LOCUS       CP000915             1893886 bp    DNA     circular BCT 31-JAN-2014
DEFINITION  Francisella tularensis subsp. mediasiatica FSC147, complete genome.
ACCESSION   CP000915
VERSION     CP000915.1
DBLINK      BioProject: PRJNA19571
            BioSample: SAMN02604345
KEYWORDS    .
SOURCE      Francisella tularensis subsp. mediasiatica FSC147
  ORGANISM  Francisella tularensis subsp. mediasiatica FSC147
            Bacteria; Proteobacteria; Gammaproteobacteria; Thiotrichales;
            Francisellaceae; Francisella.
REFERENCE   1  (bases 1 to 1893886)
  AUTHORS   Larsson,P., Elfsmark,D., Svensson,K., Wikstrom,P., Forsman,M.,
            Brettin,T., Keim,P. and Johansson,A.
  TITLE     Molecular evolutionary consequences of niche restriction in
            Francisella tularensis, a facultative intracellular pathogen
  JOURNAL   PLoS Pathog. 5 (6), E1000472 (2009)
   PUBMED   19521508
REFERENCE   2  (bases 1 to 1893886)
  AUTHORS   Brettin,T.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2007) Los Alamos National Laboratories, Los
            Alamos, NM, USA
REFERENCE   3  (bases 1 to 1893886)
  AUTHORS   Johansson,A. and Elfsmark,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2007) Swedish Defense Research Agency, Umea,
            Sweden
REFERENCE   4  (bases 1 to 1893886)
  AUTHORS   Keim,P.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2007) Northern Arizona University, Flagstaff, AZ,
            USA
COMMENT     The authors wish to acknowledge the Intelligence Technology
            Innovation Center for funding the sequencing and the Swedish
            Defense Research Agency in cooperation with the Medical Faculty at
            Umea University, Sweden for funding the annotation.
            
            F. tularensis subsp. mediasiatica FSC147 DNA was provided by the
            Swedish Defense Research Agency.
FEATURES             Location/Qualifiers
     source          1..1893886
                     /organism="Francisella tularensis subsp. mediasiatica
                     FSC147"
                     /mol_type="genomic DNA"
                     /strain="FSC147; GIEM 543"
                     /isolation_source="Midday Gerbil"
                     /sub_species="mediasiatica"
                     /db_xref="taxon:441952"
     gene            130..1521
                     /gene="dnaA"
                     /locus_tag="FTM_0001"
     CDS             130..1521
                     /gene="dnaA"
                     /locus_tag="FTM_0001"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="ACD30120.1"
                     /translation="MEQNSNLFTVYCNNEYFKKHIKSKYGNLILSTIQECHGNDLIIE
                     YSNKKFSGEKITEVITAGPQANFFSTTSVEIKDESEDTKVVQEPKISKKSNSKDFSSS
                     QELFGFDEAMLITAKEDEEYSFGLPLKEKYVFDSFVVGDANKIARAAAMQVSINPGKL
                     HNPLFIYGGSGLGKTHLMQAIGNHAREVNPNAKIIYTNSEQFIKDYVNSIRLQDQDEF
                     QRVYRSADILLIDDIQFIAGKEGTAQEFFHTFNALYENGKQIILTSDKYPNEIEGLEE
                     RLVSRFGYGLTVSVDMPDLETRIAILLKKAHDLGQKLPNETAAFIAENVRTNVRELEG
                     ALNRVLTTSKFNHKDPTIEVAQACLRDVIKIQEKKVKIDNIQKVVADFYRIRVKDLTS
                     NQRSRNIARPRQIAMSLARELTSHSLPEIGNAFGGRDHTTVMHAVKAITKLRQSNTSI
                     SDDYELLLDKISR"
     gene            1558..2661
                     /gene="dnaN"
                     /locus_tag="FTM_0002"
     CDS             1558..2661
                     /gene="dnaN"
                     /locus_tag="FTM_0002"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, beta subunit"
                     /protein_id="ACD30121.1"
                     /translation="MNFVLNRDDLLKPLQSMLSVANSKSTMPLLSCILFDIDNNNLKI
                     TASDLDTEISCNIAVSCNTTIKLALNADKIYNIVRSLNENSMIDFRINENKVTIVSNN
                     STFNLISLNADNYPLIDSNINEQASFDLSQQDFHHIISKVDFSMANDDTRYFLNGMFW
                     EINANLLRAVSTDGHRMSITEAIIDSKVLDSASKSIIPKKAILELKKIVGKTEENIKI
                     CLGKNYLKAIFGNYAFISKLIDGRYPDYQKVIPKNNTKLLAVDKQFFKNSLLRTSILA
                     NDKYKGVRLNISQNQLLLSANNPDNEKAEDKIEVQYNDQPMEICFNYKYLLDIINVLS
                     EETMSIYLDNPNMSALVKDEKDNSLFIIMPMKI"
     gene            complement(2692..3027)
                     /locus_tag="FTM_0003"
                     /note="metabolite:H+ symporter (MHS) family protein;
                     fragment, IS insertion"
                     /pseudo
     mobile_element  complement(3093..3843)
                     /mobile_element_type="insertion sequence:isftu1"
     gene            complement(4828..6051)
                     /gene="sdaC"
                     /locus_tag="FTM_0004"
     CDS             complement(4828..6051)
                     /gene="sdaC"
                     /locus_tag="FTM_0004"
                     /codon_start=1
                     /transl_table=11
                     /product="serine permease"
                     /protein_id="ACD30122.1"
                     /translation="MKRNEDLMWSLSLYGTAIGAGVLFLPIQTGISGIIPILVILVFI
                     FPMVFLSHRALCRFVISNPNTNSDITVVADDYFGKLGGIIFNILYLFAILPILLVYSV
                     GITNTLASFFKYQFHYDIQNRFLLSFFTILSLVFIINFGQKLIIRVMSLLVFPFIIAL
                     LVLSLWMMPYWNIEILQKSIEYNHSFSGILIAIWIIMPILIFSFNHSPIISSLAVYAK
                     TKYKQNADKKASKIIAFSNILMIITVVIFVISSMLTLSPKELIIAKEENISILSYLAS
                     HFNNYSLDYVAPIVALVAMSKSFFGHYLGSKEGIDGLVYKVTKNKISEKTIKPITLSI
                     VFLSCWLVAYLNPNILDMISSIGGLVLAVILFIMPIYSIYKIKYLKPYKNLLADSFIL
                     FVGIIALSSAIYVLL"
     gene            complement(6379..6615)
                     /locus_tag="FTM_0005"
     CDS             complement(6379..6615)
                     /locus_tag="FTM_0005"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30123.1"
                     /translation="MDKLQALSSKLNFKNFSHGYNNSTKRLNKDFNYAFSMEFNSTAE
                     RDNYESDPIHINIAKQHLLPLINNNTESILVFDF"
     gene            7112..7990
                     /locus_tag="FTM_0006"
     CDS             7112..7990
                     /locus_tag="FTM_0006"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyisobutyrate dehydrogenase family
                     protein"
                     /protein_id="ACD30124.1"
                     /translation="MSKQVGIIGLGNMGSVVIDHLLTSGYEIFIHNRTKAKAEKWLRN
                     TQVVWCDSPKELAENCEIIICCLYNDIAAKNVYLSKNGLTSINLVNHTILDASTLSVS
                     CFEQLNKVVTQNNGKLIDMPISGNPAALQEKRALIMLGATEEECKSFVHFLEALSNKI
                     LYLDIAGSALKEKLCINEMLFTQWFSYCEAMLLAENNGIKTEDFFKAMSQSVISSPLL
                     VQRSQYFFGYNVNLSDLNMILKDIDIIEDFVNKSKTKVTLLQKFREVVEYAIKHDFTN
                     QDFYGLYRAYKEIYKK"
     gene            complement(8004..8924)
                     /gene="pyrB"
                     /locus_tag="FTM_0007"
     CDS             complement(8004..8924)
                     /gene="pyrB"
                     /locus_tag="FTM_0007"
                     /EC_number="2.1.3.2"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase"
                     /protein_id="ACD30125.1"
                     /translation="MLSFQKLLRGDQITKDDLFKLFHQADIYKNKLANSEPIKDLEGK
                     ILASLFFEPSTRTRFSFESAMNRLGGKVISLENGSSSSTQKGETLDDTGRMIDQYADI
                     IVMRHPKPHSVEEFSKYVNSPVINAGDGENEHPTQSLVDLYTIYSEKGSLDNLKVGFL
                     GDLKYGRTVHSLTNILAKYNASFKFISSKELQIPKKLKDFIIKNGNSFIELDKVSADV
                     LEDLDVLYVTRVQRERFPDEESYLKNKDLCYLDRKHIFPRSNFIILHPLPRVDEMDRS
                     IDELECAKYFEQIKYSIPIRMALLALLVIS"
     gene            complement(9066..12350)
                     /gene="carB"
                     /locus_tag="FTM_0008"
     CDS             complement(9066..12350)
                     /gene="carB"
                     /locus_tag="FTM_0008"
                     /EC_number="6.3.5.5"
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyl-phosphate synthase, large subunit"
                     /protein_id="ACD30126.1"
                     /translation="MPKRTDIKSILVLGAGPIVIGQACEFDYSGTQACKVLKEDGYTV
                     FLVNSNPATIMTDPTTADKIFIEPITVESVGKIIARERPDAILPTVGGQTALNCALAL
                     DKAGILEKYNVEMLGAKADSIDKAENRERFNKAMAKIGLEVPRNVVVQSMEQAYKALE
                     DIGLPAIIRPSFTLGGSGGGIAYTKEEFEKIVKNGLSLSPTNEVLIDESILGWKEYEM
                     EVIRDKADNSIIVCSIENIDPMGIHTGDSITVAPALTLTDKEYQIMRDASIAVLREIG
                     VETGGSNVQFAVNPKDGKLVVIEMNPRVSRSSALASKATGYPIAKVAARLAVGYTLDE
                     IDNDITKVTPASFEPTIDYIVTKIPRFTFEKFPTTPSNLSSQMKSVGEAMAIGRSFIE
                     SLQKALVSLETGLTGLDQVEIPGVDESKSLKENKTAILKSLEELSPMRILRVAQALRY
                     DISQQEIHDACKIDPWFIEQIAIIIDAEERLKKTGLPNSKEEFSVYKNLGFSDAKIAE
                     LVGRTERYIRNFRFGKEIYPTFKRVDTCAAEFESQSSYLYSTYEHYSYEEIVRDCESE
                     ISDKKKVIILGGGPNRIGQGIEFDYACVHAAKSLKEEGIETIMINCNPETVSTDYDTS
                     DKLYFEPLMAENVLNIIKNEMRKGEVLGVIVQFGGQTPLKLVSALHENNIPILGTDPD
                     KIDLAEDRERFKELLDKVGLKQPLNTIAYTINELKKKIVNVGYPVVVRPSNVLGGRAM
                     EIIHSQEELDAYIKTNSKCILEGPILIDKFLEDATELDVDALTDGGERVFVAGIMEHI
                     EEAGIHSGDSACSIPTRSLSNEQIEEVKQATIKLARELNVIGLMNVQFAYQNGQLYVI
                     EVNPRASRTVPFVAKATGNSIANIATKLMLGKKLSEFILNNPIPRHFSVKEAVFPFGR
                     FADVDCYLGPEMKSTGEAMGIDRTFGVAFYKAQEMSFNKLPLKGNILISVSNADKPKI
                     IEPVKELIELGFNIFATKGTERFLKENGIECKLFDKASDNIGNDQVHSTVKAIEAGEV
                     DLLVNTSIRQELKISLALRRAAIMSRVSYVTTIGAFEAFVIAVRDMRKINNDFDVKTV
                     KEWINS"
     gene            complement(12355..13521)
                     /gene="carA"
                     /locus_tag="FTM_0009"
     CDS             complement(12355..13521)
                     /gene="carA"
                     /locus_tag="FTM_0009"
                     /EC_number="6.3.5.5"
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyl-phosphate synthase, small subunit"
                     /protein_id="ACD30127.1"
                     /translation="MILANDMTNAILVFPDGTYYLGRSIGVRGWTDGEICFNTSMTGY
                     QETLTDPSYAGQIITFTFPHIGNVGINNEDNESLGVFAKGLIVRENLTNPSNFRAKKH
                     IDTWLKNRNIVGLCGVDTRAIVRKVRKEGAVRVAILSVKPGEFLDANYVRSRIKNKSN
                     LNGRDLAISVTTNREYDWNEHTFTLGQQVYKQQQSYKYSVVVIDYGVKYNILRNLVDA
                     GFKVTVVPADSTYEDIMKHNPDGVFLSNGPGDPFATSDYTMPVIKKLLEVKMPIFGIC
                     LGNQLLALAAGLKTKKMHKGHRGVNQPVLDANTKKVLITSQNHGFVVCDDNVPDNIQI
                     HMSSLFDGTVEGLRFKDRPAFAVQYHPESSPGPHDCKYLFNEFAEMIAESKKGN"
     gene            13937..14992
                     /locus_tag="FTM_0010"
     CDS             13937..14992
                     /locus_tag="FTM_0010"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine acid phosphatase"
                     /protein_id="ACD30128.1"
                     /translation="MKKIFVSFTLLFFLIPVGYSSKLIFVSMITRHGDRAPFANIENA
                     NYSWGTELSELTPIGMNQEYNLGLQLRKRYIDKFGLLPEHYVDQSIYVLSSHTNRTVV
                     SAQSLLMGLYPAGTGPLIGDGDPAIKGRFQPIPIMTLSADSRLIQFPYEQYLAVLKKY
                     VYNSPEWQNKTKEAAPNFAKWQQILGNRISGLNDVITVGDVLIVAQAHGKPLPKGLSQ
                     EDADQIIALTNWGLAQQFKSQKVSYIMGGKLTNRMIEDLNNAANGKSKYKMTYYSGHD
                     LTLLEVMGTLGVPLDTAPGYASNLEMELYKDGDIYTVKLRYNGKYVKLPIMDKNNSCS
                     LDALNKYMQSINEKFQK"
     gene            complement(15116..15796)
                     /gene="tmpT"
                     /locus_tag="FTM_0011"
     CDS             complement(15116..15796)
                     /gene="tmpT"
                     /locus_tag="FTM_0011"
                     /EC_number="2.1.1.67"
                     /codon_start=1
                     /transl_table=11
                     /product="thiopurine S-methyltransferase"
                     /protein_id="ACD30129.1"
                     /translation="MNKLETNNNQYWLDRWQNDDVGFCQESPNEFLVKHFSKLNINDS
                     SVCLIPMCGCSIDMLFFLSKGVKVIGIELSEKAVLSFFSQNTINYEVIHGNDYKLYKG
                     DDIEIYVADIFNLPKIANNLPVFDIWYDRGAYIALPNDLRTNYAKMMLEVCYNNTQIL
                     LLVMEHDKKSQTPPYSVTQAELTKNFSAKIKFELIDSKQRDNIPDYRKAEGMTEQYYT
                     TYLRKKQY"
     gene            15928..17274
                     /gene="pyrC"
                     /locus_tag="FTM_0012"
     CDS             15928..17274
                     /gene="pyrC"
                     /locus_tag="FTM_0012"
                     /EC_number="3.5.2.3"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="ACD30130.1"
                     /translation="MSNQSLLIKNATVVNEGKTFKSDVLVENGRIAKVAANIDKSADK
                     ILDATGLHLLPGMIDDQVHFREPGLMHKGDIESESRAAVMGGITSYMEMPNVNPATTV
                     VERLDEKKERAATRSHANYAFYLGATNDNVEELKRLKPNDACAIKIFMGASTGNMLVN
                     NPETLEGFFRDSPLLIVTHCEDTPMITELENKARQKYGENVPFDLHPEIRSREACFKS
                     SDLAVSLAKKYNSRLHVLHLTTAEEMVHFDNTIPLEEKRITAEVCAHHLFFSRKDYAD
                     KGSRIKCNPAIKEESDRLKLLECVVNDTIDVIATDHAPHTWEEKQGTYFKTPAGLPLV
                     EQALISILEHYHKGFLTLEQVVQKTAHAPAIVYKVKERGFIREGYHADLVLVDLNDPH
                     TVTDECCHYKCGWTPFDGITFQSKVQTTIVNGVVKYHKGKIVSDQRGQCLEFNHEF"
     gene            complement(17302..18321)
                     /locus_tag="FTM_0013"
     CDS             complement(17302..18321)
                     /locus_tag="FTM_0013"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein, ArsR"
                     /protein_id="ACD30131.1"
                     /translation="MRKKTEQIRIQILKEVNYHSLDLVNHISSMFNISRQSVYRHINN
                     LIKEQKLSFDIIDGKRVYKYGKVRELSKLITINKDVSESDIYANYFIWVEQDLKENVK
                     AIVEYGFTEILNNVIDHSESKTCFVYVKRDLSNITIIINDEGEGIFNRITRLKKLSDT
                     RQALLELKKGKLTTDAEHHSGEGIFFSSKAFDEFAIISGDLTFIHENKLKNDYLLDQK
                     PGRGTYVKMKIDINSEKKLIDIFDEFAEADEYAFNKTIVPVILAKFGNENLMSRSQAK
                     RLLTRLENFKTVIFDFRDVNLIGQAFADEIFRVYANKHKDIKLEYVNINSDIEKMILR
                     ALNHK"
     gene            18592..18834
                     /locus_tag="FTM_0014"
     CDS             18592..18834
                     /locus_tag="FTM_0014"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30132.1"
                     /translation="MNQAKKGNAFGIVSFVFGFIGIFILSIVLCPVSILFGVIGIIKK
                     QYIWSGVGIICAIIGLLTSPMFLTIIGVSSAAAGAR"
     gene            18881..19159
                     /locus_tag="FTM_0015"
     CDS             18881..19159
                     /locus_tag="FTM_0015"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30133.1"
                     /translation="MKKLVKIAVAPVLALPVVASAITMDEMLKFSSEHLNNTPISEIK
                     IDPLGITDNFYLGQEWTAGVNGKEYLCSKPGLAGFWIIGKGCQKNPFK"
     gene            19548..20099
                     /locus_tag="FTM_0016"
                     /note="conserved protein of unknown function; stop codon"
                     /pseudo
     gene            complement(20215..21267)
                     /locus_tag="FTM_0017"
     CDS             complement(20215..21267)
                     /locus_tag="FTM_0017"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30134.1"
                     /translation="MYGSKFYDIKKEDSLEVLLIAIVMSVSGTIAIIINDALNFDYPF
                     WAATAAIVIFSTGSSLTLYKTWRRIVATIIGSIIGLYLSILLVEFSFVGVMIIFIIGS
                     IFLFLSKTYPKEGYFLLFIGLHISFIGAGCIVEPANAFYLTEYRILTNTVGVLCTLVF
                     VLLLPIKKGKEFSPAPPMSNKDALLNVTRIFIAMSLAVLFWMFVNIPGGSINMIITIV
                     VISGIEINKTVLIFHRRFFGCLLGVSCGIACIVISSYLPILIFPLFIVFSTIFMYFAL
                     LHPLYGYAYEQANRAFMIVCFPTKLELFSFDDGAYRALGIFIALFILLLIEIGERILD
                     IISESLGEYIIKQLLL"
     gene            complement(21254..22219)
                     /locus_tag="FTM_0018"
     CDS             complement(21254..22219)
                     /locus_tag="FTM_0018"
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="ACD30135.1"
                     /translation="MKISKLMATVIILFIIIFLICVFLFFDASFERDAYLYADFTRVN
                     SVENGQVEKIYIKKGSYVKKGDTLFVLDCRYITKELNILKSQEKKIALELKDIVIKIK
                     LAEKQRDLTKDSLIVEKRNFERYRILIKEGAVSAQQKDLAEKSLISSESQFVRACQNV
                     DNLKIRQNDLLSDQKITQSKIDQKQYSLSRCSVKATTNGYISNFILEEGDFIKKGQDL
                     FSIVDTDKWYVVANVKESNIKYLSVGQIVTMTTSLTGIKKYKGKIVDIEKGITRPEYN
                     NFSALYNIERNIDWVRLDYRFPVLIEVLSKDTKEFRLGGDVHVWF"
     gene            complement(22308..22715)
                     /locus_tag="FTM_0019"
     CDS             complement(22308..22715)
                     /locus_tag="FTM_0019"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30136.1"
                     /translation="MKKLSKLLLRMLITILVTIIVAGCASTNDSNTRYENGYYIAELN
                     YNFNDVHQATINSISSGITYDENGHVYNLLENSEINNKATITAVNNEDPKDRLEIIIF
                     KISKNNTKIMIKYADHGDSIRSSALLDTINESL"
     gene            22841..23710
                     /locus_tag="FTM_0020"
     CDS             22841..23710
                     /locus_tag="FTM_0020"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="ACD30137.1"
                     /translation="MDKFECMKSFILVAKNRSLTIAARKQGVGLAKVSKQINFLEEWL
                     SSSLFIRTTRKVELTAKGEVFLNYAEDIIKRLEDAQNDIENSDIQPRGEIAVSITAGL
                     NVTFFIEHFANFLSKYDQVKLNIHNINSPLTVLEGTCDVSISSIDVSDPRLVKYIFCS
                     FKRKLYASPKYLEKRGVPSCLADLSKHNTLVNTLTHPKGWQFGKSSVNLNYNYLSSST
                     DELKNAAIHGLGIIWSIDPLVRQEVSSGQLVEIQIDEAQEDVNLYCYFLQTSKQDKRR
                     ILAEYLVENVTIL"
     gene            complement(23711..24337)
                     /locus_tag="FTM_0021"
     CDS             complement(23711..24337)
                     /locus_tag="FTM_0021"
                     /codon_start=1
                     /transl_table=11
                     /product="soul domain protein"
                     /protein_id="ACD30138.1"
                     /translation="MLKKSLSVISALALSSCSIIGINNTPQAKYTNIKKDDNFSIRIY
                     APLTEAQVTVQDSDYKSAVNKGFGYPFRYITGANIAKQDIQMTAPVKIEQSSQKIQMT
                     APVMVKGDTNNEWTIAFVLPAQYTLENAPKPTNNKVKLVEKPETKMAVITFSGFLDKD
                     TIDSNTTKLKAWVKANNYQIVGQPEAAGYNPPWTIPFLRTNEVMIPIK"
     gene            24480..25028
                     /locus_tag="FTM_0022"
     CDS             24480..25028
                     /locus_tag="FTM_0022"
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate mutase"
                     /protein_id="ACD30139.1"
                     /translation="MNKLVKVVAGVFSLIFGFCYAGGVDKPLSLLVERASLMQEVGVC
                     KHKFNSPIYDAAQEIRVLQNAQNLAKENHLEMNTFLTFIQLQMDLSKQIEDFYWRNAT
                     EQELKQQSSDCLANYRDKVKKVDEQLYPAISKNIKAIRKDKKLILKLSELVKKQNIQG
                     IPQDPSYLVLLANSLQNIKKAK"
     gene            complement(25082..28457)
                     /locus_tag="FTM_0023"
                     /note="conserved protein of unknown function; stop codons,
                     frameshift"
                     /pseudo
     gene            28727..29371
                     /gene="pyrF"
                     /locus_tag="FTM_0024"
     CDS             28727..29371
                     /gene="pyrF"
                     /locus_tag="FTM_0024"
                     /codon_start=1
                     /transl_table=11
                     /product="orotidine-5'-phosphate decarboxylase"
                     /protein_id="ACD30140.1"
                     /translation="MRNSMKIMFSADGISKSDLEKTATVSKYVDCVKIGHILCSTLSF
                     KEIHELVGDKDIFLDFKLHDIPNTVKTAIENYSKAIPNFKYFTFYGTASDEMIKAALT
                     ADTQAIPLAVITLSSDANFDKADSLAKFQRCVDLGVENFICHPHLVADVRAKFGDKIK
                     LYVPGVRLESDLSDDHFNALTPKKAKELGVDYIIVGRPLLRAENIVEKLKEFEC"
     gene            29373..30119
                     /gene="pyrD"
                     /locus_tag="FTM_0025"
     CDS             29373..30119
                     /gene="pyrD"
                     /locus_tag="FTM_0025"
                     /codon_start=1
                     /transl_table=11
                     /product="diyroorotate dehydrogenase"
                     /protein_id="ACD30141.1"
                     /translation="MQNQDLKRIIISPPFGKYLKFKETSNVYGSFTVNRRWGLIKQAI
                     KTIRKIDKNAWRNKIGLRNPGLANTNPPKRAQDIISLAALDMSDWHSFAETLKLPKFA
                     QHRNIEINIGCPNASIVDFPAELAPLFEDRNISIKMPPTVDHNAKIREYLAVGITTFH
                     LCNTIPTAKGGISGYPLHKYSLPAIKKARQEFGDSITIIGGGGIYTLDDAKKYIEAGA
                     DHLSLSSIMFNPIRGKKLVKEIVKFWLDDF"
     gene            complement(30381..30860)
                     /gene="dtd"
                     /locus_tag="FTM_0026"
     CDS             complement(30381..30860)
                     /gene="dtd"
                     /locus_tag="FTM_0026"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /protein_id="ACD30142.1"
                     /translation="MIQSKNIYKFFKNSMLSIIQRVNCAKVVVDNQKVADINKGILAL
                     VCVEKEDTQQNFEKMADKIIKYRIFEDDAGKMNLSLVDIDAEIILVPQFTLAADTKKG
                     NRPSFSSGCPPEIAKEKFKEFENIFRRKYNKVQTGIFGADMKVSLTNDGPVTFSFKI"
     gene            complement(31060..32292)
                     /locus_tag="FTM_0027"
                     /note="major facilitator superfamily (MFS) transport
                     protein; stop codon"
                     /pseudo
     gene            complement(32312..33790)
                     /locus_tag="FTM_0028"
     CDS             complement(32312..33790)
                     /locus_tag="FTM_0028"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-fructofuranosidase"
                     /protein_id="ACD30143.1"
                     /translation="MNIQNGCIYDANLLETGGMCFSLRADSFKSYHSHDNSDIHKTKR
                     LQYHFTAKKAWMNDPNGLVYFKGKYHMFYQHYPYGKHTAMLHWGHAVSTDLVNWQHLP
                     IAIYPQNDLNDRYIGGAFSGSAMVVDDELFLIYTEHFEDLDNTPNIFIEKQNLIKSKD
                     GIHFSKPKTVINHKPDFCSYDFRDPKVWFDKIFNCYYMVIGTYANNYPSVALYRSDNA
                     ESWNYHSILFQEKTISGRTLECPDLFYLDGKYVLVLSIFETKNKKDFNYQSYYYIGNF
                     DGKHFSAETPPKHIDSAKEFYAPQTFEANGNRYAIGWMNCWEDYKNRAKDDSAGAMSL
                     IRQLKVKKDKLLSYPVDDYKTLRNKTIEIKNFDQDITMPSNLIELNLDFSSDNNWQLD
                     LLENNQGFVINIHYQDNQILVKNSLNEVIDKAFIKDIRSQEISVDIFLDTTSIELFVN
                     KGEESITMRFEASDTIKNTMRVSAVNQDDLTIKLYELNSVWK"
     mobile_element  complement(33996..34746)
                     /mobile_element_type="insertion sequence:isftu1"
     gene            complement(34812..35522)
                     /locus_tag="FTM_0029"
                     /note="transcriptional regulator, LysR family; IS
                     insertion, fragment, stop codon"
                     /pseudo
     gene            complement(35592..36257)
                     /locus_tag="FTM_0030"
     CDS             complement(35592..36257)
                     /locus_tag="FTM_0030"
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase"
                     /protein_id="ACD30144.1"
                     /translation="MQTLQALKTRKCVRQFLAKPVAQEKLQQLFDAARWTPSSKNTQP
                     WKIAVVSEQKKIDLMNKILAACNNNEKPRMEYDYNGDITLEGELKERAIKCGHDLYNA
                     LGIAREDKQQRIEQWKKNYLSFNSPTAIFIFKHLDTGISGYMDCGMLIQSILLAATDL
                     GLATCPQASLGHYPDIVKKELTGFDDYILLCGIAIGYEDTSAAVNNYRTEREVINNIV
                     SFF"
     gene            36660..37352
                     /locus_tag="FTM_0031"
     CDS             36660..37352
                     /locus_tag="FTM_0031"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein, putative"
                     /protein_id="ACD30145.1"
                     /translation="MFTKKTAFTYFITVILIFNSGWIDSVVLYNSFGASVAVMSGNLR
                     ILGHSIAGSDWIFMYKVAILIAGFVVGAAINGVIMKTDAYVISEDHTKTLVLQSAVML
                     TGTLLIDIFNNHRVIDDLFLAMVMGMQNSFTTLFFGGFARTTHMTGTTTDLGIEIGRV
                     LRGNMDNLWKIPFFITCMTMFVIGNAAGVIWVQIIGEYFTLMLFPSVILPIFVGIVIL
                     LTYNMKVKNHSL"
     gene            complement(37349..38554)
                     /locus_tag="FTM_0032"
     CDS             complement(37349..38554)
                     /locus_tag="FTM_0032"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxy/aromatic amino acid permease"
                     /protein_id="ACD30146.1"
                     /translation="MILSRKFGAAMIISGTCIGAGMLAIPATVASCGFLIGSILIVCI
                     WALMTFTALVLAEVNLKMDDGANFVEMTSQTLGPIGVGIVWICYVLLLYSLVAAYTVG
                     GGSLISTTLSNLGITLSEKTTGIIFILILGVFIYISTRIVDHINKIMFSGKLLAFLLL
                     IAVLVPHISLDHLSYKIKNPNFIWAAFPILLTSFGFHHIIPTLRTYVGSNKRSLRQAI
                     IIGSSIPLIVYLLWIFATLGSLPVATPTGILGKNSGEITSVIINHFSTSSSYISTISF
                     LFGFFALATSFLGVALGLFDFNRSTYRISENIHKHKIIAFIITFLPAYIYAIAYPDGF
                     KTALGYASIFVAILQVALPVMMLWVINYRKQKALVSTSTIAIFIIFIAILIIILQIMS
                     SFDLLPTLN"
     gene            38663..39271
                     /gene="gidB"
                     /locus_tag="FTM_0033"
     CDS             38663..39271
                     /gene="gidB"
                     /locus_tag="FTM_0033"
                     /EC_number="2.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase GidB"
                     /protein_id="ACD30147.1"
                     /translation="MKDKIRQALSELDILATEVQIDQWLDYLKLLEKWNKVYNMTAIK
                     NIDEMLVKHLFDSLAVAKYIKGDSTVDVGTGGGLPGVVLAILYPQHQFTLVDSVGKKI
                     MFLKNVKKNLSLNNINPLNTRIENLEGNFDNIISRAFSSVDTFYELCKHFLTEHNQML
                     AMKGRDLEERNLESLPLNIEKYSIKVPFLNAERNLIVMRKKL"
     gene            39268..39936
                     /locus_tag="FTM_0034"
     CDS             39268..39936
                     /locus_tag="FTM_0034"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30148.1"
                     /translation="MIDKEFIQKSYTSIMQNIDSKARLLAVSKYQSIDKIEYLAGLGQ
                     LDFGENYFQELEQKAQKLPHLRWHFIGSLQSRKIKHIVKYASSIQSVENIEHLEKIDK
                     AAGQIAKIVDVFLQINIDDDINKSGFESTQLEEVVASIMKAKSFMNLKIVGLMCIPAK
                     TNAPEKSFAKMKHFFDTVNSRLNDDLRLSRLSMGMSADYRLAIQYGSTDVRVGSSLFG
                     ARAT"
     gene            complement(39929..40813)
                     /locus_tag="FTM_0035"
     CDS             complement(39929..40813)
                     /locus_tag="FTM_0035"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30149.1"
                     /translation="MVGIAAFCAAPIHGVYRKSYTYIIVTVISINISIIIGTTISQLP
                     LLVPYVTFIIGALTFYLPTKFKLMPEILTKFCFIGYISSTFGHSHLNLSVIITSATII
                     TIILIFYYALINILLYRDQPHSKREKVQDIYHHVMIVALVSLVAGYFVTKIMTLYIPN
                     TNPWWIMMTIVLVLGYTYQRVKVSAFKRGIANILGPIIMAILMTLFKNHYYLQVLLVF
                     VLFFLVNCSISYYLILSLFASCMIISWEMISLSPPDLYTIALDRALETLVAVGIVLTV
                     NEIYKRIFANYINKRIVR"
     gene            complement(41015..41911)
                     /locus_tag="FTM_0036"
     CDS             complement(41015..41911)
                     /locus_tag="FTM_0036"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription regulator, LysR family"
