRAAMIVFL
                     LMQDANNA"
     gene            390698..390874
                     /locus_tag="SeHA_C0387"
     CDS             390698..390874
                     /locus_tag="SeHA_C0387"
                     /note="identified by match to protein family HMM PF05810"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF69967.1"
                     /translation="MLSPSQSLQYQKESVERALTCANCGQKLHVLEVHVCEACCAELM
                     SDPNSSMYEEEDDG"
     gene            391326..391478
                     /locus_tag="SeHA_C0388"
     CDS             391326..391478
                     /locus_tag="SeHA_C0388"
                     /codon_start=1
                     /transl_table=11
                     /product="gp69"
                     /protein_id="ACF68883.1"
                     /translation="MLIERIGIAAVDEIESDHKRHRWTTEECKAIKAEYQQKLKDLRD
                     SRSEAA"
     gene            391475..391699
                     /locus_tag="SeHA_C0389"
     CDS             391475..391699
                     /locus_tag="SeHA_C0389"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF67058.1"
                     /translation="MSKIQYPMTTAAIFDDVVYPLHFDNAGKVRQEMEGAVNWFCRWC
                     NEEKAAVKARLLVSCWGQYLSHEQVIREAA"
     gene            391696..391899
                     /locus_tag="SeHA_C0390"
     CDS             391696..391899
                     /locus_tag="SeHA_C0390"
                     /note="identified by match to protein family HMM PF06322"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF67929.1"
                     /translation="MTHTVKTIPDMLIETYGNQTEVARRLSCHRNTVRRYLYDKEARY
                     HAIVNGVLMIHQGGRGIYDRNQH"
     gene            391880..392059
                     /locus_tag="SeHA_C0391"
     CDS             391880..392059
                     /locus_tag="SeHA_C0391"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF66009.1"
                     /translation="MTVTSINQAKHQRERDEAELRSVREMTEQHQKAMDYLHEREREL
                     VNRIGLNKPAGDDAA"
     gene            392518..392679
                     /locus_tag="SeHA_C0392"
     CDS             392518..392679
                     /locus_tag="SeHA_C0392"
                     /codon_start=1
                     /transl_table=11
                     /product="antitermination protein Q"
                     /protein_id="ACF69725.1"
                     /translation="MPASAAYRAITMLIPNLTQPTWSRTVKPLYDALVVQCHKEESIA
                     DNILNAVTR"
     gene            393178..393321
                     /locus_tag="SeHA_C0393"
     CDS             393178..393321
                     /locus_tag="SeHA_C0393"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF70263.1"
                     /translation="MGGILSLNDWAVIIGILCTVGTFGINWYYKRKEREDRLNGNVTG
                     TTK"
     gene            393293..393796
                     /locus_tag="SeHA_C0394"
     CDS             393293..393796
                     /locus_tag="SeHA_C0394"
                     /EC_number="3.2.1.17"
                     /note="identified by match to protein family HMM PF00959"
                     /codon_start=1
                     /transl_table=11
                     /product="phage lysozyme"
                     /protein_id="ACF68708.1"
                     /translation="MAMSPALRNSVIAAISGGAIAIASVLITGPGGNDGLEGVRYKPY
                     KDVVGVLTVCYGHTGKDIMPGKTYTEAECKALLNKDLATVARQINPYIKVDIPETTRG
                     AIYSFVYNVGAGNFRTSTLLRKINQVDIKGACDQLRRWTYAGGKQWKGLMTRREIERE
                     VCLWGQQ"
     gene            393885..394322
                     /locus_tag="SeHA_C0395"
     CDS             393885..394322
                     /locus_tag="SeHA_C0395"
                     /note="identified by match to protein family HMM PF03245"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriophage lysis protein"
                     /protein_id="ACF69257.1"
                     /translation="MSRLTAIISALVICIIVCLSWAVNHYRDNAIAYKDQRDKATSII
                     ADMQKRQRDVAELDARYTKELADANATIESLRADVSAGRKRLQVSATCPKSTTGASGM
                     GDGESPRLTADAELNYYRLRSGIDKITAQVNYLQDYIRTQCLK"
     gene            394535..395221
                     /locus_tag="SeHA_C0396"
     CDS             394535..395221
                     /locus_tag="SeHA_C0396"
                     /codon_start=1
                     /transl_table=11
                     /product="gp79"
                     /protein_id="ACF69744.1"
                     /translation="MQLVEIKKLDLVTNSAVIATGVKKDHKPVIQLIRKYKSDLEEFG
                     RVEFEMRPFQTDGGMQKQEIALLNEQQTTLLITYMRNNEVVREFKKRLVAEFFTMRSA
                     LAKKKMDRNSARLEYKPMTDAIKHEREAQGKQIAPHHFSNEADLINRLALGMTAAKFR
                     VHHEIGKKEPIRDYLTPEQIHCITELQRANTVFISMGWDFEQRKEVLSGMFERNHRQP
                     LIEEQHRLAA"
     gene            395524..395766
                     /locus_tag="SeHA_C0397"
     CDS             395524..395766
                     /locus_tag="SeHA_C0397"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF68653.1"
                     /translation="MAEIIPMTEEQKFQLEIYKLVMNQNAAAEEAFQFIGTDELKLEL
                     FKIHFQSGGANSDITIRTFEAVRKSKEALDLFTTGA"
     gene            395768..395947
                     /locus_tag="SeHA_C0398"
     CDS             395768..395947
                     /locus_tag="SeHA_C0398"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF69299.1"
                     /translation="MSCVINLGKEKKFPITQELYERLESVIHYYDGEISLCEAVGTLE
                     LLKQLLIEGAKEQST"
     gene            396169..396459
                     /locus_tag="SeHA_C0399"
     CDS             396169..396459
                     /locus_tag="SeHA_C0399"
                     /codon_start=1
                     /transl_table=11
                     /product="packaging protein gp3"
                     /protein_id="ACF69669.1"
                     /translation="MTITGLTLFLDVTLETWRTYRMREDLSEVVTRAEQIIYDQKFSG
                     AAADLLNANIIARDLGLKEQSQVEDVTPDKGDRDKRRSRIKELFNRGTGRDS"
     gene            396437..397936
                     /locus_tag="SeHA_C0400"
     CDS             396437..397936
                     /locus_tag="SeHA_C0400"
                     /note="identified by match to protein family HMM PF03237"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA packaging protein gp2"
                     /protein_id="ACF70340.1"
                     /translation="MELDAILDNLSDEEQIELLELLEEEENYRNTHLLYEFTPYSKQR
                     EFIDAGHDYPERCFMAGNQLGKSFTGAAEVAFHLTGRYPGTKGYPADGKYGGEWKGKR
                     FYEPVVFWIGGETNETVTKTTQRILCGRIEENDEPGYGSIPKEDIISWKKSPFFPNLV
                     DHLLVKHHTADGVEDGISICYFKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRT
                     NKYGQFSILTFTPLMGMSDVVTKFLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYP
                     EHEREARARGIPTMGSGRIFQIPEETIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLW
                     WDKDADVFYLARVWKKSENTAVQAWGAVKSWANKIPVAWPHDGHQHEKGGGEQLKTQY
                     ADAGFSMLPDHATFPDGGNSVESGISELRDLMLEGRFKVFNTCEPFFEEFRLYHRDEN
                     GKIVKTNDDVLDATRYGYMMRRFARMMRDIRKPKEKKIPAPIRPVRRGR"
     gene            397936..400113
                     /locus_tag="SeHA_C0401"
     CDS             397936..400113
                     /locus_tag="SeHA_C0401"
                     /codon_start=1
                     /transl_table=11
                     /product="portal protein"
                     /protein_id="ACF66602.1"
                     /translation="MADNENRLESILSRFDADWTASDEARREAKNDLFFSRVSQWDDW
                     LSQYTTLQYRGQFDVVRPVVRKLVSEMRQNPIDVLYRPKDGASPDAADVLMGMYRTDM
                     RHNTAKIAVNVAVREQIESGVGAWRLVTDYEDQSPTSNNQVIRREPIHSACSHVIWDS
                     NSKLMDKSDARHCTVIHSMSQNGWEDFAEKYDLDADDIPSFQNPNDWVFPWLTQDTIQ
                     IAEFYEVVEKKETAFIYQDPVTGEPVSYFKRDIKDVIDDLADSGFIKIAERQIKRRRV
                     YKSIITCTAVLKDKQLIAGEHIPIVPVFGEWGFVEDKEVYEGVVRLTKDGQRLRNMIM
                     SFNADIVARTPKKKPFFWPEQIAGFEHMYDGNDDYPYYLLNRTDENSGDLPTQPLAYY
                     ENPEVPQANAYMLEAATSAVKEVATLGVDTEAVNGGQVAFDTVNQLNMRADLETYVFQ
                     DNLATAMRRDGEIYQSIVNDIYDVPRNVTITLGDGSEKDVQLMAEVVDLATGEKQVLN
                     DIRGRYECYTDVGPSFQSMKQQNRAEILELLGKTPQGTPEYQLLLLQYFTLLDGKGVE
                     MMRDYANKQLIQMGVKKPETPEEQQWLVEAQQAKQGQQDPAMVQAQGVLLQGQAELAK
                     AQNQTLSLQIDAAKVEAQNQLNAARIAEIFNNMDLSKQSEFREFLKTVASFQQDRSED
                     ARANAELLLKGDEQTHKQRMDIANILQSQRQNQPSGSVAETPQ"
     gene            400127..401038
                     /locus_tag="SeHA_C0402"
     CDS             400127..401038
                     /locus_tag="SeHA_C0402"
                     /note="identified by match to protein family HMM PF09306"
                     /codon_start=1
                     /transl_table=11
                     /product="scaffolding protein"
                     /protein_id="ACF67256.1"
                     /translation="MEPTTEIQATEDLTLSGDHAAASADSLVVDNANDNAGQEEGFEI
                     VLKDDETAPKQDPAKNAEFARRRIERKRQRELEQQMEAVKRGELPESLRVNPDLPPQP
                     DINAYLSEEGLAKYDYDNSRALAAFNAANTEWLMKAQDARSNAVAEQGRKTQEFTQQS
                     AQYVEAARKHYDAAEKLNIPDYQEKEDAFMQLVPPAVGADIMRLFPEKSAALMYHLGA
                     NPEKARQLLAMDGQSALIELTRLSERLTLKPRGKQISSAPPADQPITGDVSAANKDAI
                     RKQMDAAASKGDVETYRKLKAKLKGIR"
     gene            401038..402330
                     /locus_tag="SeHA_C0403"
     CDS             401038..402330
                     /locus_tag="SeHA_C0403"
                     /codon_start=1
                     /transl_table=11
                     /product="coat protein"
                     /protein_id="ACF67708.1"
                     /translation="MALNEGQIVTLAVDEIIETISAITPMAQKAKKYTPPAASMQRSS
                     NTIWMPVEQESPTQEGWDLTDKATGLLELNVAVNMGEPDNDFFQLRADDLRDETAYRR
                     RIQSAARKLANNVELKVANMAAEMGSLVITSPDAIGTNTADAWNFVADAEEIMFSREL
                     NRDMGTSYFFNPQDYKKAGYDLTKRDIFGRIPEEAYRDGTIQRQVAGFDDVLRSPKLP
                     VLTKSTATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFA
                     GVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSLSPEQRAYANVNTSL
                     ADAMAVNILNVKDARTNVFWADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIF
                     ATQGDISTLSGLCRIALWYGVNATRPEAIGVGLPGQTA"
     gene            402369..402578
                     /locus_tag="SeHA_C0404"
     CDS             402369..402578
                     /locus_tag="SeHA_C0404"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF68267.1"
                     /translation="MKIAIYKPGGSIMVWGVMAQMKVIDSSELPEYVKDGWLDHPSKL
                     LPVEADDVKPRKGRKPKAVSDADKD"
     gene            402562..403062
                     /locus_tag="SeHA_C0405"
     CDS             402562..403062
                     /locus_tag="SeHA_C0405"
                     /codon_start=1
                     /transl_table=11
                     /product="packaged DNA stabilization protein gp4"
                     /protein_id="ACF69303.1"
                     /translation="MQIKTKGDLVRAALRKLGVASDATLTDVEPQSMQDAVDDLEAMM
                     AEWYQDGKGIITGYVFSDDDNPPAEGDDHGLRSSAVSAVFHNLACRIAPDYALEATAK
                     IIATAKYGKELLYKQTAISRAKRAPYPSRMPTGSGNSFANLNEWHYFPGEQNADSTTP
                     HDEGNG"
     gene            403022..404440
                     /locus_tag="SeHA_C0406"
     CDS             403022..404440
                     /locus_tag="SeHA_C0406"
                     /codon_start=1
                     /transl_table=11
                     /product="packaged DNA stabilization protein gp10"
                     /protein_id="ACF67048.1"
                     /translation="MPIQQLPMMKGMGKDFKNADYIDYLPVNMLATPKEILNSSGYLR
                     SFPGITKRYDMNGVSRGVEYNTAQNAVYRVCGGKLYKGESEVGDVAGSGRVSMAHGRT
                     SQAVGVNGQLVEYRYDGTVKTVSNWPADSGFTQYELGSVRDITRLRGRYAWSKDGTDS
                     WFITDLEDESHPDRYSAQYRAESQPDGIIGIGTWRDFIVCFGSSTIEYFSLTGATTAG
                     AALYVAQPSLMVQKGIAGTYCKTPFADSYAFISHPATGAPSVYIIGSGQASPIATASI
                     EKIIRSYTAEEMATGVMETLRFDSHELLIIHLPRHVLVYDASSSQNGPQWCVLKTGLY
                     DDVYRGVDFMYEGNQITCGDKSEAVVGQLQFDISSQYDKQQEHLLFTPLFKADNARCF
                     DLEVESSTGVAQYADRLFLSATTDGINYGREQMIEQNEPFVYDKRVLWKRVGRIRRLI
                     GFKLRVITKSPVTLSGCQIRLE"
     gene            404444..405145
                     /locus_tag="SeHA_C0407"
     CDS             404444..405145
                     /locus_tag="SeHA_C0407"
                     /codon_start=1
                     /transl_table=11
                     /product="head completion protein"
                     /protein_id="ACF67786.1"
                     /translation="MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGA
                     IAGKANEAGQGAYDAQVKNDEQDVELADHEARIKQLRIDVDDHESRITANTKAITALN
                     VRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADYVSKTATTSQSLASPLNVTTS
                     YSVGGKKVVGARQTGWTAATGTANKGVFDADLTFAVSDTYTQSEIQAIANALITERRR
                     TKALEDALRAHGLID"
     gene            405187..405600
                     /locus_tag="SeHA_C0408"
     CDS             405187..405600
                     /locus_tag="SeHA_C0408"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF67033.1"
                     /translation="MVGNHPDIIAGSNNGDGYDYKPECRYFEVNVHGQFGGIVYYNEI
                     QPMTFDCHAMYLPEIRGFSKEIGLAFWRYILTNTTVQCVTSFAARKFRHGQMYCAMIG
                     LKRVGTIKKYFKGVDDVTFYAATREELTELLNNGR"
     gene            405603..406295
                     /locus_tag="SeHA_C0409"
     CDS             405603..406295
                     /locus_tag="SeHA_C0409"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA transfer protein gp7"
                     /protein_id="ACF67528.1"
                     /translation="MLYAFTLGRKLRGEEPSYPEKGGKGGSSDKSAKYAAEAQKYAAD
                     LQNQQWQTIMKNLAPFTPLAEQYVNQLQNLSSLEGQGQALNQYYNSQQYKDLAGQARY
                     QSLAAAEATGGLGSTATSNQLATIAPTLGQSWLSNQMSNYNNLANVGLGALQGQANAG
                     QTYANNMSSIAQQSAALAAANANKPSSLQTAISGGTSGAIAGAGLASLLGTSTPWGAG
                     IGAGIGLLGSLF"
     gene            406335..407600
                     /locus_tag="SeHA_C0410"
     CDS             406335..407600
                     /locus_tag="SeHA_C0410"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF66855.1"
                     /translation="MLAGIGGVNSNAPSVNDIGNTLQLIRQNNDIERSGANNVGLTAL
                     QGLSGIAGVFQQEKQAQRQKEFQQAYANAYASGDRGALRQLATQYPDQIESVRKGMGF
                     IDEDQRNSIGTLAAGARLASSSPEAMQSWLQNNAKELTRVGVDPNNVVQMYQQNPSGF
                     GEFVDHLGMAALGPIDYFNVQDKMAGREIDRGRLAETIRSNQAGEALQQRGQDITVRG
                     QNISAQNAALSREIQRAELQDKVLDRQIARETNQIKLDELKQKQADVRQKAEIAKADR
                     QASAQGAVDTFSTALDSLNEIEQSPGLSKAVGIRSAFPTVPGSDAANFEARLDTFKAQ
                     TFLPMVQSLKGMGALSDAEGKKLSDAVGALSPKMSEKAFRDSIGKIRNQLESKLSTVK
                     KQFDYQEPVQNAPVQQSPAGSNFSSLWGD"
     gene            407600..409597
                     /locus_tag="SeHA_C0411"
     CDS             407600..409597
                     /locus_tag="SeHA_C0411"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF66135.1"
                     /translation="MAKAWKDVIASPQYQALAPEQKAQAQEQYFNEVVAPQAGENAEQ
                     AKQAFYAAYPLPSVQPVETQQPVAQQQPQQSGFMSDLGEAVKETGRGLVQAGVNVANI
                     PASVTDAVTSAAAWAGGKLGIGDGTYQPAPRVTTQGLEQDFGLQQGSLTPQTTEGMVF
                     AEALPYLTPAGVERAATQAPTLAGRIAQGATRLLAENAVGSLAANSTKDDAEALATDL
                     GVGVLAGGAINAVGRGLGAAYRGVRGAIAPEAQQAIRFAEREGLPLHTTDLLQPTSRV
                     GKMAQTTAENIPLAGTSGVRATQQEARSQLAQRFADKFGEYDPVVVIDSLKAKTSGIR
                     RAAGNRLEKVKNAMAGVNIQPARAIQQIDTEISNLQKLGKVADNETISKLQSYRDELV
                     RNTGPDGPVNLDLKQLSDLRSQFRMDVKGERPVLPNRSDAAIQRVYKAMTDDINGAIG
                     QNLGNDTLRKYQQANAVYADEAAKLKNTRLKNVLMKGDLTPEVVNNMLFSKNKSEIKT
                     LYNSVGRVGREQMRNGIIGKAMEKSGGSPDQFLRQLNILQNQTGITFKGQDAAYLKGL
                     KNYLQSTQQAAKAAVTTPTGQQTIPFIIGYGTAMNPATTGAAVSYGLLTRAYESEPFR
                     NAMLRMANTPRGSTAFEKAMQQAQKAINALTQGAKSDALSE"
     gene            complement(410576..410749)
                     /locus_tag="SeHA_C0412"
     CDS             complement(410576..410749)
                     /locus_tag="SeHA_C0412"
                     /codon_start=1
                     /transl_table=11
                     /product="Mnt"
                     /protein_id="ACF70131.1"
                     /translation="MNNRSINAEIVATMEESLSKPSPVRGYRDEEERLASLISEQVKE