                     /protein_id="ACD30150.1"
                     /translation="MNKHKNISISLFEAFYQLVVHGSFTNTAKALGISKAAVSHTIKQ
                     LEKELKVDLLNRTTRSLSLTHEGMLLFNYCKTLQNEIDNIRDLAESFHKEPSGTLKIS
                     TSSLFAQNILINLIKEYSKKFSKVKIEVSIEEKMPNFKSNEADIILGVNWTPPENIVA
                     RKIATTRYVLCASPAYINKNGSPSNISDLANHNYIPHKSRVTPLVNIKKNKLNPQTLP
                     SNISANNIEFIKACVLNDFGIAQFHEYIVKNEIQNSQLIELLKDNFFDQQDIYIYYPK
                     NKFVQPKVKEFVNLVINSQISI"
     gene            42014..43150
                     /locus_tag="FTM_0037"
     CDS             42014..43150
                     /locus_tag="FTM_0037"
                     /codon_start=1
                     /transl_table=11
                     /product="drug:H+ antiporter-1 (DHA1) family protein"
                     /protein_id="ACD30151.1"
                     /translation="MKTYKIIILLTYISIASASAVIINPALPNIATELGLSSGTVEWL
                     VSIFLLGYVLGQIIYGPIAKKYGDVITLRAGMTINVIGILVCILASSMTMLLIGRFIT
                     AIGASAGLVCTFIILNNLVAAEKAKLALSFAISLTLATLIGGIISAYTHWYYCFYVLL
                     IHAVIMLGVSFLYENKKDFEFNLKVSAIIDGYKNAFSSFKLVVFALTLGVMTVFSYCY
                     SAAGPFIAHSMFNLNSTQYSLWTSMTIIGIVLGSMLVAKIINKHDTHKILIVALICFV
                     VLVVVMAWLKIANYMTPLIFFVLITLMYFVCNFIYPTASYLASTAIECKSNASAAMNF
                     INMLTAVVAVSIMGYIPFEYIWNFLLMCTILPIICFVLIIYNKF"
     gene            complement(43217..45521)
                     /locus_tag="FTM_0038"
                     /note="protein of unknown function; frameshift"
                     /pseudo
     gene            45699..46295
                     /locus_tag="FTM_0039"
     CDS             45699..46295
                     /locus_tag="FTM_0039"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoheptose isomerase"
                     /protein_id="ACD30152.1"
                     /translation="MTSLDKINSYFESSIQAKIETANALPPAIAQAAKAMVSCLENGG
                     KVLVCGNGSSGVIAQHFTSKLLNHFEMERPPLPAIALTGDVATITAVGNHYGFSQIFA
                     KQVAALGNEDDILLVITTSGDSENILSAVEEAHDLEMKVIALTGGSGGALQNMYNTDD
                     IELRVPSDNIANIQENHFLIVHCLCDIIDQKLFAGLED"
     gene            46303..46659
                     /locus_tag="FTM_0040"
     CDS             46303..46659
                     /locus_tag="FTM_0040"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein"
                     /protein_id="ACD30153.1"
                     /translation="MFRPITKNLCLLIAAFSLSACGIIQPYTAPVPQGKEIKDKKLFE
                     IKPNMTKSEVTYILGSPDIIDTFNPNQYVYINTYKRNMQDTQFSESKLILTFNNQDRL
                     IGISGNYAPPTKDPVF"
     gene            complement(46733..47005)
                     /gene="rpsT"
                     /locus_tag="FTM_0041"
     CDS             complement(46733..47005)
                     /gene="rpsT"
                     /locus_tag="FTM_0041"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S20"
                     /protein_id="ACD30154.1"
                     /translation="MANSKQAKKRIIQAERNRQHNVARRSMMRTFLKKTAYAIEKGDV
                     EAAKENFAKVVPILDKYASKGLIHKNKAARHKSRLSAKIKALATAA"
     gene            47275..49068
                     /gene="lepA"
                     /locus_tag="FTM_0042"
     CDS             47275..49068
                     /gene="lepA"
                     /locus_tag="FTM_0042"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein LepA"
                     /protein_id="ACD30155.1"
                     /translation="MKNIRNFSIIAHIDHGKSTLSDRFIQVCNGLSEREMKEQVLDSM
                     DIERERGITIKAQSVTLDYTARDGQTYQLNFIDTPGHVDFSYEVSRSLAACEGALLVV
                     DAAQGVEAQTVANCYTAIEQNLEVIPILNKIDLPSAEPDRVAQEIEEIIGIDATGATT
                     CSAKIGIGVEDVLETIVAKVPAPEGDVNAKLQALIIDSWFDNYLGVVSLVRVKNGTIK
                     KGEKFKVMSTGVAYQVDRLGVFTPKMKDLDHLKAGEVGFIVAGIKDIHGAPVGDTLTH
                     AHNPTDKPVPGFKKVQPQVYAGMFTISSDNYPDFREALEKLSLNDASLFFEPEVSQAL
                     GFGFRCGFLGMLHMEIIQERLEREYNLDLITSAPTVVYKAIKKDGEIIEVDNLSKLPE
                     PGAIAEIQEPIVRANILVPKDYVGSVITICIEKRGVQVDLNYVGNQVSITYDLPMIEV
                     VSDFFDTLKSVTKGYGSLDYELIRYEPANMVCLDVLINGDKVDALASIVHKDQAKYKG
                     RELVERLKELIPRQMFEVAIQAAIGGTIVARSTVKALRKNVLAKCYGGDVSRKKKLLE
                     KQKEGKKRMKNIGSVEIPQEAFLSVLKKIKL"
     gene            49074..50153
                     /gene="trmU"
                     /locus_tag="FTM_0043"
     CDS             49074..50153
                     /gene="trmU"
                     /locus_tag="FTM_0043"
                     /EC_number="2.1.1.61"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
                     /protein_id="ACD30156.1"
                     /translation="MENKKVIVGISGGVDSSVSALLLKQQGYDVTGVFMKNWEEDDTD
                     EFCSAEQDIADAQAVCDSIGIPFKKINFAAEYWDNVFEHFLIEYKAGRTPNPDILCNK
                     EIKFKAFLSYVHLLGGDYIATGHYAQTRLAADGSVQLVKGLDDNKDQTYFLYTLGQEQ
                     LRQTIFPIGNIEKSKVREIAKENNLVTFDKKDSTGICFIGERKFKEFLSKYLPAQKGE
                     IHDENGIKIGMHDGLMYYTIGQRQGLGIGGVKDRPEVPWFAAKKDLENNVLIAVQGHD
                     HPLLFKQSLQAIELSWVAGMAPADKFRCAAKVRYRQKDQSCEVEVNQDGSVNVTFDQP
                     QRAITPGQSVVFYIDDVCLGGGVII"
     gene            complement(50173..51150)
                     /locus_tag="FTM_0044"
     CDS             complement(50173..51150)
                     /locus_tag="FTM_0044"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein, putative"
                     /protein_id="ACD30157.1"
                     /translation="MRNIFKKTLLILLLSVIASCGMLSNDQFVYLGHGENSPDYQLYY
                     DKTQKLFVLIDKRNGCFQKDDTGTCLAFTLKQAREFREYVLAKMIEIDVRLAKDDYGN
                     YAIEELRKAGVTTVNKPIKTKKVFATPVKQIVLDRKQQYHLVRKEYEIDSNLVAMVVN
                     DKEGKKRIKVAYTVDFPGLEKEYSTELRPFIIDPEYLYTHMTIDAVHEAQFMQRDVMK
                     SQTNVKKKVVDYLKDVVDSDKKDTGYTHQEVASSVAALDNDLITKADEQREDKKTTLA
                     SGSSISTIAKKPINQESSGSTIQTATKTASTTQVDSNDTPKTTLASDNK"
     gene            complement(51244..51762)
                     /locus_tag="FTM_0045"
     CDS             complement(51244..51762)
                     /locus_tag="FTM_0045"
                     /EC_number="3.5.1.88"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="ACD30158.1"
                     /translation="MSLEILKYPHPVLKEVAKEVTKDEINDDLRATIAEMHELMLEAN
                     GVGLAAIQVGIKKRFFIMYDNLEEQNPEIITIINPEIIEQNGKIIDEEGCLSFPGVSA
                     KVNRATVVKIKALNEFGEEIEVEKDGFLARCIQHEIDHLNGITFFDHLGSLKRKMIEK
                     KYKKLMQENAKS"
     gene            complement(51765..52208)
                     /gene="ribH"
                     /locus_tag="FTM_0046"
     CDS             complement(51765..52208)
                     /gene="ribH"
                     /locus_tag="FTM_0046"
                     /EC_number="6.3.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="ACD30159.1"
                     /translation="MRKLAIVVSEFNSLITDKMLEGALEEAYAQGLKDSQICIKKVPG
                     AVELPYAAKLLAETKEFDAIVLLGCVIRGETDHYDYVCDQVSYGTQKVMHQYNLPVIF
                     GILTTHNKEQALERVGGKKGHEGKYSIQAAITMAKMKKDILEQGV"
     gene            complement(52218..53429)
                     /locus_tag="FTM_0047"
     CDS             complement(52218..53429)
                     /locus_tag="FTM_0047"
                     /EC_number="3.5.4.25"
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin biosynthesis protein ribAB"
                     /protein_id="ACD30160.1"
                     /translation="MFEQIKNNVENAIEALKQGKPVVVLDDYDRENEGDLILPGQKAT
                     EENIAFMLEHTSGIICLAMDSKKARELNLTPMVAADQNNSTFTTPFTVTIEAKEGVTT
                     GVSAKDRAHTIQVASKADAKTEELARPGHIFPLIANDKGVLGRNGHTEATVDLMKLSG
                     FNSAGVLCELMNKDGTMMKAAELEAFAKKHDLPLLTIAELYQYRLATEIFVTKMASST
                     IPFKKIGELEMSVYKDNFSGDEVVVLSKPYSGNNPLVRMHSSCMTGDIFGSLRCDCQD
                     QLHKGIEMISEEGGFFIYLDQEGRGIGLTNKLKAYNLQMNENMDTLEANLALGLPADA
                     RKYDLAIQVLKYNNVNRCRLISNNPEKLAALRNVDIETQPVYCEAFVNSHNRNYLITK
                     KIKAKHTIKGI"
     gene            complement(53422..54027)
                     /gene="ribC"
                     /locus_tag="FTM_0048"
     CDS             complement(53422..54027)
                     /gene="ribC"
                     /locus_tag="FTM_0048"
                     /EC_number="2.5.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin synthase, alpha subunit"
                     /protein_id="ACD30161.1"
                     /translation="MFSGIVQQLGTIKKITTKDSLKTFCIKFDNSLQCSIGDSVAING
                     TCLTVTKLDKQNLTANFDAVPETLKKTNLDTLKENQLVNIELAMRYGDHIGGHMVQGH
                     IDEPGQIKSIQNVGGAWLIEISASREFLKYLVKKGFVTIDGMSITVINVLKDSFTVTL
                     IPHTIEVTIAKNYSNGSMVNLEADATGKYIYKYIQGFKENV"
     gene            complement(54020..55087)
                     /gene="ribD"
                     /locus_tag="FTM_0049"
     CDS             complement(54020..55087)
                     /gene="ribD"
                     /locus_tag="FTM_0049"
                     /EC_number="3.5.4.26"
                     /EC_number="1.1.1.193"
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin biosynthesis protein RibD"
                     /protein_id="ACD30162.1"
                     /translation="MKNIDKYYMQQALTLANRGRLTVSPNPMVGCIIVKNGAIISEGW
                     HETVGEAHAEVHALTKAVDKAKGATAYVTLEPCCHCGRTPPCTDTIIKAGIKKVIIAT
                     LDPNPKVAGKGVERLKNAGITVEVGLLEKQAQELNKIFFHYQTTKKPFVYAKWAMSLD
                     GKIAVNDGDSKKISSHQAFVNTHELRNICDAILIGKQTLIDDNPSLDVRININKIKHP
                     TRFILANHLTTINHNWQVLDQRHAKTIFVCSKISARVATKLNQLGIEYWLLPQSQHQV
                     CLDTLLEKMGKIGITSLLVEGGNKTLNSFINQKLVNEFYTYLAPVIIADYNPKQQLSF
                     NQISVREDIIINSCFKENSNV"
     gene            55478..56092
                     /locus_tag="FTM_0050"
                     /note="Na+/H+ antiporter; IS insertion, fragment"
                     /pseudo
     mobile_element  complement(56070..56820)
                     /mobile_element_type="insertion sequence:isftu1"
     gene            complement(56924..57397)
                     /locus_tag="FTM_0051"
                     /note="nicotinamide ribonucleoside (NR) uptake permease
                     (PnuC) family protein; IS insertion, fragment"
                     /pseudo
     gene            57620..58012
                     /locus_tag="FTM_0052"
     CDS             57620..58012
                     /locus_tag="FTM_0052"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30163.1"
                     /translation="MKLRKVLIATLLGASALSLSSCWLLVGAAVGGGTAAYISGEYSM
                     NMSGSVKDIYNATLKAVQSNDDFVITKKSITSVDAVVDGSTKVDSTSFYVKIEKLTDN
                     ASKVTIKFGTFGDQAMSATLMDQIQKNL"
     gene            58033..58443
                     /locus_tag="FTM_0053"
     CDS             58033..58443
                     /locus_tag="FTM_0053"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30164.1"
                     /translation="MTFLKKAFIATIVSISALVLNSCIVAAIAVGGGTVAYIDGNYSM
                     NIEGNYKAVYKATLKAINDNNDFVLVSKDLDQTKQNADIEGATKIDSTSFSVKIERLT
                     DQATKVTIKFGTFGDQAMSSTLMDQIQAAVHKAS"
     gene            58446..58842
                     /locus_tag="FTM_0054"
                     /note="frameshift"
                     /pseudo
     gene            58937..60349
                     /gene="eriC"
                     /locus_tag="FTM_0055"
     CDS             58937..60349
                     /gene="eriC"
                     /locus_tag="FTM_0055"
                     /codon_start=1
                     /transl_table=11
                     /product="H(+)/Cl(-) exchange transporter ClcA"
                     /protein_id="ACD30165.1"
                     /translation="MSNKVLDTYYKNNRHIWVLVLSGAVIGTMIGLLATAFQLLLDFI
                     FKIKLALFSFSGGKLFIEIAMSISLSIVMVLISIFIVKKFAKEAGGSGIQEVEGALKG
                     CRKIRKRVMPVKFISGLFSLGSGLSLGKEGPSIHMAAALAQFFVDKFKLTTKYANAVI
                     SAGAGAGLAAAFNTPLSGIIFVIEEMNRKFRFSVSAIKCVLVACIMSTVISRAIMGNP
                     PAIRVETFSSVPQNTLWLFMVLGIIFGYFGLLFNKSLIKVANFFSEGSKKRYWTLVII
                     VCIIFGIGVVLSPNAVGGGYIVIANTLDYNLSIKMLLVLFVLRFAGVIFSYGTGVTGG
                     IFAPMIALGTVFGLAYGLSVAQLFPQYNIEPGVFAVAGMSALFTATVGAPLTGIVLVM
                     EMTWNFHLLLPLMITCFSASMLTYIHHQKPIYDTLLRRTISNERKQQAKEKNERNQKP
                     TPNNFRTNYLKRRNIITQFL"
     gene            60349..61766
                     /locus_tag="FTM_0056"
                     /note="metallocarboxypeptidase; frameshift, stop codon"
                     /pseudo
     gene            61853..63043
                     /gene="trpB"
                     /locus_tag="FTM_0057"
     CDS             61853..63043
                     /gene="trpB"
                     /locus_tag="FTM_0057"
                     /EC_number="4.2.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase, beta subunit"
                     /protein_id="ACD30166.1"
                     /translation="MSKLNAYFGEYGGQFVPQILVPALDQLEQEFIKAQADESFKQEF
                     KELLQEYAGRPTALTKTRNIVKNTRTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGK
                     KEIIAETGAGQHGVATALACALLDLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHS
                     GSATLKDACNEALRDWSANYSKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQMLAK
                     EGRLPDAVIACVGGGSNAIGMFADFIDEKNVKLIGVEPAGKGIETGEHGAPLKHGKTG
                     IFFGMKAPLMQNSDGQIEESYSISAGLDFPSVGPQHAHLLAIGRAKYASATDDEALDA
                     FKLLCKKEGIIPALESSHALAHALKLAYEDPNKEQLLVVNLSGRGDKDIFTVHDILKE
                     KGEI"
     gene            63043..63852
                     /gene="trpA"
                     /locus_tag="FTM_0058"
     CDS             63043..63852
                     /gene="trpA"
                     /locus_tag="FTM_0058"
                     /EC_number="4.2.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase, alpha subunit"
                     /protein_id="ACD30167.1"
                     /translation="MTNRYTTLFANLEKRNEGAFIPFVTIGDPNKALSFEILDTLVSS
                     GADALELGIPFSDPLADGPTIQEANIRALESGITPKDCFDILTKIRAKYPHIPIGLLL
                     YANLVYANGIENFYQKCLDAGVDSILIADVPAHESKEFRDIAKKVGIAQIFIAPPDAS
                     ESTLKQISELGSGYTYLLSRVGVTGTETAANMPVEDVLAKLREYNAPKPVLGFGISKP
                     EQVQQAIKAGAAGAISGSATVKIIQNNISNKQKMLNELTYFVKEMKAATLN"
     gene            complement(63907..64260)
                     /locus_tag="FTM_0059"
                     /note="protein of unknown function; stop codon"
                     /pseudo
     gene            complement(64349..65058)
                     /gene="pnuC"
                     /locus_tag="FTM_0060"
                     /note="nicotinamide ribonucleoside (NR) uptake permease
                     (PnuC) family protein; frameshift"
                     /pseudo
     gene            65278..67857
                     /gene="clpB"
                     /locus_tag="FTM_0061"
     CDS             65278..67857
                     /gene="clpB"
                     /locus_tag="FTM_0061"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone ClpB"
                     /protein_id="ACD30168.1"
                     /translation="MDINKFTIKLQEALAEAQSYAFQQKATEFTSAHILKALLEQNDS
                     VAISILSVCGVNIQNFIKAVNDMVDSVAVLSGEGNLQVTPSRDLIATLHKMQGLANKN
                     GDEFISSEVFLLASLEDKSLTGLYNKFGVTKEKLTKAVNDYRGGEKVSSQNQEDMKGA
                     LDKYTVDLTDLARKGKIDPIIGRDSEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEG
                     LAQRIVNDEVPEGVKGKKVLSLDMGALLAGAKFRGDFEERLKSVLKELSKQEGNVILF
                     IDELHTMVGAGKAEGSMDAGNMLKPALARGELKCVGATTLDEYREYVEKDPALERRFQ
                     KVLVDEPTVEDTIAILRGLKERYELHHGVNITDSAIVSAATLSHRYITDRQLPDKAID
                     LVDEAASQIRMEIDSKPEKMESLYRRIIQLKMQREQLKKEKDDATKKRLEILEQEIKG
                     LDSEYKGLEELWKAEKLKMQGTSKLKEELEKAKFELEKYQRVGDLSKMAELQYGKIPE
                     LEAQIKQIEETEAEPSENKLVRTSVTENEIADVVSKATGIPVSKMMEGEKDKLLNMES
                     FLHKRVIGQDQAIKAVSNAVRRSRSGLSDPNRPIGSFMFLGPTGVGKTELTKALAEFL
                     FDDEDAMLRVDMSEFMEKHSVARLIGAPPGYVGYEQGGYLTEHVRRKPYSVILLDEVE
                     KAHADIFNILLQVLDDGRLTDGQGRTVDFKNTVIVMTSNLGSHRIQEMQGQDYETVKS
                     AVMEMVLSHFRPEFVNRVDDAIVFEPLNKEMITEIAKIQIKRLEKRLADLSIGLEVTT
                     EAMDKLADAGFDPVFGARPLKRAIQNNLENPLALKLLDGEFKAEDKIVVDIDANNNIT
                     FSK"
     gene            68108..70300
                     /gene="chiB"
                     /locus_tag="FTM_0062"
     CDS             68108..70300
                     /gene="chiB"
                     /locus_tag="FTM_0062"
                     /codon_start=1
                     /transl_table=11
                     /product="chitinase"
                     /protein_id="ACD30169.1"
                     /translation="MKYKKLLLTALMTACGATSYATAVDYKAGTTYQQGQEVNNAGSC
                     YVCNIPGWCSSSAAWAYEPGKGTAWQEAWTEGCKDPGPSPQPVAEKTISVNLTGDSLP
                     ADAKIEFSSNGKVYTVNNNQITLPYSDTQAINYTISISGKDIGSISPDSFAMTKDTNS
                     INLTYKAKPAPVPGKCDSIPSDVKDFIPNGEVGFWGGYSKGAFVKFDGNIYELVDSYW
                     TSASPADDSGWKPCEAVVQANITVKTTGLPQTINKLNIKIGSELYTINPNNPEPITLG
                     KGNYDVSAEKVLSSDASEIYVAKNIMPNPIIIDKDSSNIDLNINFEAEAVKPTQISFN
                     VGYAEGTNPTSITATVSNTNGYKETIQLVAGANTISLPSKGEFTIKPDGYKYNDTNYQ
                     ANTLTVIDGKFKDGNSISYTPAGAWPEKSMVGYWGTWVWGQSADLADKLSQFADYYNV
                     IVPGFVRVSGNEVSGFADAVNPDNFAEAVKRIHAKDGLVIASTGGANNTWQQTLSSDN
                     TQLAKNIVNYLAENSMDGFDFDLEGDAIKGSDPSWTTQMQDLIGKMREYANSDKIKDK
                     FPRGFFITAAPQTFVDTGIPASIYWTSTGGRYNIFKDMLPINACGGNICFDALLIQNY
                     NNRNAPGWPNQDPTLSMKIAADTLKAANNTKTRIVIGDDFAPAENSYVSPQELQTAYT
                     TGNNEGPALNSYNNFSGFMVWALGQNPSTIDAVDFGKQTTEFYPINDK"
     gene            70354..71514
                     /gene="purT"
                     /locus_tag="FTM_0063"
     CDS             70354..71514
                     /gene="purT"
                     /locus_tag="FTM_0063"
                     /EC_number="2.1.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylglycinamide formyltransferase 2"
                     /protein_id="ACD30170.1"
                     /translation="MNISNIKIMLLGSGELGKEFIIAAQRLGIHTIAVDRYKNALAMQ
                     VAHESYVIDMLNSDALEQLILAKNPTYIVPEIEAINTDSLVKLEAHNFNIIPCAKATK
                     LTMDRQGIRALAAQQLNLQTSKFAFANSEQEYLDVIQSIGLPFVIKPVMSSSGKGQSI
                     VKEHNEIKKAWDYAQNGSRGHAKGVIVEQFIDFDYEIKLLTVRHKDGTSFCDPIGHIQ
                     KDGDYRFSWQPHTMPDTALAKSQEIAKEITNALGGYGVFGVELFIKGDEVFFNEVSPR
                     PHDTGMVTLISQNINEFELHLRAIVGLPIPDIQTLQPSASAAILLEGDTANASICGID
                     KALADANVDIRIFGKKEIHGKRRMGVVLAKAQNTHIALETSKQALAHIHLTK"
     gene            complement(71557..72125)
                     /locus_tag="FTM_0064"
                     /note="O-methyltransferase; frameshift"
                     /pseudo
     gene            complement(72203..72844)
                     /locus_tag="FTM_0065"
     CDS             complement(72203..72844)
                     /locus_tag="FTM_0065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30171.1"
                     /translation="MKAELDPRKLIAGTTISVAILFFVTYLVSIADGHNTLCNPFISG
                     CSDITHAGFTSYEKYMLKAILIPTATLMAVIFFFIQNLLVQISDYSKVVIKQGKVILF
                     LASVGCIGLIIGTAVIDGQDTLMNLHLKAVAVFFVLMSICQVWYTIIEYRYSSRLNKI
                     SLILRRIAILITIAFSIWSVFMDQTTVNHNIVEWWGVYALIFWFWTFSITKIK"
     gene            73081..73404
                     /locus_tag="FTM_0066"
     CDS             73081..73404
                     /locus_tag="FTM_0066"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-1"
                     /protein_id="ACD30172.1"
                     /translation="MPFVVTESCIKCKYGDCVEVCPVDCFYEGPNMLVINPDECIDCA
                     LCEPECPVNAIKSSDDLSENEEQMLDLNRELAGIWPNIVEKCEPCEDADNWASVPDKL
                     KYLEK"
     gene            73567..74319
                     /locus_tag="FTM_0067"
     CDS             73567..74319
                     /locus_tag="FTM_0067"
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="ACD30173.1"
                     /translation="MKSFLKKIWNILMWLRMTAFQLYSFAVIGGCSILINIFAFFKLP
                     LSWRMAVCYVWTYLYWIGMLVFLQVFIRITGRVNIDKDYPCIYVSKHQSMLETFMFYG
                     LLGKCHFIMKQELFDAPIFGPAMKNLGSIAIDRDKPRESLKKVVTDGKQSLADGINVV
                     IFPEGTRVSVGEYPEFQRSAMKLAADANVYIIPVAHNFGRFFPRKWGQVIKPGIARMD
                     FGKRIDPRDFDSKTLTSYCHKVITEKTKEFNG"
     gene            74333..75073
                     /locus_tag="FTM_0068"
     CDS             74333..75073
                     /locus_tag="FTM_0068"
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="ACD30174.1"
                     /translation="MKKIVHLLLVARMQVFKVYAYIVLLLCCILMNLVGVLGASLKVR
                     LFVCWIWSCLYRLGVLVLLQIYVKIDGKENIPNYPCIYVSKHQSMLETFVFYGLVRNC
                     CFVMKQELLEKPIFGKANTFAEAIGIDRSNGLSAIKKVLEDGKDRVENKNLSIVIFPE
                     GTRVPVGEYPKFHRSAMKLATVTNIPIIPVAHNFGVYFGRKKGDFVKPGIARMSFEKA
                     IDPKNYSVAELTDMCYDIINDKTKSFGG"
     gene            complement(75079..75798)
                     /locus_tag="FTM_0069"
     CDS             complement(75079..75798)
                     /locus_tag="FTM_0069"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease/exonuclease/phosphatase family"
                     /protein_id="ACD30175.1"
                     /translation="MFELNSKDNDSKKFCLMSWNSYKIDHKDSETFSAYIRHVYFNYN
                     IDIFCLQEAVHHHGSKFPIDKFDINFASNIVLRSHNYGVATVSHYPVIKNVKILTTHR
                     ESVINTHKASLITHLNINNTKVIVVNIHAINFKSNKVYEYEFEKIKEFIAPEKYKHPI
                     IIAGDFNTWNRKRVKLIKDFCREFCFKVAFIDEPQLVKSFQNNHLDFVLYRGLSLEKA
                     AVLDCKKISDHNPIIAEFCIK"
     gene            complement(75863..77014)
                     /gene="nhaA"
                     /locus_tag="FTM_0070"
     CDS             complement(75863..77014)
                     /gene="nhaA"
                     /locus_tag="FTM_0070"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ antiporter NhaA"
                     /protein_id="ACD30176.1"
                     /translation="MCASQKNQELIGGLILFSAALLAIVVNNSPLASYYAMLETINVK
                     LGIENLVIDKNLMHWINDGLMAIYFLYIGLEIKREIIVGTLSKPSNIITPAIAAFAGL
                     AMPSLIYLSINHDIKVINGWAIPSATDIAFTLGILALLGTRVPAKLKLLVITIAIFDD
                     IAAIAIIAIFYTKSLSLLSLSLGTLFILAMIICNRIFKINRSSVYVVLGFFAWFCTIK
                     SGVHATLAGFTTALCIPFRENDKDSPANFMEDSLHPWIIYFILPVFAFANAGISFSGI
                     SFSILFEPITLGIIWGLFVGKQLGIFSILAVFKKLKWFKLGESFSNLQLYGISLLCGI
                     GFTMSLFIGVLAFNDTHLLNAIKIGVVVGSVLSGFFGYIVLRFIVTNPS"
     gene            77108..78004
                     /locus_tag="FTM_0071"
     CDS             77108..78004
                     /locus_tag="FTM_0071"
                     /codon_start=1
                     /transl_table=11
                     /product="rieske protein"
                     /protein_id="ACD30177.1"
                     /translation="MKNLPKAWYAIAHIKEIKSKPIKLERLGKNLVLWKDAEKIIAME
                     NRCPHRGAELSLGKVCDGAIACPFHGFRFDTQGNCIYTPETQGAIPKLQVKTYPTKVV
                     ADMVWINVFDEQLDSSYAFEFAQNLYNEFAGNYSLLADTWNNNIRHCIENQLDYIHLA
                     TVHKRSIGRGYKIPQDIKLNICDEYIKALKNQRLMLKYIFPNFWLLNNADKLKICVYF
                     VPINEHQTKLYLVNYRKFLTGKIIKPIADIVFSITNKIILNEDKRVVKTQKYDEKYDT
                     DDFLLRHDQIIKEFRKIWHTPD"
     gene            78070..78579
                     /locus_tag="FTM_0072"
     CDS             78070..78579
                     /locus_tag="FTM_0072"
                     /codon_start=1
                     /transl_table=11
                     /product="B-type cytochrome"
                     /protein_id="ACD30178.1"
                     /translation="MKYSLPVRVLHSLLAFLIIAQLILGFGYAYDLFDSRWIMTLHKS
                     FGLVIFFVIPLLAVAKFFSIKPPYNPPLPLLQLIIAKIVHLGLYISAFSMAFSGVVGS
                     MLMGYPWKIFFVIPFPEIITPNFELGSKIFSYHYIFASVLLVLVVLHIAAALYHQLIV
                     KDNILARMK"
     gene            78609..79865
                     /locus_tag="FTM_0073"
                     /note="metabolite:H+ symporter (MHS) family protein; stop
                     codon"
                     /pseudo
     mobile_element  79997..80747
                     /mobile_element_type="insertion sequence:isftu1"
     gene            80753..81259
                     /locus_tag="FTM_0074"
                     /note="Modification methylase; IS insertion, fragment"
                     /pseudo
     gene            81211..82101
                     /locus_tag="FTM_0075"
                     /note="Restriction endonuclease; stop codon"
                     /pseudo
     gene            82386..83246
                     /locus_tag="FTM_0076"
     CDS             82386..83246
                     /locus_tag="FTM_0076"
                     /codon_start=1
                     /transl_table=11
                     /product="galactose mutarotase"
                     /protein_id="ACD30179.1"
                     /translation="MITIKNDNLLVEISELGAEVRAVINTSTEHGYMWSGDGRVWAGV
                     SPVLFPVVGKSHDNKIKYQGKEYPMGNHGLARHTVFDIVLHSENSVILAMETSKEDYP
                     FRLRFEVTYTLEVNKLITEYNIINLDDGVASCGFGAYPAFACPFDDKHKFSDYEITFS
                     EQKLDFHPITPEAFYTGETKHFKLSKIELDNHTFDNDALVYSGFTDKRVRLAEKGSNR
                     YIEVTFDGFEYLGLWSKPKANAPYVCIEPWCGRSDTLGMDVDIEYRIGNFDIEPQQNF
                     SRSYTIEFGY"
     gene            complement(83264..84046)
                     /locus_tag="FTM_0077"
                     /note="protein of unknown function; stop codon"
                     /pseudo
     gene            complement(84053..84686)
                     /locus_tag="FTM_0078"
                     /note="protein of unknown function; frameshifts"
                     /pseudo
     gene            85014..86312
                     /gene="purB"
                     /locus_tag="FTM_0079"
     CDS             85014..86312
                     /gene="purB"
                     /locus_tag="FTM_0079"
                     /EC_number="4.3.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate lyase"
                     /protein_id="ACD30180.1"
                     /translation="MIKRYDIAEISKIWADENKYAKMLEVELAILEALEDRMVPKGTA
                     AEIRARAQIRPERVDEIEKVTKHDIIAFCTSIAEQFTAETGKFFHFGVTSSDIIDSAL
                     SLQIRDSMSYVIKDLEALCDSLLTKAEETKEIITMGRSHGMFAEPMSFGQKFLGAYVE
                     FKRRLKDLKDFQKDGLTVQFSGAVGNYCILTTEDEKKAADILGLPVEEVSTQVIPRDR