                     VAADILRKEKTRS"
     gene            410966..412969
                     /locus_tag="SeHA_C0413"
     CDS             410966..412969
                     /locus_tag="SeHA_C0413"
                     /EC_number="3.2.1.-"
                     /note="identified by match to protein family HMM PF09008;
                     match to protein family HMM PF09251"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional tail protein"
                     /protein_id="ACF69542.1"
                     /translation="MTDITANVVVSNPRPIFTESRSFKAVANGKIYIGQIDTDPVNPA
                     NQIPVYIENEDGSHVQIAQPLIINAAGKIVYNGQLVKIVTVQGHSMAIYDSYGSQVDY
                     IANVLKYDPDQYSIEADKKFKYSVKLSDYLTLQDAASAAVDGLLIDVDYHFYSGETVD
                     FGGKALTIDCKAKFIGDGNLIFTKLGKGSRIAGVFMESTTTPWVIKPWTDDNQWLTDA
                     AAVVATLKQSKTDGYQPTVSDYVKFPGIETLLPPNAKGQNITSTLEIRECIGVEVHRA
                     SGLMAGFLFRGCHFCKMVDANNPSGGKDGIITFENLSGDWGKGNYVIGGRTSYGSVSS
                     AQFLRNNGGFERDGGVIGFTSYRAGESGVKTWQGTVGSTTSRNYNLQFRDSVVIYPVW
                     DGFDLGADTDMNPELDRPGDYPITQYPLHQLPLNHLIDNLLVRGALGVGFGMDGKGMY
                     VSNITVEDCAGSGAYLLTHESVFTNIAIIDTNTKDFQANQIYISGACRVNGLRLIGIR
                     STDGQGLTIDAPNSTVSGITGMVDPSRINVANLAEEGLGNIRANSFGYDSAAIKLRIH
                     KLSKTLDSGALYSHINGGAGSGSAYTQLTAISGSTPDAVSLKVNHKDCRGAEIPFVPD
                     IASDDFIKDSSCFLPYWENNSTSLKALVKKPNGELVRLTLATL"
     gene            complement(413028..414485)
                     /locus_tag="SeHA_C0414"
     CDS             complement(413028..414485)
                     /locus_tag="SeHA_C0414"
                     /codon_start=1
                     /transl_table=11
                     /product="O-antigen conversion protein"
                     /protein_id="ACF68882.1"
                     /translation="MKFNSNDRIFISIFLGLAIIYTFPLLTHQSFFVDDLGRSLYGGL
                     GWSGNGRPLSDFIFYIINFGTPIIDASPLPLMLGIVILALALSCIREKLFGDDYITAS
                     LCFMMILANPFFIENLSYRYDSLTMCMSVAISIISSYVAYQYKPINIIISSILTIAFL
                     SLYQAALNTYAIFLLAFIISDVVKKNSISNITKNTASSVAGLIVGYFAYSYFIAKRLV
                     TGSYNIEHSKIIEINSSLFEGIISNVLSFYRMFSTILNGDNYLIYYSLFFALIISLIV
                     IVLKAIKRDENKKTKLLLVVLILLASMFFIIGPMIFLKSPIYAPRVLIGMGGFMFFCC
                     LCVFYAFEDKQLISRIYFSFILLISTIFSYGAYNAINAQFQLEESIVNRISQDIDYLG
                     FGRDKKNIKFIGTEPYAPINENIVIKHPLMRELIPRIINNDWMWSEVLMQRNVFSRNY
                     RLYDKEVKLENGWKKSGNNVYDIGVVGETIVVRFN"
     gene            complement(414475..415407)
                     /locus_tag="SeHA_C0415"
     CDS             complement(414475..415407)
                     /locus_tag="SeHA_C0415"
                     /EC_number="2.4.1.-"
                     /note="identified by match to protein family HMM PF00535"
                     /codon_start=1
                     /transl_table=11
                     /product="bactoprenol glucosyl transferase"
                     /protein_id="ACF68198.1"
                     /translation="MKISLVVPVFNEEDTIPIFYKTVREFNELKEYEIEIVFINDGSK
                     DATESIINKIAASDPLVIPLSFTRNFGKEPALFAGLDHATGDAVIPIDVDLQDPIEVI
                     PHLIEKWQAGADMVLAKRSDRSTDGRMKRKTAEWFYKLHNKISNPKIEENVGDFRLMS
                     RAVVENIKQMPERNLFMKGVLSWVGGKTDVVKYARAERVAGDSKFNGWKLWNLALEGI
                     TSFSTFPLRIWTYIGLFIAGMSFLYGAWMIIDKLIFGNNVPGYPSLLVSVLFLGGVQL
                     IGIGILGEYIGRIYIETKQRPKYILKRKGFKSEI"
     gene            complement(415404..415766)
                     /locus_tag="SeHA_C0416"
     CDS             complement(415404..415766)
                     /locus_tag="SeHA_C0416"
                     /note="identified by match to protein family HMM PF04138"
                     /codon_start=1
                     /transl_table=11
                     /product="bactoprenol-linked glucose translocase"
                     /protein_id="ACF69672.1"
                     /translation="MLKLFAKYTSIGVLNTLIHWGVFAFCVYGMHTHQALANFSGFVI
                     AVSFSFYANARFTFNATTTTLRYMMYVGFMGTLSAVVGWMADQCSLPPLITLITFSAI
                     SLVCGFIYSRFIVFRDIR"
     gene            complement(416536..417006)
                     /locus_tag="SeHA_C0417"
                     /note="transposase InsF for insertion sequence
                     IS3A/B/C/D/E/fA; this gene contains a premature stop which
                     may be the result of sequencing error; identified by match
                     to protein family HMM PF00665"
                     /pseudo
     gene            417314..417682
                     /locus_tag="SeHA_C0418"
                     /note="glycerol dehydratase reactivation factor large
                     subunit; this gene contains a frame shift which may be the
                     result of sequencing error"
                     /pseudo
     gene            418036..418188
                     /locus_tag="SeHA_C0419"
     CDS             418036..418188
                     /locus_tag="SeHA_C0419"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF67102.1"
                     /translation="MARGEQEGWNPEFTKKVAGWAEKVASGNRILIKNPEYFSTYMQE
                     QLKELV"
     gene            418536..419768
                     /locus_tag="SeHA_C0420"
     CDS             418536..419768
                     /locus_tag="SeHA_C0420"
                     /note="identified by match to protein family HMM PF07690"
                     /codon_start=1
                     /transl_table=11
                     /product="putative permease"
                     /protein_id="ACF66551.1"
                     /translation="MKNNIEETIGKYLPILMILPLAGLAELASLYSIQALLPKLSEVY
                     NIPLNQVGMILSAEVGFLALAMLFSGTLSDRFGRKPIIFYSLLAGGILTLLCATASSW
                     PMLVVYRALLGIAVSGITAAVTVYISEEVSPALAGIVTGYFIFGNSLGSMSGRVFATL
                     MMEHVSIDTIFFIFGGVLIAMALAVKLFLPTSRQFVPTPSLQLGAVLKGGLEHFKNIR
                     VSLCFVIGFILFGSFTSIFNFLAFYLHRPPYELSYTWIGLIPVSFSLTFFLAPYAARV
                     ALNIGSMNALSILIICMMVGAFLTLIAPSLWVFISGIVLLSVAFFSAHSTVLAWVSSR
                     SPNAKGQATSFYLLCYYSGGAVMGYLNGYLFSWQGWNAIAASCLMMLGIGLFICRFIF
                     AKYEKQPQIKKQSVQESF"
     gene            419900..421321
                     /gene="leuC"
                     /locus_tag="SeHA_C0421"
     CDS             419900..421321
                     /gene="leuC"
                     /locus_tag="SeHA_C0421"
                     /EC_number="4.2.1.33"
                     /note="identified by match to protein family HMM PF00330;
                     match to protein family HMM TIGR00170"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase, large subunit"
                     /protein_id="ACF66048.1"
                     /translation="MSAKTLYEKLVESHTIRELDNEGHVLLYIDRSILNEYTSPQAFS
                     GLRERGRTVRHPDTFLLNIDHVNPTRSQRDVLMTDPGGQLQVDYFRENAADFGITLFD
                     VLDPRQGIEHVVAHEQGLVMPGMVIAAGDSHTTTYGAFGALGFGIGTSEIEHLLATQT
                     LVYRKLKTMRVSVQGELPFACSAKDIVLELLERIGADGATGYAIEFVGEAISALSVEG
                     RMTLCNMAVEAGARGAIIAPDKKVFDYIYGKPQMPVGELWQQALLEWSQLSSDADAVF
                     DKTVAINCHDLEPKVTWGISPDQTGSITGRVPFPEQETNPLKRLALEKALHYMGLTAG
                     MLLKDIRISHAFIGSCTNGRIEDLRAVAKVLEGRKIASHVRGIIVPGSTMVRRQAEEE
                     GLAKIFIAAGFEWRQSGCSMCLAMNEDVLSPGDRCASGTNRNFPGRQGAGARTHLMSP
                     AMVAAAAVAGHLVDVRSLLQAGE"
     gene            421323..421949
                     /gene="leuD"
                     /locus_tag="SeHA_C0422"
     CDS             421323..421949
                     /gene="leuD"
                     /locus_tag="SeHA_C0422"
                     /EC_number="4.2.1.33"
                     /note="identified by match to protein family HMM PF00694;
                     match to protein family HMM TIGR00171"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase, small subunit"
                     /protein_id="ACF69693.1"
                     /translation="MDTFKQISGRIAPMLEPNIDTDVIMPKQFLKGIDRQGLDKGVFF
                     DRRFMAGGQPNPDFILNMPGWQSATFLLVGPNFGCGSSREHAVWGLKQLGVRGLIGST
                     FAGIFDDNCQRNGILTVSLDEPALARLAQLAASADTNSITVSLDRCEITTAEETISFV
                     ISELKRAMLAAGEDAIAWTLQYLPEIENFEVAHYSRRPWLKRPASPRG"
     gene            421964..422842
                     /locus_tag="SeHA_C0423"
     CDS             421964..422842
                     /locus_tag="SeHA_C0423"
                     /note="identified by match to protein family HMM PF01557"
                     /codon_start=1
                     /transl_table=11
                     /product="5-oxopent-3-ene-1,2,5-tricarboxylate
                     decarboxylase"
                     /protein_id="ACF69275.1"
                     /translation="MKLVQYLVNGGKRYGIMQEIGIIDLSQRLGDKYPTLKSLLCANA
                     LTDAALWCDEPADYYYQEVTFLPVIDDPQKIICVGMNYADKRIEFNETNPAPTLFVRF
                     ADSQTGHNGLLLKPENTNEFDYEGELAVVIGRRCSRVSAEDALDYVAGYSCYMDGSVR
                     DWQHSWFTAGKNWPSTGSFGPCLVTTDDIPDPQMLRLLTRLNGREVQNESTANMIHPI
                     ASLIAYISTFTLLSPGDTILTGSPGGVGKKRVPPLFLHDGDVIEVEIEHIGTLRNVVR
                     DSRYLTSSVSWHDGRK"
     gene            422842..423366
                     /locus_tag="SeHA_C0424"
                     /note="haloacetate dehalogenase H-1; this gene contains a
                     frame shift which may be the result of sequencing error"
                     /pseudo
     gene            423363..423755
                     /locus_tag="SeHA_C0425"
                     /note="alpha/beta hydrolase fold; this gene contains a
                     frame shift which may be the result of sequencing error"
                     /pseudo
     gene            423789..424754
                     /locus_tag="SeHA_C0426"
     CDS             423789..424754
                     /locus_tag="SeHA_C0426"
                     /note="identified by match to protein family HMM PF00126;
                     match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="ACF67007.1"
                     /translation="MKTTPVGKKHRQPLEGWPSVEDLFVFVTVARNGGFARAALELGL
                     SPSYISKRIAILEKCLNARLFFRNNRVMRLTPEGENALCGAMQVVSEMDGFVSRLDNQ
                     RGVLAGNITINCSFGFGHKYVAEALSSFMIAYPDITVKLTLTDREVDLVEEGIDIEIR
                     VGDDINELYIARQLATNRRILCASPEYLERHGKPESVSALVQHDCLMIQEKNSAFGNW
                     ILTDGKQQTHCRLNGFHSSNSGSVVLIWALKGHGITLRSEWDVAQYIERGELVRVLPQ
                     WYQEANIWAVYTRRSSSSDRIKICIDFLTEHLAQCLPGGKAPGVL"
     gene            424852..424965
                     /locus_tag="SeHA_C0427"
     CDS             424852..424965
                     /locus_tag="SeHA_C0427"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF69321.1"
                     /translation="MVARFCFRYRGEVIFYPTTRPNLHIDTSIITGFLTWF"
     gene            425867..426061
                     /locus_tag="SeHA_C0428"
     CDS             425867..426061
                     /locus_tag="SeHA_C0428"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane protein"
                     /protein_id="ACF68788.1"
                     /translation="MTTGIENNFRGYMMRNNNTFYTLIESDNENVWDMSVEEKGTQQN
                     KDAVQKVKYQLNAIFDNGTC"
     gene            complement(426108..426866)
                     /locus_tag="SeHA_C0429"
     CDS             complement(426108..426866)
                     /locus_tag="SeHA_C0429"
                     /note="identified by match to protein family HMM PF00345;
                     match to protein family HMM PF02753"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial chaperone protein"
                     /protein_id="ACF67082.1"
                     /translation="MRNYRQWLVFSKVILTLLGLTGWYGPAQAAVNIDRTRIIFASDD
                     VAQSLTLSNDNTTPMLLQVWTDAGNIDASPDNSKTPLVALPPVFKMQPGELRTLRLLL
                     SSRQQLATDRESLFWLNIYQIPPVTQDIKNHPRKLVLPLRLRLKILIRPTGLKAPTEA
                     EEKKLRFIAKENTIRIVNPTSWYMSLTLTMDNKKSIGDIMVAPKTALDVPLTRSPTPG
                     ASINYAVINDSGNWRQYTAILEKYISKSDFIPEF"
     gene            complement(426832..428157)
                     /locus_tag="SeHA_C0430"
     CDS             complement(426832..428157)
                     /locus_tag="SeHA_C0430"
                     /note="identified by match to protein family HMM PF00419"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fimbrial usher"
                     /protein_id="ACF67480.1"
                     /translation="MLFSFRTLLFITSLFVSAGTWSSCIKVTDKSALSDAAIKAGYTA
                     QNWIGATDTNTGNIGLPTVISISNSETFQPSGTLLASGIGNFLTAATGTPYSSKQVLY
                     RCDSADAGKLYEMYSTNGDSAFAGAFFTPEVEGAYYDVERNVAVRMTNLSTGEYYSRF
                     WKERQLTADSWFQDDKYIYIPASAFSNVLYEMFKIDSRKYFAYQNPMDRDTWTQPRGY
                     IAFKGPGLITERIKAGLDHASDYYGWPSYWPGAWSTYNSVTYVRGALCKITDYPAIVK
                     IPPVAVGILAAGGNSQAPFHVSLECESGAVSSALPSTSAANVAMGFVVNQPTAVAAAR
                     RLGLTTSAGGLSWLLDTHYGEPGVASGVGIRIYNDAGTPINLLPDRIKTGTGNARGWY
                     GYKDLTTRVSSGSVETYSGDFTASLEAIGGQTVTAGSVNAQLQAVVSFQ"
     gene            complement(428162..430723)
                     /locus_tag="SeHA_C0431"
     CDS             complement(428162..430723)
                     /locus_tag="SeHA_C0431"
                     /note="identified by match to protein family HMM PF00577"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane fimbrial usher protein"
                     /protein_id="ACF68108.1"
                     /translation="MSPTINLNRKSLALLIAIVCSGSAQGEEYYFDPALLQGATYGQN
                     IARFNERQTPSGDYLADVYVNGTLVASSTNIRFNAVKEGQQAEPCLPLSVMKAAQIKS
                     LPATDAATECRPLREWVPHAGWQFDSATLRLLLTIPMTELTHKPRGYISPSEWDSGAL
                     ALFLRHNTNWTHTENTDSHYRYQYLWSGLNMGVNLGLWQVRHQSNLRYANSNQSGSAW
                     RYNSVRTWVQRPVSSINSILSLGDSYTDSSLFGSLSFNGAKLVTDERMRPQGKRGYAP
                     EVRGVAASSAHVVVKQLGKVIYETNVPPGPFYIDDLYNTRYQGDLEVEVIEASGKTSR
                     FTVPYSSVPDSVRPGNWHYSLAFGRVRQYYDIENRFFEGTFQHGVNNTITLNLGSRIA
                     QRYQAWLAGGVWATGMGAFGLNATWSNARAEHNDRQQGWRAELSYSKTFTTGTNLVLA
                     AYRYSTNGFRDLQDVLGVRREAKTGIDYYSDTLHQRNRLSATVSQPLGRLGTLNLSAS
                     TADYYNNQSRITQLQMGYSNQWRNISYGVNIARQRTTWDYDRFYHGVNEPLDVSSRQK
                     YTETTMSFNVSIPLDWGENRTSVAMNYNQSSQSRSSTVSMTGSSGENSDLSWSVYGGY
                     ERYRNSNSDSSAPTTFGGNLQQNTRFGALRANYDQGDNYRQEGLGASGTLVLHPGGLT
                     AGPYTSDTFALIHADGAQGAIVQNGQGAVVDRFGYAILPSLSPYRVNNVTLDTRKMRS
                     DAELTGGSQQIVPYAGAIARVNFATISGKAVLISVKMPDGGIPPMGADVFNGEGTNIG
                     MVGQSGQIYARIAHPSGSLLVRWGTGANQRCRVAYQLDLHTKEPFLYLNKICEKE"
     gene            complement(430707..431510)
                     /locus_tag="SeHA_C0432"
     CDS             complement(430707..431510)
                     /locus_tag="SeHA_C0432"
                     /note="identified by match to protein family HMM PF00345"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial chaperone protein"
                     /protein_id="ACF66800.1"
                     /translation="MKRQTIFNRQGVVEMKMDTRHSALYYLIVFLLLALPATASWASV
                     TILGSRIIYPSTASSVDVQLKNNDAIPYIVQTWFDDGDMNTSPENSSAMPFIATPPVF
                     RIQPKAGQVVRVIYNNTKKLPQDRESVFWFNVLQVPPTNIGSDSGQNKMLVMLRSRIK
                     LFYRPDGLGKPDNLAKKLQIKTVNKGSGKSGIVIVNPQPWFASLSNLNVKVNGASYNL
                     DADMIAPFSSQTWWLPGKRSLKSFSGTVTVTLVNDLGARISESYDVPHH"
     gene            complement(431530..432066)
                     /locus_tag="SeHA_C0433"
     CDS             complement(431530..432066)
                     /locus_tag="SeHA_C0433"
                     /note="identified by match to protein family HMM PF00419"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="ACF69629.1"
                     /translation="MSMKKYLAMITGSLLVSSSAMAVSDNTITFQGEVSDETCSVVIN
                     GNQAKPVVLLPTVSTKDLSEQGKTAGPITFDIGLSGCTGSQDKTTKISTVFVGNQVTS
                     NGNLGNTGSAKNVEVQLLDTSGEPINLTGGFTGDGDLQLEPNASEASATYTARYYSTG
                     KAEAGTVAATLQYAVSYK"
     gene            432730..433464
                     /locus_tag="SeHA_C0434"
     CDS             432730..433464
                     /locus_tag="SeHA_C0434"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane regulator"
                     /protein_id="ACF70366.1"
                     /translation="MNESIFLLDKRVVFDSTKMTLSHGNEIIRISEAETHLLLAFWHG
                     LYKKEDIIHFVWENRGGCVSESSYYKLINQMRNDFSSIGLQSSDIVTRPRVGVSLSVA
                     IEPIKKITSLKVSDENVKGTPTRENIFYKIKRHSVFVVLTGAILLALLYGVFTIYKAP