                     IAKLISIHGLIASAIERLAVEIRHLHRSDVLEVYEGFSKGQKGSSTMPHKKNPISTEN
                     LTGMARMLRSHVSIALENCVLWHERDISHSSAERFYLPDNFGIMVYALRRMKNTIDNL
                     VVQRDIIEDRVRSTSAYLSSFYLHFLVANTPFMREDCYKIVQQVAFDLKQGESFSKKL
                     QKVMHDEHNIILDILEMDFEGIKKTYLKEIDHVFDRSVKA"
     gene            86284..86925
                     /locus_tag="FTM_0080"
     CDS             86284..86925
                     /locus_tag="FTM_0080"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30181.1"
                     /translation="MFLIDLLRRKYEKILSFLFIYVYNVVKFGCQERPEISSVEEPTK
                     PLAIQDKKTKDNVITFWRQKLTYVGCGEERSVTLHYFIYNNENPKKVYYSIKAKNDPI
                     PLNKTIFEGSFTSLVLRNDVLNDVVRFLYSKKCSMPEDKLRDHIKYYTASALRYALIL
                     SNQKRIKVPQWQEVWSVDACDKNYHFPITFTGDGVGGTYWSIGKVTDTEITKS"
     gene            87012..88553
                     /locus_tag="FTM_0081"
     CDS             87012..88553
                     /locus_tag="FTM_0081"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette"
                     /protein_id="ACD30182.1"
                     /translation="MLYRQIKTVLKIPKHTVYSLVIYSILLGFLSLTIPVSVQTLVNL
                     VGVSLSIRPVISLITILFIFLTAAFFVRIFQLKLVEDIQRKVFVETVLRIISAIYKVD
                     FNDLIRVNVREKINRAFELKFLQKSVSVIFIILLDIFLQTLFCVIILAFYHPMFLVFD
                     ILLITCIVLVIFVPMRAGYEAGLKESTNIYDIVYWFEEKTAEFLSFRQRPEESSVKKV
                     DAKLCNYLDARANFFSVVLRQHVYIGLTYIFINILLLGIGSYLIINGQLSIGQLIAAE
                     ILVNIVLLGLLKFSQYLYDCYGFMVAVRKILDLLEISKKDSPTSEHKKAKLETEVTSL
                     EIALPDYQKARFDYTQNHFNNLCLTRQQAQKLLNAFFDDNSEEIIKINNVCLSNYSKE
                     EICNKIHIASGIEVVAGTVLDNLCENDFSQEKLKYLSELLDAFGVSFLEKYFEKKIDS
                     QTIKYNLEFDTMVVLKMNLIRAILKQPKLLILIDSYGLTNRSNMTITQILQKLAVPTL
                     IISIQ"
     gene            88564..89634
                     /locus_tag="FTM_0082"
     CDS             88564..89634
                     /locus_tag="FTM_0082"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-fusion protein"
                     /protein_id="ACD30183.1"
                     /translation="MQLKSFEMLKKDLSFKKIILLVLLSTIVVGVVLAMIPWQQTIDG
                     YGDVTTLSPSERQQNISAPIGGRLGKWYVFEGDSVKKGDPIVEVLDLDPEVVSRLEEE
                     KSAIELGINSVKLAIKNTKNNIERHKYLVDKGASTQRIYEQAQMEMVNYTQELAKLNV
                     DLAKVKVQIARQQSRLVKAPSDGVIVDRIHGLGGVIVKDTDVLATIVPDSKSRIVELW
                     VNSMDVPLVKIGDKVMLQFEGWPAVQFSGWPQVAIGTFEGEVIFISPQNNAQGQFKIF
                     VKQSGKRDWPSPDVLRLGTKVHGWVLLNNVSLGYELWRRYNGFPINLNSSQLRIGIKK
                     SQEVEKPTTIKEQVQNQPSNIK"
     gene            89717..89998
                     /gene="gatC"
                     /locus_tag="FTM_0083"
     CDS             89717..89998
                     /gene="gatC"
                     /locus_tag="FTM_0083"
                     /EC_number="6.3.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
                     /protein_id="ACD30184.1"
                     /translation="MDKKLVKHIAKLSCFDLTEEQLEQYTKDLINICKILDTVKNFDA
                     QGVKPMISPISVDFKFREDIPQDQDNRTSFDKFACEVVDDYFMVPQVVK"
     gene            90007..91452
                     /gene="gatA"
                     /locus_tag="FTM_0084"
     CDS             90007..91452
                     /gene="gatA"
                     /locus_tag="FTM_0084"
                     /EC_number="6.3.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA(Gln)/aspartyl-tRNA(Asn)
                     amidotransferase, A subunit"
                     /protein_id="ACD30185.1"
                     /translation="MSYIKKLRARLDSGEISAVELTKEYLAKIKEQDKRINSVITLCE
                     AEALKEAEDADAIISAGKQGLLTGIPILHKDLFCTKGIRTTAASKMLDNFVAPYDSTV
                     TKNCKDQGMVTLGKLNMDEFAMGSTNEYSYYGAVSNPWDLERVPGGSSGGSAAAVAAG
                     FAPISTGSDTGGSVRQPASFCGLTAMKPSYGSTSRFGMVAFASSFDQAGIFGHYAEDV
                     ALMLDAIAGECEFDSTCVGVKQNHFTQDLEKDISGKVIGVDESLIKDLPAQIQEAVSK
                     TLDNFKKLGAEIKSVKVPDLKEALSTYYIITPAEAAANLARYDGIRYGYRNPEARDLD
                     ELYRKSRTDGFGAEVKRRIMIGNYVLASSQYDSYYNKSQQLRKVMTDQINQIFTQVDA
                     IFMPASPSEAFKKGDKLDPVSAYLSDIYTIPANISGLPAIAFPIGFANNLPVGGQLMA
                     KAFNDNILTQMVVQYQKHYGIEEFILQQARI"
     gene            91455..92876
                     /gene="gatB"
                     /locus_tag="FTM_0085"
     CDS             91455..92876
                     /gene="gatB"
                     /locus_tag="FTM_0085"
                     /EC_number="6.3.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA(Gln)/aspartyl-tRNA(Asn)
                     amidotransferase, B subunit"
                     /protein_id="ACD30186.1"
                     /translation="MNWEMVIGLEVHIQLSTKSKLFSTSATKYGQHQNTQAAFLDLGL
                     PGTLPIVNKEAIRKAVIFGLAVDAKISKDSFFARKNYFYPDLSKGYQISQSTNPIVQE
                     GRLEIETSKGLKTIRIERAHLEEDAGKSVHGYIAGETGLDYNRAGTPLLEIVTYPDFR
                     SAEEVVAYLKKLHQLVKHLGICDGNMQEGSFRCDVNLSIRPQGQAKFGTRAELKNINS
                     FRFIDKAIEYEYARQVSVLESGGEVVQETRLYDADANETRSMRAKEDAFDYRYFPDPD
                     LLPLVITDEYIESIKKQMPLKSEEREAVYREHLAEQEVEFLLSNLEIADYYDKVAVVI
                     GYKPAYNWITVDLISTLNRAEKEFSSDVVPAEILLEIIANVQKDIISQANAKKVIAEY
                     IDAPSAIEAIIEKLGLKQVSDEGMIRELVQGIIAANPQQAADFKAGKTKLMSFFVGQA
                     MKASKGKANPKQVNQIVQEELNK"
     gene            92891..93298
                     /locus_tag="FTM_0086"
     CDS             92891..93298
                     /locus_tag="FTM_0086"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30187.1"
                     /translation="MNTNKFYYELMKLNVLSSSYVDDSYKAAWHGNVYPFFHDSKYEF
                     HYEVAKYFDRADEKTIDKLCSLLDDYVDERADFSDFEAKVEKVVGKGNVYYVLNYIFR
                     AGQYKKLLENIRLNKIHFSQHFIDRFEAGGYLD"
     gene            complement(93314..94807)
                     /locus_tag="FTM_0087"
                     /note="GDSL-like lipolytic enzyme; frameshifts"
                     /pseudo
     gene            complement(94855..96384)
                     /locus_tag="FTM_0088"
     CDS             complement(94855..96384)
                     /locus_tag="FTM_0088"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30188.1"
                     /translation="MLNKINIVFICFLVLSITPFMGFSNSFKNSNEQSQKSNSIDKQG
                     ITQLQSQIANIQAEINHLTQIKNSNNSAQFATYSSKVENIGLPNSLPGNNKLTLDIMT
                     NIDSDSSIINLSDCSIGGIFDKDGGINVGGAPAITTQGEVTFLGAYSGNNTVPIGMIS
                     SNLFASTVMGLRNKFDSYSIFFGGKIEADAQLWFGSSTISNKATNLASNGQNISLTAA
                     NLYFLSNVGHYVTAEIEFNTTELNNFSLGNAFVIFGNLDTSPFFLTAGRNKLSVGAFG
                     GGGPWTGGITKNFLSPGKVTNVSLNYKSDVWNANVAVFGSNDNQFNFSTGLFYAQKWT
                     QDIAVGFNTGYVYNMAGAGNPSLSRFLQSQGRPTDTIGSFNVNTNITYTIAGGFLNLG
                     AGWATTTNKKDFTGSGKDVLAGAWYAAANYSLVFRGRKTNFGISYGESYNSTNIPMTL
                     TASPLNFGRSSSGIQKQIIVSSQRAYFDNNVLFGPEYSYQQLYNGKHMNTITIDIAVY
                     L"
     gene            complement(96470..97660)
                     /locus_tag="FTM_0089"
     CDS             complement(96470..97660)
                     /locus_tag="FTM_0089"
                     /codon_start=1
                     /transl_table=11
                     /product="drug:H+ antiporter-1"
                     /protein_id="ACD30189.1"
                     /translation="MQIDNKNLKYIPLLVLLTWFLGNMGVHFLLPLLPLLSNNLDASV
                     KLTQYVIAFFLAGKALGMIVYGPLSEIYGRRKFMLFGLILYMSSSLLCMLTTDIYWLI
                     FWRFVQGLGVSGTILMGRVIINDSYPNDKAANIFGYLFALAAVIIACLPTLGGIIAIF
                     KNWQLAFATMMIYSSLIFVIMLKFLPETQSEQFQKSFSLIGIIKDYSNILRNRVFLGY
                     LMCTSLMVAGESAFNTNAAFLMIKTYGVSPKIFGMMMSSLLIAHLLGAAICGHYVVKR
                     GISKLTGVGALILVLAAMFLSVTSILKFDGPYLTITAMFIYFLGTGFIMTTAAVGVVS
                     PFPKMIGTAMAFALSLEFLLSALSSFITSHLSISSLFPITVLITLLSLGSFAMWFFCI
                     KRDK"
     gene            complement(97676..98929)
                     /locus_tag="FTM_0090"
     CDS             complement(97676..98929)
                     /locus_tag="FTM_0090"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate decarboxylase"
                     /protein_id="ACD30190.1"
                     /translation="MSKLSNSKSVFSKLSNKQIETIIQRYASPCFIIDENALLERARL
                     FQQAILNQYQNSIAAYSVKTQSLNTIIQKFYEVGFIPEVVSSDEFEQIQKLQLCDKSI
                     IFNGPYKNDASLIKALQLNAMINCDHFDEILRIAKIAKKLNITAKIGLRVADNKTPQN
                     WSRFGFALTDQQSNSDIFTTIDKIQQIANIQLAGLHCHIGTNIRDISRFTAMAKNIAE
                     LAETILTKYKLTLEWIDLGGGLAGISPTLSDKRLQPYNPFDLELYAATIIAPLKEYLN
                     KTNDKTKLIFELGRSLVDYSVALLTTIVGTREQNEDFQSLITDAGIHTIPTISTYRHP
                     IYHLKTDSYHKKTLLLGPSCMQHDFLHDDIFLPKLEYGDKLLIDGVGAYNISRNNEFI
                     HLKPSVILIDKNHQYQVLRVRQTHQ"
     gene            complement(98922..100184)
                     /locus_tag="FTM_0091"
     CDS             complement(98922..100184)
                     /locus_tag="FTM_0091"
                     /codon_start=1
                     /transl_table=11
                     /product="drug:H+ antiporter-1"
                     /protein_id="ACD30191.1"
                     /translation="MNNHIKAQILLLCFCQLIIIAAMEMSNPFLPIYLQSLGDFDLLP
                     VNAWNVLAYAMPLISAMLFSPFWGKYADRFGYKTMILRAALALAIIQLLIYLTNSALL
                     FITLRFIQGAIAGFLLAAQSYAVVIVSKEFRSRILAWLQSSTAIGIAIGPLIGGVLAT
                     LLSYNQIFLICAVIACCIFIILLIKLESISNPSLLSKQDNNKNCYHKNTSNNYLIYVY
                     FSVIFLAILLSQTAKFLPQSFFAIYAKEFFSSDPIIIAAIYAAPAFSLLLFSAPIGYL
                     FDKLLNKQVNNQYFFASSYFIILFAISTVAIYVHGFTHNIYLILAARFILGVTFAGTL
                     PCLFSLACRTKDNNFGFLIGYCNTFSKFGNLCGIFLGGFIFQISSMQTVFHVTAIIYM
                     FLVVIYICLLYLFDLKSSNFKNKELINV"
     gene            complement(100191..102110)
                     /gene="frgA"
                     /locus_tag="FTM_0092"
     CDS             complement(100191..102110)
                     /gene="frgA"
                     /locus_tag="FTM_0092"
                     /codon_start=1
                     /transl_table=11
                     /product="siderophore biosynthesis protein"
                     /protein_id="ACD30192.1"
                     /translation="MHIEQLQKNKTPLNIETLELIGLITTDLNPTISSIKASTLKNQF
                     KRVALSFYREGLLGKSKKINDTLFFCNINNDKILKINNPILKSLNRIELPDQLTIQDC
                     LTKRETSLENIEELINWAKDNNPQINHDDWQQFEYELDNSFENELSMNIYRGLRQKQL
                     TNTINSANYLNLWQWLTTTMSKNQQLAFLEQWGAVGHIYHPSSKTKIGLSKFENILYS
                     PEFENEVNIIFGAIHKNIAHIEIIDNRIDNYQNWMIINYPEQYKIWYHELDNRGLDSN
                     NYLMIPIHPWQAEHILPAKHKCLIDCQQLIIINDCKYTTKPSMSFRTMLPVATKDKTL
                     MPHIKLPVAIHATSVTRTVSPESVKTGPRISKILLEILAKENHLAKNMDILADIAGIH
                     TTKACRKDDIRQLSAIFRTNPEELLDSDEVACPLASLFVKTPQNQALICDILELLDYN
                     QPSQILAYFRKYTQITLTACLDLYLLYGIALEAHQQNTLVVFKENMPQKLLIRDLGGM
                     RLHLPSFEASGFHFPKDTFSLTFTNSQTITRRKFIHACLQSNIGELVIQLSSHYKIAE
                     GRFWTIVKGEIHQRFEYLKPRISPDKYKQEYTQILEKPWSIKALTRMRLNDKLECDKD
                     DMQGDIYINLKNPLA"
     gene            complement(102363..102785)
                     /gene="fur"
                     /locus_tag="FTM_0093"
     CDS             complement(102363..102785)
                     /gene="fur"
                     /locus_tag="FTM_0093"
                     /codon_start=1
                     /transl_table=11
                     /product="ferric uptake regulation protein"
                     /protein_id="ACD30193.1"
                     /translation="MNSKNLDLKEFGFKVTQPRVEILKLFEKNKDKHLSPDDVFSKLK
                     AQGSTTGIATVYRVLNQFESAGIINRLKLDNEQVMYELNQGEHHDHIICVKCNMIQEF
                     YSPGIEALQKQIVESFGAEMIDYSLNIYVKCKSCREKI"
     gene            102993..103391
                     /gene="nuoA"
                     /locus_tag="FTM_0094"
     CDS             102993..103391
                     /gene="nuoA"
                     /locus_tag="FTM_0094"
                     /EC_number="1.6.99.5"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase I, A subunit"
                     /protein_id="ACD30194.1"
                     /translation="MSTSVYEQFAPILIFLIIAFGLGAAFAIIGKVLSVIVGANNPNK
                     TKGETFECGFPTFGDAREKLDVRFYLIAVLFLVFDLELAFIIPWGINLRASAGMPAIS
                     DHAFFAMIIFLVVLFLGLIYAWKKGALEWE"
     gene            103382..103858
                     /gene="nuoB"
                     /locus_tag="FTM_0095"
     CDS             103382..103858
                     /gene="nuoB"
                     /locus_tag="FTM_0095"
                     /EC_number="1.6.99.5"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase I, B subunit"
                     /protein_id="ACD30195.1"
                     /translation="MGIGNENKGFITASADALINWVRTGSLWPVTTGLACCAVEMMHA
                     GAARYDLDRFGIVFRPSPRQSDVLIVAGTLCNKMAPALRQVYDQMPDPKWVISMGSCA
                     NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALVYGIIQLQNKIIRKDTIARK"
     gene            103861..104505
                     /gene="nuoC"
                     /locus_tag="FTM_0096"
     CDS             103861..104505
                     /gene="nuoC"
                     /locus_tag="FTM_0096"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase I, C subunit"
                     /protein_id="ACD30196.1"
                     /translation="MSTKLQDHFDKITKILSGFGVEGCISYGEITFSIRDQRDIHLIL
                     KKLKKEYLFEQLTDVTAVDYLTYGQSDWQVGKVVSQTGFSRGRQQDFKTAAVDNRFEI
                     IYQLLSMANNVRIRVKCKLKDAQIILVDSVSDLWPSANWAEREVYDMFGIYFNNHPDL
                     RRVLTDYGFVGHPLRKDFPQTGYVEMRYDENLGRVVYEPVEIDDRVNTPRVIRN"
     gene            104527..105780
                     /gene="nuoD"
                     /locus_tag="FTM_0097"
     CDS             104527..105780
                     /gene="nuoD"
                     /locus_tag="FTM_0097"
                     /EC_number="1.6.99.5"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase I, D subunit"
                     /protein_id="ACD30197.1"
                     /translation="MAEYKNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLH
                     RGTEKLAEFKPYNQSIGYMDRLDYVSMMCNEHAYVMAIEKLLQLEVPERAKYIRVMFA
                     EMTRILNHLLWVAACGIDLGAMTVFLYAFRVREDLFDCYEAVSGARMHAAYFRPGGVA
                     RDLPTQMPQYQKTRFTSKRKAKKLNEPRQGSMLDFLDHFVVDFEKSLDEIDTLLTDNR
                     LWKQRTVDIGTVTAERAKELGFTGPMLRGSGVAWDLRKTQPYEVYHKLEFDIPIGANG
                     DCYDRYLVRMAEMRESNKLIKQCVDWLRANPGPVLSDNHKVAPPKRNAMKNNMEELIH
                     HFKLFSEGYCTTEGEVYVGTEHPKGEFGVYIKSDGANKPYRLKMRAPGFAHISAMDEL
                     LSGHMLADTPAIISTIDVVFGDVDR"
     gene            105790..106278
                     /gene="nuoE"
                     /locus_tag="FTM_0098"
     CDS             105790..106278
                     /gene="nuoE"
                     /locus_tag="FTM_0098"
                     /EC_number="1.6.99.5"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase I, E subunit"
                     /protein_id="ACD30198.1"
                     /translation="MSLVDLISPQAREDIDRVLSKFPADQRRSAILEGLHILQDQNGG
                     YLTDDLQTALAEYLQVSKVDVYEVATFYCMYNLKPVGRHKLNVCTNVSCMLNGAYEIL
                     AHIEKKLAIKPGETTKDGRITLKEVECQGACCGSPMLEVNKVFYENLTIEKVNQIIDS
                     LE"
     gene            106285..107559
                     /gene="nuoF"
                     /locus_tag="FTM_0099"
     CDS             106285..107559
                     /gene="nuoF"
                     /locus_tag="FTM_0099"
                     /EC_number="1.6.99.5"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase I, F subunit"
                     /protein_id="ACD30199.1"
                     /translation="MANEVCFRTLHLDKPYSLESYLSVGGYSYWNKILTEKIPPEQII
                     EELKISGLRGRGGAGFPTGLKWSFMPRNAPGQKYVVCNSDEGEPGTCKDREILRNNPH
                     QLIEGIAIAGYVVGATAGYNYTRGEFYEPIARFEDALIEAYQAGLLGTNIKSSGISFD
                     LYSAIGAGAYICGEETALLNSLEGKKGRPRFKPPFPAFKGLYDKPTNINNTETYASVP
                     AILQYGGEWFKKLGTEKSGGTKLFCVSGHVQQQRVVEIGLGMPFKELLDMCGGVRNGN
                     KLKAVIPGGSSSKILTADEMMAVTMDYESIAAAGSMLGSGAVVVLDETTCIVRTLARL
                     ADFYYEESCGQCTPCREGTGWLARTLHRIVAGEGRPEDIDTLVRVATNIEGNTICGLG
                     DAAAWPVQSYIDKFRHEFVYMIENNGRSIVDQ"
     gene            107577..109943
                     /gene="nuoG"
                     /locus_tag="FTM_0100"
     CDS             107577..109943
                     /gene="nuoG"
                     /locus_tag="FTM_0100"
                     /EC_number="1.6.99.5"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase I, G subunit"
                     /protein_id="ACD30200.1"
                     /translation="MSGNKESKKISIEIDGKDYQALPNQSIIEVADANGIYIPRFCYH
                     KKLSVAANCRMCLVDVEGARRASPACATPVMDGMKVKTRSEKALQMQKDVMEFLLINH
                     PLDCPICDQGGECELQDIAMGYGNTTSEYLESKRTVEDPELGPLVATDMTRCILCTRC
                     VRFGEEIAGVKELGVMGRGDHSAISTYISGEMVDSEISANIIDLCPVGALTSKPFRFK
                     ARSWELKQFPTLSAGDALATEINAHIYQNKLVRVVPRENDITGTWIADRDRFEYTGLY
                     SQDRIQQPMIKKAGDWVDVSWEEALDFVKVAIQKTIEKDGADAISAIVSETATSEEMY
                     LTKKLLAAVGSVNIDARVRQYADIPGISAGKGLSCSLEDIRESDFILVFGSNIRKEYP
                     LVNIAIKDAVEKNAAKAVAWNVCDYNFNYDIKQVRLAADNIQYIALSLLKAIFVRANL
                     PYGDLDEILRKVDPAAEVRDVADRIVAAKAPKIIIGQDIVNTSGFETVFSILDVLEKV
                     TSVRGGVLATNVNSVAADRIFSSSKAKFSTYKCLNGQTNTKLLLTVHTELAKDSLYGE
                     QKLRNALENIDIVVSFTAFVDKFTKDTADIILPIATHYETSGSFVDLFGNRKEFKQVV
                     KPYAGNKELWRVLRVLGNLLELEGFDYNSIAEVTNDAYATRARVGVNHVTQILNANLD
                     YQKEVAFVASNSMYSTTSLLRRAEPLQKTTDAKRFAGVRISQELADEIGLKGQSRVIK
                     IYNIDNEINPEVVVDPSLQAKNIMLPRALFKDFLSSDNISIKLVEEER"
     gene            109945..110955
                     /gene="nuoH"
                     /locus_tag="FTM_0101"
     CDS             109945..110955
                     /gene="nuoH"
                     /locus_tag="FTM_0101"
                     /EC_number="1.6.99.5"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase I, H subunit"
                     /protein_id="ACD30201.1"
                     /translation="MLGYILWTSLYVLLIVIPLILVVAYYTYAERKVIGYMQDRIGPN
                     RVGSFGLLQPIFDALKLFLKEIIVPTNSNRYLFFIAPILAFAPAYAAWAVIPFSKGVV
                     LSDMNLGLLYILAMTSFSIYGIVIAGWASNSKYSLFGALRAGAQVISYELAMGFAIVG
                     VVIAAGSMGITGIIEAQSGGIWHWYFISLFPLFIVYFIAGIAETNRAPFDVVEGESEI
                     VAGHHIEYTGSRFALFFLAEYANMILISILTSIMFLGGWNSPFQATALESIFGFVPGV
                     VWLFAKTGIFMFMFLWVRATYPRYRYDQIMRLGWKIFIPLTFVWVVIVACMVRLGVGP
                     WW"
     gene            110969..111457
                     /gene="nuoI"
                     /locus_tag="FTM_0102"
     CDS             110969..111457
                     /gene="nuoI"
                     /locus_tag="FTM_0102"
                     /EC_number="1.6.99.5"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase I, I subunit"
                     /protein_id="ACD30202.1"
                     /translation="MRNITNFLKTFLLWELLKGLKVTGKHFFTRKVTVQYPDEKTPIS
                     NRFRGLHALRRYENGEERCIACKLCEVVCPALAITINSTEREDGTRRTSSYEMDLFKC
                     IFCGYCEESCPVDSIVETNILEYHFEERGENIMTKAKLLAIGDKYEAQIAADRLQDKD
                     FR"
     gene            111462..112067
                     /gene="nuoJ"
                     /locus_tag="FTM_0103"
     CDS             111462..112067
                     /gene="nuoJ"
                     /locus_tag="FTM_0103"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase I, J subunit"
                     /protein_id="ACD30203.1"
                     /translation="MVVTDILFYTFASLAIIFALVLVLANNPVNSVIAMIFTFIFTAA
                     VWIILQQVYLALLLIVVYVGAVLVMFLFVVFMLDLHVEEQGRVGRFFYALAAVVVCAI
                     FATVISYAATNVFAGAMMQGGVGGLKIIGLTMFSNANLYVFELVDFILLAAMTAAITL
                     TLRAKRKGNKTVDPAQQVKVRAKDRLTMVKMPSNNEGAKDE"
     gene            112060..112377
                     /gene="nuoK"
                     /locus_tag="FTM_0104"
     CDS             112060..112377
                     /gene="nuoK"
                     /locus_tag="FTM_0104"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase I, K subunit"
                     /protein_id="ACD30204.1"
                     /translation="MNSISVSVTHGLIFSTLLFVISVAGIIINRRNILILLMSIELML
                     LAVNTNFLIFANMHQQAMGGVFVFFIMAVAAAETAIGLAIVVAIFRKRKTIDLSKLNT
                     LRG"
     gene            112387..114396
                     /gene="nuoL"
                     /locus_tag="FTM_0105"
     CDS             112387..114396
                     /gene="nuoL"
                     /locus_tag="FTM_0105"
                     /EC_number="1.6.99.5"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase I, L subunit"
                     /protein_id="ACD30205.1"
                     /translation="MIINTQVAAVLIAVIVLAPLLGALIAGFGGKSVKNAGVNFFTIS
                     LCGLSFVLSVILAYGVFSGAEVYSVSFYQWAPISNMFAFDVGFTVNKITVYMMLIVTF
                     VSTLVHIYSIGYMKGEEGYARFFAYISGFTFAMLCLVMGNNFLLLFFGWEGVGLFSYL
                     LIGFYFNRDKANVASLRAFIVNRIGDLGFLLGIGAVILYTKSVDYTTVFAALPDIDNT
                     QTIHFLGISFSPVTLMCSLLFIGAMGKSAQFPLHSWLEGSMEGPTPISALIHAATMVT
                     AGVFMVARLSPMFVLSPAALSFVLIIGAITCLFMGLIAIVQTDIKRVIAYCTLSQLGY
                     MMVAQGAGAFSIGMFHLMTHAMFKALLFLAAGSVIVAMHHEQDIRRMGGLRKYMPVTY
                     LCMLIGAWALAALPPFSGFFSKDLIIEAAQATTVYGHEFAYYMVLACAFVTSFYIFRM
                     FFLVFHGKERMSDEERSHLKESPFSILIPLILLAIPSVFVGEYFFSSILSQEHGLFGN
                     TITPFIQAGLGWESVTAHLANEPAIVSSMAFIKHSVTTLPFWLAFSALVLAYVLYVWL
                     PAIPRLFANAKSGFGIIYHILVKKYFIDALYDVIFVNIFLAISNFLWKVVDIFIIDKT
                     VVNGTSNLIYHTGDSFRKIQRGYLFDYAFVMMVGVLLFMILLISV"
     gene            114422..116011
                     /gene="nuoM"
                     /locus_tag="FTM_0106"
     CDS             114422..116011
                     /gene="nuoM"
                     /locus_tag="FTM_0106"
                     /EC_number="1.6.99.5"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase I, M subunit"
                     /protein_id="ACD30206.1"
                     /translation="MNLGNYLLSLIIWLPIVGGFVVLATRTKELHGDAARWVALVFSC
                     LTLALCVPLVTSFDYSSSAMQFQESVKWFKVFGMHDIYYSLGVDGFSVLFIVLTSFAT
                     LVIVLAAWTSIKTKVRQYMAIFLITCGLTNGVFCATDSILYYVFWEALLIPTCLGIGI
                     WGGKHKAYAAVKYFMYTFFGSVFLLAAILYIQTRVAASPTHFLVNQDTYSIQNFIAWA
                     TQSQGFIDSVKFTLTAQWLVFGAFFLAFAVKIPMWPFHSWLPDAHSEAPAGGSVILAA
                     LMLKLGAYGFLRFAIPMLPEVTASLEYVLIIMSLIAIVYVGVVAVAQTDVKRLIAYSS
                     ISHMGLVTLGLFSIFILKNADPVLGTTHAQLALQGAVFQMIAHAFSSGGMFIGIGYLY
                     LRMHTREISDFSGVAKTMPIFATFFLLFCMANVGLPGTSGFVGEFMILQAVFQYSPLI
                     ALIAGLTLVIAPIYTLWMYKRVFFGEVVSTQVASLTDLNRMELFVFILLAVPTLLFGF
                     YPEPILQLSAAASAHIVGLSL"
     gene            116027..117478
                     /gene="nuoN"
                     /locus_tag="FTM_0107"
     CDS             116027..117478
                     /gene="nuoN"
                     /locus_tag="FTM_0107"
                     /EC_number="1.6.99.5"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase I, N subunit"
                     /protein_id="ACD30207.1"
                     /translation="MSLSILYILPEILLALGVIVVMFSGLFLHGKIRNINYIFFQVFT
                     LLALIATFAKEYLIQTTGSVFEGQVVFSGFAYTLQLVILVLAVFVALYSRDYVKDRKI
                     SDGDFYTLLMLCVLGAMVLTAAHSLVTIYVGLELLSLPMYALIAIYRDSGKGLEAAIK
                     YFVLGAIASALLLFGMSFVYGMTGKLDITEIANVLAHGNFAGLQQQFLLVCLVMMIAT
                     FLFKLGAFPFHMWLPDVYQGAPNAVANIVATIPKVAAFAMLVNILFVGFPSLKDSWIY
                     LFRIIGILSIFFGSLVALSQTNVKRLLGYSTVSQIGFVLLATTLNPQGYALTAASFYV
                     IVYVFTTLAVFGVLTTISVGGYEVQDLNDLKGFNTKDSWLAFILLIVLFSMAGIPPFG
                     GFIAKLFVVMGLINDGNYFLACFVLFMAVIASFYYVRVIKTMYFDDPDNDETVKPPLT
                     SLIALSINGLVLLFLGIMPMLLLGVLTQVTNVI"
     gene            117554..117748
                     /locus_tag="FTM_0108"
     CDS             117554..117748
                     /locus_tag="FTM_0108"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACD30208.1"
                     /translation="MKEILGPLNDVIKNSKENIVNKSLKKLDVVSREEFEVQKKILLK
                     TRQKLEQVEAKLDKLLAEKK"
     gene            117750..119257
                     /locus_tag="FTM_0109"
                     /note="magnesium chelatase; frameshift"
                     /pseudo
     gene            119311..120345
                     /gene="hemE"
                     /locus_tag="FTM_0110"
     CDS             119311..120345
                     /gene="hemE"
                     /locus_tag="FTM_0110"
                     /EC_number="4.1.1.37"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="ACD30209.1"
                     /translation="MRKLFLDAFGEKKLDKPPVWIMRQAGRYLPEYRAVRAKFDNFMD
                     MCRNADACCEVALHPLQRYDLDAAIVFSDILTIPEAMGMDLKFIKGTGPVFSEPIQSQ
                     KDLDKLKSIEDSIGSLDYVYNAVKTTSSAINVPLIGFTGSPWTLAAYMIEGSGSKQFN
                     KLRKMMYANPQLMHSLLQRLADITIIYLLEQVKAGASSVMIFDTWGGILPLEHYKNFS
                     LKYKEYIAKNVKQKINIPIVFFTKGGSNFFEEIKDKSCDGVGVDWSVTLKQARHRIGV
                     GKVLQGNFDPAFLYGSKQSIRETVRANIEFIQSDKLNNYIVNLGHGIYPDIDPDSVRV
                     MIDAIREFSA"
     gene            120419..120495
                     /locus_tag="FTM_0111"
     tRNA            120419..120495
                     /locus_tag="FTM_0111"
                     /product="tRNA-Met"
     gene            120571..121023
                     /locus_tag="FTM_0112"
     CDS             120571..121023
                     /locus_tag="FTM_0112"
                     /codon_start=1
                     /transl_table=11
                     /product="protein Lpl2691"
                     /protein_id="ACD30210.1"
                     /translation="MLLDDLYEIVEPITADLGYILWGIEVVGSGKLTIRIFIDHENGV
                     SVDDCQIVSKEISAVFDVEDPVSGKYILEVSSPGMNRQIFNIIQAQALVGFNVKAVTL
                     APVGSQTKFKGVLERVEGNSVILNLEDGKEISFDFDELKKLRVSPDFS"
     gene            121041..122510
                     /gene="nusA"
                     /locus_tag="FTM_0113"
     CDS             121041..122510
                     /gene="nusA"
                     /locus_tag="FTM_0113"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor NusA"
                     /protein_id="ACD30211.1"
                     /translation="MSKELLLVLETVANEKDISKDLLFEAMEEALAIITKKELDEHMN