                     VRNSPDSFFTYLGEYNDYAIYKTKEDKVTLSEVVFAFNSLKIKIYRQNGRHLYYIREP
                     NMNIFLQCLNPVEMAVPKCITVKERY"
     gene            433437..433937
                     /locus_tag="SeHA_C0435"
                     /note="conserved hypothetical protein; this gene contains
                     a frame shift which may be the result of sequencing error"
                     /pseudo
     gene            434261..435811
                     /locus_tag="SeHA_C0436"
     CDS             434261..435811
                     /locus_tag="SeHA_C0436"
                     /note="identified by match to protein family HMM PF00563"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic diguanylate phosphodiesterase (EAL)
                     domain protein"
                     /protein_id="ACF67124.1"
                     /translation="MLFIAVPLIVMILVGLLAGIFQLKRDIAVSANTLLRFSADISAA
                     SWQVARKAARLAESSCTDTLKELSRTRAFTPYVRDIGFLENGDITCSFVTGTERYHFS
                     RLAGLSLPASYPERWLRSIGSMAEGPDRLVVVYVKKVAANKAAFVIVDSQYVQELMEI
                     LAAERASAFSLTFGAGEAITSAATLRGKAFLTQRFTSTDHTIQLMVRTPFSTLSAYWL
                     QNLFIFIPLSLCLSVGMMLFYRRWYLKRLSLAREIARGITHNEFTVHYQPVFNVEDGS
                     CGGVEALMRWPQPDGRFITPDIFITAAENEGMIIPLSRHLFELIAHDVINWTVSDDFY
                     ISVNISPAHLMDDGFIQDIEALRTRLGTITLMLELTERSLIVEPSQVAEKLSTLREKG
                     VLIAIDDFGTGYCSLSYLQQLPVDSLKIDRTFIDTIDTSSDDVPVLDTIITLSQRLGL
                     NVVAEGVSTQHQLRYILSHGVGFVQGFLYARPMGANDFMSWLGKSAQRQNGLLKGENE
                     SASGLVAE"
     gene            435911..436654
                     /locus_tag="SeHA_C0437"
     CDS             435911..436654
                     /locus_tag="SeHA_C0437"
                     /note="identified by match to protein family HMM PF00486"
                     /codon_start=1
                     /transl_table=11
                     /product="putative response regulator"
                     /protein_id="ACF70260.1"
                     /translation="MSQNNYLIDKRVILDCERMTLSCAGESITISESERSLLIAFYEG
                     LFKKDDLINYVWGRKGVVVSDASYYKLINQLRGSFDKIGLKGASVVTRPRVGVLLSVS
                     IEPLSDEAQNTPLPAVAETELSTVEVRRDDTIIPPIPGAVNKKDWLYFCLAALLMFFM
                     MYKVKGENIDYFTLQGSYDGYTFYSVGHDKTHLTDIVEAYSEMSNEIHKQNGKIIYYI
                     RVPNTNIFVQCLNQLDIAEPKCISIKERY"
     gene            436627..437115
                     /locus_tag="SeHA_C0438"
     CDS             436627..437115
                     /locus_tag="SeHA_C0438"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein"
                     /protein_id="ACF69985.1"
                     /translation="MHFHKRTLLSVATLGMLAVSVVLMVVWVRNSSHSSINTNEFLCT
                     TRTVTTIQPKDIHADGSLVLDFKMKRITLQYEIKTKDNGVKILYRDVYMKNLHRTAPG
                     VYTFEVSQVKVFATDTAGDLLSYLRVLHPEAANEIRISKVGEKTFFYSLNRQLYNVCT
                     AQ"
     gene            437515..438039
                     /locus_tag="SeHA_C0439"
     CDS             437515..438039
                     /locus_tag="SeHA_C0439"
                     /note="identified by match to protein family HMM PF06316;
                     match to protein family HMM TIGR03304"
                     /codon_start=1
                     /transl_table=11
                     /product="attachment invasion locus protein"
                     /protein_id="ACF69485.1"
                     /translation="MKRRSSFLVFLGLLLASPLALANDQHTVSFGYAQTHLSSLKNSD
                     SKDLRGFNFKYRYEFNETWGMLGSFTATRNEMENYTWKEGKLHKNGSDSVDYGSLMFG
                     PTYRFNDYVSLYGNAGIATMKFNKHSKEESFAYGAGVIFNPVKSISIDASWEASRFFA
                     VDTNTFGVSVGYRF"
     gene            438183..438824
                     /locus_tag="SeHA_C0440"
     CDS             438183..438824
                     /locus_tag="SeHA_C0440"
                     /codon_start=1
                     /transl_table=11
                     /product="putative response regulator"
                     /protein_id="ACF68925.1"
                     /translation="MINSLSEQLPLKTIGIVLTDDYYTYLGIASLFEDGKCFMFPLNG
                     EYNSCQISASEDIIIIIDGRVLIQGVWKGFKALMQHYPHARRIWLTRRDIGKLYPHGC
                     DRDPDIDPDLAKPVFIEHFIKYACANEVAVGELAPLTKKEEELLWHFLYKKSMSQIAS
                     SYGMSRKTLYIHRLRICRKYGFKRFFHLLFIYQRSRHIFASKICRVDKNADQA"
     gene            438880..439059
                     /locus_tag="SeHA_C0441"
     CDS             438880..439059
                     /locus_tag="SeHA_C0441"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF68418.1"
                     /translation="MLLAIKILISALDEKTKIRLREHIEKTEQEIASSIHDSIMTETF
                     LQQMKDIRYIFNIVP"
     gene            439093..439476
                     /locus_tag="SeHA_C0442"
     CDS             439093..439476
                     /locus_tag="SeHA_C0442"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c type biogenesis protein CycH"
                     /protein_id="ACF66063.1"
                     /translation="MINRPGISMKKILVCFVGLALTACSANSLNYGAEQVRVMTSEPG
                     KECSYLGDITGSQGNFFTGGWTSNSNLETGARNDLKNKAYKMGGNTVVLLTQRAGQTG
                     SSWHGSGSSKQTNVTLSGNVYRCPR"
     gene            complement(439546..441003)
                     /gene="oprA"
                     /locus_tag="SeHA_C0443"
     CDS             complement(439546..441003)
                     /gene="oprA"
                     /locus_tag="SeHA_C0443"
                     /note="identified by match to protein family HMM PF02321;
                     match to protein family HMM TIGR01845"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane efflux protein OprA"
                     /protein_id="ACF67327.1"
                     /translation="MKITFRGYRQTATLATLAFVTTLAGCTMAPKHERPASPTAMVYP
                     YATSTVSGAPDAADIGWRDFFHDPLLQELIAIALRNNRDLRKAGLNVEAARALYRIQR
                     AEMLPTLGIATAMDAGRTPADLSVTDEPEINRRYEMAGATTAWELDLWGRVRSLSDQA
                     LAAYMALDETYIAARMSLVSEVASAWLTLRADRELLRLTEDTLAAQKSSYTLTTQLAR
                     TGNATQLDLRMAEIALRSAEINRAAYTRQLARDRNALELLLGQPLTPELSRRLNEAVT
                     LTEGAIPTTLPGGLPSDLLVRRPDIRAAEYRLRGANARIGAARAAFFPTISLTGAAGT
                     ASASLSGLFEPGSGSWRFLPQITLPLFHGGALRADLDRAHVQKQIEIARYENVIQQAF
                     RDVADGLAGQRTLNDQVQSEQRAVEASQIAYELAGLRFQEGVDDYLTLLDTHRMLYGA
                     QQRLVRTRLMQQLNIINLYKALGGGWREYSEKKQG"
     gene            complement(441020..444187)
                     /locus_tag="SeHA_C0444"
     CDS             complement(441020..444187)
                     /locus_tag="SeHA_C0444"
                     /note="identified by match to protein family HMM PF00873;
                     match to protein family HMM TIGR00915"
                     /codon_start=1
                     /transl_table=11
                     /product="OqxB"
                     /protein_id="ACF66840.1"
                     /translation="MKFTHFFIARPIFAIVLSLLMLLAGAIAFLKLPLSEYPAVTPPT
                     VQVSASYPGANPQVIADTVAAPLEQVINGVDGMLYMNTQMAIDGRMVISIAFEQGTDP
                     DMAQIQVQNRVSRALPRLPEEVQRIGIVTEKTSPDMLMVVHLVSPQKRYDSLYLSNFA
                     IRQVRDELARLPGVGDVLVWGAGEYAMRVWLDPAKIANRGLTASDIVTALREQNVQVA
                     AGSVGQQPEASAAFQMTVNTLGRLTSEEQFGEIVVKIGADGEVTRLRDVARVTLGADA
                     YTLRSLLNGEAAPALQIIQSPGANAIDVSNAIRGKMDELQQNFPQDIEYRIAYDPTVF
                     VRASLQSVAITLLEALVLVVLVVVLFLQTWRASIIPLVAVPVSLVGTFALMHLFGFSL
                     NTLSLFGLVLSIGIVVDDAIVVVENVERHISQGKSPGEAAKKAMDEVTGPILSITSVL
                     TAVFIPSAFLAGLQGEFYRQFALTIAISTILSAINSLTLSPALAAILLRPHHDTAKAD
                     WLTRLMGTVTGGFFHRFNRFFDSASNRYVSAVRRAVRGSVIVMVLYAGFVGLTWLGFH
                     QVPNGFVPAQDKYYLVGIAQLPSGASLDRTEAVVKQMSAIALAEPGVESVVVFPGLSV
                     NGPVNVPNSALMFAMLKPFDEREDPSLSANAIAGKLMHKFSHIPDGFIGIFPPPPVPG
                     LGATGGFKLQIEDRAELGFEAMTKVQSEIMSKAMQTPELANMLASFQTNAPQLQVDID
                     RVKAKSMGVSLTDIFETLQINLGSLYVNDFNRFGRTWRVMAQADAPFRMQQEDIGLLK
                     VRNAKGEMIPLSAFVTIMRQSGPDRIIHYNGFPSVDISGGPAPGFSSGQATDAIEKIV
                     RETLPEGMVFEWTDLVYQEKQADNSALAIFALAVLLAFLILAAQYNSWSLPFAVLLIA
                     PMSLLSAIVGVWVSGGDNNIFTQIGFVVLVGLAAKNAILIVEFARAKEHDGADPLTAV
                     LEASRLRLRPILMTSFAFIAGVVPLVLATGAGAEMRHAMGIAVFAGMLGVTLFGLLLT
                     PVFYVVVRRMALKRENRVDSHDQQA"
     gene            complement(444184..445410)
                     /locus_tag="SeHA_C0445"
     CDS             complement(444184..445410)
                     /locus_tag="SeHA_C0445"
                     /note="identified by match to protein family HMM PF00529;
                     match to protein family HMM TIGR01730"
                     /codon_start=1
                     /transl_table=11
                     /product="putative auxiliary transport protein, membrane
                     fusion protein (MFP) family"
                     /protein_id="ACF66243.1"
                     /translation="MRRTFKIMLIAGVIATIGGVIYITGEALWDKGNAVGPPASAPPP
                     PSVPVAKALSRTLAPTAEFTGFLAAPETVELRSRVGGTLDAVSVPEGRLVSRGQLLFQ
                     IDPRPFEVALDTAVAQLRQAEVLARQAQADFDRIQRLVASGAVSRKNADDVTATRNAR
                     QAQMQSAKAAVAAARLELSWTRITAPIAGRVDRILVTRGNLVSGGVAGNATLLTTIVS
                     HNPMYVYFDIDEATWLKALRHTRSDKNPPVVNMGLTTDNGLPYQGVLDFMGNQMNRST
                     GTIRARAVIPDPDGMLSPGLFARISLPIGEPRETVLIDDLAVSADQGKNYVLIVGKEN
                     QVEYRPVELGQMVDGLRVVTQGVQPGEKIILKGLVRPGMTVAPRLVPMRQNVTDKQTA
                     TLTKADGDSASKAVRQ"
     gene            445554..445667
                     /locus_tag="SeHA_C0446"
     CDS             445554..445667
                     /locus_tag="SeHA_C0446"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF68728.1"
                     /translation="MSRIILFYEPSHILAEPCSLNTLDLPTMASFRLSDTE"
     gene            445687..447975
                     /locus_tag="SeHA_C0447"
     CDS             445687..447975
                     /locus_tag="SeHA_C0447"
                     /EC_number="3.6.3.4"
                     /note="identified by match to protein family HMM PF00122;
                     match to protein family HMM PF00403; match to protein
                     family HMM PF00702; match to protein family HMM TIGR01494;
                     match to protein family HMM TIGR01511; match to protein
                     family HMM TIGR01525"
                     /codon_start=1
                     /transl_table=11
                     /product="copper-translocating P-type ATPase"
                     /protein_id="ACF69113.1"
                     /translation="MSQSENRHDTISLLIEGMTCASCVARVEKGIKAVPGVTDATVNL
                     ATERATVRGTASAEAVIAAIEKTGYEARPVETAGQGEDDSEEKKEAERVRLKRDLILA
                     SVLALPVFVLEMGSHLIPGMHEWVIKTIGLQQSWYWQFALTLLVLTIPGRRFYLKGFP
                     ALARLAPDMNSLVAVGTAAAFGYSLVATFTPDLLPEGTVNVYYEAAAVIVALILLGRF
                     LEARAKGRTSEAIKRLVGLQARVAHVLREGRIVDIPVDEVVLGDCVEVRPGERIPVDG
                     EVTEGRSFVDESMITGEPIPVEKSAGSAVVGGTVNQKGALTLRATAVGGQTMLAQIIR
                     LVEQAQGSKLPIQAVVDKVTLWFVPMVMLIAALTFVVWLAFGPSPALTFALINGVAVL
                     IIACPCAMGLATPTSIMVGTGRGAEMGVLFRKGEALQLLKDAKVVAVDKTGTLTEGRP
                     VLTDLDVASGFERREVLAKVAAVESRSEHPIARAIVVSAEEEGIALPGMGGFESVTGM
                     GVYATVAGTRVDVGADRYMREIGVDISGFATTAERLGQEGKSPLYAAIDGQLAAIIAV
                     ADPIKPSTPAAINALHQLGIKVAMITGDNARTAQAIARQLGIDDVVAEVLPEGKVEAI
                     RRLKAAYGQVAFVGDGINDAPALAESDVGLAIGTGTDVAVESADVVLMSGNLQGVPNA
                     IALSKATIRNIHQNLFWAFAYNTALIPVAAGALFPVWGILLSPVFAAGAMAMSSVFVL
                     GNALRLRRFRAPMATPSDTSTT"
     gene            447987..448451
                     /gene="cueR"
                     /locus_tag="SeHA_C0448"
     CDS             447987..448451
                     /gene="cueR"
                     /locus_tag="SeHA_C0448"
                     /note="identified by match to protein family HMM PF00376;
                     match to protein family HMM PF09278; match to protein
                     family HMM TIGR02044"
                     /codon_start=1
                     /transl_table=11
                     /product="Cu(I)-responsive transcriptional regulator"
                     /protein_id="ACF67149.1"
                     /translation="MNIGKAAKASKVSAKMIRYYEQIGLIPAASRTDSGYRAYTQADV
                     NQLHFIRRARDLGFSVAEISDLLNLWNNQSRQSADVKRLAQTHIDELDRRIQNMQHMA
                     QTLKALIHCCAGDALPDCPILHTLGQPDDSEPEARTGAVLRRPRRHGLAKRL"
     gene            448529..448723
                     /locus_tag="SeHA_C0449"
     CDS             448529..448723
                     /locus_tag="SeHA_C0449"
                     /note="identified by match to protein family HMM PF00403"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF67373.1"
                     /translation="MQFHIDDMTCGGCASTVKKTILTLDANATVRTDPATRLVDVETS
                     LSAEQIAAALQKAGFPPRER"
     gene            complement(448767..448880)
                     /locus_tag="SeHA_C0450"
     CDS             complement(448767..448880)
                     /locus_tag="SeHA_C0450"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF70330.1"
                     /translation="MLAKIDKSLHIINKAYWHMICHSFYGDYLMQRKAKRG"
     gene            449015..450268
                     /locus_tag="SeHA_C0451"
     CDS             449015..450268
                     /locus_tag="SeHA_C0451"
                     /note="identified by match to protein family HMM PF00083;
                     match to protein family HMM PF07690"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily MFS_1"
                     /protein_id="ACF68661.1"
                     /translation="MYTPLNWTTTQRHVAFASFTSWMLDAFDFFILVFVLSDLAEWFH
                     ASVSDVSIAIMLTLAVRPIGALLFGRMAEKYGRRPILMLNILFFTVFELLSAWSPTFM
                     AFLIFRVMYGVAMGGIWGVASSLAMETIPDRSRGLMSGIFQAGYPCGYLFASVIFGLF
                     YSMVGWRGMFLIGALPVVLLPYIWFKVPESPVWLAARARKENTALLPVLRKQWKLCLY
                     LVLVMAFFNFFSHGTQDLYPTFLKMQHGFDPHLISIIAIFYNIAAMLGGIFYGTLSER
                     IGRKKAIMIAAFLALPVLPLWAFSSGSFTIGLGAFLMQFMVQGAWGVVPTWLNELVPA
                     NARAVLPGFVYQLGNLLASVNATLQARIAETHGGNYGLAMAIVAGAVAILICVFVAFG
                     RETRGVVISGTDSDALPESAVGHRT"
     gene            450457..452415
                     /locus_tag="SeHA_C0452"
     CDS             450457..452415
                     /locus_tag="SeHA_C0452"
                     /EC_number="2.1.1.72"
                     /note="identified by match to protein family HMM PF01555"
                     /codon_start=1
                     /transl_table=11
                     /product="type III restriction-modification system StyLTI
                     enzyme mod"
                     /protein_id="ACF69831.1"
                     /translation="MLKDNQKHNESVAPNSVFLSELQRALPEFFTADCYNEQGELIAK
                     GGFDLAKFERALKARNIDELTSGYQIDFIGKDYAKKQAGEKSVTVIVPDVEHNTLAEN
                     KNSHNLFLTGDNLDVLRHLQNNYADTVDMIYIDPPYNTGSDGFVYPDHFEYSDRALQD
                     MFGLNDTELARLKSIQGKSTHSAWLSFMYPRLFLARKLLKDTGFIFISIDDNEYANLK
                     LMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAKTGQGALRLEPLSKEY
                     IQKSYKEPTEQFPEGKWRPVPLTVSKGLSGGGYTYKITTPNGTVHERLWAYPEASYQK
                     LVADNLVYFGKDNGGIPQRVMYAHHSKGQPTTNYWDNVASNKEGKKEILDLFGDNVFD
                     TPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEEDGGQRTFILCTIDQAL
                     SNNTIAKKAGYNTIDEISRERITRVAAKIRANNPATNSDLGFKHYRFATPTQQTLDDL
                     DSFDIATGHFINTSGQLAAFTESGFTDMINPFSARGLGVPGGASGEETLLTTWLVADG
                     YKMDIDVQTIDFSGYCARYVDNTRLYLIDERWGTEQTRDLLNHIGTHQLPVQTIVIYG
                     YSFDLESIRELEIGLKQLDQKVNLVKRY"
     gene            452428..455397
                     /locus_tag="SeHA_C0453"
     CDS             452428..455397
                     /locus_tag="SeHA_C0453"
                     /EC_number="3.1.21.5"
                     /note="identified by match to protein family HMM PF04851;
                     match to protein family HMM PF08774"
                     /codon_start=1
                     /transl_table=11
                     /product="type III restriction-modification system StyLTI
                     enzyme res"
                     /protein_id="ACF70459.1"
                     /translation="MNILLEELPHQEQALAAILASFTGIDHAQADHNHYANPLIKERY
                     DDKANIDVKMETGTGKTYVYTRLMYELHQKYGLFKFVLVVPTPAIKEGARNFITSDYA
                     RQHFSQFYENTRMELCTINAGDFKVKSGRKNFPAQLLSFTDASRRDSHTIQVLLINAQ