                     IEVKIDRVTGDFKADRVWHIVSEDEDLIDYSKELYEDVVQEKGYNVKAGDVMREPVEV
                     KEYGRIAATMAKQILMKKIKNFEREKSARFYQNKIGDIVYGEIKRATYEILVVDLGNN
                     AEGILPKKDLIARERYRVGDKIRACVEAVESDESGKPNTIMLSRSSNTMLKALFKLEV
                     PEVEEELINIVNVVREPGFRSKVTVKSNDQRIDPCGACVGVRGSRIHSIMSELNGEKV
                     DVILWNEDMVQYAINSLSPVDAADILEVNVDEETNSMDIVVKQESLSKAIGKNGVNVR
                     LASSLIGWKINVLSDAEQEEKQMSIVEKFVEALDIDHDFALVLIEEGIETLEDLAYLD
                     RAELLEIEGFDEEIVDELQERAKAVILSQALGGKKPAQDLLDMQGMSLDLAEQLAQNN
                     IVTMEDLAELSVDELLDIVDIDEEQATNLIMQARAPWFE"
     gene            122549..125089
                     /gene="infB"
                     /locus_tag="FTM_0114"
     CDS             122549..125089
                     /gene="infB"
                     /locus_tag="FTM_0114"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="ACD30212.1"
                     /translation="MAEITVGQLAQQTNKEVDALLKQLKSFGIEKSSEKDTLTPTEMK
                     TLLEKINSAKNTATRKKVTSVKLDGKHKINVSVKRKRRVAKKVEQQESTTLEQPQELE
                     TMVQEVSQQVDIVKEQDNIEQIVENKEAVKVQEQRQAEIAKPVIKDSGFKITAMPEIK
                     IEEIVAEDDEGLAASDKQAKKKAAKKVFSEAVNTNTKYKREEEEKKSKAKKAGGKGFK
                     KANPRQLSQLAGDLESFDEFGAKKGKLKAPKVKKQEFTKPVENTVRTVEIHEGITVSE
                     LAQKMAVKGAEIVKVLFNMGVMATINQSLDQDTAILIVEEMGHKYTLHNENALEEAVT
                     IVDRSSYKKISRAPVVTIMGHVDHGKTSLLDYIRQTRVVAGEAGGITQHIGAYSVKTD
                     KGSITFLDTPGHEAFTSMRARGAKSTDIVILVVAADDGVMPQTEEAIQHAKAARVPIV
                     VAVNKIDKPEADPDKVISELAQRNVIPESWGGDVMFVNVSAKTGEGVADLLEAVLLQS
                     EVLELEAFAEGLAEGVVIESRLEKGRGPVATVLVQNGNLKQGDNILCGTEYGRVRAMH
                     NDLGKKIKAAGPATPVEILGLSGVPAAGDEMVVIENEKKAKELAAQRSQKQKEAKIAQ
                     EQSLKLSNMFNNMGKEGEQQVLKIILKGDVQGSVEAIRESLLKLSTDEVKVDIIASGI
                     GAITSSDVTLAVASTAVVIGFNVRADSAAKKLAETDGVEFRYYNIIYDLIDDVKKAMS
                     GLLSPEMKEQIIGIAEVREVYRSSKFGSIAGCMVIEGVVKRTNPIRVLRNNVVIYEGT
                     LESLKRFKDDASEVKKGLECGIGVKNYNDVREGDQIEVFEVIEVAKEL"
     gene            125092..125523
                     /gene="rbfA"
                     /locus_tag="FTM_0115"
     CDS             125092..125523
                     /gene="rbfA"
                     /locus_tag="FTM_0115"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="ACD30213.1"
                     /translation="MAAEGRVQRVASEFQKVISLLLRTRIKDAKLASATITEVDLSKD
                     LSYAKIYYTCLAIEDAEYIDKAFEKSKGFFRSSIAKSLSLRIVPNLKFIYDTSLDYGM
                     QMEEKIQQALEADSKIIKQDDKSLQENYKQNDKETKAEKLR"
     gene            125531..126796
                     /gene="hisS"
                     /locus_tag="FTM_0116"
     CDS             125531..126796
                     /gene="hisS"
                     /locus_tag="FTM_0116"
                     /EC_number="6.1.1.21"
                     /codon_start=1
                     /transl_table=11
                     /product="histidyl-tRNA synthetase"
                     /protein_id="ACD30214.1"
                     /translation="MSKLTIVRGFNDVLPLDSYKWQLLESKVKLILDRYNYSETRLPI
                     VERSELFHRSVGESSDIVSKETYDFQDRNGDSLTLRPEGTAGCVRMVIENNLATRGQT
                     QKLWYCGPMFRYERPQKGRYRQFYQLGVEAYGFDGIAIDLEVIAIAWSLFKELGISEY
                     VTLELNSLGSSLNRQEYTQALLQYLKPYHAELDEDSIKRLDKNPLRILDSKIEKTQKI
                     LANAPKLIDFIDHDLRLRFKQTCQYLDALGVRYKLNENLVRGLDYYTGLVFEWTTDKL
                     GSQSAICAGGRYDGLVENLGGQKTAAIGFAIGMERLLLLLEDLGKLPNQDNACDVFFI
                     LDSAQLHQSLAIVENIRQELPQLKIDMDLKFGSFKSQFKKADKSGAKVAIIIGQDELD
                     NGFAGIKFLQQNEEQQQVAFNELINFLER"
     gene            126803..128101
                     /locus_tag="FTM_0117"
     CDS             126803..128101
                     /locus_tag="FTM_0117"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily"
                     /protein_id="ACD30215.1"
                     /translation="MKLHNIKGYAWIVVGLSSFLLIDKYIMNVSPSLIANELMSSFSI
                     NATEMSAMVSLFLWSVVFCQFFVAGPIIDKLGFRKVSFFSLILSAIGLLLFVLSADIH
                     SFALGCVSRLMIGIGASFATVGYIKAAAVWFDPRKFAFVCSFLMTAAMTGALLGQVPL
                     VYLIELTGSWHRALISYACFSIVIALLYLALVRDYNPDASYSNQTKGNTGTLAGIKKV
                     LLNKNNWYLTLYTGLTFTTIDVFGGIWGNNYFRELYSIPAKDASYIVSMMFLGLAIGS
                     PIIGKLSEKFDNRVGIMVAFHIIATISLAVVLQFKLTPTISGVLLFVFGFCLGVYMLA
                     FAIGNRINPVVVAATVAALINTGEPLLGALFDLLIGHLLDLTWTGQYIDAQNHISAIA
                     SEGAHRYFHINAYHHAFLILVFSMIVSFFLLILVKDKEVK"
     gene            128104..129171
                     /locus_tag="FTM_0118"
     CDS             128104..129171
                     /locus_tag="FTM_0118"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="ACD30216.1"
                     /translation="MKLENIYLQKIRELDLKVDSLQLEAIRRLQEIVDQLYSKKKSKL
                     RLFKKSFYPAIKGLYMWGGVGRGKTFIMDIFYNNLTIKNKKRQHFSHFMKNIHTQLRK
                     YQGEKNPISKVAFDMAKQTQIICFDEFFVEDIADAMILGSIFTELFKFGVVLVATSNI
                     EPEKLYKNGLQRELFLPAIDVLLKNVDVLNLDSGVDYRFRLPTEYLNYLYPYNEHNRK
                     NFFDKFFLRNSHFDKDLSIRVLARDIPTILLSHKDVCFDFKVICGDGRSAHDYIDICH
                     KYEQLFIYNLVVFGPHNEDMARRFIALIDEFYDQNKKVVILANCDFKDLYNGERLKFE
                     FQRTISRLNDMQSSRFGVINE"
     gene            129164..130093
                     /gene="rluC"
                     /locus_tag="FTM_0119"
     CDS             129164..130093
                     /gene="rluC"
                     /locus_tag="FTM_0119"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal large subunit pseudouridine synthase
                     C"
                     /protein_id="ACD30217.1"
                     /translation="MNKVELIEVAEDVIDQRIDNFLLSRFSRLPKSLIYRWIRKGELR
                     VNKKRVKQISRVSAGDIVRVPPFSLEEDSKPIKISQSHLDFLEQRILYENDDYIIVDK
                     PSGMAVHGGSGVNSGLVERLRQLRPKVRRLDLVHRLDKETSGCVLLAKKHSSLVYFFD
                     IFKQRKVDKIYYSIVHGHWDKKIIKIDLPLKRTETKDGQRVVKVDSKDGKQALTRIIS
                     VRHLQGGFSLLEIKLETGRTHQIRVHTKAMGHPIVADKKYGFATKDQLLLDKGVDRLL
                     LHAAKLEFYDDKQNKQISVTAALDSRFEKFIQE"
     gene            complement(130095..131399)
                     /locus_tag="FTM_0120"
     CDS             complement(130095..131399)
                     /locus_tag="FTM_0120"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily"
                     /protein_id="ACD30218.1"
                     /translation="MEQRIYNIRGYAWIIIILSSFLLFDKYVMQVFPSLITDDMMSNF
                     GTNATQTGALGSAFFWSIIICQLFLAGPIIDKFGFRLISPISITISATGVILFVVAAN
                     LGSLSMAYIARITTGLGVSFATISYLKAVSVWFEPRKFAFAASFLATAAMIGALCAQA
                     PLAYLITICGDWKMAMLLFSVASLLIAVVYYIVVRDFNPKQPEASSPNNQLKTLDVLK
                     EVIKNKNNWLLTFYVGLSFTAVDAFAGFWGNAYFREAYHISREEAASIISMIFIGMAI
                     GSPIIGKLSEILDSRKGVMIFFHIIGTIALSFVLLTKTSSTISAILLFIFGLCLGIYM
                     LSFAIGNRINPIIITATVAAFINTGEPILGAIFDPLIGYFLDWSWTGKYINKAGEVVS
                     QYTGSADIKYFELESYHFAFTTLVASMIASLVILVMIKDKKD"
     gene            131476..131907
                     /locus_tag="FTM_0121"
     CDS             131476..131907
                     /locus_tag="FTM_0121"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30219.1"
                     /translation="MLIWAFLVLCESVFMNEIHVMLTNIKIDTKKFILLQLILVLVGY
                     FVILVFYNYDYANSFLIGSLTMFLANFVFFFRLFINKQFSPGIEIAIFYLSELLKLSI
                     VALLTILLAIYVKPKLFSYIFGLVLLQLAVCFVPILFKRVR"
     gene            131960..132751
                     /gene="atpB"
                     /locus_tag="FTM_0122"
     CDS             131960..132751
                     /gene="atpB"
                     /locus_tag="FTM_0122"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase, F0 sector, subunit a"
                     /protein_id="ACD30220.1"
                     /translation="MANTEAGSQVATEYVQHHLHHWQVSLGQGSFWQLNVDSLLVSGI
                     LGVVFILAMFLAARKANSGVPGKFQNMIEAVWEWMDGIVANNYHHKRDFVTPLALTIF
                     VWVVLMNFMDLLPVDLFGWIISFFTASHEAYFRVVPTADPNVTFAMSIAVFFLVIFYN
                     LKAKGFGLIKEVLSSPFGIWLFPLNIFFRLVDEIVKPVSLSLRLFGNIFAGELIFILI
                     ALLPWWFQWTLGGIWAIFHILIVLIQAFVFMMLTVVYLNMAQEAH"
     gene            132802..133107
                     /gene="atpE"
                     /locus_tag="FTM_0123"
     CDS             132802..133107
                     /gene="atpE"
                     /locus_tag="FTM_0123"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase, F0 sector, subunit c"
                     /protein_id="ACD30221.1"
                     /translation="MDMSLQVLGNLNGLTAVAVALLISLPALGTAIGFGVLGGKYLEG
                     VARQPELGGMLLGRMFIVAAFVDAFAAISIAIGFLVLYANPLAIPGLAEAAQKVIGA"
     gene            133153..133623
                     /gene="atpF"
                     /locus_tag="FTM_0124"
     CDS             133153..133623
                     /gene="atpF"
                     /locus_tag="FTM_0124"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase, F0 sector, subunit b"
                     /protein_id="ACD30222.1"
                     /translation="MDINITLIGQMITFAIFVGFTMKFVWPPLRKALEERREKIAEGL
                     ASADRASRELEVAKRQSAEILREAKAKATEIVENAYVRAHKVDEQAKEEAIAAADKIK
                     SMAIAEIEQEKVKAKEQLKQELVNLAMAAASKIIAASVDEKASKKVLEDFVEKV"
     gene            133643..134167
                     /gene="atpH"
                     /locus_tag="FTM_0125"
     CDS             133643..134167
                     /gene="atpH"
                     /locus_tag="FTM_0125"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase, F1 sector, subunit delta"
                     /protein_id="ACD30223.1"
                     /translation="MTNISVIAKPYAKAAFEFANEHNLLQQWSKLLQTFSELIKDKSV
                     AAIVSSPTISQIEVVDALKKQLDENFFNFLALIAENKKMLIMPEIADQFESIKKIHNN
                     VRVADVTLAYATDKNILDSLKTSLEKKFGCTIDMHINIDPAIIGGAVVKVGDTVIDSS
                     VSGHLEKLKSILLS"
     gene            134186..135727
                     /gene="atpA"
                     /locus_tag="FTM_0126"
     CDS             134186..135727
                     /gene="atpA"
                     /locus_tag="FTM_0126"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase, F1 sector, subunit alpha"
                     /protein_id="ACD30224.1"
                     /translation="MQLSPSEISGLIKQRIEKFDNSVELKSEGTIVSVADGIVTIYGL
                     NDVVAGEMIKLPGDVYGLALNLNTDSVGAVVLGDYEHIKEGDKAYCTGRILEVPVGEA
                     LLGRVVDALGNPIDGKGEVATDLTSPIEKIAPGVIWRKSVDQALQTGIKSIDSMVPIG
                     RGQRELIIGDRQIGKTAIAVDTIINQKGTGVKCIYVAIGQKASTIANIVRQLEEHGAM
                     EHTIIVAATASDSAALQYIAPYAGCSMGEYFRDRGQDALIVYDDLTKQAWAYRQISLL
                     LRRPPGREAYPGDVFYLHSRLLERAARVNEEYVEKFTNGEVKGKTGSLTALPIIETQA
                     GDISAFVPTNVISITDGQIFLETDLFNSGLRPAINPGNSVSRVGGAAQTKIIKKLGGG
                     IRLALAQYRELEAFSQFASDLDEATRAQLNRGQRVTELLKQKQFSTLSVALMALSLYA
                     ADNGYLDNLEVSEVIPFESALHALAETKYSDVIAEINETGKYDADIADKLKIIVEDCK
                     ANQAW"
     gene            135742..136638
                     /gene="atpG"
                     /locus_tag="FTM_0127"
     CDS             135742..136638
                     /gene="atpG"
                     /locus_tag="FTM_0127"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase, F1 sector, subunit gamma"
                     /protein_id="ACD30225.1"
                     /translation="MSNAREIRSKVQSVKNTQKITGAMELVAASKMRGAIVKMNNVRP
                     YVESANTIIKNVTAASIDYPNPYLFDRDVKRVGYIVISTDRGLCGGLNINLFKHVLKE
                     IKNNIEDRVGVDVCVIGSKAENFFAKLKDVNIVATAHYNDKDKEGSIRAIGGAVKVML
                     DKFTAGEIDRLYMSSNQFVSTIKQRPRLQTLLPIQDIFSAEEIKANKEKATKGHWDYI
                     YERDIEEVLNALCIRYIEAQVRGAILENAACEQAARMMAMKNATDNASDIIDQLKLDY
                     NKVRQAMITQELAEICSGAAAV"
     gene            136648..138024
                     /gene="atpD"
                     /locus_tag="FTM_0128"
     CDS             136648..138024
                     /gene="atpD"
                     /locus_tag="FTM_0128"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase, F1 sector, subunit beta"
                     /protein_id="ACD30226.1"
                     /translation="MSTGKIIQVIGAVIDVEFARDNTPKVYDALNVVEAGLVLEVQQQ
                     IGDGVVRTIAMGSSDGLRRGMEVKNTNAPISVPVGHGTLGRIMNVLGEPIDEAGPIEY
                     TEKRSIHQAPPAYDELALSTEILETGIKVVDLICPFAKGGKVGLFGGAGVGKTVTMME
                     LINNIAKEHSGYSVFAGVGERTREGNDFYYEMKDSNVLDKVSLVYGQMNEPPGNRLRV
                     ALSGLTIAEGFRDEKRDVLMFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAAEMGA
                     LQERITSTKTGSITSVQAVYVPADDLTDPSPATTFSHLDATIVLSRQIAELGIYPAVD
                     PLDSTSRQLDPLVVGQDHYEIARAVQKVLQRYKELKDIIAILGMDELSDEDKKIVDRA
                     RKIQRFLSQPFHVAEVFTGNPGKFVSLKDTVASFKAIVNGEYDHLPEQAFYMVGSIQE
                     AIEKAKTL"
     gene            138037..138474
                     /gene="atpC"
                     /locus_tag="FTM_0129"
     CDS             138037..138474
                     /gene="atpC"
                     /locus_tag="FTM_0129"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase, F1 sector, subunit epsilon"
                     /protein_id="ACD30227.1"
                     /translation="MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELL
                     STLPAGVVNVRKDQHTDVLYVSGGIVEVTPTRVTIMVDDMERAENLNQAEAEKARVRA
                     KEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD"
     gene            138685..141528
                     /locus_tag="FTM_0130"
     CDS             138685..141528
                     /locus_tag="FTM_0130"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30228.1"
                     /translation="MRKLFINLILLTLIFPLILQAEPLSDSDSSSSKSLLPNRTIAGF
                     LDIRTPGSTTRVDMQKVKKDGYNVMIVAYGEVYDDNIGFYTNSVTSTQTIIDKIRDAK
                     KAGMKVLLAVGGSPNTFHPGVKQGAPDPKIFGNDLTDAQIKSLANNIVSFLNKNDIDG
                     ILYCIKKFTSPEFITKLSADIKKINAKIIIAAEPEVNNYKLVTTGLSNDYDKAIEDGN
                     IDYLFIQEYNTYPEYDPNFISESYPKIIESVNIPIKTKILIEEPTNAVSGGTNTIYHP
                     QGNATKSLSTEQAIKLLLPQLEKLKFKPRFAGVAGWSLNTDYAADLYGDSSHNAGAFA
                     KGLSACIYKNTCTEIDNQIHGPVVAGILPLWGKSSSYNISGQQINTIPISISMPKDKE
                     YCDYNPNVCKYNVIIAAYLTYTSSKGFELSFNEENGSSKKIYSPEELKAFITYMNSKG
                     KHTIVSIGGKYSHINWETINFSDLVKIVQEYGFNGINFDLSSSDMPKNDKVAKIAADK
                     INKLITALRQNNHGFWLTFSPEWHYIVAPLAKNDKDNIYVNHNYIELLDSLGMNKIDY
                     IWLNTFADKPSDGILSFYKDKDGEHIKITPADGYAKFLASLAWALTTRAGYDANMPKY
                     DEIDKPLHIPANKLVLMIPATKGTTHSDMVYVLSEKDIKEVVSLMKGNNASFAGFAVW
                     SIDFDATNINNGDLGNDYSHKPWSTTAAISDISLPPIVSQLKDQIKQETKATSPIQEQ
                     EQSIDTGIINYPDKIGAYNVDTIINFQGKKYKCKSNLEVKLCNDKGYIPNGLYGYLAW
                     DEIDSAKQTKVKRKQRKLAVGEIVKYPKFIGNYSVGQIVIAGDRKFECQKQELCNDKS
                     YRPIGKSGYLAWSDITDDVAHLATEAKQVKPKGAEYIYPFGIEDYSAGTVVAIGQELY
                     RCKVGPESSLCNSEAYKPTGKYGTDAWTKIDSK"
     gene            complement(141545..141874)
                     /locus_tag="FTM_0131"
     CDS             complement(141545..141874)
                     /locus_tag="FTM_0131"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin-related protein"
                     /protein_id="ACD30229.1"
                     /translation="MYTPEEQKVVERIEKQLKENDIILYMKGSPNLPQCGFSAHAATA
                     IRSCGKPFAFVNILENPDIRAILPKYADWPTFPQLWVKGELIGGCDIIMEMNESGELK
                     KLIDSVK"
     gene            142010..142588
                     /gene="sodB"
                     /locus_tag="FTM_0132"
     CDS             142010..142588
                     /gene="sodB"
                     /locus_tag="FTM_0132"
                     /EC_number="1.15.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="iron/manganese superoxide dismutase family
                     protein"
                     /protein_id="ACD30230.1"
                     /translation="MKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVE
                     GTEHDGRNLEEIVKTSNGGIFNNAAQVFNHTFYWNCLTPNKTEASSQLKAALIETFGS
                     VENFKEQFSKAAIATFGSGWAWLVKNTEGKLEIVTTSNAGCPLTENKKPLLTFDVWEH
                     AYYIDYRNARPKYVEALWDIVNWQFVSEQFAD"
     gene            142600..142788
                     /locus_tag="FTM_0133"
     CDS             142600..142788
                     /locus_tag="FTM_0133"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACD30231.1"
                     /translation="MAKNKISLFYFVIGVLSIVVVILIAVLFPGLRLSAIFRNILLII
                     LLLPWIVFMLSLLFSGKE"
     gene            complement(142793..144058)
                     /gene="ampG"
                     /locus_tag="FTM_0134"
     CDS             complement(142793..144058)
                     /gene="ampG"
                     /locus_tag="FTM_0134"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide-acetyl-coenzyme A transporter (PAT)
                     family protein"
                     /protein_id="ACD30232.1"
                     /translation="MTSSPSFIDKLKAPFKEAKMFTMLILGYASGFPLMLTASSLFLW
                     YKDNGIETKDIGFLTLIAIPYTFKYLWAPFLDKIKIPILGRRKGWILITQVSLVILIA
                     IMSRFSPANSPLIIAFIGFLICFISATQDIAINAYQTEVLLEHERALGNAIAVMGYRI
                     GMLVTGSLVLIIVDKLNNNWNLAWLMIIPFFIICPLYTLLIKESQYQDAPKSFKDAFI
                     LPFVEFFKRQGLYTAIIIIIILISYKLADAIAFSLNSIFFIDLGFSKTTIAVSYKAFS
                     LFASLAGLFVGGLIAKQIGVYKSFLYFSIIMACANLTYVLLAIVGKNYYLMLASVSVE
                     YFCGAMGTAMLVAMIMSLVNVKFSATQFAILSSIDSLARVFVGPLAGYIQAHYKWEGL
                     FIFSFIVGMFISLLIFIFRTRIKLMANLQ"
     gene            complement(144148..145407)
                     /gene="gltA"
                     /locus_tag="FTM_0135"
     CDS             complement(144148..145407)
                     /gene="gltA"
                     /locus_tag="FTM_0135"
                     /EC_number="2.3.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="citrate synthase I"
                     /protein_id="ACD30233.1"
                     /translation="MSKYATLKYADKNIEIELPVYSPSLGNDCIDVSSLVKHGIFTYD
                     PGFMSTAACESKITYIDGGKGVLLHRGYPIEEWTQKSNYKTLCYALIYGELPTDEQVK
                     SFRQEIINKMPVCEHVKAAIAAMPQHTHPMSSLIAGVNVLAAEHIHNGQKESQDEVAK
                     NIVAKIATIAAMAYRHNHGKKFLEPKMEYGYAENFLYMMFADDESYKPDELHIKAMDT
                     IFMLHADHEQNASTSTVRLSGSTGNSPYAAIIAGITALWGPAHGGANEAVLKMLSEIG
                     STENIDKYIAKAKDKDDPFRLMGFGHRVYKNTDPRATAMKKNCEEILAKLGHSDNPLL
                     TVAKKLEEITLQDEFFIERKLFSNVDFYSGIILKAMGIPEDMFTAIFALARTSGWISQ
                     WIEMVNDPAQKIGRPRQLYTGATNRNF"
     gene            145665..146138
                     /gene="sdhC"
                     /locus_tag="FTM_0136"
     CDS             145665..146138
                     /gene="sdhC"
                     /locus_tag="FTM_0136"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase, cytochrome b556
                     subunit"
                     /protein_id="ACD30234.1"
                     /translation="MSKNISLRVVCITLVTSDLLLYKNCFGGMSSMKKITNIDLMSIK
                     SYNFPITAISSIMHRISGVVLIIAIPLCVVAMNYALAGPDGYQQTVTVLTKSWFSVFF
                     WLFLSSITYHVYAGIRHMIMDMGFGESMKVAKITSLLVIVLGVLSAILWGCYLWL"
     gene            146114..146482
                     /gene="sdhD"
                     /locus_tag="FTM_0137"
     CDS             146114..146482
                     /gene="sdhD"
                     /locus_tag="FTM_0137"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase, hydrophobic membrane
                     anchor protein"
                     /protein_id="ACD30235.1"
                     /translation="MGVLLMAVISLTSSGIKDFFVQRVTAVIIAVYFGYLILEALYLS
                     HIGALNYDSWRGLFTDGMFFRVATLMAYLAMFFHAWVGIWIICGDYIKFAWASALVML
                     SFVLVYIFCFFWLFAVLFFY"
     gene            146495..148288
                     /gene="sdhA"
                     /locus_tag="FTM_0138"
     CDS             146495..148288
                     /gene="sdhA"
                     /locus_tag="FTM_0138"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase, flavoprotein subunit"
                     /protein_id="ACD30236.1"
                     /translation="MSIATQEFDAIVIGAGGAGLRASFQLSQSGFKTAVVSKVFPTRS
                     HTVAAQGGIAAALGNIEFDDGLPSDDWKWHMYDTVKGSDYIGDQDAIEYMCEHAPQSI
                     IELEHMGMPFSRLKNGKIYQRAFGGMSRNYDPANQAERTCAAADRTGHALLHTLYQGN
                     LAHKTDFYTEWFAVDLVKADDGSIAGVIALCIETGETVFLKAKITILATGGAGRIYES
                     STNAYINTGDGMGLALRAGLPLQDMEFWQFHPTGIAGAGVLVTEGCRGEGGVLRNKDG
                     ERFMERYAPNAKDLACRDVVSRASQQEIMEGRGDTFSGTSCVWLDLTHLGEDVIDERL
                     PTVRELGRTFAGIDPVEKPIPVVPTCHYQMGGIPTNKHGQVITQVDGKDKVIGGLYAV
                     GECASVSVHGANRLGSNSLLDLVVFGRAAGMHAEQSLKEGMPMKEVSQENIEKATARI
                     TKWDTSEQRGCKEKISELRKELQRVMQQYFSVFRQESTMKEGLDKLFNIRERLDNAVL
                     EDNSRIFNMMRIEALELDNLVLTAIATAKLALERKESRGAHSRVDYPERDDKNWMKHT
                     LYFLEGDRTSLRDVNMSPTKVKAFQPAERKY"
     gene            148306..149007
                     /gene="sdhB"
                     /locus_tag="FTM_0139"
     CDS             148306..149007
                     /gene="sdhB"
                     /locus_tag="FTM_0139"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase iron-sulfur protein"
                     /protein_id="ACD30237.1"
                     /translation="MEVRFKIYRYNPEVDKKPYYDEYTVEVENEGVKVLTALELIKEQ
                     DPTLALRRSCREGVCGSDGMNINGKNRLACITSVGELKQPIKVNPLPGLPVIRDLIVD
                     MKQFYKNYEKVKPYLINDDEPPVKERLQSPEDRAKLDGLYECILCACCTTSCPSFWWN
                     PDKFIGPSGLLQAYRFIADSRDTAKEQRLEDLKDPFSLFRCRTIMNCVSVCPKGLNPT
                     EAIGKIRSALLKKSV"
     gene            149037..151850
                     /gene="sucA"
                     /locus_tag="FTM_0140"
     CDS             149037..151850
                     /gene="sucA"
                     /locus_tag="FTM_0140"
                     /EC_number="1.2.4.2"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate dehydrogenase, E1 component"
                     /protein_id="ACD30238.1"
                     /translation="MKKKQPDFSQWLETTQFFGGNLEYLESIYDDYIRGNHDGIDPKW
                     LSFFDSIASSTDTVHGELVDEFKYLAKNKNNTANVNTVVSTEGDIGLKAKALVKAYRS
                     YGYKSANIDPLGLTRFERDSDLELAAHGLSEKDLTQLVNLGDFTDNKAIPLQQVINKA
                     KAIYESNIGYEYRYIGNKEEKLWLQDRIEDTAVIPSDSKKWILQQLVAAEGLEKYLAL
                     RYVGQKRFGLEGGESLIPSLQHIVEKAVSRHSTRFIQLGMAHRGRLNVLVNVMGKNPK
                     DLFEEFEGKQSEKSLSGDVKYHMGYSNYRSIDGKEAKIALAFNPSHLEAVDPVVEGAA
                     KAIQDKLDGDVYSKVLPILIHGDSAFCGQGVVMETFGFSLTEAYGTGGTIHLVVNNQV
                     GFTTSSAFGVNRSSNYSTDVAKMVDAPIFHVNGDDPEAVLKVTDIALEYRMKFNKDVV
                     IDLVCYRRNGHNETDEPSGTQPQMYEVIKKLPSTLKLYSDKLIKEGVVDADHFARMNA
                     NYRSKLDNGKVTIDVLDRKIVKDKLNVCDWLPYLGKQESDYNYMPIPEKTLKELALKI
                     SEVPAEVEMQMQVKKAVTDRIKMANGELPLNWGFAESLAYATLLSDGYPVRISGEDSG
                     RGTFSHRHAVIKNMNTKSQPKEYIPLRHINEKVRFDVIDSTLSEYGVLGFEYGYSCYS
                     PDALVVWEAQFGDFVNTAQVVIDQFLVAAEEKWGILSGLTLFLPHGQEGAGAEHSSAR
                     LERFLNSCANDNMQVCTPTTPAQIYHLLRRQVIRPLRKPLIVMTPKSLLRNPMAVSSL
                     QELSQGKFEAIIDDVNAKAAKVTKLILCNGKVYYDLMAKKQDNYEHIAVVRLEELYPF
                     PQQQLAQIFTKYNNVNKVVWLQEEPENKGAWYNIRHFIEKLVDKKQELLCVARERSST
                     PAVGYHALYVKQQEEIINTALEI"
     gene            151876..153345
                     /gene="sucB"
                     /locus_tag="FTM_0141"
     CDS             151876..153345
                     /gene="sucB"
                     /locus_tag="FTM_0141"
                     /EC_number="2.3.1.61"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate dehydrogenase, E2 component,
                     dihydrolipoamide succinyltransferase"
                     /protein_id="ACD30239.1"
                     /translation="MVELKVPMFPESVADGTLAQWNKNEGDFVNEGDILAEIETDKVV
                     LEVPATSSGVLKGIKKHAGDTVLSEESLAIIDTAVSTSEPNQQTTNQGNASEATATGQ
                     EIDIKAPVFPESVADGTISEWHKKEGETVSEGDILAEIETDKVVLEVPATSNGVLTKI
                     LKTAGETVLSAELIAKITAGGATATTKSEASVGVSQANNDPHLVPSARKAFNASGLDT
                     AANIEGTGKKRRITSEDVKKAVASVNKPQQQTVVINQGARYEKRVKMTRLRQTIANRL
                     VEVQHTNAILTTFNEVDMSAVMELRNKYKDMFVKEHDTKLGFMSFFIKAATEALKKFP
                     DVNASIDGDEIVYHNYFDIGIAVGTDRGLVVPVLRDTDTKSLAELEADVLDKAIKGRD
                     GKLSLEDMQGGTFTITNGGTYGSMLSTPIINSPQSAILGMHNIVERPVVVKGEIKIRP
                     IMYLALSYDHRIIDGGTSVRFLKMIKELIEDPNRILLQV"
     gene            153385..153912
                     /gene="apt"
                     /locus_tag="FTM_0142"
     CDS             153385..153912
                     /gene="apt"
                     /locus_tag="FTM_0142"
                     /EC_number="2.4.2.7"
                     /codon_start=1
                     /transl_table=11
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="ACD30240.1"
                     /translation="MNLDFIKSKIAAVPDFPKPGIMFRDITPLLADPQGLRKTAEAMA
                     QELKNKGIQPTIVAGTESRGFIFGVALAEVLGLGFVPVRKPGKLPRATYSVKYDLEYG
                     SDSLEIHQDAFKVTDEVLVVDDLLATGGTAKATVDLIEKTQAKVAGLIFVMELDGLGG
                     REVLAGYNVSALIKF"
     gene            153923..155254
                     /gene="mrsA"
                     /locus_tag="FTM_0143"
     CDS             153923..155254
                     /gene="mrsA"
                     /locus_tag="FTM_0143"
                     /EC_number="5.4.2.10"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucosamine mutase"
                     /protein_id="ACD30241.1"
                     /translation="MAKYFGTDGIRGEVANSTITVEFTQKLGNAVGSLINQKNYPKFV
                     IVGQDTRSSGGFLKFALVSGLNAAGIDVLDLGVVPTPVVAFMTVKHRAAAGFVITASH
                     NKFTDNGIKLFSSNGFKLDDALEEEVEDMIDGDFIYQPQFKFGSYKILANAIDEYIES
                     IHSRFAKFVNYKGKVVVDCAHGAASHNFEALLDKFGINYVSIASNPDGLNINVGCGAT
                     CVSNIKKAVKEQKADLGISLDGDADRIIIVDENGQEIDGDGILNILAQYSNICGGTNG
                     IVGTQMTNMSYENHYRANKIPFIRSKVGDRYVLEDLVKYGYKIGGESSGHVINLNFGT
                     TGDGLFTAIQLLAIFSQADKPVSEFKLQGELMQQTLINVPLTKKVAREDLQKVASDVN
                     DVEKRLGNRGRVLLRPSGTEPVLRVMVEADDKSLATNEAEYLVEKVKQKLV"
     gene            155257..156018
                     /gene="tpiA"
                     /locus_tag="FTM_0144"
     CDS             155257..156018
                     /gene="tpiA"