                     MLNSASMTRDDYDQTLLGGLTSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQ
                     MIVRFGATFPDIVEGKGKNKCVRKDYYRRQPQFDLNAVDSFNDGLVKGIDIYYPNLPE
                     EQANNRYIVDSVTAKKLILRRGSKIAEVGVGENLADVDAGFEGSIEYAGSKMLSNDLE
                     LEAGMALVPGTFGASYQELIIQEAIDKHFDTEQANFLRSNEPENNAPRIKTLSLFFID
                     SIKSYRDDEGWLKLKFECLLKKKLTQLIDDYQRKTLPREVEYLSFLQATLASLHSDNQ
                     NVHAGYFGEDRGSGDEAIQAEVDDILKNKEKLLSFSDHHGNWETRRFLFSKWTLREGW
                     DNPNVFVIAKLRSSGSESSKIQEVGRGLRLPVDENGHRVHQEEWPSRLSFLIGYDEKA
                     FASMLVDEINRDSKVQLNEQKLDEAMITLIVTERQKVDPAFTELRLLEDLDDKKLINR
                     SNEFKPSVTLNGETKSGFAWLLEFYPELTQARVRADRIRDNKPASRLRVRLRKENWEQ
                     LSSIWEQFSRRYMLQFERSGASLEQIAAEVLRDPALYIRQKPSQVQQRLVSNEDNGRF
                     EVAQREGELAASEFMAGMKYGHFLKQLALRTSLPVNVLHPVLMAMLRDVLHGDSRYLS
                     EISLDNMTRALQARINAHFAQRHDYLPLDFQASTSVFDSTARQFREEISAEIVGKNVD
                     ENAIDDPRSLYQIPPLRYDSVDPELPLLKYDYPQQVSVFGKLPKRAIQIPKYTGGSTT
                     PDFVYRIERQDADSVYLLVETKAENMRVGDQVILDAQRKFFDMLRRQNINVEFAEATS
                     APAVFSTINGLIEGKAN"
     gene            455892..457295
                     /locus_tag="SeHA_C0454"
     CDS             455892..457295
                     /locus_tag="SeHA_C0454"
                     /EC_number="1.10.3.-"
                     /note="identified by match to protein family HMM PF01654"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome bd-II oxidase subunit 1"
                     /protein_id="ACF65921.1"
                     /translation="MEFDAFFLARLQFAFTVSFHIIFPAITIGLASYLVVLEGLWLKT
                     RNPVWRSLYQFWLKIFAVNFGMGVVSGLVMAYQFGTNWSGFSQFAGSITGPLLTYEVL
                     TAFFLEAGFLGVMLFGWNKVGPGLHFLSTCMVALGTLMSTFWILASNSWMHTPQGFEI
                     HNGQVVPVDWFAVIFNPSFPYRLLHMSVAAFLSSAMFVGASAAWHLLKGNDTPAIRRM
                     FSMALWMAVVVAPVQALIGDMHGLNTLKHQPVKIAAIEGHWENTPGEPTPLTLVGWPD
                     MEAERTRYALEIPALGSLILTHSLDKQVPALKDYPKEDRPNSTVVFWSFRLMVGMGVL
                     MIFLGLASLWLRYRRRLYHSRPFMHFALWMGPSGLIAILAGWVTTEVGRQPWVVYGLL
                     RTRDAVSAHSTLQMSISLLAFFVVYSLVFGVGYIYMIRLIQKGPQPAETPTAETDGRP
                     ARPISAVGESLEQEKRE"
     gene            457292..458302
                     /gene="cydB"
                     /locus_tag="SeHA_C0455"
     CDS             457292..458302
                     /gene="cydB"
                     /locus_tag="SeHA_C0455"
                     /EC_number="1.10.3.-"
                     /note="identified by match to protein family HMM PF02322;
                     match to protein family HMM TIGR00203"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome D ubiquinol oxidase, subunit II"
                     /protein_id="ACF66577.1"
                     /translation="MTIDLPVIWFAIIVFATLMYIVMDGFDLGVGILFPFIRDKHDRD
                     VMVNSVAPVWDGNETWLVLGGAGLFGAFPLAYAVITDALTIPLVVMLLGLIFRGVAFE
                     FRFKATESHRAFWDKSFIVGSILATFAQGVVVGAVVSGFQVEGRTFSGSQLDWLTPFN
                     LFCGVGLVVTYALLGATWLIMKSEDPLHSRMCALSRPLLIVLLLVMGGVSVWTPLTHD
                     DIAGRWFTLPNLYYFLPVPVLVLAFSVWLWRSVKKPESHARPFILTLGLIFLGFSGLG
                     ISIWPNIIPPDISLYAAAAPPQSQSFMLVGALIIIPIILAYTFWSYYVFRGKVRHGEG
                     YH"
     gene            458302..458433
                     /locus_tag="SeHA_C0456"
     CDS             458302..458433
                     /locus_tag="SeHA_C0456"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF68927.1"
                     /translation="MVKVKKWSRRVVWMVAIWCASVLLLAGVGMLFRLLMTSAGFRS"
     gene            458640..459644
                     /locus_tag="SeHA_C0457"
     CDS             458640..459644
                     /locus_tag="SeHA_C0457"
                     /note="identified by match to protein family HMM PF00165"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC-family transcriptional regulator"
                     /protein_id="ACF68493.1"
                     /translation="MSPISCHSSAAPAMKKIFSVSDFIAFGERYGIDYRFPALPQYTQ
                     SSPVLHGDIEEIALPGGICITRSDVHVLQPYETTSRHSSPLYMLVVLEGNVALAVNEQ
                     TFLLSAGMAFCSQLSEQQTIRAHHGADSKLRTLSLGMYPDGGWRERLPVSLADEWENS
                     ATSARVWQVPEFLLSGLRYAQQPGPHAASRQLMLEGIMLQLLGYALNLCQPATQKRGL
                     PVTGEYQRLELIRRLLEQTPEKAYTLNELARRAAMSPSSLRCKFRHAYGCTVFDYLRD
                     CRLARARRYLMEGYSVQQAAWMSGYQHATNFATAFRRRYGCSPGELRDASLTASRHCA
                     "
     gene            459808..461898
                     /locus_tag="SeHA_C0458"
     CDS             459808..461898
                     /locus_tag="SeHA_C0458"
                     /note="identified by match to protein family HMM PF00593;
                     match to protein family HMM PF07715; match to protein
                     family HMM TIGR01783"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrichrome-iron receptor"
                     /protein_id="ACF66410.1"
                     /translation="MFATTRMALLIGGAIGGATFPLFAQETTKNDTVIVTSPVQSGAT
                     KLATPDIETPQSVSIITRQQFEEQGATSVRQAVSYTPGVYSNQIGASNRFDYIVLRGF
                     SDGSLDNVYLDGLKMMGDTNSHSSLVVDPWFLEDIEVVRGPASVLYGRSSPGGIVSLT
                     SRKPAFDAGGEVKLFAGNNNQRGAAFDVTGPLDDNERVAARLSGMTRYADSQFTPLKE
                     ERYALMPSLTWRITDRTRLDLMAYLHRDPEGGSHSGLPYQGTVVPYNGGKISNTFFEG
                     EDDYDKYDRRENMVGYNIEHLFDNGWSVRQKLRYLHTKVTLNQVYAAGWLNETALNRG
                     YSGSGEKMSAIALDNQLDGSVDTGAINHRLLVGIDYQDRSNHTTGYYGAFPPIDAFNP
                     VYGAQPDYITLYSREQHKLRQTGYYLQDQMSWDRWRFTLGGRYDRVSVSNIDKLHDSR
                     SDLDKNNVSTRAALLYLFDNGVAPYLSYSTAFTPTSFADENGNVLEPMKGKQWEAGVK
                     YEPPGGNSQFSAAVYRINQTNIATKEEPTDPYRSIGEIESKGVELEAISHLSDSVRLQ
                     AAYTYTDIRYKKSSPQEQGKRAVYAPRNQASAWLSYDVKSGLLEGLTLGSGIRYVNGV
                     TSDRLNTHTLPSYTLVDMVVGYDLSSIGLNGLSAQLNVNNLTDKRYVAACNSLSYCYF
                     GAERSIVGSVSWAF"
     gene            complement(461939..462571)
                     /locus_tag="SeHA_C0459"
     CDS             complement(461939..462571)
                     /locus_tag="SeHA_C0459"
                     /note="identified by match to protein family HMM PF01810;
                     match to protein family HMM TIGR00949"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transport protein"
                     /protein_id="ACF65951.1"
                     /translation="MEPFHAVVLTVSLFVLTFFNPGANLFVVVQTSLASGRRAGVITG
                     LGVATGDAFYSGLGLFGLATLITQCEAVFSLIKIVGGAYLLWFAWNSIRHQATPQMST
                     LQTPIAAPWTIFFRRGLMTDLSNPQTVLFFISIFSVTLSAETPTWARLMAWAGIVLSS
                     VIWRIFLSQAFSLPAVRRAYGRIQRIASRVIGAIIGMFALRLLYEGVTHR"
     gene            462803..463078
                     /locus_tag="SeHA_C0460"
     CDS             462803..463078
                     /locus_tag="SeHA_C0460"
                     /note="identified by match to protein family HMM PF07338"
                     /codon_start=1
                     /transl_table=11
                     /product="protein YahO"
                     /protein_id="ACF70381.1"
                     /translation="MKTGYKVMLGALAFVVTNVYAAEIMKKTDFDKVASEYTKIGTIS
                     TTGEMSPLDAREDLIKKADEKGADVVVLTSGQTENKIHGTADIYKKK"
     gene            complement(463214..464839)
                     /gene="prpR"
                     /locus_tag="SeHA_C0461"
     CDS             complement(463214..464839)
                     /gene="prpR"
                     /locus_tag="SeHA_C0461"
                     /note="identified by match to protein family HMM PF00158;
                     match to protein family HMM PF02954; match to protein
                     family HMM PF06506; match to protein family HMM TIGR02329"
                     /codon_start=1
                     /transl_table=11
                     /product="propionate catabolism operon regulatory protein
                     PrpR"
                     /protein_id="ACF69890.1"
                     /translation="MTTAHSAPRDNSDKPVIWTVSVTRLFELFRDISLEFDHLATITP
                     IQLGFEKAVTYIRKKLATERCDAIIAAGSNGAYLKSRLSIPVILIKPSGFDVLQALAK
                     AGKLTSSIGIVTYQETIPALLAFQKTFHLRLEQRSYVTEEDARGQINELKANGIEAVV
                     GAGLITDLAEEAGMTAIFIYSAATVRQAFHDALDMTRLTRRQRVDYPSGKGLQTRYEL
                     GDIRGQSPQMEQLRQTITLYARSRAAVLIQGETGTGKELAAQAIHQTFFHRQPHRQNK
                     PSPPFVAVNCGAITESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEM
                     PLPLQTRLLRVLEEKAVTRVGGHQPIPVDVRVISATHCDLDREIMQGRFRPDLFYRLS
                     ILRLTLPPLRERQADILPLAESFLKQSLAAMEIPFTESIRHGLTQCQPLLLAWRWPGN
                     IRELRNMMERLALFLSVDPAPTLDRQFMRQLLPELMVNTAELTPSTVDANALQDVLAR
                     FKGDKSAAARYLGISRTTLWRRLKAGAKDQSDN"
     gene            465105..465992
                     /gene="prpB"
                     /locus_tag="SeHA_C0462"
     CDS             465105..465992
                     /gene="prpB"
                     /locus_tag="SeHA_C0462"
                     /EC_number="4.1.3.30"
                     /note="identified by match to protein family HMM
                     TIGR02317"
                     /codon_start=1
                     /transl_table=11
                     /product="methylisocitrate lyase"
                     /protein_id="ACF68733.1"
                     /translation="MSLHSPGQAFCAALAKENPLQIVGAINANHALLAQRAGYQAIYL
                     SGGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCPLPLLVDADIGFGSSAFNVARTVK
                     SIAKAGAAALHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDARTDPNFVIMARTD
                     ALAVEGLEAALDRAQAYVDAGADMLFPEAITELSMYRQFADVAQVPILANITEFGATP
                     LFTTDELRSANVAMALYPLSAFRAMNRAAEKVYTVLRQEGTQKNVIDIMQTRNELYES
                     INYYQFEEKLDALYRNKKS"
     gene            466115..467284
                     /gene="prpC"
                     /locus_tag="SeHA_C0463"
     CDS             466115..467284
                     /gene="prpC"
                     /locus_tag="SeHA_C0463"
                     /EC_number="2.3.3.5"
                     /note="identified by match to protein family HMM PF00285;
                     match to protein family HMM TIGR01800"
                     /codon_start=1
                     /transl_table=11
                     /product="2-methylcitrate synthase"
                     /protein_id="ACF70240.1"
                     /translation="MTDTTILQNNTHVIKPKKSVALSGVPAGNTALCTVGKSGNDLHY
                     RGYDILDLAEHCEFEEVAHLLIHGKLPTRDELNAYKSKLKALRGLPANVRTVLEALPA
                     ASHPMDVMRTGVSALGCTLPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERI
                     QPETDDDSIGGHFLHLLHGEKPTQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSD
                     VYSAIIGAIGALRGPKHGGANEVSLEIQQRYETPDEAEADIRKRVENKEVVIGFGHPV
                     YTIADPRHQVIKRVAKQLSEEGGSLKMYHIADRLETVMWETKKMFPNLDWFSAVSYNM
                     MGVPTEMFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYTGPDDRQFVPIEKRC"
     gene            467322..468773
                     /gene="prpD"
                     /locus_tag="SeHA_C0464"
     CDS             467322..468773
                     /gene="prpD"
                     /locus_tag="SeHA_C0464"
                     /EC_number="4.2.1.79"
                     /note="identified by match to protein family HMM PF03972;
                     match to protein family HMM TIGR02330"
                     /codon_start=1
                     /transl_table=11
                     /product="2-methylcitrate dehydratase"
                     /protein_id="ACF67768.1"
                     /translation="MSAHISNIRPDFDREIVDIVDYVMNYEITSKVAYDTAHYCLLDT
                     LGCGLEALEYPACKKLLGPIVPGTVVPNGARVPGTQFQLDPVQAAFNIGAMIRWLDFN
                     DTWLAAEWGHPSDNLGGILAIADWLSRNAVAAGKAPLTMKQVLSGMIKAHEIQGCIAL
                     ENAFNRVGLDHVLLVKVASTAVVAEMLGLTRDEILNAVSLAWVDGQSLRTYRHAPNTG
                     TRKSWAAGDATSRAVRLALMAKTGEMGYPSALTAKTWGFYDVSFKGETFRFQRPYGSY
                     VMENVLFKISFPAEFHSQTAVEAAMTLYEQMQAAGKTAADIEKVTIRTHEACLRIIDK
                     KGPLNNPADRDHCIQYMVAVPLLFGRLTAADYEDEVAQDKRIDALREKIVCYEDPAFT
                     ADYHDPEKRAIGNAISVEFTDGSRFDEVVVEYPIGHARRRADGIPKLIEKFKINLARQ
                     FPTRQQQRILDVSLDRARLEQMPVNEYLDLYVI"
     gene            468814..470700
                     /gene="prpE"
                     /locus_tag="SeHA_C0465"
     CDS             468814..470700
                     /gene="prpE"
                     /locus_tag="SeHA_C0465"
                     /EC_number="6.2.1.17"
                     /note="identified by match to protein family HMM PF00501;
                     match to protein family HMM TIGR02316"
                     /codon_start=1
                     /transl_table=11
                     /product="propionate--CoA ligase"
                     /protein_id="ACF67241.1"
                     /translation="MSFSEFYQRSINEPEAFWAEQARRIDWRQPFTQTLDHSRPPFAR
                     WFCDGTTNLCHNAVDRWLDKQPEALALIAVSSETDEERTFTFSQLHDEVNIVAAMLLS
                     LGVQRGDRVLVYMPMIAEAQITLLACARIGAIHSVVFGGFASHSVAARIDDARPALIV
                     SADAGARGGKILPYKKLLDDAIAQAQHQPKHVLLVDRGLAKMAWVDGRDLDFATLRQQ
                     HLGASVPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGGV
                     FFCASDIGWVVGHSYIVYAPLLAGMATIVYEGLPTYPDCGVWWKIVEKYQVNRMFSAP
                     TAIRVLKKFPTAQIRNHDLSSLEALYLAGEPLDEPTASWVTETLGVPVIDNYWQTESG
                     WPIMALARALDDRPSRLGSPGVPMYGYNVQLLNEVTGEPCGINEKGMLVIEGPLPPGC
                     IQTIWGDDARFVKTYWSLFNRQVYATFDWGIRDAEGYYFILGRTDDVINIAGHRLGTR
                     EIEESISSYPNVAEVAVVGIKDALKGQVAVAFVIPKQSDTLADREAARDEENAIMALV
                     DNQIGHFGRPAHVWFVSQLPKTRSGKMLRRTIQAICEGRDPGDLTTIDDPASLQQIRQ
                     AIEE"
     gene            complement(470804..471778)
                     /gene="hemB"
                     /locus_tag="SeHA_C0466"
     CDS             complement(470804..471778)
                     /gene="hemB"
                     /locus_tag="SeHA_C0466"
                     /EC_number="4.2.1.24"
                     /note="identified by match to protein family HMM PF00490"
                     /codon_start=1
                     /transl_table=11
                     /product="delta-aminolevulinic acid dehydratase"
                     /protein_id="ACF69226.1"
                     /translation="MTDLIHRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDY
                     KAIDAMPGVMRIPEKQLAREIERIANAGIRSVMTFGISHHTDDTGSDTWKEDGLVARM
                     SRICKQTVPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLANLGKQAVIAAAAGAD
                     FIAPSAAMDGQVQAIRQALDAAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKT
                     YQMNPMNRREAIRESLLDEAQGADCLMVKPAGAYLDVLREIRERTELPLGAYQVSGEY
                     AMIKFAAMAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAEKNILR"
     gene            471998..472117
                     /locus_tag="SeHA_C0467"
     CDS             471998..472117
                     /locus_tag="SeHA_C0467"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF66458.1"
                     /translation="MWVSTLFMFILFFFNPYLSYMCFVFLFSCKAMKKNAFQL"
     gene            complement(472108..472224)
                     /locus_tag="SeHA_C0468"
     CDS             complement(472108..472224)
                     /locus_tag="SeHA_C0468"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF68354.1"
                     /translation="MFSKKDYAASLLKGSIILYPQSGFGHELKGRNKRKIYN"
     gene            472630..475236
                     /locus_tag="SeHA_C0469"
     CDS             472630..475236
                     /locus_tag="SeHA_C0469"
                     /note="identified by match to protein family HMM PF03797;
                     match to protein family HMM TIGR01414"
                     /codon_start=1
                     /transl_table=11
                     /product="putative autotransporter/pertactin"
                     /protein_id="ACF65919.1"
                     /translation="MWDDTAYVDHDWDDGDTFTLNIANSTIDDDYEYFYFTDDYNNAD
                     GKVTTEDWRTSELASLGTAVTLDVESNINITNNSRVAGITLSQGDTYDATYATGGDSA
                     YVHTWDNTIVVDNSTVTSGAVTPLEGSGWFGNSSEPSDYSGNAVYDTTTGTWYHNPND
                     TALSFSDDPDSYYSMKNNVTFTNGSTLMGDVVFTSNFNNADDANADSNGDGVISASDG
                     FSPIGYDTNNDGVEDTNGGWSHDNDNVDELNLKLDNGSKWVGDAYFSYEYIAPADMYD
                     LEDGTNSLEPSSTVDKWGNVVDDKTFQSGIFTVALDNGSEWDTVNASNVDTLTVNNGS
                     QVNVADSSSLIADTITLTNGSTMNLSSYGEVDTDHLTVDSYSKVDLTNETAYLYANTI