                     /locus_tag="FTM_0144"
                     /EC_number="5.3.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="ACD30242.1"
                     /translation="MQKLIMANWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSV
                     YVKEVISQLPEKVGVGLQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAE
                     SDEDVFKKLNKIIDTTITPVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKV
                     VIAYEPVWAIGTGVVASLEQIQETHQFIRSLLAKVDEKLAKNIKIVYGGSLKAENAKD
                     ILSLPNVDGGLIGGASLKAVEFNEIINQANKICTE"
     gene            156006..156359
                     /gene="secG"
                     /locus_tag="FTM_0145"
     CDS             156006..156359
                     /gene="secG"
                     /locus_tag="FTM_0145"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase, subunit G, membrane
                     protein"
                     /protein_id="ACD30243.1"
                     /translation="MYGIILTIDIIAAIAIVVLVLLQQGKGANMGVSFGAGASSTVFG
                     SKGAASFLFKMTVFFTAVFFVSCLTLGYLGKSSAITANISTANTDSSIASQYDQYQKE
                     VSQAGTADTSKQASK"
     gene            156368..156453
                     /locus_tag="FTM_0146"
     tRNA            156368..156453
                     /locus_tag="FTM_0146"
                     /product="tRNA-Leu"
     gene            156529..157483
                     /locus_tag="FTM_0147"
                     /note="transcriptional regulator, LysR family; frameshift"
                     /pseudo
     gene            157590..158039
                     /locus_tag="FTM_0148"
                     /note="protein of unknown function; frameshifts"
                     /pseudo
     gene            complement(158036..159178)
                     /gene="hemN"
                     /locus_tag="FTM_0149"
     CDS             complement(158036..159178)
                     /gene="hemN"
                     /locus_tag="FTM_0149"
                     /EC_number="1.3.99.22"
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase, anaerobic"
                     /protein_id="ACD30244.1"
                     /translation="MFEINKQIGIYIHFPWCVRKCPYCDFNSHPIKDDSYLSEQYYQK
                     LIADFDTHLNDLQAREVISIFIGGGTPSLFKAEYLDKVLQHITKNTKISINCEITLEM
                     NPGTVERGSILSYQNIGINRISLGVQSFQDDKLKILGRIHNCENVYTTIDEIKNSKIS
                     NFNIDIMHGLPNQSFDDGIFDITQAIAMQPTHISWYQLTIEPNTLFAAKRPKLPDEEI
                     LKSIEIAGKEALAHAGFKQYEVSAFAKNTLRSIHNSNYWMFGDYIGIGAGAHSKITNL
                     KTKQIKRVWKHKHPKIYTQTDKFIKDSNIVTQDEIIYEFMLNTLRLKNGFKLSEFEQQ
                     TFLSSNIISQKLQLGIDKGLLELNANQIKPTAKGYLFLNDCINIFS"
     gene            complement(159183..159560)
                     /locus_tag="FTM_0150"
     CDS             complement(159183..159560)
                     /locus_tag="FTM_0150"
                     /codon_start=1
                     /transl_table=11
                     /product="GtrA-like protein"
                     /protein_id="ACD30245.1"
                     /translation="MLKKQLSLFIIVGILASITNFIIVWILVELNIFRPLVANFFAFL
                     IAFNVSYFGHRFLTFSTTTQSHKKAATQFFINVMIGLGLNESIYYVLLHILKIQYLLA
                     LFITMGLVAVYTFVVSKFLIFKA"
     gene            159630..160508
                     /locus_tag="FTM_0151"
     CDS             159630..160508
                     /locus_tag="FTM_0151"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-dependent peroxidase"
                     /protein_id="ACD30246.1"
                     /translation="MEIIKYQLGIVENLPLSALYMMFNIKKNSDVSFGLKILQRFVDG
                     KSVVAGFGNNLLKMFKIPENESFKRTKFNNPRMSDNDGYDLVLWLRDDDRGELFHKAI
                     AIKKALEDYFDIEKVISSYTYRGKYDLSGFEDGIENPKGLEVVPAAIISEGELEGSSF
                     WVLQQWLHDFDWLNNASQSAKEECIGRSLDDSHQFESLKDFAHVKRSAKENFNPEAQI
                     LRKSMPWSDDQLNGGFMFSGFAPSFRSFNLQMGNMLGGSDGIIDGVFKFSKIIETSYL
                     WCPPFKKGKLDISLLN"
     gene            160613..163426
                     /gene="acnA"
                     /locus_tag="FTM_0152"
     CDS             160613..163426
                     /gene="acnA"
                     /locus_tag="FTM_0152"
                     /EC_number="4.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase 1"
                     /protein_id="ACD30247.1"
                     /translation="MSDIKNITKLQIEDKGKKYSLYSLKKLSQELGKDVTRLPYSIRV
                     LLENQLRNIDGYKVKEDDMHKVLDWDAKASSRPEIPHMPARVVMQDFTGVPAVVDLAA
                     MRKAIKDAGGDADKINPLVDTAMVIDHSVQVDFYGTKTALAQNVAKEFERNGERYSLL
                     KWAQKAFDDFIVVPPGMGIIHQVNLEYLAKGALVKNINGEDVIYPDTLVGTDSHTTMI
                     NGVGVVGWGVGGIEAEAVMLGQPYYMVLPDVVGVKFTGKLKTGVTATDLVLKVTEVLR
                     KHGVVGKFVEYYGEGLESLSLPDRATIANMAPEYGATIGFFPVDEVTLDFFNNTNRSE
                     LVDAAREMYKEQLLFRENPAEEPEYSGIVEIDLSEVESNLAGPKRPQDRVAFHDMKKA
                     FAEALVHEQGLHGFGLTDEQLQKSAEVKGLNERITHGSVAIAAITSCTNTSNPSLLLG
                     AGLLAKKANEKGLKVKPFVKTSLAPGSQVVTQYLEKANLLPELENLGFNLVGYGCTTC
                     IGNSGPLDEPVVEAINEADLIVASVSSGNRNFEGRINPHVKANYLASPIHVVAYALAG
                     TVDFDPVEDAIGKDAEGNDVYLADIWPTTEEIAAIQSHVINSDMFKKAYATVLDGTED
                     WQKLKAPEGKLYEFDSSSTYIQCPNFFEKFAEGNDDLDIKGARTLLMLGDSVTTDHIS
                     PAGAIPEEYPAGQYLKSHGVEKKDFNSYGSRRGNHEVMMRGTFANIRIRNLLLDNVEG
                     GFTKYHLDGSQQYVFDAAMKYKEKGIPLVILAGKEYGTGSSRDWAAKGTFLLGVKAVI
                     AESYERIHRSNLVGMGVLPLEYVNGQNAKTLGLDGTEMFNIKNLNNIKPRQIVIVEAV
                     HPKTAHTTTFEALARLDADVDVDYLKNGGILQTVLKDIMGDKKESKSTQSTTSKGCGS
                     ADTSSETSCPFAKIANFFKKLFK"
     gene            163521..163577
                     /gene="pilT"
                     /locus_tag="FTM_0153"
                     /note="Type IV pili nucleotide-binding protein; IS
                     insertion, stopcodons"
                     /pseudo
     mobile_element  complement(163581..164331)
                     /mobile_element_type="insertion sequence:isftu1"
     gene            complement(165449..166435)
                     /locus_tag="FTM_0154"
                     /note="predicted NAD/FAD-dependent oxidoreductase;
                     frameshifts"
                     /pseudo
     gene            complement(166432..166878)
                     /locus_tag="FTM_0155"
     CDS             complement(166432..166878)
                     /locus_tag="FTM_0155"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30248.1"
                     /translation="MKNQKSIDFYLAYSGLIPFLFFTICLLFNYKHTLIFENTIQALS
                     IYGLIIASFLAGTHWGRQINIESPIVKLLLQISSNINVITIWFAYLNLNSKYFILLLI
                     IEFLVLLKIDYYIYKLKITSSRYFLYIRLPITIAVVILLAISWSLI"
     gene            complement(166889..167852)
                     /gene="appB"
                     /locus_tag="FTM_0156"
                     /note="cytochrome bd-II terminal oxidase subunit II;
                     frameshift"
                     /pseudo
     gene            complement(167856..169231)
                     /gene="appC"
                     /locus_tag="FTM_0157"
                     /note="cytochrome bd-II terminal oxidase subunit I;
                     frameshifts"
                     /pseudo
     gene            169467..170348
                     /locus_tag="FTM_0158"
     CDS             169467..170348
                     /locus_tag="FTM_0158"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD dependent epimerase/dehydratase family"
                     /protein_id="ACD30249.1"
                     /translation="MRILVAVGSGFVGRELSKYLSTRHHLTLLTRVANQNLGDYKELI
                     TWQQLTEDNIVNYDIIINLCGYNIGQKRWTKAVKDRILSSRIEPTNKLIRLISNKNIW
                     LINASAIGYYNFSKLAQDEDNHDRSYDKLTFGQKVVDQWEKCLVDSHLQRYTILRFGV
                     VIGNGGVLEKMALPAKFGFLTMFGDGHNYMSWVSAYDLSRAIEFIIDKKLDSKEIFNL
                     TAPDACQHKLLVELLRKYLDKKRIIKILTFMIKLMFGQMGEELLLSSQNIKPAKLQRL
                     GFVFEDSNIQQALERYI"
     gene            complement(170345..171772)
                     /locus_tag="FTM_0159"
     CDS             complement(170345..171772)
                     /locus_tag="FTM_0159"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component regulator, sensor histidine
                     kinase"
                     /protein_id="ACD30250.1"
                     /translation="MFLKNKKESSILSFLVVSFASFFAVFMLVISIFSFYQVKHQNDS
                     LLDYQLRTAAEVIETVLKIYPLEDDENTTHMIMNRISNSFLNIKNYNKSIGFIVYDRK
                     RKKLLLKTSNLPNFHKNYDGITSTTGFEWVYTNEEDGQKNWYTYTLKTDNGNLITVFA
                     NDTIKDKISRQIIFKFALLLASTYIVLIGFIYYILKTALHPLERINKRVAKINPRKNE
                     KLNEDVIPYEIKSIVDQINLLIEKFHETLEREKRFSGDAAHELKTPIAGVKTLVEIAL
                     ASDDIDEIKQKLERIKSSTNRYSHIIDQLLTLSRIQPNEQVTFGKKLMINKVLESFIA
                     ENAIKAIEKNIEIVFYPSQQHLYCYSNDYLLGILFKNLISNAIKYTPNGGLIEISSYQ
                     EENNIVVEIKDNGIGVPQENIERIFDRFYRETGTDEEGSGLGLAIVAEIVRLHNGKIF
                     AQNNINQKGLTITVKIPIDHKYEEN"
     gene            171888..172843
                     /locus_tag="FTM_0160"
                     /note="protein of unknown function; frameshift"
                     /pseudo
     gene            172847..174126
                     /locus_tag="FTM_0161"
                     /note="conserved protein of unknown function; frameshift"
                     /pseudo
     gene            174285..174806
                     /locus_tag="FTM_0162"
     CDS             174285..174806
                     /locus_tag="FTM_0162"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30251.1"
                     /translation="MEEKTIYRGINVTIVTKHLVQIERPSKLLEILFYKYVFKHQTYA
                     DLALEYGKTKRWAYDQIHSYEVAKKEHNPRAVTLLCDTTFYGKRKDKLATVVFCDTIE
                     NEVLLWRHVDSEKSKYYKEMLQQLLSLGYTVNAVTIDGKRGLNTVKVCPIQMCHFHQK
                     IVDRYIVNPRVFC"
     mobile_element  complement(174784..175534)
                     /mobile_element_type="insertion sequence:isftu1"
     mobile_element  175692..176434
                     /mobile_element_type="insertion sequence:isftu2"
     gene            176462..176871
                     /locus_tag="FTM_0163"
                     /note="transposase; IS insertion, fragment"
                     /pseudo
     gene            177103..178116
                     /locus_tag="FTM_0164"
     CDS             177103..178116
                     /locus_tag="FTM_0164"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase, U61 family"
                     /protein_id="ACD30252.1"
                     /translation="MLLKNNYLVSIILVVLIMIVTKSFACAATDYNKVALINVSTQYY
                     PNDIEQAEKALKDTGYNTTYKYLDIYPSDFGYSNPDSIRAKILLDALLDKNIDIIWFL
                     KGGGGAFNLLPYLYDHINELKKAKPKILVGFSDVTAIHFFVNNVLGWKSLHGVVAAYN
                     KNAYSSQKIGKIRINDLERIPNITEIINNGISYDKLMPMNKMAYNGTDGSIVGGNMTL
                     IYSYFSTVYQQDISTKILFLEDTGISFRQLDRSLHQLLYLPENKKPEAIIFGQFYPLD
                     PTDDQRLIYKTVIKKFAKTFNRPVYYFPFIGHGQYNKPLLLGVTSNIKCSKETIFCTL
                     KQK"
     mobile_element  178676..179638
                     /mobile_element_type="insertion sequence:ISFtu4"
     gene            complement(179561..180142)
                     /locus_tag="FTM_0165"
     CDS             complement(179561..180142)
                     /locus_tag="FTM_0165"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family protein"
                     /protein_id="ACD30253.1"
                     /translation="MDKDVLDIYTDYLINQTKYATATKLSDILDQEVSHDKITRFLSK
                     PYLTSLEFWKYIKPLVKKHNSEYEVLCLDDTISEKPSTDENDIVCWHHSHAKGVHVKG
                     INIVSCILSTSNLSIPIDYEIVKKYKRYYDEKDKRYKRRSKITKNQMFQNMINRAVIN
                     QVKFKYILTSVRQLFHRQTLRIIDFNWVNNKLS"
     gene            complement(180384..181664)
                     /locus_tag="FTM_0166"
     CDS             complement(180384..181664)
                     /locus_tag="FTM_0166"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily"
                     /protein_id="ACD30254.1"
                     /translation="MDKSHLPNTKVLVTLSWIICLIATLNYSYDFFIRAASSVMGNNL
                     IIDFGISHTELGMLSSAYFVSYTIMQIPAGVILDKYNRKVVISIATAFCVLGNYLFSA
                     TNYYEVAYIGRIFMGIGSAFGFIGAAKMAGMWLPEKLFSTFIGFATVVGILGGLVTDT
                     LLSSLVSDLGWRDGNAVFTYIGVDILLLIVIFIRDNPKHVAKFTHLSEANFKETIVKV
                     LKIFCNLKFWAASIIGAVLFIPINVLGSLWGVGLIQAKFGLPQEIASHLNGALFIGAA
                     VGFTVAAIIASLTNRYHLMLTLSIVSLAMLLAIILYVPMSLSMFTVLYFLLGAAAGPQ
                     AVTFGIAKIISPKGTTGSATARVNMINNFVPIILLPLVGYILTHFGTFIANSRTIYTI
                     TSYQNALDMVIIFLLVCLPIAMLIPKQIQADLNH"
     gene            complement(181784..184897)
                     /locus_tag="FTM_0167"
     CDS             complement(181784..184897)
                     /locus_tag="FTM_0167"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter, AcrB/AcrD/AcrF family"
                     /protein_id="ACD30255.1"
                     /translation="MRLIDLFIRRPVLSLSISFMIIVVGVGSFFKLQVRQYPYIDSAT
                     ITVTTSYPGANPATIQAFVTRPLEAAVGSSKGIDYMTSESALGTSTITVYVKLGYNTN
                     DVLSEVVQNVNSILNQLPQDAYSPAIKLNPADNFPSLILAFTSKTMNTSEISAYINSE
                     LTPKLLAEGGLSEINVWGNMPYAMRIYPNKTRMAEYGITPTELATAIGSNSLVSAGGQ
                     IQGPYLNYTLNPETSMSTAQEYRNLIIKKSYNQIVRLSDVARVELGAQNYNSSVYFDG
                     KNAVLAGTVVSPEENPLDVVNRLVKQLPNIKASLPNGLNVDVAYNSTLYIESSIDEVL
                     HTLLEAVIIVSIVMFLFLGSLRAIIVPIIAIPLSIIGSFFLMSIMGFSINLLTLLAMI
                     LAIGLVVDDAIVVLENIYRHIEEGMEPFAAAIKGAREIANPVILMTLTLIVVYAPIGM
                     MGGFTGQLFTEFAYSLAGAVLISGIVAYTLSPMMCSKVLNREMMSSKLVKFIDNVFSK
                     LAAKYKALLMFVLDIKPAIAIVGIIVLASCFIMGKGIKSELAPNEDMGFLGVMGQAPS
                     SANINYLETFGKKLANTLDEIPGKQNVFILNGVMSSNVIFGGFIMQPWDERKISQQQA
                     ANIAQAKVTELPGVQTYTYQTPALPGIPRGAPLSLVIQSVNDYEAIDEITNKIIAKMM
                     SSGLFVFAQSDLKFDNPIVDINIDRDKAGILGITMSDIAKTLGYSYAGGYINYFFLKG
                     YSFQVIPQLARNEMLTQEQLGNIYIRSNEMNKLFDSEVPLSALVTFKTEGQPLTLNTF
                     QQLNASTISAVMAPGITQGQAIEYVQSVVKSMLPEGFSYNFSGSARQYIENGNTMMVA
                     FAFAIVLIFLALSAQFESFRDSLVILVTIPMAISGALIPLYVGQYLGASWASLNIYTQ
                     LGLVTLIGLISKQGIMVVEFANHLQKHNGMNKYDAIVTSSSQRLRPILMTVSAMVVGV
                     IPLVTSSGAGAISRNCIGVVISSGLVIGAIFSLFVLPVVYMYIASDKSKSVKTDAEQQ
                     QIIDQIK"
     gene            complement(184897..186270)
                     /locus_tag="FTM_0168"
     CDS             complement(184897..186270)
                     /locus_tag="FTM_0168"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane fusion protein"
                     /protein_id="ACD30256.1"
                     /translation="MDVKKTFLNIKQKINSSKRNYAIFVIATIILAWLVLGKLGISLA
                     IVYFIFQINYIKNKLHKLKDKKTASIAIVVATLILFGGIFGFAEFIQSMIKKGMAAYV
                     PQPVAVTSSVVEKTDWKQVINTIGEAQAVQSTAISSQSGGIVSEIHFKSGQEVKKGDL
                     LFKLDTSQLKANLEEALSNLKLAKITKDRYNKLVEQKATSKESADKANADYLSALAQV
                     QNIESQIGFKEVRAPFDGKIGIRNISLGQYFNNGDNAATLTTIDPIFITFPVPQNKVS
                     MISVGQEINFYSDSYPGETFTGKITAINSFINDSNRSITVQATYANPHHKIVAGMFLT
                     VHVSLPVRKNSIVIPRNAISYSLYGQSVFTLEPVMKDGQPVKASYTSTADGGMKTINT
                     DKTLYKVGQANIEVLETRNNLALVTGLEPGTTIITSGQNKVHKGMNAIINNSVEIDNN
                     IYKQGIQ"
     gene            complement(186283..186774)
                     /gene="dsbB"
                     /locus_tag="FTM_0169"
     CDS             complement(186283..186774)
                     /gene="dsbB"
                     /locus_tag="FTM_0169"
                     /codon_start=1
                     /transl_table=11
                     /product="disulfide bond formation protein"
                     /protein_id="ACD30257.1"
                     /translation="MKKLSNCIFIFNTLACFVALGVVIFTISVLDWKPCPMCLLQQLC
                     VLSIMLLSLLVLATKKFKSLSTLLQLITIIVIATGAYIAADQVYLQYFLTDTSNNNAA
                     CGAINNKFLLDATKSITGTINSCTDISEKISGVSLTVYSFIFFISLLIINCINFLVRI
                     LKK"
     gene            complement(186814..187896)
                     /gene="cca"
                     /locus_tag="FTM_0170"
     CDS             complement(186814..187896)
                     /gene="cca"
                     /locus_tag="FTM_0170"
                     /EC_number="2.7.7.72"
                     /codon_start=1
                     /transl_table=11
                     /product="CCA-adding enzyme"
                     /protein_id="ACD30258.1"
                     /translation="MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAA
                     NFPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSKYITLEDDLKRRDLTINSIAIDQ
                     NNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLCNFNFSIAQEMLALI
                     KELVKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCILPLIPNK
                     SFFENPIYKGSNINEKITLCLLKIPQQQLDDIRKELLLTNKHYKLLKASIAISKILED
                     RSITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPHRNYQLLQTTINTIK
                     NASIDSLTIKTIPKDKLRNTLKQLKL"
     gene            188001..189830
                     /gene="msbA"
                     /locus_tag="FTM_0171"
     CDS             188001..189830
                     /gene="msbA"
                     /locus_tag="FTM_0171"
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A export permease/ATP-binding protein
                     MsbA"
                     /protein_id="ACD30259.1"
                     /translation="MANMIDKIDLKSQGSSNLSGEMTNHQKVGTLYKRLLLQVKHLWH
                     FLLLAAIGSIFFSAADASMIYLINPILNYGFGPGGGITKQSATILMLMGVGMVGLLAL
                     RSVGSFVSQYFIGSLGQKVVYKFRKDIYKRLMDLPASFFDKHSTGQIISRLLYNVDQV
                     TEATSTAIITVVQDGTFVIGLIVVMFVSSWQLSLFLIVVGPFLGLFISIINKKFRNLS
                     RNTQSSMGNVTHTAEETIRNYKEIRIFGAQQKQQNKFFRNLDYTYSQQIRTIALDALT
                     SPVIQIIASLVLAFSLFTIAIFGTNEGDGSSWLTAGSFASFFAAAAAILKPIKNLTKV
                     NVVIQKAVAATEDIFYILDYPAEKETGSKELAKVDGNVTIKDLSFAFGEHKVLSGVSV
                     DIKAGQTIAFVGKSGSGKTTLTSIISRFYTQHEGEILLDGVDTRELTLENLRSHLSIV
                     SQNVHLFDDTVYNNIAFGLSREVSEEEVIDALKRANAYEFVQELSDGINTNIGNNGSK
                     LSGGQRQRISIARSLLKNAPVLIFDEATSALDNESERVVQQALESLTKSCTTIVIAHR
                     LSTVENADKIVVMDGGRVVESGKHQELLEQGGLYTRLYQSGLQ"
     gene            189836..190804
                     /gene="lpxK"
                     /locus_tag="FTM_0172"
     CDS             189836..190804
                     /gene="lpxK"
                     /locus_tag="FTM_0172"
                     /EC_number="2.7.1.130"
                     /codon_start=1
                     /transl_table=11
                     /product="tetraacyldisaccharide 4'-kinase"
                     /protein_id="ACD30260.1"
                     /translation="MLDKIWYRSKPNLLSRVLQPISLVFIDIANKRKIKQQLKQYKSK
                     IPIIVVGNISVGGTGKTPVVRMLAQQYLAQDKKPAIISRGYGAKADNYPFEVTSGTLA
                     TQCGDEPAMLFDALQAQVPIVIAPERVQAVKYIEKNFPDTDIIMSDDGLQHYKLARDK
                     EIVVVDAIRMFGNKLCLPAGPLREPIERLKEVDQIIVIGNCSDKDKELLKNYKNVTYA
                     KVVATEFVNILTAKKVAKTEFNHQNAIAIAGIGNPTKFFKTLEESAINITAKKVFKDH
                     HKFTQSDFEGIDSDITVVMTYKDAIKCKNFAKANWWYLDIALDINV"
     gene            190900..193593
                     /gene="polA"
                     /locus_tag="FTM_0173"
     CDS             190900..193593
                     /gene="polA"
                     /locus_tag="FTM_0173"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="ACD30261.1"
                     /translation="MKKIVLVDGSSYLFRAYHALPHLTNNQGEPTGAIIGVINMLKKL
                     PIMYDTEYVAVVFDAKGKSFRHQLYPQYKAHRKDIDDELRVQIQPLHQIIEKMGFAVI
                     IEDGVEADDVIGTLAQKLQKQDYQIIISTGDKDMAQLVTDNIVLYDSMKNVTTDVAGV
                     LEKYQISPHQMIDYLALMGDSSDNIPGIPKVGPKTAVKWLQDYQNIDGIIANQQQIKG
                     KVGENLRNNIDLLKLSYQLATIKCDLELDLTVEDLKCKAADKAYLIEAYTRYEFKSLL
                     KDLDNSDIKIVTSQAQAADVAIEYITITTQTQLDDLIAELEKYDSFVFDTETDSLNTY
                     EANLVGLSFCAKEGRAFYIPLQHRYLGVPQQLELGFVLDKLKPLFADSKKVKVAHNFK
                     FDEKVLSKYAIEINGKVDDTMIMAYVLKSSGKHDMDSLSKEHLGIEPIAYTAIAGTGK
                     QQQTLDQVDIEIVAKYAAEDADITFRLFNHFKALLEQDKVLFKLYCELEMPLTTILNQ
                     MEKTGVKIDATKLIQQSASLETSIKELESKCYNLAGQEFNLSSPVQLREILFEKLGLP
                     PVKKTAKGQVSTSEEVLVQLAEDYEIAALIMKYRHLSKLKNTYTDKLPKMLDANGRVH
                     TSYNQTGTVTGRLSSSDPNLQNIPIKSPEGRKIREAFIAEDGYCIVAADYSQIELRIM
                     AHLSKDKNLLKVFNQNLDIHSATAAEVLGISIDEVSSEQRRKAKAINFGLIYGMSAFG
                     LARQLEIPRAEAQEYIDIYFNRYPSVKEYMTTAKEFAKQNGYVETILGRRLYLPEINS
                     KNVMQRNAAERAAINAPMQGTAADIIKKAMINVNMMISQEYNSEIKMVMQVHDELVFE
                     VKKTKLEEIVAKIKSIMEAAVKLNVPLEVNVDSGKSWDQAH"
     gene            193613..194389
                     /locus_tag="FTM_0174"
     CDS             193613..194389
                     /locus_tag="FTM_0174"
                     /EC_number="2.7.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="type III pantothenate kinase 1"
                     /protein_id="ACD30262.1"
                     /translation="MLLVMDMGNSHIHIGVFDGDRIVSQIRYATSSVDSTSDQMGVFL
                     RQALRENSVDLGKIDGCGISSVVPHLNYSLGSAVIKYFNIKPFFISMDTTDLDMSAVE
                     AHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN
                     ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGALKELKRRSVEEFGSPVYT
                     IATGGFAGLFKEEDIFNEISPDLILRGIRIAFLENNKKGV"
     gene            194394..195638
                     /gene="deoB"
                     /locus_tag="FTM_0175"
     CDS             194394..195638
                     /gene="deoB"
                     /locus_tag="FTM_0175"
                     /EC_number="5.4.2.7"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopentomutase"
                     /protein_id="ACD30263.1"
                     /translation="MLKDKKVVILLFDSFGIGQAPDAADFGDEGADTLGHIVDYFTNN
                     GMSISLPNLSKKGLKKAAEYSRCKEFSQDIAQSEQVENAKYGYCAEVSKGKDTPSGHW
                     ELAGVPVMFDWYYFTKKQHQSCFDKEFIDKWVERAGITEGFIDAGHASGTEVLKEHGC
                     ESCVTKKPIIYTSADSVFQVAAHEDYYGLDKLLKICLVAREVLDEMGMKVGRVIARPF
                     IGESADEYVRTGNRRDFSILPPAPTLLDKLVKAGGEVVSIGKIADIYANQGITKKVKA
                     TGLEELFDKTIDEYTLAKQNTLVFTNFVDLDSSFGHRRDPKGYGKALEYLDSRIPDLD
                     AKLDDNTIVVLAADHGCDPTAPGSDHTRECVPFLLWGRNIKPEFIGARDTFADIGQTI
                     ADFMGIESLEYGKSIFGASHDN"
     gene            195601..196362
                     /gene="deoC"
                     /locus_tag="FTM_0176"
     CDS             195601..196362
                     /gene="deoC"
                     /locus_tag="FTM_0176"
                     /EC_number="4.1.2.4"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribose-phosphate aldolase"
                     /protein_id="ACD30264.1"
                     /translation="MVNQSLGLAMITKQEIVSLIDLTQLGDSDTQVDIVNLCSKARNS
                     LGEVAALCVYKQFIPVVKKQLGNNFKVATVVNFPNGDNTIEDVISEVKQALSLGADEI
                     DLVIDYKEYLDQGFSEKSCQMMVEVKKLCKDKTFKVIIESGELKTAKLITKVCQDVID
                     AGADFIKTSTGKTSEGATLAAAQVILETIKSSAKRIGFKASGGIRNYNQAVAYIELAA
                     NILANNFINPQTFRFGVSGLLDNLLNEQQEQIDDY"
     gene            196352..197551
                     /gene="nupC1"
                     /locus_tag="FTM_0177"
     CDS             196352..197551
                     /gene="nupC1"
                     /locus_tag="FTM_0177"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside permease NupC"
                     /protein_id="ACD30265.1"
                     /translation="MIIKSLYFILGLIVIYFLAYIWSNNRRNIRYKNLIIILIVQLIL
                     AKFMLSTSIGINIINYVNKCFEVLLDSTHIGVEFVFGNLANTKEFIFFFNAAMPIVVM
                     SAVIGILQYFRILQFLVVAIGSILSKVTGMGKLESFDAVSSLSVGQSENFLYYKKIIK
                     YLPSNVLYTMAATAMSTVSIGTAAAYMTIIDPSYVCVAIVMNMFGAFFVLNIINPYEK
                     TKEVTYEFLTDQVEDYERQRFFEMLSEYILDGFKVAIIVCVMIMGYIAFLNLADGIFS
                     SLVGISLRDILGYIFYPIAWILNIHGNEIFLSSQIMGTKIVTNEFVAMQELANHSTQL
                     SQHIKAVVSVFLVSFANFSSIGIIIGAIQALSREASVKVARFSLKILYGAVLVSFLSA
                     NIVGFIL"
     gene            197570..198772
                     /gene="nupC"
                     /locus_tag="FTM_0178"
     CDS             197570..198772
                     /gene="nupC"
                     /locus_tag="FTM_0178"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside permease NupC"
                     /protein_id="ACD30266.1"
                     /translation="MFVKILYLLLGLVTVFILAFIWSSDRKKIKYKHLFIILFFQLLF
                     CFFILQSSEGIKLVAIISTGFDKILQHAHEGTAFVFGSLADTSKNGFVFFFNVGMPIV
                     LISGIIGVLQYFRILPLVIRGVGFILTKITGMGKLESFNAVSSLTVGQQENFLIYKKI
                     IGHLPANVLYTMAATAMSTVSLAIAGSYMSIIEPKYVCTAIVLNMLSTFFVLHIINPY
                     DKDPSLNYDTLHADYETGRQSFFEMLSEYLLDGFKIAVIVCAMLVGFIALLNLVDGIF
                     QEILGITFRQILGYIFYPIAWVLNIHGNEIFLSSQIMGTKIVTNEFVAMQELAKNSQQ
                     LSEHTKAVVSVFLVSFANFSSIGIIVGAVQALNKEASIKVARFSLKILYGAVLVSILS
                     ACVVGFIV"
     gene            198785..199414
                     /gene="tmk"
                     /locus_tag="FTM_0179"
     CDS             198785..199414
                     /gene="tmk"
                     /locus_tag="FTM_0179"
                     /EC_number="2.7.4.9"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate kinase"
                     /protein_id="ACD30267.1"
                     /translation="MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTK
                     IAEELRNLVLHNKYDEEIHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSS
                     MAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAG
                     LEFFNKTRKVFKDLVKDSDNAIEIDAAKSIQEVEKQIYLILDKHFNFQN"
     gene            199476..201053
                     /gene="prfC"
                     /locus_tag="FTM_0180"
     CDS             199476..201053
                     /gene="prfC"
                     /locus_tag="FTM_0180"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 3"
                     /protein_id="ACD30268.1"
                     /translation="MSEYLQQIAKRRTFAIISHPDAGKTTITEKMLLFGNAIKTAGTV
                     KAKKSGIYATSDWMEMEKQRGISITTSVMQFPYNGRIINLLDTPGHEDFSEDTYRTLT
                     AVDSALMVVDAVKGVEDRTIKLMNVCRLRDTPIVTFMNKFDRDTRDPLELLDEVENIL
                     KIKCAPMNWPIGMGKYFKGVYDLYNDEVTLFETGHGHEIYPYKKIKGLANAKDAIGID
                     LYEDLEMEIDLVRGASHEFDEQEFLEGNLTPVYFGTALSNFGVKEMMDGFTRYAPAPQ