                     TVSNGGEFSIGAGEFDADSFGTDTLELTNAGVFNINNSDYVLDADLVNGHTNTTDTSN
                     ATYGYGVIAMTSDGHLTVNGNGDYYNGDNTADTTYSANGEADNSYTDNVVAATGNYKV
                     RIDNATGAGSVADYKGNELIRVNDVNTDATFSAANKADLGAYTYQAKQEGNTVVLEQM
                     ELTDYANMALSIPSANTNIWNLEQDTVGTRLTNARHGLADNGGAWVSYFGGNFNGDNG
                     TINYDQDVNGIMVGVDTKVDGNNAKWIVGAAAGFAKGDLSDRTGQVDQDSQSAYIYSS
                     ARFANNIFVDGNLSYSHFNNDLSANMSDGTYVDGNTSSDAWGFGLKLGYDLKLGDAGY
                     VTPYGSVSGLFQSGDDYQLSNDMKVDGQSYDSMRYELGVDAGYTFTYSEDQALTPYFK
                     LAYVYDDSNNDADVNGDSIDNGVEGSAVRVGLGTQFSFTKNFSAYTDANYLGGGDVDQ
                     DWSANVGVKYTW"
     gene            475322..475945
                     /locus_tag="SeHA_C0470"
                     /note="putative inner membrane protein; this gene contains
                     a frame shift which may be the result of sequencing error;
                     identified by match to protein family HMM PF00027"
                     /pseudo
     gene            complement(475990..477147)
                     /locus_tag="SeHA_C0471"
     CDS             complement(475990..477147)
                     /locus_tag="SeHA_C0471"
                     /note="identified by match to protein family HMM PF00144"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="ACF67291.1"
                     /translation="MKRSLLFTAMLFAASLTSVQAAQPIADPVFASDIVDRYAEHIFY
                     GSGATGMALVVIDGNQRVFRSFGDTRPGNNVRPQLDSVIRIASLTKLMTSEMLVKLLD
                     QGTVKLNDPLSKYAPPGARVPTYQGTPITLVNLATHTSALPREQPGGAAHRPVFVWPT
                     REQRWNWLSTATLKVAPGSQAAYSNLAFDLLADALATASGKPYTQLFEEKITRPLGMK
                     DTTFTPSPDQCKRLMVAEKGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYHR
                     SQQADRMQTLIYQRTQLKKIIGMDVPGKADALGLGWVYMAPKDGRPGIIQKTGGGGGF
                     ITYMAMIPQYNIGAFVVVTRSPLTRFTNMSDGINDLVTELSGNKPIAIPAS"
     gene            477494..478714
                     /gene="smbA"
                     /locus_tag="SeHA_C0472"
     CDS             477494..478714
                     /gene="smbA"
                     /locus_tag="SeHA_C0472"
                     /note="identified by match to protein family HMM PF05992;
                     match to protein family HMM PF06472"
                     /codon_start=1
                     /transl_table=11
                     /product="protein SbmA"
                     /protein_id="ACF69065.1"
                     /translation="MFKSFFPKPGPFFMSAFVWALIAVIFWQAGGGDWVARLVGASDE
                     VPISAARFWSLDYLIFYAYYLICVGLFATFWFIYSPHRWQYWSILGTSLIIFVTWFLV
                     EVGVAVNAWYAPFYDLIQTALSSPHKVTLGQFYHEVGVFLGIALIAVVIGVLNNFFVS
                     HYVFRWRTAMNEHYMAHWQYLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIA
                     FLPVLVTLSAHVPNLPIVGHIPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVE
                     AAYRKELVYGEDDASRATPPTVRELFSAVRHNYFRLYFHYMYFNIARILYLQVDNVFG
                     LFLLFPSIVAGTITLGLMTQITNVFGQVRGSFQYLINSWTTLVELMSIYKRLRSFERQ
                     LDGQPVQEVTHSFS"
     gene            478729..479823
                     /locus_tag="SeHA_C0473"
     CDS             478729..479823
                     /locus_tag="SeHA_C0473"
                     /note="identified by match to protein family HMM PF07759"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane lipoprotein"
                     /protein_id="ACF67812.1"
                     /translation="MSAASRLYPLPFLAVAILAGCSSQSGQPVSKGEKPVDVASVVRQ
                     KMPASVKDREAWAKDIATTFKSQGLAPTVENICSVLAVAQQESGYQADPVVPGLSKIA
                     WQEIDRRAERLHIPLFLVHTALKINSPNGKSYSERLDTVKTEKQLSAIFDDFINMVPM
                     GQTLFGAYNPVHTGGPMQVSIAFAEQHAKGYPWKMTGTVRQEVFTRRGGLWFGTYHLL
                     NYPANYSAPVFRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYNSKEPGKTE
                     LAVRKLAGQLGMSEREIRSQLEKGDSLAFEKTALYKKVYKLAEAKTGKTLAREMLPGI
                     QLESPKITRKLTTAWFAKRVDERRARCMGR"
     gene            complement(479861..480169)
                     /locus_tag="SeHA_C0474"
     CDS             complement(479861..480169)
                     /locus_tag="SeHA_C0474"
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane protein YaiY"
                     /protein_id="ACF70370.1"
                     /translation="MADFTLSKSLFSGKHRETSSTPGNIAYAIFVLFCFWAGAQLLNL
                     LVHAPGIYEHLMQVQDTGRPRVEIGLGVGTIFGLVPFLTGCLIFAVIAAFLRWRHRHQ
                     "
     gene            480437..480652
                     /locus_tag="SeHA_C0475"
     CDS             480437..480652
                     /locus_tag="SeHA_C0475"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF69854.1"
                     /translation="MRLPVKIRRDWHYYAFSIGLIFILNGVVGLLGFEAKGWQTYGVG
                     LVTWIISFWLAGFIIRRREDDEVKDAR"
     gene            complement(480678..481772)
                     /locus_tag="SeHA_C0476"
     CDS             complement(480678..481772)
                     /locus_tag="SeHA_C0476"
                     /EC_number="6.3.2.4"
                     /note="identified by match to protein family HMM PF01820;
                     match to protein family HMM PF02222; match to protein
                     family HMM PF07478; match to protein family HMM PF08443;
                     match to protein family HMM TIGR01205"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine--D-alanine ligase"
                     /protein_id="ACF69787.1"
                     /translation="MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGID
                     KAGQWHVNDAENYLQNADDPAHIALRPSAISLAQVPGKHQHQLINAQNGQPLPTVDVI
                     FPIVHGTLGEDGSLQGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFIT
                     LTRTNRHAFSFAEVESRLGLPLFVKPANQGSSVGVSKVANEAQYQQAVALAFEFDHKV
                     VVEQGIKGREIECAVLGNDNPQASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPAQLPS
                     GVNDKIRAIAIQAYQTLGCAGMARVDVFLTADNEVVINEINTLPGFTNISMYPKLWQA
                     SGLGYTDLISRLIELALERHAANNALKTTM"
     gene            481880..482563
                     /locus_tag="SeHA_C0477"
     CDS             481880..482563
                     /locus_tag="SeHA_C0477"
                     /note="identified by match to protein family HMM PF06904"
                     /codon_start=1
                     /transl_table=11
                     /product="extensin family protein"
                     /protein_id="ACF67034.1"
                     /translation="MRGKGFLIIVLLGGIGGLGYRYLPSYYNPFAPLQLADPPGWITT
                     FKLQRLTPSQCRELLTAANQQGLISSQPVADSAGECPLSHVVRVRDFGLVKLSSSFLA
                     SCPLALRSALFVEQQAKPLTETWMKRRLTRIEHLGSYACRNIYHRPDARRSEHASAEA
                     LDVSGFQLSDGRKITVLRGWGREETGPWLRAMLNASCHYYGNGLGPDYNAAHANHFHL
                     GMRGYGVCR"
     gene            482732..483943
                     /locus_tag="SeHA_C0478"
     CDS             482732..483943
                     /locus_tag="SeHA_C0478"
                     /note="identified by match to protein family HMM PF07690"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily MFS_1"
                     /protein_id="ACF69237.1"
                     /translation="MESWKVNLISVWFGCFFTGLAISQILPFLPLYISQLGVSSHEAL
                     SMWSGLTFSITFLISAIVSPMWGSLADRKGRKLMLLRASLGMAIAILLQAFATHVWQL
                     FLLRGIMGLTSGYIPNAMALVASQVPRERSGWALSTLSTAQISGVIGGPLMGGFVADH
                     IGLRAVFLITAMLLVVSFLVTLFLIKEGVRPVIKKSERLSGKAVFASLPYPALVISLF
                     FTTMVIQLCNGSISPILALFIKSMMPDSNNIAFLSGLIASVPGISALISAPRLGKLGD
                     RIGTERILMATLICAVLLFFAMSWVTTPFQLGLLRFLLGFADGAMLPAVQTLLVKYSS
                     DQITGRIFGYNQSFMYLGNVVGPLMGATVSAMAGFRWVFIATAAIVLINIGQLTLALR
                     RRRNAQKAKGQ"
     gene            484240..484500
                     /locus_tag="SeHA_C0479"
     CDS             484240..484500
                     /locus_tag="SeHA_C0479"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="ACF66745.1"
                     /translation="MKNLIAELLLKLAQKEEESKELVAQVEALEIIVTAMLRNMAQNE
                     QEMLIRQVEGALEGVKPDASVPDHDTELLRQYVKKLLRHPRH"
     gene            complement(484524..484685)
                     /locus_tag="SeHA_C0480"
     CDS             complement(484524..484685)
                     /locus_tag="SeHA_C0480"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF66658.1"
                     /translation="MQFDYPQLHWQDAEEQRITLHCYYHSRFVFILLCITQKKIKTKR
                     LCYFIKVTL"
     gene            484852..485172
                     /locus_tag="SeHA_C0481"
     CDS             484852..485172
                     /locus_tag="SeHA_C0481"
                     /note="identified by match to protein family HMM PF07769"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate starvation-inducible protein PsiF"
                     /protein_id="ACF68566.1"
                     /translation="MKITLLVTLLFGLVFLTAVGATEKPLTPQQQRMTTCNQQATAQA
                     LKGDARKTYLSDCLKNSQSAPGEKSLTPQQQKMRECNVQATEQSLKGDDRSKFMSACL
                     KKAA"
     gene            485264..486376
                     /locus_tag="SeHA_C0482"
     CDS             485264..486376
                     /locus_tag="SeHA_C0482"
                     /note="identified by match to protein family HMM PF00990;
                     match to protein family HMM PF05230; match to protein
                     family HMM TIGR00254"
                     /codon_start=1
                     /transl_table=11
                     /product="AdrA protein"
                     /protein_id="ACF70410.1"
                     /translation="MFPKIMNDENFYRKAVEQAVAPPDPPDDRQRSGLRFARRIRLPR
                     AVGLGGMFLPVAAVLVTQPVFGGWWLLLVGWSFVWPHLAWQWAAKALDPLRQEIYNLK
                     VDAILSGMWIALMGVNMLPAAALFMMMSMNLMGAGGRRLFTVGMGLLLASCLVTLQLT
                     GLPVAMRSSSLEVTLSLPVIILYPLLFAWVSYQTAIKLAEHKRRLQAMSSRDGMTGVY
                     NRRHWEILLRNEFDHSRRHHREATLLIIDIDHFKSINDTWGHDVGDEAIIALTRQLQI
                     TLRGSDIIGRFGGDEFAVIMCGTPADSAITAMSRVHERLNTLRLPGAPQVMLRISVGV
                     APLTPQIGHYREWLKSADMALYKAKNAGRNRTEVAA"
     gene            complement(486391..487200)
                     /gene="proC"
                     /locus_tag="SeHA_C0483"
     CDS             complement(486391..487200)
                     /gene="proC"
                     /locus_tag="SeHA_C0483"
                     /EC_number="1.5.1.2"
                     /note="identified by match to protein family HMM PF03446;
                     match to protein family HMM PF03807; match to protein
                     family HMM TIGR00112"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="ACF68825.1"
                     /translation="MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAA
                     LHDQYGINAAQSAQEVAQVADIVFGAVKPGIMVKVLSEISSSLNKDSLVVSIAAGVTL
                     DQLARALGHDRKIIRAMPNTPSLVNAGMTSVTPNALVTPEDTADVLNIFRCFGEAEVI
                     AEPMIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLET
                     GKHPGELKDMVCSPGGTTIEAVRVLEERGFRAAVIEAMTKCMEKSEALSKS"
     gene            487234..487383
                     /locus_tag="SeHA_C0484"
     CDS             487234..487383
                     /locus_tag="SeHA_C0484"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF68304.1"
                     /translation="MVSLTRIENGQKEKQHFDERQKRETIKDCIPYGRHYDHLGGCGC
                     VSECH"
     gene            487340..487795
                     /locus_tag="SeHA_C0485"
     CDS             487340..487795
                     /locus_tag="SeHA_C0485"
                     /note="identified by match to protein family HMM PF02639"
                     /codon_start=1
                     /transl_table=11
                     /product="protein YaiI"
                     /protein_id="ACF68068.1"
                     /translation="MTIWVDADACPNVIKEILYRAAERMQLPLILVANQALRVPPSRF
                     IRTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEVLEKGAAALNPRGERYSDATI
                     RERLTMRDFMDTLRASGVQTGGPNTLSPRDRQHFAAELDKWWLESQRKK"
     gene            487980..488525
                     /gene="aroK"
                     /locus_tag="SeHA_C0486"
     CDS             487980..488525
                     /gene="aroK"
                     /locus_tag="SeHA_C0486"
                     /EC_number="2.7.1.71"
                     /note="identified by match to protein family HMM PF01202"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="ACF67555.1"
                     /translation="MMQPLYLVGPRGCGKTTIGMALAQATGFRFADTDRWLQSHVQMS
                     VADIVEKEGWGGFRARETAALEAVSAPSTVVATGGGIILTEYNRRYMHRVGVVIYLCA
                     PVSTLVNRLEAEPEADLRPTLTGKPLSEEVREVLEQRDALYRETAHYIIDATKTPAQV
                     VSEIIAALPPSTQRLQGDVYT"
     gene            488552..488743
                     /locus_tag="SeHA_C0487"
     CDS             488552..488743
                     /locus_tag="SeHA_C0487"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF66582.1"
                     /translation="MPTRPPYPREAYIVTIEKGTPGQTVTWYQLRADHPKPDSLISEH
                     PTAEEAMDVKKRYEDPDKS"
     gene            488994..489671
                     /locus_tag="SeHA_C0488"
     CDS             488994..489671
                     /locus_tag="SeHA_C0488"
                     /note="identified by match to protein family HMM PF07302"
                     /codon_start=1
                     /transl_table=11
                     /product="aro operon protein"
                     /protein_id="ACF65924.1"
                     /translation="MSASLAILTIGVVPMSEVLPLLTEYIDEQHITHHSLLGKMSRED
                     VMADYAVEPGDDPLLTLLNDNQIAHVSRQKVERDLQSVVEVLDNQGYDVIILMSTAAI
                     KSMAARNSILLEPLRIIPPLVASIVDGHQVGVIVPVAELLAAQEKKWQVLQMPPVYSL
                     ANPVHGSEQQLIDAGQALLDQGADVIMLDCLGFHQRHRDILQQALDVPVLLSNVLIAR
                     LASELLV"
     gene            489742..490026
                     /locus_tag="SeHA_C0489"
     CDS             489742..490026
                     /locus_tag="SeHA_C0489"
                     /note="identified by match to protein family HMM PF06865"
                     /codon_start=1
                     /transl_table=11
                     /product="protein YaiE"
                     /protein_id="ACF69926.1"
                     /translation="MLQSNEYFSGKVKSIGFTSSSTGRASVGVMAEGEYTFGTAEPEE
                     MTVVSGALKVLLPGTVEWKVYAAGEVFNVPGHSEFHLQVAEPTSYLCRYL"
     gene            complement(490064..490975)
                     /gene="rdgC"
                     /locus_tag="SeHA_C0490"
     CDS             complement(490064..490975)
                     /gene="rdgC"
                     /locus_tag="SeHA_C0490"
                     /note="identified by match to protein family HMM PF04381"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination-associated exonuclease RdgC"
                     /protein_id="ACF69407.1"
                     /translation="MLWFKNLMVYRLSRDITLRAEEMEKQLASMTFTPCGSQDMAKMG
                     WVPPMGSHSDALTHTANGQIIICARKEEKILPSPVIKQALEAKIQKLEADQGRKLKKT
                     EKDSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGS
                     LPVVPLALENPIELTLTEWVRSGTVAQGFQLLDEAELKAMLEDGGVIRAKKQDLVSDE
                     IAVHIEAGKVVTKLALDWQQRIQFVMCDDGSIKRLKFCDELRDQNEDIDREDFAQRFD
                     ADFILMTGELAALIQSLVEGLGGEAQR"
     gene            491101..492009
                     /locus_tag="SeHA_C0491"
     CDS             491101..492009
                     /locus_tag="SeHA_C0491"
                     /EC_number="2.7.1.59"
                     /note="identified by match to protein family HMM PF00480"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-D-glucosamine kinase"
                     /protein_id="ACF68903.1"
                     /translation="MRIGIDLGGTKTEVIALDDAGEQRFRHRLPTPREDYQQTIETIA
                     TLVDMAEQATGQTGSVGIGIPGSLSPYTGVVKNANSTWLNGQPFDSDVSRRLKREVRL
                     ANDANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVALNGRAHIGGNGTAGEWGHNPL
                     PWMDDDELCYREEIPCYCGKQGCIETFISGTGFATDYQRLSGNALKGDEIIRLVDAQD
                     AVAELALSRYELRLAKALSHVVNILDPDVIVLGGGMSNVERLYKTVPSLMKSFVFGGE
                     CETPVRKARHGDSSGVRGAAWLWPLA"
     gene            complement(492031..493203)
                     /locus_tag="SeHA_C0492"
     CDS             complement(492031..493203)
                     /locus_tag="SeHA_C0492"
                     /note="identified by match to protein family HMM PF07690"