                     HREADQRVVAADEQKLTGFVFKIQANMDEKHRNRIAFFRICSGKYEKGMKIFHERTGK
                     QMQISKALTFMAGEREQVEEGYAGDIIGLHNHGSIQIGDSFTQGEKLKFKGIPNFAPE
                     IFKRVKLNDPLKMKALQKGLVQLSEEGATQVFKPFISNDLVLGAVGVLQFDVVAQRLA
                     SEYNVKCSYEGVNVTLARWIFCSDEKKLNDFKKKYEVNLAYDGAGYLTYLAPTGVNLQ
                     LAQEKNPDIIFSATREH"
     gene            201128..202447
                     /gene="fimV"
                     /locus_tag="FTM_0181"
     CDS             201128..202447
                     /gene="fimV"
                     /locus_tag="FTM_0181"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pili, pilus assembly protein"
                     /protein_id="ACD30269.1"
                     /translation="MLKSISRVLVAGFALAMVSPVFSMEIYTVKSNDYLYKIAKNHAV
                     TGVSISELTDAIKGINKSEIPGIIDNRIRIGDKLAIPTTKAEVEDGLTLMRNQIIQSS
                     YQQPSSDTTSQQPSSTPAANLGDNTAAANDADDSSTPSVVSQDKIPVLIPTDDNSTPE
                     TYKSNLDTQINSDNIQETASYEQQPTQSSSTWGSLFRFIIYVIILAVVVVVGKRFWET
                     RNSKKEQELELISKKKRDHLMSRISPVVSDNEFYRSDKVNNSPQEEFDFFGAAKSSRS
                     EVTTVDEEIQSQQESEDTFEQPAQNEEDLFAQRDKNIIVKTEKGVVFETNTDDTLVNS
                     TADETKVEEIDSQQQAEQELQYINELIEQFLDSEKYVEASITIQDSLEKDPNNIDLRY
                     KLLEVYARAGDEIAFEGEVHFIKSKNIVSMFDPLHQKIAKLRDKYFE"
     gene            202480..203475
                     /gene="ftsY"
                     /locus_tag="FTM_0182"
     CDS             202480..203475
                     /gene="ftsY"
                     /locus_tag="FTM_0182"
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle-docking protein
                     FtsY"
                     /protein_id="ACD30270.1"
                     /translation="MFFKKKKNTEIESPIERVQEQDNKKGLFSRLQAGLSKTANKFGS
                     GLSTILMGQKVVDEELLEDIEMQLLTADVGVEATDEIVTYLRDKVARNELQTADKLNQ
                     IIQQKLTEIILPCEKPLEVDTQKSPFVILVVGVNGVGKTTTIGKLTKKLQSQGKSVIL
                     AAGDTFRAAAVEQLREWGDRNNTHVVYQHEGADSASVIYDAIGSAKSKGIDVVIADTA
                     GRLHNKDNLMQELKKVVKVIKKTDETAPHEIMLVVDATTGGNALNQAEAFNQIVNLTG
                     ITITKLDGTAKGGIVFSIAKKLGLPLRFIGVGEKIDDLQVFNARDFTTALFNSND"
     gene            203566..205788
                     /gene="uvrD"
                     /locus_tag="FTM_0183"
     CDS             203566..205788
                     /gene="uvrD"
                     /locus_tag="FTM_0183"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase II"
                     /protein_id="ACD30271.1"
                     /translation="MSNYDFTLGLNPEQQKATLLEDRNALILAGAGSGKTKVLTSRIA
                     YLCRDKGVSIENILAVTFTNKAAKEIQQRVEKMLGISTFGMWIGTFHGIAHRLLRKHT
                     HELGLDKNFRILDQDEQAQLVKKVINNLDLDDKKYPPKLLQNFINKQKDKAIRSNKLT
                     KQYDANYAHIYTAYEERLQLDNALDFADLLLYLYELFSFNQQLREYYQNKFKYILIDE
                     FQDTNHVQYMWIKLLITDNNYMMAVGDDDQSIYGWRGAVVDNIHNYVKDLKNVEIIKL
                     EQNYRSTKNILKVANSVIKNNDNRMSKELWSAAEDGEKVVLYCAVNERDEAKYIIDKI
                     RQLHNDGVDYSDIAILYRSNYLSRVLEESCIYASIPYRIYGGFRFFDRAEIKDALAYL
                     RLAVTNSDNLAFERIINTPTRGIGNKTLETIRNYAQINSLSYWQATLDVIQKELVTKR
                     TASLLLKFIELISGISAQINQHSLDKLLESVINQSGLLASYQEKNSEKDRQKIDNLKE
                     LISAAKDFEPQIELLDDNTDILQDFLSFAVLEAGEMQADEATDSVQLMTIHASKGLEF
                     RYVFLVAAEEGVFPPSSIVNSEEVFDNTSSKKMQEKLAEERRLFYVAVTRAMKALTIS
                     YAQVRSIFGRSSFQVKSRFVAEIDSQHLSQGKLEFTAAKPKTKQKANFGMSPFDFLKS
                     NNTTNSFKPGDKVFHKVFGKGVFIKAQAQGTKEFYTVDFGIDVGQKILLADIANLVKV
                     "
     gene            205907..207475
                     /locus_tag="FTM_0184"
     CDS             205907..207475
                     /locus_tag="FTM_0184"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type oligopeptide transport system,
                     periplasmic component"
                     /protein_id="ACD30272.1"
                     /translation="MASVLILPGCSNDSDNNIDPYAGQLTKNNNQLVVNIGSDMPSID
                     PQQSSDNSSSRVIEDIFQGLVDYNQKSEVIPTGASSWKISKDGKTYTFYLRKNAKWTN
                     GDPVTADDYVYSYRRSVTPETLTRAYASYFNPIVNAVAIQAGKKSPETLGVKALDKYT
                     LQIKLTEPNPTFLDSLTIYAFFPVNKKAIEKYGDSWAAKPDTIISNGAYKLTKWIHNG
                     YALAEKSSNYWDAKNVSIDSVKYLMINDVSSDLENYKAGGESLTYNNLPANTAEWYKE
                     HFTNNQFQPSPMLAQAYFIFNMRDTKFQDIRVRKALSMVIDRKGIAEGVKKGLVTSSY
                     LVVPETVAGGRYKDLAKDIPDYDWVNEPIEQRIKQARQLLKEAGYSKKHPLEFTINFN
                     TSDVNRLMAQILQGSWQQDFGDLVKVSIFNEDWKVYLDSLKNGNFDVARMAWIADFNQ
                     PNTYTEMYTCDSDNNYGHYCDKEADEIYNKSLTTNSMDEFYKLQKELIIKQTAGYPTI
                     PLFTQPTYSLYNRM"
     gene            207577..208514
                     /gene="oppB"
                     /locus_tag="FTM_0185"
                     /note="peptide/opine/nickel uptake transporter (PepT)
                     family protein; frameshift"
                     /pseudo
     gene            208514..209376
                     /gene="oppC"
                     /locus_tag="FTM_0186"
                     /note="peptide/opine/nickel uptake transporter (PepT)
                     family protein; frameshifts"
                     /pseudo
     gene            209380..210348
                     /gene="oppD"
                     /locus_tag="FTM_0187"
     CDS             209380..210348
                     /gene="oppD"
                     /locus_tag="FTM_0187"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide/opine/nickel uptake transporter (PepT)
                     family protein"
                     /protein_id="ACD30273.1"
                     /translation="MKDLALQIKDLNVGFKTDDGMFSAVRDISFDLKKGHTLGIVGES
                     GSGKSQTVLSLMGLLAGNAVVSGQALFHDQNLINMPTKNLNKIRGDKIAMIFQDPMTS
                     LNPYLTIHKQLLEPLTIHKGMSHKDATKKVLEMLDAVQIPDAKNRLKLYPHEFSGGMR
                     QRVVIAVALLYSPEILIADEPTTALDVTVQGQILQLLSDLQKEFHMSMLFITHDLGVV
                     AEICHDVMVMYCGNIMEQGTVDNIFANAQHPYTKGLLNTMPSITRDVDILQTIPGETP
                     NIHNMPKGCPFVTRCNFAIDICKDTKPELISYLDQRTACHLVKEYK"
     gene            210349..211322
                     /gene="oppF"
                     /locus_tag="FTM_0188"
                     /note="peptide/opine/nickel uptake transporter (PepT)
                     family protein; frameshift"
                     /pseudo
     gene            complement(211326..212528)
                     /locus_tag="FTM_0189"
     CDS             complement(211326..212528)
                     /locus_tag="FTM_0189"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily"
                     /protein_id="ACD30274.1"
                     /translation="MQKFKLSLILVVGISFYCYEFFLRILTGAYQEQIVEHFNISTHI
                     GFSFLVSSYNITYLLMQIPAGILLDRYGSKKVLIGATILCGIGNIIFVSGEYELALFG
                     RLLVGLGSSFAFIGVLKLTLENFESKYFLIITSLVISLGTLAAAFSQNISVIISHYDT
                     SWINIFIYSGVIALPLAIFFQLIIPHEKYSSALMPKFSEILKRGKQLIKNSLIWKNAI
                     WAGLLYTPTVILTSQYGVLYFKQSYGFDSIYSTTMITAIFIGWIIFSPIMTHLCNKFS
                     GKKIITISIVGILLVSILINAQLLKNYAISIAFLFGTFSASQVLVWYYFNKICPPSFA
                     AVRIAITNMLITLVIEIGQLSAGLAIDSGDHFNINANTSITIAFSIVLALAFIIMRNM
                     IKKIKNNS"
     gene            212662..213243
                     /locus_tag="FTM_0190"
     CDS             212662..213243
                     /locus_tag="FTM_0190"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30275.1"
                     /translation="MKKVITFSALFLCSIFGYSDNNLNQQTGMYYITANNFFYRPSTE
                     RGNEVVDRQNSSEFSDRISSSAINITDSLVFDAYTSSTSLIAQGSMGDLKDTKFYTQE
                     TKLVKKLWNDKLEIYGGTVLGANPYQLNNINSAYDPGSRIAAFASGRTGAKYNVSRNF
                     GLLIEGQYNLTGEMADNTDMFTGFNGAQYRTQL"
     gene            213342..214655
                     /locus_tag="FTM_0191"
     CDS             213342..214655
                     /locus_tag="FTM_0191"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar transporter, MFS superfamily"
                     /protein_id="ACD30276.1"
                     /translation="MLVSKKLFVFTYSGFLSIILRYLKYIFSYTMQKVTKAGFIIWFI
                     CAFFYALEFIIRASGNSLYNDFSIAPYNLSPEQISVLSSAFYWAYVASQLPAGILIDK
                     FGVKKIMLVSTLLFSVGVFIATRATSQEYLILYRVLAGVGGGFAFLSALKSIAIWLPK
                     RTFPLFTGATQMLMYGAGTLTGLPLVILANHFSIQVIMSVILVVSILLFLSVVFFIPT
                     VEPHNQKDTDELADTHTKIEDIPIVFKIKQILLNGFFCFTIYGTTAIFADLWSYRFLS
                     LDGYSVHYAGLASSMIFIGIAIFSPLWGVIATLLNKQKSLLVLASIFGLFIVIAIVYM
                     HVDPIIMCILCILWGGMQAVHVLNFTILRMHISSLYIATGIAAVNLFIPLSGAVLQPF
                     VGFVVSLLENHGFKQLIAFKYALVILPVLMLLSIVLSLFITEKKN"
     gene            214712..216220
                     /gene="glpK"
                     /locus_tag="FTM_0192"
     CDS             214712..216220
                     /gene="glpK"
                     /locus_tag="FTM_0192"
                     /EC_number="2.7.1.30"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="ACD30277.1"
                     /translation="MSKDFILAVDQGTTSSRAIIFDKKGNIRKIAQKEFTQIYPKSGW
                     VEHDAMEIWGTQSGVMREALEFGRVKPDQIAAIGITNQRETVIVWDKETGDPVYNAIV
                     WQCRRTSSICDEIKRDPQFVKYIKENTGLVVDAYFSGTKVKWILDNVEGAREKANAGK
                     LLMGTIDTWLIWNLTRGKVHATDYSNASRTMLFNINSLEWDKKILDYLNIPESMLPEV
                     KNSSEVFGVTDSHTLGGAEIPIAGVAGDQHAALFGHCCFEKGMAKNTYGTGCFALMNV
                     GDKPVYSDEGLLTTIAWAENGKPTYALEGSVFIAGAVIQWIRDGLGLVRSAEDSEYYA
                     TKIDSTNGVYLVPAFVGLGTPYWDMYARGTIVGITRDTKREHIIRAALEAIAYQAKDV
                     LECMKEDTGLDLAGLRVDGGAVQNNFLMQFQSDILQSEISKPKINEITGLGAVFLAGL
                     AVGFWKDKQELKSILTTEKVFEPQKDSQAVAHDYRGWKKAVERSKAWAECYS"
     mobile_element  complement(216217..216967)
                     /mobile_element_type="insertion sequence:isftu1"
     gene            217283..218815
                     /gene="glpD"
                     /locus_tag="FTM_0193"
     CDS             217283..218815
                     /gene="glpD"
                     /locus_tag="FTM_0193"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="ACD30278.1"
                     /translation="MKKEYDIIIIGGGATGFGCAIEAVSRGYKTLLLEASDFGKGTSS
                     KSTKLIHGGLRYLENFDFALVKEGLEERFSFLHNAPHLTHKQSYLIPTRSYFETIKYT
                     IGVKLYEFLSGKYKIGKSYNLNKHQTLAELPNIEASKLKKSLVYYDGQFDDTRLLISL
                     MKTFEAKGGVALNYHKVEKIFSSTDSKLDTVKVVDTLSGEQKEFTAKHIINATGTFSD
                     KTISLANQQDAHKYVSVAQGTHIVFDREKFPTEHAILIPETEDGRVLFILPWHDHLIV
                     GTTDIKKEVPSLEPRADKSEIDFILETFNQYAKDKATIIDIKSVYCGQRPLVTPKKAK
                     NSAKISRKHEIVESKDGLITVVGGKWTIFRRMGQDTLDYIETKKIAQKISKTSDQLLI
                     DAIEPKDTYPLKVYGKNAEDIKTIQNELDNFELLARGLPYYQAEVVYHVRHEKAKTIE
                     DVLARRTRAAFLDIKASIDAAPKVAELMAKELGKDEVWQNQQIDSFIEFSKNFNVEEL
                     YK"
     gene            218825..219589
                     /gene="glpF"
                     /locus_tag="FTM_0194"
     CDS             218825..219589
                     /gene="glpF"
                     /locus_tag="FTM_0194"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol uptake facilitator protein"
                     /protein_id="ACD30279.1"
                     /translation="MLTACIAELIGTMLLILLGNGVVAGVVLNKTKAHDGGWIVITFA
                     WGLAVFIGVLVAGPISGAHLNPVVTLSLALAGKFSWTWVLPFIISQIIGAMLGQLLVW
                     IMYYPHYSATDNPELKLATCCTSPAIKHLPANFASEVIGTFVLVLAILTMHGVVLHVG
                     DSSITTTYPVDMGALGGIPVAFVVVVIGMSLGGTTGYAINPARDFGPRLFHAIMPIQG
                     KGSSQWSYAWVPILGPVCGSIIATAFYLLLKVKGVF"
     gene            219593..220306
                     /locus_tag="FTM_0195"
     CDS             219593..220306
                     /locus_tag="FTM_0195"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30280.1"
                     /translation="MCEITFIPLLADDVLRLFISFILFLSCVILSYIFAKQKPWDIAF
                     WICFSIFLFSMGGYGYIIHHIYLENTFSYDGFISGAAFITVCGLLFSRKRYINFADSF
                     VNKNTAILIATFVVFALIYILTIRYNFSCVEEPHQFFIDALQIVIYPLLLLFAITAFL
                     YRFAICLSAFAVSMALFIIENILFIAHAIAAQHKYDIVFEEVLFATISIVLSAIAVYI
                     LTRAKRIYKENSDVRSIRQ"
     gene            220284..220781
                     /locus_tag="FTM_0196"
     CDS             220284..220781
                     /locus_tag="FTM_0196"
                     /codon_start=1
                     /transl_table=11
                     /product="small conductance mechanosensitive ion channel
                     (MscS) family protein"
                     /protein_id="ACD30281.1"
                     /translation="MFDQLGNSGAFLINAIVAVVILVVGFWASKYIKSLVYSLLKEYD
                     KTVSQFLASLVYTIFLVLVVVIALAKLGVPISPVTGVLTGVVFGISMSLKTSYNTVAC
                     GIMLAFSKPFEVGEKVDFGGIKGTVKSIGFLYTKLDDEDGNEIVISNNLVLSKVITRF
                     TQTDK"
     gene            220781..222195
                     /locus_tag="FTM_0197"
                     /note="DNA helicase; frameshift"
                     /pseudo
     gene            222352..222436
                     /locus_tag="FTM_0198"
     tRNA            222352..222436
                     /locus_tag="FTM_0198"
                     /product="tRNA-Tyr"
     gene            222438..222511
                     /locus_tag="FTM_0199"
     tRNA            222438..222511
                     /locus_tag="FTM_0199"
                     /product="tRNA-Gly"
     gene            222539..222614
                     /locus_tag="FTM_0200"
     tRNA            222539..222614
                     /locus_tag="FTM_0200"
                     /product="tRNA-Thr"
     gene            222659..223843
                     /gene="tufA"
                     /locus_tag="FTM_0201"
     CDS             222659..223843
                     /gene="tufA"
                     /locus_tag="FTM_0201"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor Tu"
                     /protein_id="ACD30282.1"
                     /translation="MAKEKFERSKPHVNVGTIGHVDHGKTTLTAAITKVMAEKNGGMA
                     RKFDEIDSAPEEKARGITINTSHVEYESPNRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLSRQVGVPKIVVFLNKCDMVDDEELLELVEMEVRELLDQ
                     YEFPGDDTPVIMGSALRAIEGDEAYVEKIVELVQAMDDYIPAPERDTEKPFILPIEDV
                     FSISGRGTVVTGRIERGVVNVGDEVEVVGIRPTQKTTVTGVEMFRKLLDRGEAGDNVG
                     ILVRGLKRDDVERGQVLCKPGSIKPHTKFEAEVYVLSKEEGGRHTPFFKGYRPQFYFR
                     TTDITGAVELPEGVEMVMPGDNVKMTITLINPIAMDEGLRFAIREGGRTVGAGVVAKI
                     IE"
     gene            223863..223938
                     /locus_tag="FTM_0202"
     tRNA            223863..223938
                     /locus_tag="FTM_0202"
                     /product="tRNA-Trp"
     gene            224036..224506
                     /gene="secE"
                     /locus_tag="FTM_0203"
     CDS             224036..224506
                     /gene="secE"
                     /locus_tag="FTM_0203"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase, subunit E, membrane
                     protein"
                     /protein_id="ACD30283.1"
                     /translation="MPVYKLFFLKDCFVKRNQGFNNNKVWISGATKTTEVKKISKSNN
                     LMLWLAVVAIIVLGVAVTMYSDILGDSYSTYNTSLAVVVVLLAVVVARFTNQGRRFWA
                     FFQASRLELAKVVWPTRKETMTISLMVIVVVIIFALIISLFGVIFENFIQYFLG"
     gene            224522..225055
                     /gene="nusG"
                     /locus_tag="FTM_0204"
     CDS             224522..225055
                     /gene="nusG"
                     /locus_tag="FTM_0204"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination factor
                     NusG"
                     /protein_id="ACD30284.1"
                     /translation="MLWYVVQVHSGYEKRVKAQLEENIEIAGLKNNFGRILVPTENVV
                     EMKGGQKRKSERKYFPGYVLIEADLSTDAWNLVKSVPRVLTVVGSKGKPIPLSKAEVD
                     RILDFVEGSKSTVEPRLRKSYHVGEVVRVLEGPFNDFTGVIEEVNYEKSRLRVAVSIF
                     GRSTPVELEFSQVEKES"
     gene            225125..225559
                     /gene="rplK"
                     /locus_tag="FTM_0205"
     CDS             225125..225559
                     /gene="rplK"
                     /locus_tag="FTM_0205"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="ACD30285.1"
                     /translation="MAKKKIEAIIKLQVAAGKANPSPPIGPALGQHGVNIMGFCKEFN
                     AKTQGMEPGMPIPVEISVYSDRSFTFEMKTPPASYLIKKAINVKSGSSKPSKEFVGTI
                     TRAQLEEIAKVKDPDLTAADLDAAVRIIAGSARSMGVKVEGV"
     gene            225562..226257
                     /gene="rplA"
                     /locus_tag="FTM_0206"
     CDS             225562..226257
                     /gene="rplA"
                     /locus_tag="FTM_0206"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="ACD30286.1"
                     /translation="MAKVSKRMKEISAKINAEKKYPVSEAFDLLREVSSVKFVESVDV
                     SVALGVDPRKSDQVVRGASVLPNGTGKTVRVAVFAKGPAADAAKEAGAEVVGMEDLAD
                     EVKKGNMDFDVVIASPDSMRVVGQLGQILGPKGLMPNPKVGTVTMDVAKAVRDAKAGQ
                     VRYRVDKAGIIHTTIGKVNFTSDALKQNLEQLLTDLKKAKPAVSKGIYLKKVSVSSTM
                     GPGINVDFSDLNI"
     gene            226427..226945
                     /gene="rplJ"
                     /locus_tag="FTM_0207"
     CDS             226427..226945
                     /gene="rplJ"
                     /locus_tag="FTM_0207"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="ACD30287.1"
                     /translation="MALRIEDKKAIVAEVAEQMSSALSAAVADYRGLTVNEMTSLRKQ
                     ARESGVYLRVVRNNLARLAIKGTEFECLADALKGPLVLALSKDAPGAAAKLFKNFQKD
                     HNAFEVKNLAMSGELFGPEKLDDFAKLPTREEALATLLNVMQAPVTKFVRTLNEIPSQ
                     AVRVFAAVGDSK"
     gene            227008..227388
                     /gene="rplL"
                     /locus_tag="FTM_0208"
     CDS             227008..227388
                     /gene="rplL"
                     /locus_tag="FTM_0208"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L7/L12"
                     /protein_id="ACD30288.1"
                     /translation="MAITKEDILNAVAEMSVMDVCDLVKMMEDKFGVSAAAATVAVAA
                     GPVAGPAEAAEEKTEFDVVLVDAGSNKIAAIKAVRGATGLGLKEAKDAVEGTPFTVKE
                     AASKEEAEALKKQLEEAGAKVELK"
     gene            227542..231618
                     /gene="rpoB"
                     /locus_tag="FTM_0209"
     CDS             227542..231618
                     /gene="rpoB"
                     /locus_tag="FTM_0209"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase, beta subunit"
                     /protein_id="ACD30289.1"
                     /translation="MSYSYAEKKRIRKEFGVLPHILDVPYLLSIQTESYKKFLTADAA
                     KGRLHSGLEIVLKQSFPVESKNGQYELHYVDYQIGEPTFDETECQVRGATYDAPLNVK
                     LRLVVYNKDALPNEKIVEDIREEYVYMGDIPLMTTNGTFIINGTERVVVSQLHRSPGV
                     FFSKDDSEEGAFSARIIPYRGSWLDFEFDSKGIIWARIDRKRKFCATVILKALGYTQE
                     QILENFSESKTITSNSKGFALRLDSLSNMKGELLKFDIVDAQDYVIVKKNKKLTSRDV
                     KKIKDAGVDSVAIDFDLVSTLRVAKDIVNEATGEVIAYANDDVTESLLESCVEVGLLE
                     LEVIDFITTERGRYISDTLKYDLTRNTDEALVEIYKVLRPGDPPAAASVKALFEGLFF
                     IESRYSLSDIGRMKLNARLGSDKVSKDIYTLENSDIVGVIEELINIRDGKGKVDDIDH
                     LGNRRVRSVGEMVENQFRIGLYRVEKGIRESMSLVHKDKLMPKDIVNSKPITAAIKEF
                     FTSGALSQFMDQDNPLSEVTHKRRISALGPGGLSRDRAGFEVRDVHATHYGRLCPIET
                     PEGPNIGLINSLASYARVNDYGFLEAPYRKVVDGKVTDEIEYLSAIDEDNYVIAQAST
                     KLDENNYFVEDLIQCRSGGEAIFTESSRVQYMDVSAKQMVSAAAALIPFLEHDDANRV
                     LMGANMQRQAVPTLKSEKPLVGTGMEKIVARDSGNCIIARNAGEVAEVDSNRIVIKVD
                     TEKSQTSNLVDIYSLTKFKRSNKNTCINQRPIVNVGDKVEAGDILADGFAADFGELSL
                     GHNLMVAFMPWNGYNFEDSILLSERIVKDDKYTSIHIEEFTCVARDTKLGPEEITADI
                     PNVSESSLAKLDESGIVHIGANVEAGDILVAKITPKAEQQLTPEERLLRAIFNEKASN
                     VADSSLRMPSGTSGTVINVQVFENDKGGKSKRALKIEKELIDKARKDFDEEFAVIESV
                     VKSSIEQEVVGAKIQKAKGLKKGAILTKEFLATLPFSKWLEISFEDEKLEEKVQNARE
                     YYEEAKIAIDAKFEAKKKSITQSNELSPGVLKTVKVFVAIKKRIQPGDKMAGRHGNKG
                     VVSRVLPVEDMPYMEDGTPVDVCLNPLGIPSRMNIGQILEAHLGLASYGLGKKIEKTL
                     EKTRKAAELRKTLEEIYNSVGDKKVNLEALNDEEILTLCDNLKGGVPIATPVFDGAKE
                     EDIKSLLKIGGFATNGQMKLFDGRTGKPFDRHVTVGYMYMLKLDHLVDDKMHARSTGS
                     YSLVTQQPLGGKAQFGGQRFGEMEVWALQAYGAAYTLREMLTVKSDDIAGRSKMYKNI
                     VDGKLTMNVDVPESFNVLRNEVRALGIDMDFDYSSEEE"
     gene            231680..235933
                     /gene="rpoC"
                     /locus_tag="FTM_0210"
     CDS             231680..235933
                     /gene="rpoC"
                     /locus_tag="FTM_0210"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase, beta' subunit"
                     /protein_id="ACD30290.1"
                     /translation="MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINY
                     RTFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVVCERCGVEVEQAKVRRERMGH
                     IDLVCPVVHIWYLKSLPSRIGLFLDMPLKNVEKVLYFESYIVTDPGMTPLEKKQLLTD
                     EEYAEALENYGYEFEASMGAEAIRDLLADTDIESEIELLQAECEESKSTAKKEKAIKR
                     LRLLETFQASGNKPEWMVMTVLPVLPPDLRPLVPIEGGRFATSDLNDLYRRVINRNNR
                     LKKLLDLNAPDIIVRNEKRMLQEAVDALLDNGRRGRAVTGSNKRPLKSLADMIKGKQG
                     RFRQNLLGKRVDYSGRSVITVGPSLRLHECGLPKKMALELFKPFVYSKLRLGGHATTI
                     KQAKRMVELEEAVVWDILETVINEHPVLLNRAPTLHRLGIQAFEPRLIEGKAIQLHPL
                     VCAAFNADFDGDQMAVHVPLTVESQLEARVLMMSTNNILSPASGQPIITPTQDIVLGL
                     YYITREKEGARGEGKLFSSYEDVSRAYNSGTIDIHAKIKLRIDRQVFDTKGNTYNEKG
                     VVNTTVGRALLLNILPEGLSFSLLNKVLVKKEISKIINQAFRVLGGKATVVLADKLMY
                     AGFKYSTLSGVSVGVDDMTIPDNKEAKIEEAEKEIKQITEQYQSSLITENERYNNIIN
                     IWSKTSDEVGASMMDAISKDTVSINGEKKEIESFNSVYMMAKSGARGSYNQMRQLAGM
                     RGLMAKPDGTMIETAITANFREGLSVLQYFTSTHGARKGLADTALKTANAGYLTRRLV
                     DVAQDLVVIEEDCGTDDGLMFSAIVEDGEVKVPLVERALGRTLAADVVTEKGVVLLEA
                     GTLLDENLVELLDDNGIDMIKVRSPITCKTRRGLCAKCYGRDLARERQVNVGESVGVI
                     AAQSIGEPGTQLTMRTFHTGGAASLGITVSDIKVKTAGKIKFKNIRTVTNKEGQEIVI
                     SRAGEIIVSDTMGRVREQHKIPMGAVVPLASGKAVEIGDVIATWDPHAQPLITDVAGK
                     VVLEDVIDGITSKHTYDDLTGQQTIEITSISQRTTSKNLKPVVKIVDEKGAKLKSIPL
                     AVGAVLNVADDSILEVGDIVAKIPLEGSKNKDITGGLPRVAELFEARRPKDAAILSPC
                     DGMVRLGNRDTKEKQRIEIIDKNGHIVEEILLPKSRHLVVFDGEQVSRGDVLADGPTD
                     PHDLLKYKGLEEFADYILIEAQSVYRMQGVVINDKHIETIVRQMLRKAVILDEGDSKF
                     VKDESIELVRILEENDKLRKQGKKEVEYELVLMGITRSSLSTESFLSAASFQETTRVL
                     TEASINSQIDNLRGLKENVLIGRLIPTGTGLAVRKESAKIEKMREELGVEDNMVFTDL
                     SSFNPEEISFDSIQSQKEDKDINEDIEESLRNALESLDF"
     gene            236036..236272
                     /locus_tag="FTM_0211"
     CDS             236036..236272
                     /locus_tag="FTM_0211"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30291.1"
                     /translation="MFDMLAKLFWQIFFGILIILIVILSILNTDKVSFDYIFGTTTLP
                     LIVLMSIAFVLGLLLGSFITKFIQITKTSGGAKK"
     gene            236272..237282
                     /gene="gcp"
                     /locus_tag="FTM_0212"
     CDS             236272..237282
                     /gene="gcp"
                     /locus_tag="FTM_0212"
                     /codon_start=1
                     /transl_table=11
                     /product="O-sialoglycoprotein endopeptidase"
                     /protein_id="ACD30292.1"
                     /translation="MIVLGIESSCDETGLAIYDYSKKKLIADELYSQVKLHKKYGGVV
                     PELASREHIAKLNLLAKKIFKETGLSFEDIDCIAYTAMPGLVGALMVGATFAKTLGLI
                     HNIDTIAVHHLEGHLLSPLLDHNSNIEYPFVALLVSGGHTQLFEVKEFGEYSLLGESI
                     DDAAGEAFDKTTKLLGMGYPGGVEVANLADQATDKSKYILPRPMKNKPNLDFSFSGLK
                     TAVLNTWYDEQDQSLENKANLCYAFQDAAIDVLVSKCAKALQKTKNTRLVISGGVSAN
                     KLLRHQLDLLAKNRGYQIFFPPMKYCTDNGAMIALAGAYRYVNGFKDSNLEINVKARS
                     PL"
     gene            237396..238562
                     /locus_tag="FTM_0213"
     CDS             237396..238562
                     /locus_tag="FTM_0213"
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid desaturase"
                     /protein_id="ACD30293.1"
                     /translation="MNNNEIIHQTIEKQGSIVWKSVFGLLLLPLVALIAIPWYAMTYG
                     FSTSDYVCLVVFYMLTGVGITMGYHRLWSHKTYKANKIVSYALLLFGTAALQNSVIQW
                     SSDHRKHHKDVDDPIKDPYAATRGFWFSHFGWLLRHSSPDVQEIRGVNDLLKDKALVF
                     QHNHYTVLAILSCFGLPALLGFIFGFLSGHTLTAAWHSALGFLLLGGLLRVILVHHAT
                     FCINSLAHTIGKRPYSTKNTARDSWITAIVTGGEGYHNYHHAFAGDYRNGIRWFDLDP
                     SKWFIAGLAKIGWCYDLKTTPKHLIEIAKAKVKLEEALTKKNKTFHLGIEEKYAKLVA
                     NVKNMYNAKQEYLKAKKDNVLSKADIKEIKSKYKDLKIEFIQAKKKYNKASTIA"
     gene            complement(238774..239934)
                     /gene="metK"
                     /locus_tag="FTM_0214"
     CDS             complement(238774..239934)
                     /gene="metK"
                     /locus_tag="FTM_0214"
                     /EC_number="2.5.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="ACD30294.1"
                     /translation="MSKNYLFTSESVSEGHPDKLADQISDAILDEILKQDKNARVACE
                     TLVKTGMALVAGEITTSAWVDIEELVRNVITETGYDNASKGIDGRTCSVINAIGKQSR
                     DIAQGVDRGSLEDLGAGDQGLMFGFATNETPTLMPSAIYYSHLLMRKQAELRKSGKLA
                     WLRPDAKAQVTLAYENDKPKFIDTIVLSTQHNESISQKELHDAVIEEIVKKVIPNELI
                     TKDTKYHINPTGVFLIGGPQGDCGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSG
                     AYMGRYIAKNIVAAGLADKCEVQVAYAIGVAKPVSLMVNTFGTGKITDNQIEKLVAEV
                     FDLRVGKIIENLDLLRPIYRKTSNYGHFGRELPEFTWEKIDKADILKSAARI"
     gene            240228..240476
                     /gene="rpsP"
                     /locus_tag="FTM_0215"
     CDS             240228..240476
                     /gene="rpsP"
                     /locus_tag="FTM_0215"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S16"
                     /protein_id="ACD30295.1"
                     /translation="MVVIRMARGGAKKRPFYRIVVADKRSPRDGRFIEKLGFFNPLAK
                     GGEERLKLDVAKAEAWLAKGAQPSDRVASLIKEAKKAA"
     gene            240519..241028
                     /gene="rimM"
                     /locus_tag="FTM_0216"
     CDS             240519..241028
                     /gene="rimM"
                     /locus_tag="FTM_0216"
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA processing protein RimM"