                     /codon_start=1
                     /transl_table=11
                     /product="protein AraJ"
                     /protein_id="ACF68447.1"
                     /translation="MKKVIFSLALGTFGLGMAEFGIMGVLTELARDVGITIPAAGHMI
                     SFYAFGVVLGAPVMALFSSRFSLKHILLFLVMLCVMGNAIFTFSSSYLMLAVGRLVSG
                     FPHGAFFGVGAIVLSKIIRPGKVTAAVAGMVSGMTVANLVGIPVGTYLSQEFSWRYTF
                     LLIAVFNIAVLTAIFFWVPDIHDKAQGSLREQFHFLRSPAPWLIFAATMFGNAGVFAW
                     FSYIKPFMMYISGFSETSMTFIMMLVGLGMVLGNLLSGKLSGRYTPLRIAVVTDLVIV
                     LSLMALFFFSGYKTTSLTFAFICCAGLFALSAPLQILLLQNAKGGELLGAAGGQIAFN
                     LGSAIGAWCGGLMLTLGFAYHYVALPAALLSFSAMSSLLVYGRLKHKQPSVTPVAG"
     gene            complement(493376..496516)
                     /locus_tag="SeHA_C0493"
     CDS             complement(493376..496516)
                     /locus_tag="SeHA_C0493"
                     /note="identified by match to protein family HMM PF02463;
                     match to protein family HMM TIGR00618"
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease SbcC"
                     /protein_id="ACF66206.1"
                     /translation="MKILSLRLKNLNSLKGEWKVDFTAEPFASNGLFAITGPTGAGKT
                     TLLDAICLALYHETPRLNTVSQSQNDLMTRDTAECLAEVEFEVKGEAWRAFWSQNRAR
                     NQPDGNLQAPRVELARCSDGKIFADKVKDKLEMIATLTGLDYGRFTRSMLLSQGQFAA
                     FLNAKAKERAELLEELTGTEIYGQISAQVFEKHKSARLELEKLQAQASGVALLADEQL
                     QQLEASLQALTDEEKRLLADQQVQQQHLHWLTRKNELHTELHARQQALYAAQEAREKA
                     QPQLAALTLAQPARQLRPHWERIQEQTRAVERVRQHSDEVNARLQSAYRLRQRIRACA
                     HRQFTQLNATGQRLKTWLAEHDGIRIWRSELAGWRALLTQQSHDRAQLSQWQQQLLSD
                     TRQRDALPPLTLDLTPQALAEARALHTRQRPLRHRLAALQGQILPKQKRQAQLQAAIA
                     RHHQEQAQYTQRLADKRLSYKTKAQELADVRTICEQEARIKDLESQRAHLQSGQPCPL
                     CGSTTHPAIAAYQALELSANQTRRDALEKEVKTLAEEGAALRGQLDALTQQLQRDESE
                     AQSLLQEEQALTEEWQTLCATLGVQLQPQEDLAGWLAAAEEHEQQLDQLSQRHALQTQ
                     IAAHTEQVARFTAQIAQRQASLTADLAQYTLSLPAPEDEASWLNERADEAKIWQQRQT
                     EFADLQTQIDRLAPLLETLPQTDTADSDDDVPLDNWRQAHDECVSLQSQLQTLQEQTT
                     QEQQRAAEAIAHFDAALKNSPFDSQATFLAALLDEETVTRLEKQQQTLESQLQQAKAL
                     SAQSAQALADHQQQPPAGLDPTCTAEQLAQRLAQLAQQLRENTTRQGEIRQQIKQDAD
                     NRQRQRALMAEMKQASQQVEDWGYLNALIGSKEGDKFRKFAQGLTLDNLVWLANHQLT
                     RLHGRYLLQRKASDALELEVVDTWQADAVRDTRTLSGGESFLVSLALALALSDLVSHK
                     TRIDSLFLDEGFGTLDSETLDAALDALDALNASGKTIGVISHVEAMKERIPVQIKVKK
                     INGLGYSKLDKAFAVE"
     gene            complement(496513..497715)
                     /locus_tag="SeHA_C0494"
     CDS             complement(496513..497715)
                     /locus_tag="SeHA_C0494"
                     /note="identified by match to protein family HMM PF00149;
                     match to protein family HMM TIGR00619"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent dsDNA exonuclease"
                     /protein_id="ACF68062.1"
                     /translation="MRILHTSDWHLGQNFYSKSRAAEHQAFLDWLLETAQAHQVDAII
                     VAGDIFDTGSPPSYARELYNRFVVNLQQTGCHLVVLAGNHDSVATLNESRDILAFLNT
                     TVIASAGYAPRLLHRRDGSPGAVLCPIPFLRPRDIITSQAGLSGSEKQQQLLHAIADY
                     YQQQHQEACQLRGERKLPVIATGHLTTVGASKSDAVRDIYIGTLDAFPAQHFPPADYI
                     ALGHIHRAQCVGGTEHIRYCGSPIALSFDECGKSKCVHLVTFDQGKWQSTESLAVPVT
                     QPLAVLKGDLASITEQLEQWRGVEQSPPVWLDIEITTDDYLHDIQRRIQTLTESLPVE
                     VLLVRRSREQRERSLANERRETLSELSVEEVFARRLALEALDHPQRERLNQLFSSTLY
                     ALNEEHEA"
     gene            complement(497757..497888)
                     /locus_tag="SeHA_C0495"
                     /note="conserved hypothetical protein; this gene contains
                     a frame shift which may be the result of sequencing error"
                     /pseudo
     gene            497930..498619
                     /gene="phoB"
                     /locus_tag="SeHA_C0496"
     CDS             497930..498619
                     /gene="phoB"
                     /locus_tag="SeHA_C0496"
                     /note="identified by match to protein family HMM PF00072;
                     match to protein family HMM PF00486; match to protein
                     family HMM TIGR02154"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate regulon transcriptional regulatory
                     protein PhoB"
                     /protein_id="ACF69483.1"
                     /translation="MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKLNE
                     PWPDLILLDWMLPGGSGLQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDY
                     ITKPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPGSHRVMTGDSPLDMGPTEF
                     KLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEHSGHDRMVQTV
                     RGTGYRFSTRF"
     gene            498689..499984
                     /gene="phoR"
                     /locus_tag="SeHA_C0497"
     CDS             498689..499984
                     /gene="phoR"
                     /locus_tag="SeHA_C0497"
                     /EC_number="2.7.3.-"
                     /note="identified by match to protein family HMM PF00512;
                     match to protein family HMM PF00989; match to protein
                     family HMM PF02518; match to protein family HMM TIGR02966"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate regulon sensor protein PhoR"
                     /protein_id="ACF66926.1"
                     /translation="MLERLSWKRLVLELVLCCIPALILSAFFGYLPWFLLAAVTGLLV
                     WHFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRS
                     GAESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPDDNGQNILNLLRYPEFTQYLKTRD
                     FTRPLHLVLNTGRHLEIRVMPYTDKQLLMVARDVTQMHQLEGARRNFFANVSHELRTP
                     LTVLQGYLEMMQEQALEGATREKALHTMREQTYRMEGLVKQLLTLSKIEAAPALLLNE
                     KVDVPMMLRVVEREAQTLSQQKHTFTFEVDDSLSVLGNEEQLRSAISNLVYNAVNHTP
                     AGTHITVSWRRVAHGAEFCIQDNGPGIAAEHIPRLTERFYRVDKARSRQTGGSGLGLA
                     IVKHALNHHESRLEIDSSPGKGTRFSFVLPERLIAKNSD"
     gene            complement(500197..500346)
                     /locus_tag="SeHA_C0498"
     CDS             complement(500197..500346)
                     /locus_tag="SeHA_C0498"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF69780.1"
                     /translation="MPFPEDYKAAFFINFSGKSSRTDAAKNCFSIYRANAVVMTAPEA
                     QFKRL"
     gene            500393..501712
                     /gene="brnQ"
                     /locus_tag="SeHA_C0499"
     CDS             500393..501712
                     /gene="brnQ"
                     /locus_tag="SeHA_C0499"
                     /note="identified by match to protein family HMM PF05525;
                     match to protein family HMM TIGR00796"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid transport system II
                     carrier protein"
                     /protein_id="ACF66394.1"
                     /translation="MTHQLKSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTA
                     AIGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGLLLATVCYLAVGPLFATPRT
                     ATVSFEVGIAPLTGDSAMPLLIYSVVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALV
                     ILSVAAIVWPAGPISNALDAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGV
                     TEARLLTRYTVWAGLMAGVGLTLLYLALFRLGSDSATLVDQSANGAAILHAYVQHTFG
                     GAGSFLLAALIFIACLVTAVGLTCACAEFFAQYIPLSYRTLVFILGGFSMVVSNLGLS
                     HLIQISIPVLTAIYPPCIALVVLSFTRSWWHNSTRIIAPAMFISLLFGILDGIKASAF
                     GDMLPAWSQRLPLAEQGLAWLMPTVVMVILAIIWDRAAGRQVTSSAH"
     gene            501727..503157
                     /locus_tag="SeHA_C0500"
     CDS             501727..503157
                     /locus_tag="SeHA_C0500"
                     /note="identified by match to protein family HMM PF00324;
                     match to protein family HMM PF03845"
                     /codon_start=1
                     /transl_table=11
                     /product="proline-specific permease ProY"
                     /protein_id="ACF66775.1"
                     /translation="MYTTGLNAPWFFIVLIGQKLMESNNKLKRGLSTRHIRFMALGSA
                     IGTGLFYGSADAIKMAGPSVLLAYIIGGVAAYIIMRALGEMSVHNPAASSFSRYAQEN
                     LGPLAGYITGWTYCFEILIVAIADVTAFGIYMGVWFPAVPHWIWVLSVVLIICAINLM
                     SVKVFGELEFWFSFFKVATIIIMIIAGIGIIVWGIGNGGQPTGIHNLWSNGGFFSNGW
                     LGMIMSLQMVMFAYGGIEIIGITAGEAKDPEKSIPRAINSVPMRILVFYVGTLFVIMS
                     IYPWNQVGTNGSPFVLTFQHMGITFAASILNFVVLTASLSAINSDVFGVGRMLHGMAE
                     QGSAPKVFAKTSRRGIPWVTVLVMTIALLFAVYLNYIMPENVFLVIASLATFATVWVW
                     IMILLSQIAFRRRLPPEEVKALKFKVPGGVVTTIAGLIFLVFIIALIGYHPDTRISLY
                     VGFAWIVLLLIGWIFKRRRDRQLAQA"
     gene            503319..505136
                     /locus_tag="SeHA_C0501"
     CDS             503319..505136
                     /locus_tag="SeHA_C0501"
                     /EC_number="3.2.1.20"
                     /note="identified by match to protein family HMM PF00128"
                     /codon_start=1
                     /transl_table=11
                     /product="maltodextrin glucosidase"
                     /protein_id="ACF67331.1"
                     /translation="MLNAWHLPVAPFVKQHNDKLTITLWLSGENPPSRVTLRSEFDNE
                     EISLAMRKQRRQPQPGVTAWRATLNIALGQPRRRYSFKLLWHDRQLWFTPQGFSRFPP
                     ARLEQFAVDVPDSGPQWVADQIFYQIFPDRFARSQSREAGQDKVYYHHAAGHDIVRKE
                     WDEPLTPQAGGSTFYGGCLNGICEKLPYLKTLGVTALYLNPVFTAPSVHKYDTEDYRH
                     VDPQFGGDRALLRLRRETQAQGMRLVLDGVFNHSGDSHAWFDRHNRSTGGACHHPDSP
                     WRDWYSFSPQGVALDWLGYPSLPKLDYQSETLVDEIYRGEDSIVRHWLKAPWNMDGWR
                     LDVVHMLGEAGGARHNLQHVAGITRAAKEAQPEAYIVGEHFGDARQWLQADAEDAAMN
                     YRGFTFPLWGFLANTDIAYEPQHIDARTCIAWMDNYRAGLSHQQQLRMFNQLDSHDTA
                     RFKTLLGKDAARLPLAVVWLFTWPGVPCIYYGDEVGVDGANDPMCRKPFPWDERKQDG
                     NLLALYQRMAKLRQRSLALRRGGCQALYAEGDVVVFVRVYQQQRALVAINRGEACEVA
                     LEALPLLNVAGWQCKTGSGDIREGRLSLPAISATVWMNR"
     gene            complement(505208..505810)
                     /locus_tag="SeHA_C0502"
     CDS             complement(505208..505810)
                     /locus_tag="SeHA_C0502"
                     /EC_number="1.11.1.15"
                     /note="identified by match to protein family HMM PF00578;
                     match to protein family HMM PF08534"
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin-2"
                     /protein_id="ACF67824.1"
                     /translation="MVLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPM
                     DFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEFVHNAWRNTPVDKGGIGPVKYAM
                     VADVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDA
                     LQFHEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL"
     gene            complement(506020..506601)
                     /gene="acpH"
                     /locus_tag="SeHA_C0503"
     CDS             complement(506020..506601)
                     /gene="acpH"
                     /locus_tag="SeHA_C0503"
                     /EC_number="3.1.4.14"
                     /note="identified by match to protein family HMM PF04336"
                     /codon_start=1
                     /transl_table=11
                     /product="[acyl-carrier-protein] phosphodiesterase"
                     /protein_id="ACF69952.1"
                     /translation="MNFLAHLHLAHLADSSLSGNLLADFVRGNPATHYPPDVVEGIYM
                     HRRIDVMTDNLPEVREAREWFRHETRRVAPITLDVMWDHFLSRHWTQISPDFPLQAFV
                     GYAHAQVATILPDSPPRFVNLNDYLWSEKWLERYRDMDFIQNVLNGMANRRPRLDALR
                     DSWYDLDAHYDALEERFWHFYPRMMAQAARKAL"
     gene            506695..507759
                     /gene="queA"
                     /locus_tag="SeHA_C0504"
     CDS             506695..507759
                     /gene="queA"
                     /locus_tag="SeHA_C0504"
                     /EC_number="5.-.-.-"
                     /note="identified by match to protein family HMM PF02547;
                     match to protein family HMM TIGR00113"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine:tRNA
                     ribosyltransferase-isomerase"
                     /protein_id="ACF68315.1"
                     /translation="MRVTDFSFELPESLIAHYPQPERSRCRLLSLEGPTGALTHGTFT
                     DLLDKLNPGDLLVFNNTRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPK
                     PGTELLLGDDESIHATMTARHGALFEVEFNDPRPVLDILNAIGHMPLPPYIDRPDEDA
                     DRELYQTVYSEKPGAVAAPTAGLHFDEPLLAALREKGVEMAFVTLHVGAGTFQPVRVD
                     TIEDHIMHSEYAEVPQEVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKSDLIEPF
                     FGDTQIFIYPGYQYKVIDALITNFHLPESTLIMLVSAFAGYQHTMNAYKTAVEQKYRF
                     FSYGDAMFITYNPQAISERP"
     gene            507956..509083
                     /gene="tgt"
                     /locus_tag="SeHA_C0505"
     CDS             507956..509083
                     /gene="tgt"
                     /locus_tag="SeHA_C0505"
                     /EC_number="2.4.2.29"
                     /note="identified by match to protein family HMM PF01702;
                     match to protein family HMM TIGR00430; match to protein
                     family HMM TIGR00449"
                     /codon_start=1
                     /transl_table=11
                     /product="queuine tRNA-ribosyltransferase"
                     /protein_id="ACF66259.1"
                     /translation="MKFELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPE
                     EVEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIR
                     KITEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSME
                     MSLRWAKRSRDRFDSLGNKNALFGIIQGSVYEDLRDISVKGLVEIGFDGYAVGGLAVG
                     EPKADMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGH
                     LFVTDGVVKIRNAKHKSDTSPLDAECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHN
                     LRYYQRLMAGLRKAIEEGKLESFVTEFYQRQGRPVPPLNVD"
     gene            509106..509438
                     /gene="yajC"
                     /locus_tag="SeHA_C0506"
     CDS             509106..509438
                     /gene="yajC"
                     /locus_tag="SeHA_C0506"
                     /note="identified by match to protein family HMM PF02699;
                     match to protein family HMM TIGR00739"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase, YajC subunit"
                     /protein_id="ACF67001.1"
                     /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQK
                     RTKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAEAGYIAIALNDTTEVVIKRDFVAAVL
                     PKGTMKAL"
     gene            509466..511313
                     /gene="secD"
                     /locus_tag="SeHA_C0507"
     CDS             509466..511313
                     /gene="secD"
                     /locus_tag="SeHA_C0507"
                     /note="identified by match to protein family HMM PF02355;
                     match to protein family HMM PF07549; match to protein
                     family HMM TIGR00916; match to protein family HMM
                     TIGR01129"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-export membrane protein SecD"
                     /protein_id="ACF70365.1"
                     /translation="MLNRYPLWKYIMLVVVIIVGLLYALPNLYGEDPAVQITGVRGVA
                     ASEQTLIQVQKTLQEEKIPAKSVALEEGAILARFDTTDTQLRAREALMSVLGDKYVVA
                     LNLAPATPRWLAAIHADPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLRE
                     KGIPYTTVRKENNYGLSITFRDSKARDEAIAYLTPRHRDLVISSQSGNQLRAVMTDAR
                     LSEAREYAVQQNINILRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGAT
                     ATLEFRLVNTNVDQAAAAAGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQD
                     EYNQPQVNISLDSAGGNIMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEV
                     INIANIQSRLGNSFRITGISNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNI
                     KQGLEACLAGLVVSILFMIFFYKKFGLIATSALVANLVLIVGIMSLLPGATLSMPGIA
                     GIVLTLAVAVDANVLINERIKEELSNGRTVQQAINEGYAGAFSSIFDANITTLIKVII
                     LYAVGTGAIKGFAITTGIGVATSMFTAIIGTRAIVNLLYGGKRVTKLSI"
     gene            511324..512295
                     /gene="secF"
                     /locus_tag="SeHA_C0508"
     CDS             511324..512295
                     /gene="secF"
                     /locus_tag="SeHA_C0508"
                     /note="identified by match to protein family HMM PF02355;
                     match to protein family HMM PF07549; match to protein
                     family HMM TIGR00916; match to protein family HMM
                     TIGR00966"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-export membrane protein SecF"
                     /protein_id="ACF66200.1"
                     /translation="MAQEYTVEQLNHGRKVYDFMRWDFWAFGISGLLLIAAIVIMGVR
                     GFNWGLDFTGGTVIEITLEKPAEMDVMREALQKAGYEEPQLQNFGSSHDIMVRMPPTE
                     GETGGQVLGSKVVTIINEATNQNAAVKRIEFVGPSVGADLAQTGAMALLVALISILVY
                     VGFRFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVS
                     DRIRENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLVVILMLYLFGGPVLEGFSLT
                     MLIGVSIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
     gene            512440..512805
                     /locus_tag="SeHA_C0509"
     CDS             512440..512805
                     /locus_tag="SeHA_C0509"
                     /note="identified by match to protein family HMM PF00903"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="ACF69976.1"
                     /translation="MKNLINWFEIPVTDMARAIAFYEQVMQISLRRETMDGADLAVFP
                     YVEPGPGGALIKQDDVAPVAQGVVIYLHTADLLASIERVVLAGGKCVLEPMVPGDDIG
                     TIALFIDSEGNRIGLHQPA"
     gene            512831..513523
                     /locus_tag="SeHA_C0510"
     CDS             512831..513523
                     /locus_tag="SeHA_C0510"
                     /note="identified by match to protein family HMM PF08279"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix, type 11"
                     /protein_id="ACF66097.1"
                     /translation="MTRRADRLFQIVQILRGRRLTTAALLAQRLAVSERTIYRDIRDL
                     SLSGVPVEGEAGSGYRLMAGFDLPPLMLTHRESEALMVAIRLLKTWGGDSLSRELESA
                     QEKVLAILPEESRRKAEQTRIYAPDLGASPHSRSAFDLIHQAVSAQQVLALHYRDEAG
                     HLSSRDIQPLGLFFWGEHWLLVAWCERREDYRCFRLDRCLQITPLNRRFRETIDRSLR
                     DFLRKVEHEKMP"
     gene            513693..514040
                     /locus_tag="SeHA_C0511"
     CDS             513693..514040
                     /locus_tag="SeHA_C0511"
                     /note="identified by match to protein family HMM PF01844"
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="ACF68988.1"
                     /translation="MAIIPKNYARLESGYREKALKLFPWVCGRCSREFVYSNLRELTV
                     HHIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGSTVIAGEDAQKDVGEATYN
                     PFADLKAMMNKKK"
     gene            514433..514585
                     /locus_tag="SeHA_C0512"
                     /note="conserved hypothetical protein; this gene contains
                     a frame shift which may be the result of sequencing error"
                     /pseudo
     gene            complement(514669..515532)
                     /locus_tag="SeHA_C0513"
     CDS             complement(514669..515532)
                     /locus_tag="SeHA_C0513"
                     /note="identified by match to protein family HMM PF03502"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-specific channel-forming protein tsx"
                     /protein_id="ACF68587.1"
                     /translation="MKKTLLAVSAALALTSSFTANAAENDQPQYLSDWWHQSVNVVGS
                     YHTRFSPKLNNDVYLEYEAFAKKDWFDFYGYIDIPKTFDWGNGNDKGIWSDGSPLFME
                     IEPRFSIDKLTGADLSFGPFKEWYFANNYIYDMGDNKASRQSTWYMGLGTDIDTGLPM
                     GLSLNVYAKYQWQNYGASNENEWDGYRFKVKYFVPITDLWGGKLSYIGFTNFDWGSDL
                     GDDPNRTSNSIASSHILALNYDHWHYSVVARYFHNGGQWQNGAKLNWGDGDFSAKSTG
                     WGGYLVVGYNF"
     gene            complement(515720..515857)
                     /locus_tag="SeHA_C0514"
     CDS             complement(515720..515857)
                     /locus_tag="SeHA_C0514"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF68954.1"
                     /translation="MIFSLLINKRSGGAFCAFRNIPRATFVALLTFPSFMTWIGNIHE
                     R"
     gene            complement(515832..516329)
                     /locus_tag="SeHA_C0515"
     CDS             complement(515832..516329)
                     /locus_tag="SeHA_C0515"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="ACF67307.1"
                     /translation="MSLTACAPQSEVRQMHQSISTLNKEMTQLNQETVKITQQNKLNA
                     ESTRGVYLLLGANTPARLESQIGTLRMTLLEITPVADGAHATLHIQGESRDPLPAFSA
                     TVEYGQLQGTTENYQEVNAQSLLVNAPASLRAPSDVNISLPLKGITPAQLGFIRIHDI
                     QPVNQ"
     gene            516404..516550
                     /locus_tag="SeHA_C0516"
     CDS             516404..516550
                     /locus_tag="SeHA_C0516"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF68090.1"
                     /translation="MVVRYTHKGTDPLSQKRSAFVVAPVQGKIAFPKSSGQDAVCIAH
                     FVSP"
     gene            516523..516972
                     /gene="nrdR"
                     /locus_tag="SeHA_C0517"
     CDS             516523..516972
                     /gene="nrdR"
                     /locus_tag="SeHA_C0517"
                     /note="identified by match to protein family HMM PF03477;
                     match to protein family HMM TIGR00244"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, NrdR family"
                     /protein_id="ACF66945.1"
                     /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVA
                     ELVMPRVIKSNDVREPFNEDKLRSGMLRALEKRPVSADDVEMALNHIKSQLRATGERE
                     VPSKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKDFGEEIARLQD"
     gene            516976..518079
                     /gene="ribD"
                     /locus_tag="SeHA_C0518"
     CDS             516976..518079
                     /gene="ribD"
                     /locus_tag="SeHA_C0518"
                     /EC_number="3.5.4.26"
                     /EC_number="1.1.1.193"
                     /note="identified by match to protein family HMM PF00383;
                     match to protein family HMM PF01872; match to protein
                     family HMM TIGR00227; match to protein family HMM
                     TIGR00326"
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin biosynthesis protein RibD"
                     /protein_id="ACF67611.1"
                     /translation="MQDEFYMARALKLAQRGRFTTHPNPNVGCVIVNNGDIVGEGYHH
                     RAGEPHAEVHALRMAGAKAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVAAMQD
                     PNPQVAGRGLYRLQQAGIAVSHGLMMSEAEALNKGFLKRMRTGFPYLQLKLGASVDGR
                     TAMASGESQWITSPQARRDVQRLRAQSHAILTSSATVLADDPALTVRWAELDASTQAS
                     YPQENLRQPVRIVIDSQNRVTPAHRIVQQPGETWIARTQEDSRAWPDAVRTISVPAHN
                     GHLDLVVLMMQLGRQQINSIWVEAGPGLAGALLQAGLVDELIVYVAPKLLGTQARGLC
                     ELPGLEKLADAPQFTFSEIRHVGPDVCLHMVSA"
     gene            518168..518638
                     /gene="ribH"
                     /locus_tag="SeHA_C0519"
     CDS             518168..518638
                     /gene="ribH"
                     /locus_tag="SeHA_C0519"
                     /EC_number="6.3.3.-"
                     /note="identified by match to protein family HMM PF00885;
                     match to protein family HMM TIGR00114"
                     /codon_start=1
                     /transl_table=11
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="ACF66041.1"
                     /translation="MNIIKANVAAPDARVAITIARFNQFINDSLLDGAVDALTRIGQV
                     KDDNITVVWVPGAYELPLATEALAKSGKYDAVVALGTVIRGGTAHFEYVAGGASNGLA
                     SVAQGSGVPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA"
     gene            518659..519078
                     /gene="nusB"
                     /locus_tag="SeHA_C0520"
     CDS             518659..519078
                     /gene="nusB"
                     /locus_tag="SeHA_C0520"
                     /note="identified by match to protein family HMM PF01029;
                     match to protein family HMM TIGR01951"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination factor
                     NusB"
                     /protein_id="ACF67753.1"
                     /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVD
                     VLYFRELLSGVATNSAYLDGLMKPYLSRLLEELGQVEKAVLRIALFELSKRSDVPYKV
                     AINEAIELAKTFGAEDSHKFVNGVLDKAAPVIRPNKK"
     gene            519157..520137
                     /gene="thiL"
                     /locus_tag="SeHA_C0521"
     CDS             519157..520137
                     /gene="thiL"
                     /locus_tag="SeHA_C0521"
                     /EC_number="2.7.4.16"
                     /note="identified by match to protein family HMM PF02769;
                     match to protein family HMM TIGR01379"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-monophosphate kinase"
                     /protein_id="ACF69797.1"
                     /translation="MACGEFSLIARYFDRVKSSRLDVETGIGDDCALLNIPEKQTLAI
                     STDTLVAGIHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLAA
                     FSDSLFEQLDYYDMQLIGGDTTRGPLSMTLGIHGLVPVGRALKRSGAKPGDWIYVTGT
                     LGDSAAGLAILRGDFRVGSWGDADYLVKRHLRPTPRILQGQALRDLASSAIDLSDGLI
                     SDLGHILQASNCGARIDLEALPDSEELWGHANDPEQKLRWMLSGGEDYELCFTVPELN
                     RGALDVALGHLGVPFTCIGQMTADIEGIAFVRDGEPVTFDWKGYDHFATP"
     gene            520124..520630
                     /gene="pgpA"
                     /locus_tag="SeHA_C0522"
     CDS             520124..520630
                     /gene="pgpA"
                     /locus_tag="SeHA_C0522"
                     /EC_number="3.1.3.27"
                     /note="identified by match to protein family HMM PF04608"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylglycerophosphatase A"
                     /protein_id="ACF66705.1"
                     /translation="MPRHKDVAKSRLNLRNPWHLLATGFGSGLSPVVPGTMGSLAAIP
                     FWYLMTFLPWQLYSLVVMFGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMAL
                     PTTDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIG
                     HHWPLGII"
     gene            complement(520734..521708)
                     /locus_tag="SeHA_C0523"
     CDS             complement(520734..521708)
                     /locus_tag="SeHA_C0523"
                     /note="identified by match to protein family HMM PF00248"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, aldo/keto reductase family"
                     /protein_id="ACF69936.1"
                     /translation="MQYNTLGNTDLRVSRLCLGCMTFGEPSRGNHAWTLPEESSRPII
                     KRALEGGINFFDTANSYSDGSSEEIVGRALRDFARRDEVVVATKVFHRVGDLPEGLSR
                     AQILRSIDDSLTRLGMEYVDILQIHRWDYTTPIEETLEALNDVVKAGKARYIGASSMH
                     ASQFAQALALQKQHGWAPFVTMQDHYNLIYREEEREMLPLCWQEGVAVIPWSPLARGR
                     LTRPWGETTARLVSDDVGKNLYDESDKNDAQIAERLAGVSEALGATRAQVALAWLLSK
                     RGVAAPIIGTSREEQLDELLNAVDLTLKPEQIAELETPYKQHPVVGFK"
     gene            complement(521765..523627)
                     /gene="dxs"
                     /locus_tag="SeHA_C0524"
     CDS             complement(521765..523627)
                     /gene="dxs"
                     /locus_tag="SeHA_C0524"
                     /EC_number="2.2.1.7"
                     /note="identified by match to protein family HMM PF02779;
                     match to protein family HMM PF02780; match to protein
                     family HMM TIGR00204"
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="ACF70423.1"
                     /translation="MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVS
                     RSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKG
                     GLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMA
                     FEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSG
                     VPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLKGPQ
                     FLHIMTKKGRGYEPAEKDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAA
                     KDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIY
                     STFLQRAYDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMT
                     PSDENECRQMLLTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGLVKRHGEKLAI
                     LNFGTLMPEAAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAG
                     SGVNEVLMAHRKPVPVLNIGLPDFFIPQGTQEEARAELGLDAAGIEAKIKAWLA"
     gene            complement(523651..524550)
                     /gene="ispA"
                     /locus_tag="SeHA_C0525"
     CDS             complement(523651..524550)
                     /gene="ispA"
                     /locus_tag="SeHA_C0525"
                     /EC_number="2.5.1.10"
                     /note="identified by match to protein family HMM PF00348"
                     /codon_start=1
                     /transl_table=11
                     /product="geranyltranstransferase"
                     /protein_id="ACF69008.1"
                     /translation="MDFTQQLQACVTQANQALSRFIAPLPFQNTPVVEAMQYGALLGG
                     KRLRPFLVYATGQMFGVSTATLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCH
                     IKFGEANAILAGDALQTLAFAIISDAPMPEVTDRDRIAMIAELANASGIAGMCGGQAL
                     DLAAEGQRITLDALERIHRHKTGALIRAAVRLGALSAGDKGRNTLPILDRYAESIGLA
                     FQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARNKARDLIEDARQSLHQ
                     LAAQSLDTSALEALANYIIQRDK"
     gene            complement(524551..524793)
                     /gene="xseB"
                     /locus_tag="SeHA_C0526"
     CDS             complement(524551..524793)
                     /gene="xseB"
                     /locus_tag="SeHA_C0526"
                     /EC_number="3.1.11.6"
                     /note="identified by match to protein family HMM PF02609;
                     match to protein family HMM TIGR01280"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease VII, small subunit"
                     /protein_id="ACF68377.1"
                     /translation="MPKKNEAPASFETALSELEHIVTRLESGDLPLEDALNEFERGVQ
                     LARQGQAKLQQAEQRVQILLSDNEEASPEPFIADNE"
     gene            525003..526451
                     /gene="thiI"
                     /locus_tag="SeHA_C0527"
     CDS             525003..526451
                     /gene="thiI"
                     /locus_tag="SeHA_C0527"
                     /note="identified by match to protein family HMM PF02568;
                     match to protein family HMM PF02926; match to protein
                     family HMM TIGR00342"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis/tRNA modification protein
                     ThiI"
                     /protein_id="ACF67201.1"
                     /translation="MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVV
                     RHWDNIEVRAKDENQRLAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALAQYREQL
                     EGKTFCVRVKRRGKHEFSSIEVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLL
                     LIKGRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEI
                     GVRQVAHYLWNRFGSSHRVRFVAINFEPVVGEILEKVDDGQMGVVLKRMMVRAASKVA
                     ERYGVQALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISYDKEHIINLARQIGTE
                     DFARTMPEYCGVISKSPTVKAIKAKIEAEEENFDFSILDKVVEEANNVDIREIAQQTQ
                     QEVVEVETVSGFGPNDVILDIRSVDEQDDKPLKVEGVDVVSLPFYKLSTKFGDLDQSK
                     TWLLWCERGVMSRLQALYLREQGFANVKVYRP"
     gene            complement(526495..527292)
                     /gene="phnV"
                     /locus_tag="SeHA_C0528"
     CDS             complement(526495..527292)
                     /gene="phnV"
                     /locus_tag="SeHA_C0528"
                     /note="identified by match to protein family HMM PF00528;
                     match to protein family HMM TIGR03255"
                     /codon_start=1
                     /transl_table=11
                     /product="2-aminoethylphosphonate ABC transport system,