                     /protein_id="ACD30296.1"
                     /translation="MSQDFVEIAKIGATYKLNGELNLYPLANSIETLLSYGDWYIQLP
                     ATNVWQQLKGESVLKRADKVYIKLANINNADTAKKYVNALIGVPKRALPQLAEDEVYF
                     KDLIGCSVKNINNDSFGVVVDIIETGANGVLVCKEDNSEYLIPYVKQYIVSEDLNSKK
                     IVVDWEYDY"
     gene            241431..242189
                     /gene="trmD"
                     /locus_tag="FTM_0217"
     CDS             241431..242189
                     /gene="trmD"
                     /locus_tag="FTM_0217"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N1)-methyltransferase"
                     /protein_id="ACD30297.1"
                     /translation="MKFGIISIFPEMFKAINDFGVTARAIKDSKVSISCFNPRDYTTD
                     RHATVDDTSFGGGAGMVMKYQPLSAAIEDAKNTLGCGTKVVYLSPQGSIFNHRKAQEL
                     LQNDSLILLCGRYEGVDERLIQDYVDEEISVGDFVLSGGELPAMLVMDSLIRLLPEVL
                     GNKESVVEDSFYDGLLDYPHYTKPAVLPNGNAVPDVLLSGNHKEIAKWRRKQKLIRTY
                     ERRKDLIECLCLSAKDKQILDDYKIDKVSTKGEE"
     gene            242189..242536
                     /gene="rplS"
                     /locus_tag="FTM_0218"
     CDS             242189..242536
                     /gene="rplS"
                     /locus_tag="FTM_0218"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L19"
                     /protein_id="ACD30298.1"
                     /translation="MKNKFVELVEKSQLRTDLPEFNPGDSITVNLWIKEGDKQRIQAF
                     KGFVLRKRNRGLHSAFTVRKMSSGMGVERTFQTHSPLIDSIIVEKRADVRRAKLYYMR
                     GLTGKAARIKEKV"
     gene            242702..243580
                     /gene="xerD"
                     /locus_tag="FTM_0219"
     CDS             242702..243580
                     /gene="xerD"
                     /locus_tag="FTM_0219"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine recombinase XerD"
                     /protein_id="ACD30299.1"
                     /translation="MSSAVDAFLDNLWLEHGLSQNTISSYRTDLKFLQNYFAKTDLIS
                     LDFEQLYAFISYRSKNGYSSHSNARMISTLRKFYAWLISTGQTNNNPTAKLTLPKLAK
                     KLPKDMTETDVERLLQAPDMTEDVGIRDKAMLELMYATGLRVSELVGLNIDDIDINIG
                     VIQVMGKGSKERIVPIGEYALEYLQKYFAEARRSLSKNFKEKAVFISKHAKRITRQSF
                     WHRIKNYALIAGINTDISPHTLRHAFATHLLNHGADLRSVQLLLGHSNVSTTTIYTHI
                     SQNRLQEIYQKHHPRG"
     gene            243703..244549
                     /locus_tag="FTM_0220"
                     /note="oxidoreductase iron/ascorbate family protein;
                     frameshift"
                     /pseudo
     gene            244554..245138
                     /locus_tag="FTM_0221"
     CDS             244554..245138
                     /locus_tag="FTM_0221"
                     /codon_start=1
                     /transl_table=11
                     /product="acid phosphatase, HAD superfamily protein"
                     /protein_id="ACD30300.1"
                     /translation="MTQQQVISYYESTAHENEVELILARAKKIIQAQQSLQGNAIVLD
                     IDETALNHYYSLKLAGFPQGENHTIWNELLSRTDAYPIKATLDFYLYCLTSGLKVFFI
                     SARFAQYLESTKQALRNAGYVNFEDVFVFPENIEQYNSKDFKNFKAERRAYIESLGYK
                     ILISIGDQSSDLLGGYTLYTLQLPNYLYGENSRF"
     gene            complement(245135..246018)
                     /locus_tag="FTM_0222"
                     /note="licB-like transmembrane protein; stop codon,
                     frameshift"
                     /pseudo
     gene            complement(246143..247657)
                     /locus_tag="FTM_0223"
                     /note="hypothetical membrane protein; stop codon"
                     /pseudo
     gene            247820..248287
                     /locus_tag="FTM_0224"
     CDS             247820..248287
                     /locus_tag="FTM_0224"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="(Di)nucleoside polyphosphate hydrolase"
                     /protein_id="ACD30301.1"
                     /translation="MIDKSGYRANVAIVLLNKQNRVFWGQRRNRTSWQFPQGGVDTGE
                     TPLQAMYRELHEEIGLRPQDVEVIASTRDWYKYDIPDSLVRTKEPICIGQKQKWFLLK
                     LKSPESYIDLDANDSPEFDNWRWVSYWYPINHVVYFKQEVYRKALTYFKEYIA"
     gene            complement(248297..248923)
                     /gene="nudH"
                     /locus_tag="FTM_0225"
     CDS             complement(248297..248923)
                     /gene="nudH"
                     /locus_tag="FTM_0225"
                     /codon_start=1
                     /transl_table=11
                     /product="dGTP pyrophosphohydrolase"
                     /protein_id="ACD30302.1"
                     /translation="MNYFDHKLAKTTAIYGFLTLIIAILSYNFLDIKFATLVHSSELF
                     GTGISTIAAFTSNIFSPKVWTVITAIATVICIYKHIVKKPSQKLYIMSLSLIMTIIIT
                     TIVKVILARYRPEMLLFDNHYGFHFFSFKKAYNSMPSGHTALTFAGLLAIANFFEKKY
                     ITLIAIIISGLVAVSRIIILDHFISDVIVAAYIGIFTYLWSKAFVESK"
     gene            248997..249521
                     /gene="ampD"
                     /locus_tag="FTM_0226"
     CDS             248997..249521
                     /gene="ampD"
                     /locus_tag="FTM_0226"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase, protein
                     AmpD"
                     /protein_id="ACD30303.1"
                     /translation="MFNQGWYKKAKCIKSPNFNQRADKNDINLVVIHCISLPEGGYAN
                     CNVEKFFTNQLDCSLHPSFASLKGVEVSAHFYIKRDGEIVQFVSVDDRAWHAGVSEFQ
                     GWQGCNDFSVGIELQGTDKTAYTEQQYLSLNSLLKDLRKAYPTLLNITGHEDIAPQRK
                     TDPGKCFEWNKVIW"
     gene            complement(249569..251452)
                     /gene="parE"
                     /locus_tag="FTM_0227"
     CDS             complement(249569..251452)
                     /gene="parE"
                     /locus_tag="FTM_0227"
                     /EC_number="5.99.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV, B subunit"
                     /protein_id="ACD30304.1"
                     /translation="MQNYNAKSIEVLTGLDPVKKRPGMYTNTENPNHLIQEIIDNSVD
                     EVLAGFASKINITLYEDNSIEVADDGRGMPVDIHPEHKMSGIELIMTKLHSGGKFSNK
                     NYTHSGGLHGVGVSVVNALSTRLEAEIKRDGNVYHIVFEDGFKTKDLEIIDNVGKKNT
                     GTKIRFWPNKKYFDDIKVNFKALKNLLEAKAILCKALTIKYSNEIKKEKLTWHFETGL
                     KGYLDHKLEAETLPAEPFMIDNFSNGDSYLDAVFCWCEDPSESIKNSYVNLIPTPQDG
                     THVTGLKNGIYDAIKAYIEKNSLSVKNIKITANDSFAQLNYVISVKITNPQFAGQTKE
                     KLSNKDVTNFVATAVKDLLTIWLNQNPDEARQIVENISKVAQKRINADKKTTRKRIMN
                     TTIRLPGKLTDCISSDVNSTELFIVEGDSAGGSAKQARDKNFQAVLPLKGKILNSWEL
                     DADTIMNSQEIHNIATAIGVDPDNDDISALRYNKICILADADSDGLHIATLICAMFLK
                     HFRKLIENGHIYIAQPPLFRIDIGKSTFYALDENERDTILTKNSKLPGKVNIMRFKGL
                     GEMNPAQLRESAMDVSSRRLLQLTISDVYDDTEMLDMLLAKKRAKDRRDWLENYGDRA
                     SVE"
     gene            complement(251543..252724)
                     /locus_tag="FTM_0228"
     CDS             complement(251543..252724)
                     /locus_tag="FTM_0228"
                     /codon_start=1
                     /transl_table=11
                     /product="drug:H+ antiporter-1 (DHA1) family protein"
                     /protein_id="ACD30305.1"
                     /translation="MYKGIRPSIFILILMVSLGPFGDTIYAPALPELKTILGTDYPHV
                     QLTITSYLLGYSISQLLYGPFSDRFGRKPVMLVGTCFFIISSIICIFSNHINTLIYAR
                     MIQGFGAAAGGVIATVAVKDAFKVNEQGAVFAIMNIAFALAPAFGAVLGVFLSPTAIF
                     WVLLVAASILFIKVAIFFPETIREKNFEDLTFKSFFKNYFLLFKDHQFFFATFVLGIN
                     ISVIYACLVTAPDIFVNILKLEKSNFLYLLTIMVTAVVLGSIVCSKLSRIIAYKHLVN
                     FGMFCTLISGVLCIYAFKKLTGLELSIALTAILSLTFIGVSFSVPLLTPIALENFTTT
                     AGAASSVMGFMQMGIASITTAIMSQISLGSEFTLSFAFVILPLIGLTIFLPYSCYFLK
                     K"
     gene            complement(252724..254094)
                     /locus_tag="FTM_0229"
     CDS             complement(252724..254094)
                     /locus_tag="FTM_0229"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane assembly lipoprotein YfgL"
                     /protein_id="ACD30306.1"
                     /translation="MKKLLFITAPLLLSVLTASCSKSNVPPPTPLAEEPPRETFVKVI
                     WKRKTGNGNGGLANYNVAPAYANDTVFVPNQNGMAYALAITNGKIIWKNDTGTNLSVQ
                     PNTIANAVIFGSIKGTLTAIDDKDGQTLWRTDAPSSIFSQPTIYDNSIYLQTHDGSVS
                     AFDARNGSKEWSVANNIPEITLPSNSSPIILNNTVMIGNAFGAVLGFTIKSGDRTINI
                     PIAISHGSSPADKMVDITANPMLYDHYLIFAAYQGAIVALDKDSGKMLWAKKASIINN
                     MAINNGVIFTTQDDSELKAYDIQTGDTVWTQDTLKWRKITAPIYYKGLIVVADYQGYL
                     HFFNSLNGEYLGRYKLTSKSDIFDYGISGQLIPTEKGIIIEADNGTTYLVDAYSNKVI
                     YDSILSDYQVDKGKSVARIYPLEQDKPTKATAPLATKTTQTTETKSKGINATIIIGDF
                     SKGKPS"
     gene            complement(254097..254735)
                     /locus_tag="FTM_0230"
     CDS             complement(254097..254735)
                     /locus_tag="FTM_0230"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30307.1"
                     /translation="MKNLSKKQTQALYTIAGIIIVAIICAIFLQFYNSSNDKKMLEAS
                     TIYQKALIANENPKSSVETKIAKFEQVVNDYPNTSFGIFASWQLADLYTTPTKPDSKN
                     FNVNITNLPKAIVILQQSIENNPKDSLSDISKVRLARLYIVAKQPDQAIKTLQGIKSF
                     KDNAYPLMLLGQAYSEKKDKVKAIESWQKALQDPNSSDQFKQIISQLINNTN"
     gene            254915..256159
                     /gene="hemA"
                     /locus_tag="FTM_0231"
     CDS             254915..256159
                     /gene="hemA"
                     /locus_tag="FTM_0231"
                     /EC_number="1.2.1.70"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA reductase"
                     /protein_id="ACD30308.1"
                     /translation="MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHA
                     VILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPNYKIKDYFKLRQGTEVIMHLMKL
                     ACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGHC
                     PVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKA
                     QKITSAFRNASAHYLSELPQLIKKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQ
                     ALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVKSLEEYLEKEKAIIS
                     NSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEA
                     SKQGRSDCLVCMKRMFGLNVEK"
     gene            256160..257245
                     /gene="prfA"
                     /locus_tag="FTM_0232"
     CDS             256160..257245
                     /gene="prfA"
                     /locus_tag="FTM_0232"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 1"
                     /protein_id="ACD30309.1"
                     /translation="MKDSIKAKLQSLIERHEEVSALLSEAGIISDQNKFRDLSKEYSH
                     LEPIVKAFKEYTQALEDKQAAYEMLNEKDAELVEMAKEELKLANEAIEKLESELQIFL
                     LPRDPNDDANVFLEIRAGTGGDEASIFSGDLFKMYSKYAEQRGWKIEVISASEGEHGG
                     YKEIISRIYGDGVYSQLKFESGAHRVQRVPATESQGRIHTSACTVAVMPEADEVEGID
                     INPADIKVDTFRASGAGGQHVNKTDSAIRITHIPTGVVVECQDQRSQHKNRAAAMSML
                     KSKLLQAEIDKQQKEQSDTRKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLDEV
                     MEGSLDSIIQPLILEHQADLLATMSDE"
     gene            257238..258092
                     /gene="hemK"
                     /locus_tag="FTM_0233"
     CDS             257238..258092
                     /gene="hemK"
                     /locus_tag="FTM_0233"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="modification methylase, HemK family"
                     /protein_id="ACD30310.1"
                     /translation="MSNITISQLLALSLAKFNQCDISTKHDLQMIICDVLGVDKTYLY
                     INSDKQLDKNTLKKIDEKILRLLAGEPLAYILGYKYFWNQKLYVTKDTLIPRADTETI
                     VATVLDDIQNKDAQLKILDLGTGTGAIALALAAELANSQVVAVDLYQQSLDVAKKNAQ
                     ANNITNVKFIQSSWYTNLDTDKFDIIVSNPPYIDLADTNIDQSVKDYEPARALFAADN
                     GLADIRIIISQAKDFLNLGGFIYIEHGFTQADAITALFSQCNFTDIKIVKDLNNNDRY
                     TKAQLGYL"
     gene            complement(258083..258511)
                     /locus_tag="FTM_0234"
                     /note="conserved protein of unknown function; IS
                     insertion, fragment"
                     /pseudo
     mobile_element  258641..259391
                     /mobile_element_type="insertion sequence:isftu1"
     gene            complement(259511..261145)
                     /gene="groEL"
                     /locus_tag="FTM_0235"
     CDS             complement(259511..261145)
                     /gene="groEL"
                     /locus_tag="FTM_0235"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin GroEL (HSP60 family)"
                     /protein_id="ACD30311.1"
                     /translation="MAAKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSF
                     GAPTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTE
                     GLKAVAAGINPMDLKRGIDKATARLVEELKALSKPCSDPKSIEQVGTISANSDATVGK
                     LIADAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENP
                     YILIVDKKISNIRDLLPILEGVSKSGRALLIIAEDVESEALATLVVNNMRGVVKVCAV
                     KAPGFGDRRKAMLEDIATLTGATFVSEDLSMKLEETNMEHLGTASRVQVTKDNTTIID
                     GAGEKEAIAKRINVIKANIAEANSDYDREKLQERLAKLSGGVAVIKVGAVTEAEMKEK
                     KDRVDDALHATRAAVEEGIVAGGGVALIRAQKALDGLTGENDDQNHGIALLRKAIEAP
                     LRQIVSNAGGESSVVVNQVKANQGNYGYNAANDTYGDMVEMGILDPTKVTRSALQHAA
                     SIAGLMITTEAMIGEIKEAAPAMPMGGGMGGMPGMI"
     gene            complement(261183..261470)
                     /gene="groES"
                     /locus_tag="FTM_0236"
     CDS             complement(261183..261470)
                     /gene="groES"
                     /locus_tag="FTM_0236"
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperonin GroES (HSP10)"
                     /protein_id="ACD30312.1"
                     /translation="MNIRPLQDRVLVRRAEEEKKSAGGIILTGSAQEKPSQGEVVAVG
                     NGKKLDNGTTLPMDVKVGDKVLFGKYSGSEVKVGDETLLMMREEDIMGIIA"
     gene            261720..262154
                     /locus_tag="FTM_0237"
     CDS             261720..262154
                     /locus_tag="FTM_0237"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30313.1"
                     /translation="MNIKNMSFLARLIHTIGFEFFGIIIFTPFAMFILHQDVFHIASL
                     AIIISLIAMLWNFIYNYIFDIIEIKFGMHRSKRGIIIRALHALLFELGLLIATIPLVA
                     YILNMSFLSALLVDIGFVIFYLVYAFVYNYIFDRIYFEFIHK"
     gene            262165..262240
                     /locus_tag="FTM_0238"
     tRNA            262165..262240
                     /locus_tag="FTM_0238"
                     /product="tRNA-Arg"
     gene            262795..263559
                     /locus_tag="FTM_0239"
     CDS             262795..263559
                     /locus_tag="FTM_0239"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30314.1"
                     /translation="MIIVISPAKSQNFEPIKTAYQFTQPIFKQQIIKLINTLKHYEVE
                     EIEKLMKISPKLAEEVFAKHNSFNPNKYDNSNAKAAIFTFSGDVYKGLEADTLDNKTI
                     EYAQNHLLMLSGLYGLVRPLDLIQAYRLEMGTNIKIDGKILHKYWQDKITTQLNEYFS
                     QQQNKILINLASNEYSQAIDKKSLAVKWLDIDFKENKAGAYKTIGIHAKKARGLITRY
                     ILENRIENVSDIKKFNVAGYQFNPDFSDENLLCFTR"
     mobile_element  complement(263606..264356)
                     /mobile_element_type="insertion sequence:isftu1"
     gene            264438..265130
                     /locus_tag="FTM_0240"
                     /note="type I restriction-modification system, subunit R
                     (restriction); IS insertion, fragment"
                     /pseudo
     gene            265106..265648
                     /locus_tag="FTM_0241"
                     /note="type I restriction-modification system, subunit R
                     (restriction); fragment"
                     /pseudo
     gene            complement(265798..265874)
                     /locus_tag="FTM_0242"
     tRNA            complement(265798..265874)
                     /locus_tag="FTM_0242"
                     /product="tRNA-Met"
     gene            266052..266753
                     /gene="proQ"
                     /locus_tag="FTM_0243"
     CDS             266052..266753
                     /gene="proQ"
                     /locus_tag="FTM_0243"
                     /codon_start=1
                     /transl_table=11
                     /product="activator of osmoprotectant transporter ProP"
                     /protein_id="ACD30315.1"
                     /translation="MSEGRNKLNDFLLLQSLLGGSSKIEEKTSRMKQARDKNISKNKS
                     IPKPTVVKKVEERDTSFIRIPQYGHRINNKIVDELQNPQLEDNQEILVTVDIEKERQK
                     EEARLFKWLCHRFPKCFDPINKKPLKIGISEEIEIIYQNENYAPVDKMVLRNVLRRYV
                     GDTRYHKAVFELKQRFNLQGQPVEDYAPEHVEYSKKRLDEIAEKAEFRAKGLSMKDYY
                     EYKKQQQQEKVDTEE"
     gene            266776..267321
                     /locus_tag="FTM_0244"
     CDS             266776..267321
                     /locus_tag="FTM_0244"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30316.1"
                     /translation="MSLSLFRFILLYTVFKFFVMTMYSKKAKVFFSRKVIIVMLMTLL
                     VTSCATDKYQARELPLLKHGYSKKNLTAYNIFGFCCDNTPSGIFNIIDKKPTEFLVNI
                     YVGDNQGCKFIYAADTKGKQGEITQTGSFTAYLSGRNELLKLECKGKDSNIDYKVIAY
                     ANAIEYDRVGNLSYLVESGGL"
     gene            complement(267336..268790)
                     /gene="trkH"
                     /locus_tag="FTM_0245"
     CDS             complement(267336..268790)
                     /gene="trkH"
                     /locus_tag="FTM_0245"
                     /codon_start=1
                     /transl_table=11
                     /product="K+ transporter (Trk) family protein"
                     /protein_id="ACD30317.1"
                     /translation="MMLSQKPKIIGIFLMFLSLTMLSPLLVDYIYDEDNAYPFVLSFT
                     VTFLCGFLLWFISRKSNKKLSNRDGFLIVTLVWIFVTVFGAIPYMSFPGLNLSFTNAV
                     FESVSGFTTTGGTVIEGLDKLPHSILFYRQQTEFFGGMGIIVLSVAILPLLGVGGMQL
                     YKAEVSGQWKDDKIAPKISSTAKALWMVYLLLTFLCFISYLLVGVEPFDAICYTFSTV
                     STGGFAPSDASMTDKPLGMLIVCAIFLFLGATSFKAHYIALSKFKISHYFRNIEFKAY
                     FYFLFFTSFIVCITIITHTNDLSNIFSIVTNSIFQVISISSSAGFVSDNNYYLWPSFL
                     PIMLMFIAIIGGCGGSTAGGLKMIRAILFKEKAILEARRVIHPQGVFTVKLGDIHISE
                     QALNRVSGFISVYIIIFAGGWLALLGCGLDIPTAFSTIATTLSNVGPGLGDIGSNFKN
                     LPKEALWICNFAMIAGRLEIFTILVLFMPDFWRK"
     gene            268902..269105
                     /locus_tag="FTM_0246"
     CDS             268902..269105
                     /locus_tag="FTM_0246"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30318.1"
                     /translation="MMKLILRLAHLFDNKKDRAYVSEVDRFLQEFDKANPQKSESQKK
                     EILKHRNIFNREAKPKASFLDGE"
     gene            complement(269487..270104)
                     /gene="lolA"
                     /locus_tag="FTM_0247"
     CDS             complement(269487..270104)
                     /gene="lolA"
                     /locus_tag="FTM_0247"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein releasing system, subunit A, outer
                     membrane lipoproteins carrier"
                     /protein_id="ACD30319.1"
                     /translation="MKKIIICFIFVFSINVSFADATSELIDKIKNIHSMTANFNQKLI
                     DGQTNNNLNSKGNMSLKKPQYFKWITTSPNHQEIVYNGTKLWIYDGDLDQLIIKKVSN
                     DIAQFPYLILLSKNTNNINKLFTVTAQDNNSYILKPKNDQMIDSIKIKFTPNNQLEYL
                     EISTSLNQFTKIEFNNVKTDVDISNTSFDFKAPQNTDIIDETKSA"
     gene            complement(270105..272600)
                     /gene="ftsK"
                     /locus_tag="FTM_0248"
     CDS             complement(270105..272600)
                     /gene="ftsK"
                     /locus_tag="FTM_0248"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsK"
                     /protein_id="ACD30320.1"
                     /translation="MTDNNINKTNHAVGRLKITLVVILTASIIYLFIALFSFNINDPG
                     WSSVSSETTIKNYAGPVGAYIASFILSIFGIIGFILPFLLIDFVRILLIKRKQQSLSY
                     LLFTVKTIGIIVFILSCCGLAELYLSFANYWVPQRSGGILGYESVKLTIKYLGSVGGN
                     FALLIALLVGLTLYSGTTWIYLFKNLAIFVAKVFTYITKSKTNDNKNIPDINGFENFE
                     SKNNLTSPLNRDNKVVSSIFEDNQQTHKKDIFREVLDNTKVTNELSFRDPKTESPQNS
                     DLEIVSDSDSILDLDVLDEDIDLDSELSSQSDNESKPAMTKEQLKGITTVSSPISSSA
                     ALNKKMLPSLDLLIEPEAKQTVISQAQLDETSSLLEQTLNDFNINAKVVAAYPGPVIT
                     RYEIDLARGTKVSKLTNIAQDLARALSTTAVRVVEVIPGKPYVGLELPNPTRQMVRIK
                     EVLAAPEFVKSKAPTLMGIGVDISGKPTFAELAKMPHLLVAGTTGSGKSVGVNAMILS
                     MLYKCSPDELKFIMIDPKMLELSIYDGIPHLLTPVVTDMTEAANSLRWCVKEMERRYA
                     LMSAAGVRNIALLNDKIEQAEKVGRPLKDTMFIKMNPERVHEAPLLTKMPYIVVVADE
                     FADMIMVVGKKVEELIARLAQKARAAGIHIILATQRPSVDVVTGLIKANIPTRMSFQV
                     SSRIDSRTILDQQGAEQLLGQGDMLYLKPGFGAPMRIHGAFVDDNEVHRVVEAWKEYG
                     EPEYVQDILEAAEESENGGSPSNSGDSEDPLYNEAVEIVIKTQKASISAVQRKLKIGY
                     NRSARLMEEMEENGIVSEMNQNGMREVLIKRDS"
     gene            272722..273390
                     /locus_tag="FTM_0249"
     CDS             272722..273390
                     /locus_tag="FTM_0249"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidic acid phosphatase, PAP2 superfamily"
                     /protein_id="ACD30321.1"
                     /translation="MARFHIILGLVVCFFAWIFFLIFPNLDIQFAGHFYNSSAHQFID
                     GYDGFLGFLHWFARFFPIFFSIIVILFLLGSLFIDKFKIKYRKAIFFIAVCLWIGPGL
                     VVNYVFKDHWGRPRPVMVKQFNGDKIFQPPFVISSQCDKNCSFVCGDASMGFWLFAFM
                     SLLATRKKKLVAFIVAVVAGGGLGLMRMSQGGHFFSDVVFCGIFVYISTWVVYALMYR
                     KKEY"
     gene            273637..275091
                     /gene="lysP"
                     /locus_tag="FTM_0250"
     CDS             273637..275091
                     /gene="lysP"
                     /locus_tag="FTM_0250"
                     /codon_start=1
                     /transl_table=11
                     /product="lysine:H+ symporter"
                     /protein_id="ACD30322.1"
                     /translation="MSQKLKRGLHTRHMSMIALGGCIGTGLFVALGGAIADAGPGGTV
                     LAYVIIAIMVYFLMASLGEMAAHSPVSGTFCEYATRYVDPALGFSTGWSYWFNWAITV
                     ATEVIAAALIMQYWFPGSSILLWSGFFFVLVFALNIFSVKIYGEVEYWLSFIKVSTVI
                     IFIIVGFLSILGLVGNHQSVGFQNWHIGDAPFHNGWWGFISVFMIAGFSFQGSELIGV
                     TAGEAKDPNTSIPKAIKQTFWRLFIFYILAVVIISFLIPYNNPSLIKAGASNDVSVSP
                     FTIVFENVGLNSAATIMNVIILTAIISACNASMYSATRVLWHLGNIKQAPQFFATTNS
                     KGTPMIALLVTAVIGSSFFFVSFVGSGYIFTWLVNVSSLAGFIAWFTIALSHYRFRRA
                     YIKQGKSLEDLPYVAKFFPLAPIIALTMVSIVIVGQGVTMLTMEGRTWFSVIIEFLST
                     YIGFFAFVILYFVYKFIKKTKLIRLEDCDLTRES"
     gene            275100..275738
                     /locus_tag="FTM_0251"
     CDS             275100..275738
                     /locus_tag="FTM_0251"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30323.1"
                     /translation="MDTFFIQGQAGRIETAYDKVKGANKDIVAVICHPHPLYQGSMHN
                     KIVTTIVRAMKTFNIESYRFNYRGVGESQGQYGDGVGELEDLISVCDWIKHNSTAKKI
                     ILCGFSFGGAIAYKGLSSLDNIVSLITIAPAVDRFDLTKFSQPQDIPWLVVQGIDDDT
                     VNPNSVFDFTLKAIKSDLTLVKMNQVGHFFHGKLIELKTVIENFLTPIVDKL"
     gene            275758..276744
                     /gene="glpX"
                     /locus_tag="FTM_0252"
     CDS             275758..276744
                     /gene="glpX"
                     /locus_tag="FTM_0252"
                     /EC_number="3.1.3.11"
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-1,6-bisphosphatase, class II"
                     /protein_id="ACD30324.1"
                     /translation="MNRKVALEAVRVTELAALASWSQMGRGDKIAADQAAVDAMRKAL
                     NEVDIDGTVVIGEGELDEAPMLYIGEKVGAGGCEVDIALDPLEGTTITSKGGANALTV
                     LAMADKGGFLNAPDVYMQKIAVGGINAPKGIVDLDDSVTNNLKRIAEFKGVHMSALVV
                     CTMDRPRHEHIIKEARECGARVILINDGDVSGVIATATENSGIDVYIGTGGAPEGVLA
                     AAALKCLGGQMQARLIFNDEEEIKRAHRLGITDLNKKYDIDDLASGDIVFAATGVTDG
                     NMLQGVKRVNSTRRGSYAVTHSVVMRSTTKTVRHITAEHSFDFKEGIEKFMS"
     gene            277009..278516
                     /gene="putP"
                     /locus_tag="FTM_0253"
                     /note="proline:Na+ symporter; frameshift"
                     /pseudo
     gene            278587..280266
                     /locus_tag="FTM_0254"
     CDS             278587..280266
                     /locus_tag="FTM_0254"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, group 2"
                     /protein_id="ACD30325.1"
                     /translation="MKKTLVLILAMLVLYCLSLAGETFAGITMLLLLLCFVFYLFITS
                     KSRNFNLITSMYVVLSFAFVVCATQVLLSVDYSTHPFISMLILFVLLPTFFLLGYRII
                     LSIHCFIDSFLARYKIFVEEAPELECSIVITTRNEPFDVCKLTFDSAYSIDYPAKKLE
                     IVVVDNSDLSHKDFARWQQYVNQHNMLEGISCKFIHRNGTEGFKPRNLDIAMEHIRFD
                     YVLFLDADSTLPENALKVALPEFKQNSKLGFVSFLIESTNYSTNLVAKVASIFQNTIR
                     YFNEFVGKYGYCNYQGHNGIWSRKALEATSKWEEYYRSQVMVTEDIAAGFRCYEAGFT
                     SKPVFLKTGEWVPTSLKEFEKMWLRWSFGGMQVMHKYMSNIISSSNLYFRVKLDMLYL
                     LFKVVASGFPIFALLLVLFPRSNPAFVSIVNVTLVPLLILSLWYYLYGDIKGSFLSKI
                     SQIYMAMFMLSSFVFWCGIKAEINYYLNKPQGWKPTSKVFDKVDGWIRVIYDNIGKLS
                     FSAFGLIVAVYSICKFYPQPNFSMYLLCMLPSILLFLNTILCVMVLGRAKY"
     gene            280277..281584
                     /locus_tag="FTM_0255"
     CDS             280277..281584
                     /locus_tag="FTM_0255"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter-associated protein, HlyC/CorC
                     family"
                     /protein_id="ACD30326.1"
                     /translation="MIGYNNIVYIAIAFGFVLLNAFFVIAEFSLVKLRSSQVELLRNK
                     KALQGKVLYKAHNNIDICLSACQFGITLASLGLGWIGEPAFSKLLEPLFIFLGVTANL
                     SKFIAFATGFALISFLHIVIGELMPKSMAIRQAERLSLLTCIPLYIFYWVMFPFIWIL
                     NATANKLLELFKLDVVGEAEYGYTTDEIKVILKSSYLKKPLTEEHRDILLRMVEFAHL
                     HAIDAMCPIKEMVSIDYDLTNREKLAVIKEFLYTRYPVYQKDKNNIIGVVHTKDILCA
                     LDTELMKQDLRPILKVSYHDRLINVLNKFQQGRPHFALVYKKNQLIGFITLDNLLTIL
                     IGRISDEFHLVKEPWITLANNKFLIKADAPVYAIERLADIDLSEYPADTVLDLLQTVL
                     AEKISTNTMWEHDKFILKAYRVDEDGLKDVILELKSLDQIKFN"
     gene            281655..282002