                     membrane component PhnV"
                     /protein_id="ACF66576.1"
                     /translation="MLIWSPKGRAAAGVVASVLFIVFFFLPLAVILMSSLSQQWNGIL
                     PSGFTLNHFVNALHGAAWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLS
                     MVFYLPSAIPSVSVGLGILVAFSQGPLQMNGTLWIVLTAHFVLISAFTFSNVSTGLAR
                     ISADIENVASSLGASPWYRLRHVTLPLLMPWMVSALALSLSLSMGELGATMMIYPPGW
                     TTLPVAIFSLTDRGNIADGAALTIVLVAITLLLMMKLERIAKRLGQK"
     gene            complement(527286..528155)
                     /gene="phnU"
                     /locus_tag="SeHA_C0529"
     CDS             complement(527286..528155)
                     /gene="phnU"
                     /locus_tag="SeHA_C0529"
                     /note="identified by match to protein family HMM PF00528;
                     match to protein family HMM TIGR03226"
                     /codon_start=1
                     /transl_table=11
                     /product="2-aminoethylphosphonate ABC transporter,
                     permease protein"
                     /protein_id="ACF68280.1"
                     /translation="MSLILPLEKPALNLRPLLWLLLPLLVLATLFFWPLSLIVEQALR
                     GANGEIGLETFRQVVDSKRFVGALLNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSE
                     LIGRVVDTFIALPTFLITLAFTFIYGSAGLLNGALMSLFAFELPPVDFLYSMQGVILA
                     EITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVIGQVIFPAALPALMAGGSLC
                     LLLTTNEFGIVLFIGAKGVNTLPMMVYSKAILESDYTVACMIALINIVLSLGLFSLYR
                     LAASRTGVRSQPC"
     gene            complement(528158..529267)
                     /gene="phnT"
                     /locus_tag="SeHA_C0530"
     CDS             complement(528158..529267)
                     /gene="phnT"
                     /locus_tag="SeHA_C0530"
                     /note="identified by match to protein family HMM PF00005;
                     match to protein family HMM PF08402; match to protein
                     family HMM TIGR03258"
                     /codon_start=1
                     /transl_table=11
                     /product="2-aminoethylphosphonate ABC transport system,
                     ATP-binding component PhnT"
                     /protein_id="ACF67625.1"
                     /translation="MLMKTTAVHVPASQGTSGIVLDSLRVAYHGNVVLKPLSLTIEPG
                     EVLALIGPSGSGKTTVLRAVAGFVQPAGGRILIGDTDVTHLPPYKRGLAMVVQNYALF
                     PHLKVEDNVAFGLRAQKQPKALINERVTQALKTVGMSDYAARYPHQLSGGQQQRVAIA
                     RAIAVRPRVLLLDEPLSALDAQIRHNMVEEIACLHRELPELTILYVTHDQTEALTLAD
                     KIGIMKDGSLIAHGETRALYQHPPNRFAAEFLGRANILSAIALGITEAPGLVDVSCGG
                     AVIRAFSRGSHHGYNKLLCIRPQHLSLTPRSAYSNRFNATLQSVHWQGDLTHLLCDVA
                     GETVRMVLTHVNPLPRVGDKLALWFEPDDAVLIEV"
     gene            complement(529273..530286)
                     /gene="phnS"
                     /locus_tag="SeHA_C0531"
     CDS             complement(529273..530286)
                     /gene="phnS"
                     /locus_tag="SeHA_C0531"
                     /note="identified by match to protein family HMM PF01547;
                     match to protein family HMM TIGR03227"
                     /codon_start=1
                     /transl_table=11
                     /product="2-aminoethylphosphonate ABC transporter,
                     2-aminoethylphosphonate binding protein"
                     /protein_id="ACF69291.1"
                     /translation="MKLSRLALLSVFALASAPSWAESVVTVYSIDGLHDGDNSWYQVQ
                     FDAFTKATGITVRYVEGGGGVVVERLAKERTNPQADVLVTAPPFIQRAAAEKLLANFN
                     TDAASAIPDANNLYSPLVKNYLSFIYNSKLLKTAPASWQDLLDGNFKNKLQYSTPGQA
                     ADGTAVMLQAFHSFGSKDAGFAYLGKLQANNVGPSASTGKLTALVNKGEIYVANGDLQ
                     MNLAQMERNPNVKIFWPANDKGERSALAIPYVIGLVQGAPQSENGKKLINFLLSKEAQ
                     TRVSELSWGMPVRSDVTPSDEHYKTATAALEGVQSWQPNWDDVAVSLSADISRWHKVT
                     ESE"
     gene            complement(530484..531203)
                     /locus_tag="SeHA_C0532"
     CDS             complement(530484..531203)
                     /locus_tag="SeHA_C0532"
                     /note="identified by match to protein family HMM PF00392;
                     match to protein family HMM PF07702; match to protein
                     family HMM TIGR03337"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator protein"
                     /protein_id="ACF68644.1"
                     /translation="MKSIPGDIPQYLLIKAQLQARIQSGALKSGDKLPSERELCAIFN
                     TTRITIRESLAQLESSGLIWRADRRGWFVTPERLWLDPTQNTNFHKLCREQGREPKTA
                     LLSGVLTTVPVEVMEPLQLQPFDQIYLLTRLRYADGRAVCYCENHCLPARVPELLQYD
                     LNGSLTEVYESHYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLRRLNYDQHGR
                     VLDLDIEYWRHDSLRIEVDTH"
     gene            531343..532446
                     /gene="phnW"
                     /locus_tag="SeHA_C0533"
     CDS             531343..532446
                     /gene="phnW"
                     /locus_tag="SeHA_C0533"
                     /EC_number="2.6.1.37"
                     /note="identified by match to protein family HMM PF00266;
                     match to protein family HMM TIGR02326; match to protein
                     family HMM TIGR03301"
                     /codon_start=1
                     /transl_table=11
                     /product="2-aminoethylphosphonate--pyruvate transaminase"
                     /protein_id="ACF66903.1"
                     /translation="MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIR
                     QQLTELATASEGYTSVLLQGSGSYAVEAVLGSALGPQDKVLIVSNGAYGARMVEMAGL
                     MGIAHHAYDCGEVARPDVQAIDAILNADPTISHIAMVHSETTTGMLNPIDEVGALAHR
                     YGKTYIVDAMSSFGGIPMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGH
                     SRSLSLDLYAQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQ
                     RSLVAGMRALGFNTLLDDELHSPIITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVS
                     QSDCFRIGNIGEVYAADITALLTAIRTAMYWMK"
     gene            532456..533265
                     /gene="phnX"
                     /locus_tag="SeHA_C0534"
     CDS             532456..533265
                     /gene="phnX"
                     /locus_tag="SeHA_C0534"
                     /EC_number="3.11.1.1"
                     /note="identified by match to protein family HMM PF00702;
                     match to protein family HMM TIGR01422; match to protein
                     family HMM TIGR01509"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonoacetaldehyde hydrolase"
                     /protein_id="ACF66343.1"
                     /translation="MNRIHAVILDWAGTTVDFGSFAPTQIFVEAFRQAFDVEITLAEA
                     RVPMGLGKWQHIEALGKLPAVDARWQAKFGRSMSAADIDAIYAAFMPLQIAKVVDFSS
                     PIAGVIDTIAALRAEGIKIGSCSGYPRAVMERLVPAAAEHGYRPDHWVATDDLAAGGR
                     PGPWMALQNVIALGIDAVAHCVKVDDAAPGISEGLNAGMWTVGLAVSGNEFGATWDAY
                     QTMSKEDVAVRREHAASKLYAAGAHYVVDSLADLPGVIAHINARLAQGERP"
     gene            complement(533362..533952)
                     /locus_tag="SeHA_C0535"
     CDS             complement(533362..533952)
                     /locus_tag="SeHA_C0535"
                     /note="identified by match to protein family HMM PF01965;
                     match to protein family HMM TIGR01383"
                     /codon_start=1
                     /transl_table=11
                     /product="protein ThiJ"
                     /protein_id="ACF67911.1"
                     /translation="MSAQALVCLAPGSEETEAVTTIDLLVRGGIHVTTASVASDGNLT
                     IVCSRGVKLLADAPLVEVADGDYDIIVLPGGIKGAECFRDSPLLVETVKQFHRSGRIV
                     AAICAAAATVLVPHDIFPIGNMTGFPALKDKIPAEQWQDKRVVWDARVKLLTSQGPGT
                     AIDFGLKIIDLLAGREKAHEVASQLVMAAGIYNYYE"
     gene            complement(533915..534826)
                     /gene="panE"
                     /locus_tag="SeHA_C0536"
     CDS             complement(533915..534826)
                     /gene="panE"
                     /locus_tag="SeHA_C0536"
                     /EC_number="1.1.1.169"
                     /note="identified by match to protein family HMM PF02558;
                     match to protein family HMM PF08546; match to protein
                     family HMM TIGR00745"
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="ACF67418.1"
                     /translation="MKITVLGCGALGQLWLSALCKHGHDVQGWLRVPQPYCSVNLIDT
                     DGSFFNESLTANDPDFLAKSELLLVTLKAWQVSDAVRTLASTLPVTSPILLIHNGMGT
                     IEELQNIQQPMLMGTITHAARRDGNIIIHVANGTTHIGPAREQDGDYSYLADILQGVL
                     PDVAWHNNIRAEMWRKLAVNCVINPLTALWNCPNGELRHHTDEINAICEEVAAVIERE
                     GYHTSADDLRYYVEQVIDSTAENISSMLQDVRAMRHTEIDYITGYLLKRARVHGLAVP
                     ENSRLFEMVKRKESEYERSGTGMPRPW"
     gene            534952..535443
                     /locus_tag="SeHA_C0537"
     CDS             534952..535443
                     /locus_tag="SeHA_C0537"
                     /note="identified by match to protein family HMM PF04461"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF67583.1"
                     /translation="MPSFDIVSEVDLQEARNGVDNAVREVESRFDFRGVEATIELNDA
                     NKTIKVLSESDFQVNQLLDILRAKLLKRGIEGASLDVSDEFVHSGKTWYVEAKLKQGI
                     ESAVQKKIVKLIKDSKLKVQAQIQGEEIRVTGKSRDDLQSVMALVRGGDLGQPFQFKN
                     FRD"
     gene            complement(535490..536854)
                     /locus_tag="SeHA_C0538"
     CDS             complement(535490..536854)
                     /locus_tag="SeHA_C0538"
                     /note="identified by match to protein family HMM PF07690"
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane transport protein YajR"
                     /protein_id="ACF65899.1"
                     /translation="MNDYKMTPGELRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQG
                     ASEALIGIAIGIYGLAQAIFQIPFGLLSDRIGRKPLIVGGLAVFVAGSVIAALSHSIW
                     GIILGRALQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIVTH
                     SLGLNALFWMIAALATLGILLTIWVVPNSTNHVLNRESGMVKGSFSKVLAEPRLLKLN
                     FGIMCLHILLMSTFVALPGQLADAGFPAAEHWKVYLATMVIAFAAVVPFIIYAEVKRR
                     MKQVFLFCVGLIVVAEIVLWGAGQHFWELVIGVQLFFLAFNLMEALLPSLISKESPAG
                     YKGTAMGVYSTSQFLGVALGGSLGGWIDGTFDGQTVFLAGAVLAMVWLAVASTMKEPP
                     YVSSLRVEIPADIVADDRLKQRLLAMKGVSEALIVAEEHSAYVKIDSKVTNRFEVEQL
                     ISKG"
     gene            537379..538890
                     /locus_tag="SeHA_C0539"
     CDS             537379..538890
                     /locus_tag="SeHA_C0539"
                     /note="identified by match to protein family HMM PF08238"
                     /codon_start=1
                     /transl_table=11
                     /product="putative periplasmic protein"
                     /protein_id="ACF66590.1"
                     /translation="MKIKFLSLCILAGVLFVSQVNASANNGKDDVKYAALTQKDLDAL
                     PVEKRASVLDELGFIHEYGIGVPMNRERALQYYKQACELGGNYGCYNVKYAYQYGDGV
                     AKDSAQANKYAKKMNLDNLLIEQEYIDKFSQEIYMAKALADTDKSQRAAFISILIHAL
                     NNRPESDALFFSRIGFNQEKTFRLATLWSQDGDPQMDYQMGRLTLNDFSGRYADEPYQ
                     ARPASLKWFRAAAEKGVVEAQSLLGSIYSGGEGDEWGIKPDIQEAQKWYGQAAKQGDS
                     DAQIALGKIYYSGATGRTDYAKALALFTQVENDGTNSRSTMPLSWMYYNGLGTAPDCD
                     KAWSYYKKASRYVGKMVEEKIFLSKCAADIQSRKNNADALPKVTLKKESVFSRGITAK
                     PKECALIFQIGTDKIRNMANLHITLELKNDDGMATEETLMIPPFGLNTLGIDMQNHDV
                     DPLITTYDLPLYTQDFCHGIGDIHFTLKSATATINGKNVDLLKADSVRFLDKE"
     gene            538902..540395
                     /locus_tag="SeHA_C0540"
     CDS             538902..540395
                     /locus_tag="SeHA_C0540"
                     /note="identified by match to protein family HMM PF08238"
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="ACF69445.1"
                     /translation="MIKRKWSILFLLGLSFASVCQAGDDIDALYSRIAQKDIQALNEL
                     KALAKDNNAQALAELGFIYEYGVSVSVDIPQAIKYYEQACDLDGDYGCFNAAYFYEYG
                     IGTQKDITQAKTLAKQLREKINLSNINLDKKVSERIIGSVYSNKLEAYRDLSFRPHFI
                     QGLSFYFYAPQSDERKLLSRIGFDSSHLARIAILWAREGDPEVAYQTAKLVSTLYFNN
                     ETKTIDIAEALKWLRISAEKGDADSQTLLGFLYEHAGLGLQPDGEKARKWYEMAAQQG
                     NGEALYTLGRMYYSGVMVNVDYDKALYFFKKAYEKELQAAADYLAQMYFNGQSVDVDC
                     QQSWHYYDNSYIKKMTQRDYLDYCEKDRKRRNDFSQQLPELTLEKYAGLFGRIDNIPL
                     CQIGFVVNTNKLIHVANLRVELILKNDAGVSDERMVAFPPLGLNTLGAEQGMGDSFKS
                     MGYLLMKNGDLCDYHKLTFTVKSATATINGKKVDLLKTDNLHIIQNR"
     gene            complement(540477..541364)
                     /gene="cyoE"
                     /locus_tag="SeHA_C0541"
     CDS             complement(540477..541364)
                     /gene="cyoE"
                     /locus_tag="SeHA_C0541"
                     /EC_number="2.5.1.-"
                     /note="identified by match to protein family HMM PF01040;
                     match to protein family HMM TIGR01473"
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="ACF70271.1"
                     /translation="MFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVG
                     VSLVVASGCVFNNYIDRDIDRKMERTKNRVLVKGLISPGVSLVYATLLGIAGFMLLWF
                     GANPLACWLGVMGFVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGDFDSG
                     AAILLAIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVA
                     TLMLTLGGYAGYKYLVVAAAVSVWWLGMALRGYKVEDDKVWARKLFGFSIIAITALSI
                     MMSVDFMVPNSQNLLTYVW"
     gene            complement(541379..541708)
                     /gene="cyoD"
                     /locus_tag="SeHA_C0542"
     CDS             complement(541379..541708)
                     /gene="cyoD"
                     /locus_tag="SeHA_C0542"
                     /EC_number="1.10.3.-"
                     /note="identified by match to protein family HMM PF03626;
                     match to protein family HMM TIGR02847"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome o ubiquinol oxidase, subunit IV"
                     /protein_id="ACF69111.1"
                     /translation="MSHSTESGGASHGSVKTYMTGFILSVILTVIPFWMVMTGAASPA
                     VILGSILAMAVVQILVHLVCFLHMNTKSDEGWNMTAFIFTVLIIAILVVGSIWIMWNL
                     NYNMMMH"
     gene            complement(541708..542322)
                     /gene="cyoC"
                     /locus_tag="SeHA_C0543"
     CDS             complement(541708..542322)
                     /gene="cyoC"
                     /locus_tag="SeHA_C0543"
                     /EC_number="1.10.3.-"
                     /note="identified by match to protein family HMM PF00510;
                     match to protein family HMM TIGR02842"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome o ubiquinol oxidase, subunit III"
                     /protein_id="ACF69208.1"
                     /translation="MATDTLTHATAHAHEHGHHDAGQNKIFGFWVYLMSDCILFSILF
                     ATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMHKNNKSQVISWL
                     ALTFLFGAGFIGMELYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVL
                     MVQVARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVVYLMGAM"
     gene            complement(542312..544303)
                     /gene="cyoB"
                     /locus_tag="SeHA_C0544"
     CDS             complement(542312..544303)
                     /gene="cyoB"
                     /locus_tag="SeHA_C0544"
                     /EC_number="1.10.3.-"
                     /note="identified by match to protein family HMM PF00115;
                     match to protein family HMM TIGR02843"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome o ubiquinol oxidase, subunit I"
                     /protein_id="ACF67385.1"
                     /translation="MFGKLSLDAVPFHEPIVMVTIAAIIVGGLAILAAITYFGKWTYL
                     WKEWLTSVDHKRLGIMYIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQI
                     FTAHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNLSL
                     GVGEFAQTGWLAYPPLSGIEYSPSVGVDYWIWALQLSGIGTTLTGINFFVTILKMRAP
                     GMTMFKMPVFTWASLCANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYI
                     NLIWAWGHPEVYILILPVFGVFSEIAATFSRKRLFGYTSLVWATVCITVLSFIVWLHH
                     FFTMGAGANVNA