                     /locus_tag="FTM_0256"
     CDS             281655..282002
                     /locus_tag="FTM_0256"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30327.1"
                     /translation="MKARFSSTSKQRGLSLVESLISSGLILFVLLSSFLVINSVITTS
                     VTVEKKFQLSQQLDKKIAQYILTGRFNDMAVGNSDFLQAKSSNSNLVKFVGIDRNFGI
                     RVSKEVIKYGTTF"
     gene            281986..282904
                     /locus_tag="FTM_0257"
                     /note="pilus assembly protein; frameshift"
                     /pseudo
     gene            282901..284307
                     /locus_tag="FTM_0258"
                     /note="pilus assembly protein; stop codon"
                     /pseudo
     gene            284318..284938
                     /locus_tag="FTM_0259"
     CDS             284318..284938
                     /locus_tag="FTM_0259"
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein"
                     /protein_id="ACD30328.1"
                     /translation="MLKISAIFLVLIVSICNVYAANCQLIDAQNGSNGLVEFSCDQDV
                     SLDDNKVIFYIVGKDVEIDSIKVSRGDIDFTIDQVTKNVKRVSLNIVKKTILDFELDY
                     IAYRQQPVKLIIQAKKDSNLDYQILWGGVVKNSYTNTENNNNNFQFYITKSKLFVVKN
                     GLECSIKGDCDANINILDRNDSPQATQLLQKLATYFDFGIVHQRLV"
     gene            285049..285754
                     /locus_tag="FTM_0260"
                     /note="pilus assembly protein; frameshifts"
                     /pseudo
     gene            285738..286657
                     /locus_tag="FTM_0261"
                     /note="pilus assembly protein; frameshift"
                     /pseudo
     gene            286670..287830
                     /locus_tag="FTM_0262"
                     /note="membrane protein of unknown function; stop codon"
                     /pseudo
     mobile_element  complement(287834..288584)
                     /mobile_element_type="insertion sequence:isftu1"
     gene            complement(288762..289253)
                     /locus_tag="FTM_0263"
     CDS             complement(288762..289253)
                     /locus_tag="FTM_0263"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="ACD30329.1"
                     /translation="MIRLERFTESNISDLLSELNRHDIRFLYQFGGINYQFPLDYLQI
                     KQTMDNKSNLLFNVLDDEDKSVGHCQIIRLDQANKKASIGRLLIYEEYRAKGLGKLMI
                     KKLLEFAKSIGLQNISLRVFDFNNSAIKCYETIGFEKTIEEYIDIPSLKEKWKIISME
                     IEI"
     gene            complement(289279..290457)
                     /locus_tag="FTM_0264"
     CDS             complement(289279..290457)
                     /locus_tag="FTM_0264"
                     /codon_start=1
                     /transl_table=11
                     /product="drug:H+ antiporter-1"
                     /protein_id="ACD30330.1"
                     /translation="MSNDPFKRISSDKTVIFIICLFGLMSQFATDSFIPSLPHIAEYF
                     HAAAKDIKLTVGVYFFGMTCSMLGFGYLSDKYGRKPALLAGYLIFCVASILCMIAESE
                     TQLLFFRFLQGIGMGSSFVSFRAIMKDVFSDSQSLAKASLVITSIVSLTPPLAPITGG
                     IIQETIGWRGNFTLHSIMAIIITVLIIKYLHIKAIPKSNYNVLDSYKRILTHKVFVLN
                     AICSGLALSLVFVFATLSPFFFQIKLGFSAVEYSFISAGVIIPSAIFLILFKNIISRL
                     DMNKVILYCGSFSTLSGLLLAFSYFIFGLDAKVIVILCALAFCGNVFQYTATYVCAYR
                     DIHTEIGVASAIFGFIQIAVTTISSSLVSSITLHNQLVFGLLMAIPPFLIVILKIIDI
                     "
     gene            complement(290513..291457)
                     /locus_tag="FTM_0265"
     CDS             complement(290513..291457)
                     /locus_tag="FTM_0265"
                     /EC_number="2.1.1.72"
                     /codon_start=1
                     /transl_table=11
                     /product="modification methylase, HemK family"
                     /protein_id="ACD30331.1"
                     /translation="MYSQQKQQDIINNLHTIRDYIRWSISEMTANNVYFGHGSESIWD
                     EAVHLVLSAINVAHDIDSNMVGSRLLTEEKKIIIDYVYQRACLRKPLPYILKKAWFAG
                     MEFDIDERVIIPRSPIAELIRNEFSPWINDIDDVTSVLDLCTGSGCIGIACSNVFEDA
                     NITLVDISDDALTVANHNIKKHQLSDRVRAIKSDLFDNLHGQKFDLIVSNPPYVDKQD
                     LDTMPHEYHYEPKLALEAGDDGLDLAKRIILEADKYMTENGVLIVEVGNSQYALMEMC
                     PDIPFTWLSFADGGDGVFLLTYDELVKYKDAFKKYFQK"
     gene            complement(291461..292840)
                     /gene="cysS"
                     /locus_tag="FTM_0266"
     CDS             complement(291461..292840)
                     /gene="cysS"
                     /locus_tag="FTM_0266"
                     /EC_number="6.1.1.16"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteinyl-tRNA synthetase"
                     /protein_id="ACD30332.1"
                     /translation="MIFYNSLSGQKEQFKPIEANKIKMYACGVTVYDDCHIGHARTYI
                     AFDVINRYFKYRGYDVTLVRNITNIDDKIIKRANENGESTTELVERNIKAMHDVFARL
                     NILKPSKEPRATETIPEMVAMIETLIKKGYAYQGANGDVFYRVTKFADYGKLSKQNLE
                     ALQQGSRVDVVEEKENPMDFVLWKMAKEGEPAWDSPWGAGRPGWHIECSAMSKKLLGN
                     TFDIHAGGSDLRFPHHENEIAQSEACNECTFANYWLHSGMVKVNAEKMSKSLNNFFTI
                     VEVLEEYHPEVVRYFLASTVYRSEINYSKENLENAKASVERLFNALRDIEPIEVNLPD
                     DASEYEEKFIKAMDNDFNTPEALAVLFSLAKEINTLKTTNKYKASGYAYLLRKLCDVL
                     GILFTDIEEYFKQGDGADASEIEKLIAERTQAKKDKNYARADEIRNQLQQQGIILEDS
                     ATGTTWKKG"
     gene            complement(292923..293228)
                     /locus_tag="FTM_0267"
                     /note="hypothetical membrane protein; IS insertion,
                     fragment"
                     /pseudo
     mobile_element  complement(293231..293981)
                     /mobile_element_type="insertion sequence:isftu1"
     gene            294111..294275
                     /locus_tag="FTM_0268"
                     /note="amino acid transporter; IS insertion, fragment"
                     /pseudo
     gene            complement(294289..294570)
                     /locus_tag="FTM_0269"
     CDS             complement(294289..294570)
                     /locus_tag="FTM_0269"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30333.1"
                     /translation="MNETTNQNPMVNFLKKFISFESFLTPSIIVFIFWLSIIGVCFSG
                     LTAIFSGYFIAGILEIILGAIFAKVFCEILIVLFKINDSLKEIAKNTRK"
     gene            complement(294583..296085)
                     /locus_tag="FTM_0270"
     CDS             complement(294583..296085)
                     /locus_tag="FTM_0270"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid-polyamine-organocation family
                     protein"
                     /protein_id="ACD30334.1"
                     /translation="MEINTSQKMSLFSAILIGVTSMVGSGWLFSAQLTAKTAGNWAFL
                     AWVLAAIMIMMVGLCLAKVVSVFPVRGATTRSSALSHNSVFAMPFAFANWFGIVVMIS
                     TEAQATTQYLAGIKGFEWLMHNGIISTYGMLLSLFILVIYLIINFYGVKLLASVNNGI
                     TVFKMFVPAAIVIIFIIYAFTHSTEHHSLVSADIPNNNFTVGNALTAIVAGGLVYTFN
                     GFQIVVAYSSEIKNPSRNVPLAIILSLTLVLLLYMGLQYAFMQAVPHEYLISKGGWAG
                     LDFESPLLQVATLIGLGYIAVLLIIDSIVSPSATGYSYLGASSRMLYAMSAEGQMPRY
                     FAKINKQVNISRRSLIANFLICAGFLIFSDNWVALMLIVTGFNIIGYMAAPISMGAIA
                     PKTRIFGMIVFVLLTMLLNTVEVETNIHLSIILVILMSIFGIFEYRRVGFRSLVILIM
                     PFIIFVCIISSINHTYFEGIIGAIFYLIVTDKRYVTYCKKTANQDNIVED"
     gene            complement(296450..297193)
                     /locus_tag="FTM_0271"
     CDS             complement(296450..297193)
                     /locus_tag="FTM_0271"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30335.1"
                     /translation="MQYNYFNYPNEKLPPYGSVVYFAYRKLNTDKQQIIYLLDQLKSQ
                     IISCTELYNNLEVANEKMNWWLREVNNLANKKNISSPQLKKLAEIFDQEILYQKLIED
                     ISLSIDNSSATERNFKQHFSKNFLGIETLKALYLNDFTAIDNNKIEQINANNEIIRHI
                     FCIPKHFYNQISFDNRISPTMSSQDFKDITTQWLGLYKKTTINKKLKPLEKINQIHYK
                     MIKKYIRNIDSPFKETLDFSPLNLLFYSI"
     gene            complement(297195..297890)
                     /gene="ubiG"
                     /locus_tag="FTM_0272"
     CDS             complement(297195..297890)
                     /gene="ubiG"
                     /locus_tag="FTM_0272"
                     /EC_number="2.1.1.64"
                     /codon_start=1
                     /transl_table=11
                     /product="3-demethylubiquinone 3-methyltransferase/
                     2-octaprenyl-6-hydroxyphenol methylase"
                     /protein_id="ACD30336.1"
                     /translation="MINIDNNEVDKFSRLADSWWNHNGQLKTLHQVNPLRLEFIKKFT
                     SLDNKKIIDIGCGGGILSESLTTNNNDVYGLDASSEAINVAKQHAKQNKLKINYINST
                     IEDFVTQGNLDFDIVTCMEMLEHVPEPESIIASIAKLIKKDGLFFASTLNRNLKSYLL
                     SIVAAEHILKMVPQGTHQYNKFIKPYELIKTAEKYGFVALEIIGVHYNPLTNSFKLAS
                     GADVNYIISFRKV"
     gene            298032..299132
                     /locus_tag="FTM_0273"
     CDS             298032..299132
                     /locus_tag="FTM_0273"
                     /codon_start=1
                     /transl_table=11
                     /product="VacJ family protein"
                     /protein_id="ACD30337.1"
                     /translation="MKLNAKSTLLLSLLGVTLSSCSSLKATKDNRDPFESYNRKMYAF
                     NDKAYETLTPAANSYEKVVPDTLKSGIFNIFQNLAEPARVANDMFQSEWDYAGDDGFR
                     FLTNTTLGLAGYFDVADSWFNKPMRYHQSFAVTLHKWGVYKDNEASPYVVWPLIGPGT
                     LEDITTGVDALFNPLTYIFFFAPVGSAISWGVSVGTTGAYYVNQGVSYLPSYSNLKEV
                     SIDPYMAMRNAYLQNYDYGMAKVLKQQLSKDDATIQTDQAVLGVLGLDSDNVNAQIAT
                     TGGTKVKSSEPPVIFKSNISTVNKASQVEEAFDQDYSNDSTALDLANVDNDDTTQSEA
                     SKLKTEIRDAKADLPGDADSPASAVQTLAEQG"
     gene            complement(300247..302532)
                     /locus_tag="FTM_0274"
                     /note="glycosyl hydrolase family 18 protein"
                     /pseudo
     gene            303067..303995
                     /locus_tag="FTM_0276"
                     /note="transcriptional regulator, LysR family;
                     frameshifts"
                     /pseudo
     gene            304236..304961
                     /locus_tag="FTM_0277"
     CDS             304236..304961
                     /locus_tag="FTM_0277"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30338.1"
                     /translation="MKVKKLVKSIFIASCSMISLSTIPSISYAEVSDIIEVNKQVINQ
                     NSTIITGKILPNDSYFIRDSNGNTILEGVSDSNGVFHKKVRGLDENDTLVLNYRGQSI
                     TAYNDGFMAIFKYKPHVLFASSPFDPPEYDDPSYWWGQAKNMQALFFQTTLGLFNIRQ
                     AYKEALISGKGMSWYQATNFENITLGLLSVGQGFYDAYKSQQATKETLEKLSKDFNES
                     YSKIMKKLDWFVNNIDVEFSFNT"
     gene            305028..306484
                     /locus_tag="FTM_0278"
                     /note="hypothetical protein; frameshift"
                     /pseudo
     gene            306548..309381
                     /locus_tag="FTM_0279"
                     /note="hypothetical membrane protein; frameshift"
                     /pseudo
     mobile_element  complement(309382..310132)
                     /mobile_element_type="insertion sequence:isftu1"
     gene            310196..311341
                     /locus_tag="FTM_0280"
                     /note="conserved protein of unknown function; IS
                     insertion, fragment"
                     /pseudo
     gene            311395..311865
                     /locus_tag="FTM_0281"
     CDS             311395..311865
                     /locus_tag="FTM_0281"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30339.1"
                     /translation="MKIPAEKEFAIKKAILKAIEHGYSPAQLADSFGVSKSLIYKYRR
                     ALRDQGFIRKNENDMYVITQNKFSIKPRIPESGKLDLDNDIKDQPQPNLQASNQELEQ
                     PIIDEPKPDVSRTEIKLQEKLQQIREIQLQQQQNAANQDKGLFKKIIGKFKKII"
     gene            312002..312826
                     /locus_tag="FTM_0282"
     CDS             312002..312826
                     /locus_tag="FTM_0282"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase"
                     /protein_id="ACD30340.1"
                     /translation="MVNNSKTILITGCSHGGIGYATAVHLKNLGHRVFASARQQKDVE
                     ALSQEGFETYLIDVTNYEYIDNALADILNKTGGSLDVIFNNAGYGQAGALEDIDTKFL
                     KQQFETNVFGLHNLTYKALKIMRKQGYGKIIQHSSVLGLVAMKYRGAYNASKYAIEGL
                     TDTMRLELRDSNIFITSLNTGPITSKFRENSIKTITNVNYDSSVHKQQYEKILARQHK
                     KVPFNEPAISVAKVVEKIINCDKPKPRYYITKATWIMTSLKRILPTNILDNFLNRY"
     gene            complement(312848..314197)
                     /locus_tag="FTM_0283"
     CDS             complement(312848..314197)
                     /locus_tag="FTM_0283"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid-polyamine-organocation (APC)
                     superfamily protein"
                     /protein_id="ACD30341.1"
                     /translation="MDINSNQDQVLGFKDVTIMAVTANFGIRWIPVAACLGASAIFFW
                     ILGAVMFFLPLVIIAVQLSRKHPDEGGIYSWTVRALGQKAGFMVAWLYWVNTIFYYPA
                     VLIFLATNFAYFIGRPDLVDNHYYITIVVLVAFWLVTVISFYGLKANKYLVDIGGVLG
                     SFLPAIAIIVLGVIAYLIVGKSATDFSLANMIPHDNIWHNLSTLTIIMFAMAGIEIIP
                     TFANSVKDAKKNLYYGLMFSAFILLGLYILGTIALNLVASPDTINSASGLMEAFEIIG
                     HRFGWEWFPRLMAFLLTFAELAAVSIWLLAPVVMFFKCTPRGILPEWLHKTNKYDSPK
                     NALVFMGILVTVIVLLTNFLPSVNLMYQALILMATVLYFIPYLYLVVAYIKLMDSTYK
                     YLLGFLVFISTSLGIIFSFQPSSDLTGGYDIFIYEFELILGPVIFIFIGWLLYKFKR"
     gene            complement(314456..315328)
                     /locus_tag="FTM_0284"
     CDS             complement(314456..315328)
                     /locus_tag="FTM_0284"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30342.1"
                     /translation="MKKILLGFTLLSGVVFASDELKLKIKLHTNTQEQNILMPPNRYI
                     SDNISCPQGKSWIQELGQNVFTANVPLISTYDPESFGLLWPALSLHKRVGDTSLYFVV
                     QQKIDRELTTGPEDNITVKYHALIADGINTGVGKPNNKVLKGKFNLRDSEGNSLIGDY
                     RDMEVSAHNNLWSGPENDDVLREMITSYTSKDNSVIISELLISDDTQNADFIDPINSD
                     IKNILTVHVLLNEKDFESFVTDMGNYQITQDNSFLENYLVNQNGVEAIRDGLAIYKNT
                     IAYVRSVAENKKVK"
     mobile_element  315496..316246
                     /mobile_element_type="insertion sequence:isftu1"
     gene            complement(316274..316723)
                     /locus_tag="FTM_0285"
     CDS             complement(316274..316723)
                     /locus_tag="FTM_0285"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30343.1"
                     /translation="MKKIIIVIASMLIALTANATGDCSDKSFNDIKSKARQMEQAWDS
                     ADVEKVVSFYADDFIYMSGGKPYTTKNAVLKHYVDGFAANSSGKRDMGKLKLNYQYCR
                     NLDQNYQLVILKFIWTSSDGKVASGHDLLVWHKDSKGDYEIIVDFPQ"
     gene            complement(316732..317127)
                     /locus_tag="FTM_0286"
     CDS             complement(316732..317127)
                     /locus_tag="FTM_0286"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30344.1"
                     /translation="MRRIFSFLLFFPCLGLATMTQAEIDKLYTKPIVLSSKQYTFNVE
                     LPVDSIDGYRWFLISPDYDYIDDDSYSHESVDIQNSKWGGMDNFKLKLTKKFRKVPHK
                     IVLHFECLRPFESNPKILTKDVTVLSLPD"
     gene            317210..317941
                     /locus_tag="FTM_0287"
     CDS             317210..317941
                     /locus_tag="FTM_0287"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="ACD30345.1"
                     /translation="MALEKFELELVSFKDITDKVRHFVFKRTDGKPLDFIAGQFITFL
                     LTDEDGNIKRRSYSLGSLPADNMLLEIGMTYVEGGIATDTFFNMKVGDTAAAMGPAGR
                     LVLKKDEEIRKLILVGTGTGIVPYRAMFPELLEKADNTEIHILLGVQYRKDALYQDDF
                     IEFAKKHHNIHFKLCLSRETQDLRDYEISGYVQNQFDKIGLDPERDVVYVCGNPNMID
                     ESYEMLTQAGFNAKNVRREKYISSN"
     gene            318063..318278
                     /gene="rpmE"
                     /locus_tag="FTM_0288"
     CDS             318063..318278
                     /gene="rpmE"
                     /locus_tag="FTM_0288"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31"
                     /protein_id="ACD30346.1"
                     /translation="MRQEIHPKYTEVTVTCSCGNTFVTRSTAGKKEMNIDICSECHPF
                     YTGKQRIVDTAGRVDKFKKRFGGMKKI"
     gene            complement(318489..319994)
                     /gene="gshA"
                     /locus_tag="FTM_0289"
     CDS             complement(318489..319994)
                     /gene="gshA"
                     /locus_tag="FTM_0289"
                     /EC_number="6.3.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-cysteine ligase"
                     /protein_id="ACD30347.1"
                     /translation="MYDFKKINNLRGIERETLRVTDCGNLATSNHPDGLGHKLTNNSI
                     TVDFSENLLELITKPHDSIDKAIGELYQLSAFTLDNMHSDEIILNTSMPLSANDNDIQ
                     EADFGSSNSGRMKRVYRKGLSARYGKIMQIISGIHYNFSFDKDLISNIATNKQVSISD
                     IYFDVLNNYFEFMWLLPYLFGASPICAKTSVKNKPDYLSVLDDKFYVGEYATSLRMSD
                     LGYTSPAQKDLAISYDNVKAYVKDLIQATDDTFADYKRIGLYNSQGQRIQLNDSILQI
                     ENEYYSAIRPKQIAKRGERPACALYNRGVEYVEVRVLDVDPFEPVGISKDTALFVEAM
                     LMTCLDKDAKKYHKDIIKQAKQNLTAVAIQGRNPQLKLKKLDDDSEILLKDYALELFD
                     EIEAVAKKMPKEYLDAVEIQKRKVLDISQTPSAKIIELARQHGYKKFILDISRQVSQQ
                     FRSYELPAAIVAKLKDQAGQSVAAEKELVANDKISLDEYINRYYESSKGCC"
     gene            complement(320047..321588)
                     /gene="mviN"
                     /locus_tag="FTM_0290"
     CDS             complement(320047..321588)
                     /gene="mviN"
                     /locus_tag="FTM_0290"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug/oligosaccharidyl-lipid/polysaccharide
                     (MOP) transporter"
                     /protein_id="ACD30348.1"
                     /translation="MQKFFSNILIVSIFLFLSKLLGFVRDLLLASFFGSGAALQAFLV
                     AFRFPEFIRKVTSSGTLTQIINPYLNASINQRNNKFIITILYFIALFLLIVTFLAIVF
                     SNIWVGIYAYGFVDETSVLVLVKSMFVIMIPYVLFNGVMGVISAILNSYSKYVVSSLL
                     PIVLNVVMIIGVDISPRFNVPIYSVAYAVLLAGIIQVSIGGYSLIKLIGKISFSRDIF
                     LVKDSRAKIFLRKLPSAFLGTAILQINGLVETFFASFLLSGSLAWLYYADRVNQFLYG
                     VFGTAIATVMIPYLIDCKRDKQQFFKTLAAIIRFTLLVTIPAIVGLFVLAKPIVISLF
                     YYGKFSLNDVDFTYLAMLGYLMSLFCFVVVRVIVSALYAQNKTTIVFYISLVSLITTI
                     CLDIFIVHFFSGDKYAFVYLALASSSVALLNLFIQLWVLCDFSFKLFIVTYLPFMTIV
                     KIIIASTTMVLVLKLFNLSDSYWITLSMFGRLKSIALIVFIGVCVYLVTILLLVGIKP
                     LKTLE"
     gene            complement(321611..322672)
                     /locus_tag="FTM_0291"
     CDS             complement(321611..322672)
                     /locus_tag="FTM_0291"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30349.1"
                     /translation="MKAKFIIAFLSILFFSSSYATLEQCYKDSVNQDYEKVLESCKPY
                     LKTDARATGLLAEANIQLDSSDKLALEDALWAVNFYQKNGAPKDPEGARSYSYLVYLI
                     GELYFFGSDDIKVDQKKGIEYIIKSANLGYDIAQNQLGNLYVRAGKVPGPNFAKAYKW
                     YKLAIANGSLDARNAYLMNNERSFIENYPYCISIGRALIGDTYLNGLAGLPKSPDFAI
                     QWYQKAYELDHISPVETGLARAYMAKGDKKLAYKYAREAIQQPYAPAFVVIADLTDNK
                     VAKYAYLAEAVELYKNPALKFWSQFNEYCMPDISDNGLKQAQRNLAKIKLSKQELELA
                     TKEQQSLRNSWQQNAVTSK"
     gene            complement(322755..323165)
                     /locus_tag="FTM_0292"
     CDS             complement(322755..323165)
                     /locus_tag="FTM_0292"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30350.1"
                     /translation="MKSILVNDEEQMYQLAKEYSQQLKPGQIIYLYGDLGAGKTTFVK
                     GILNALGYTGNVKSPTYTLVESYEFDKFDIYHFDLYRLADPEELEWIGARDYFNQKDI
                     CFIEWPEKGKGFLPLNTTKVHIKYLAQGRQVDFY"
     gene            complement(323143..324324)
                     /gene="folC"
                     /locus_tag="FTM_0293"
     CDS             complement(323143..324324)
                     /gene="folC"
                     /locus_tag="FTM_0293"
                     /codon_start=1
                     /transl_table=11
                     /product="folylpoly-gamma-glutamate synthetase/
                     dihydrofolate synthetase"
                     /protein_id="ACD30351.1"
                     /translation="MSVEIKIAKLMAKPDALYCDLLDLSLILSRFNFAKKFKVITIAG
                     TNGKGTTVAMLEELLVTNNKNVLSHTSPHVFKFNERISLNKQPICDSVLLEILERLEE
                     LAPEYRLSYYQIAFLCLCIYSQRVELDYLILEVGIGGRLDAANIIDADITAITNIDFD
                     HCEILGDTLDKIGFEKAGISRPQVPLFLGSQIPQSVYEYAQTIGAVIYQNSYEYSSRQ
                     CFTHSYNIAMGIAEYLFYRMQISYIPNLEDIRARARFATLKNDSLNNSYVVVDVAHNP
                     ASVRHLFELLESKFAGKNIRYEAIFGILATKDIREVLNIAKQHVYKWDVIDLKYLDSR
                     AADLEKIKQEFKLQQIIRVDYNKDLSSVYLAKKDTLTVVFGSFVLAGEFIRHYEKYTS
                     K"
     gene            complement(324339..325241)
                     /gene="accD"
                     /locus_tag="FTM_0294"
     CDS             complement(324339..325241)
                     /gene="accD"
                     /locus_tag="FTM_0294"
                     /EC_number="6.4.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase, carboxyl transferase,
                     beta subunit"
                     /protein_id="ACD30352.1"
                     /translation="MSWLTRVIGRSLGLEAQKKDMPSGVWSQCPNCGVTLYSEELHNN
                     KSVCPSCNYHYRISARNRLNLFFDRDSMQEHFANVSPVDMLKFKDTKTYKDRLAQAQK
                     KTEEQDALVVMEGTVKGFPVVAAAFNFMFLGGSMGSVVGEKFVRGVKLAIEKKVPFIC
                     FTASGGARMQESLFSLMQMAKTSAALQKLAEAKLPYLVVLTDPTTGGVSASLAMLGDI
                     HIAEPKALIGFAGPRVIEQTVREKLPEGFQRSEFLVEKGMVDMIVDRRNLRGEVAKLI
                     DKLMPNLTKINYSQPLEYKSEQQA"
     gene            complement(325283..325705)
                     /gene="ndk"
                     /locus_tag="FTM_0295"
     CDS             complement(325283..325705)
                     /gene="ndk"
                     /locus_tag="FTM_0295"
                     /EC_number="2.7.4.6"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside diphosphate kinase"
                     /protein_id="ACD30353.1"
                     /translation="MTKQRTLSIIKPDAVEKNVIGEIYSRFEKAGLRIIAAKMKHLSK
                     AEAEGFYAVHKDRPFFSALVEFMISGPVIIQVLEGENAIAKNRELMGATNPKEAKAGT
                     IRADFADSIDANAVHGSDAEDTAAQEIRYFFSDTEIFG"
     gene            complement(325778..327418)
                     /gene="pyrG"
                     /locus_tag="FTM_0296"
     CDS             complement(325778..327418)
                     /gene="pyrG"
                     /locus_tag="FTM_0296"
                     /EC_number="6.3.4.2"
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthase (UTP-ammonia lyase)"
                     /protein_id="ACD30354.1"
                     /translation="MNSNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLD
                     PYINVDPGTMSPLQHGEVFVTEDGAETDLDLGHYERFIRNKMTQANNFTTGKVYQSVL
                     RRERKGDYLGATIQVIPHITDEIKRRICSGIADDVDVVIVEIGGTVGDIESQPFLEAI
                     RQLRIELGRNRTLFVHLTLLPYIKVAGEIKTKPTQHSVKELRGIGIQADVLVCRCEKK
                     FDDSEKRKIALFTNVDQDCIFTAEDVDTIYEVPLKYNQQGFDAKLVELLNLNAKEADL
                     SEWQNVVNTIIDVKGEVTIAMVGKYVSLTEAYKSLNEALYNAGYKKGVKVKIKFVDSE
                     DVNENNVESYFKDVAAILVPGGFGSRGIEGKIISIKYARENQIPFLGICLGMQLAVIE
                     YARNILGIKDAHSSELEPTTANPVIGLITEWQAEDGTVHQRTHSSDLGGTMRLGGYKC
                     VLKQGSRAREIYQADEVVERHRHRYEVNSNYVERLEEAGLIFSGRSEDNKLMELIEIP
                     QHKWFIACQAHPEFTSTPRYGHKLFESYIQAAIENSNN"
     gene            327759..329240
                     /locus_tag="FTM_0297"
                     /note="C4-dicarboxylate anaerobic carrier; stop codons"
                     /pseudo
     gene            complement(329475..330431)
                     /locus_tag="FTM_0298"
     CDS             complement(329475..330431)
                     /locus_tag="FTM_0298"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30355.1"
                     /translation="MCDFDAEIKTSPIYVDIIRNFVFSMFINIDYPAFSYFLSPDELG
                     KSDDDTSYQKSYKVTVSGDGITELNIRNVEYDYHDFIMKNESELSLNLLGAKKVNLIN
                     DATIYLNVVSSEKLILDLSKDINRMIIRDSSIEKLDFNSCEFETVPSFDDKSSIKHSV
                     DIDLATFNNLLKVEKGGSLEFSRLAEFFNRNNAYMEAQQLHRHYLLAKAKESKSCDLK
                     VWVWFYNLINGCGTSLAKPVIWILLLFIFNLFIVLLGSDLLGFDITYYAINTTIPIFK
                     LASNHIELSNGILLVLNISSILATLLWFLIALQIRKLLRLKE"
     mobile_element  330886..331636
                     /mobile_element_type="insertion sequence:isftu1"
     mobile_element  complement(331614..332368)
                     /mobile_element_type="insertion sequence:isftu2"
     gene            332556..333521
                     /locus_tag="FTM_0299"
     CDS             332556..333521
                     /locus_tag="FTM_0299"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase sugar-binding region
                     containing DXD motif family"
                     /protein_id="ACD30356.1"
                     /translation="MGSLIPDKYINNIFYLLSQSDHYINIWTDRPEETRLKFLDKIGG
                     YSHLQRNKITDRLEFKQIFELENWCQINLSNYLTLIQMKTLSETFMFEYPNYSDRYNK
                     YSLEVLYKLGNLATLSDILRLVILYKEGGIYIDCDNTFKGQHIKYNIKYSKNPNQYNI
                     CANCKFSLYSFHNIAGNSVLVANSGAQGCVEILKLSLDTIYKQQTGRELIDNIEKMKR
                     ILFTEKSYLKDVFDYFMSNSYIEKDKDLRRHGKDPNGYKLQILKDYGGVNQSMYHCGY
                     PYAYLAMQIGPEVLKEFERNKAFSKRITEISIFHTIIINSDQAWL"
     mobile_element  complement(333718..334468)
                     /mobile_element_type="insertion sequence:isftu1"
     gene            334630..336516
                     /gene="htpG"
                     /locus_tag="FTM_0300"
     CDS             334630..336516
                     /gene="htpG"
                     /locus_tag="FTM_0300"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone Hsp90, heat shock protein HtpG"
                     /protein_id="ACD30357.1"
                     /translation="MSEKKYTFETEVDKLLHLVIHSLYSNREIFLRELVSNSSDAIEK
                     LRYESISNAALNEDDTDYAIRIDFDKDAKTITVSDNGIGMTEEEVIENLGTIAKSGTK
                     KFLESLTGDKSKDNELIGQFGVGFYSSFIVADKVTVRTRKAGQDKSQATKWVSDAQNG
                     FTVETITKEKRGTEVILHIKKEHLDLLEYHVLKGLVNKYSDCINTPIQMKKVEYDKDG
                     KQTVKDEYETVNNTKAIWLRSKDEVTDEEYQEFYKYISHDFADALMWIHNKVEGNLEY
                     NSLLYIPQNKPFDFWNRDKNYGLSLYVRRVFIMENKELLPPYLRFVKGVIDSADLPLN
                     VSREILQHNKVIDKIKKAITTKILSELKKLASKDKEKYQKFWDSFGQVLKEGVSDDYS
                     NKEKIAGLLRFATTQSGDSKQTVSLADYISRMKEGQDTIYYITSDSYKAAANNPQLEA
                     FKKKGIEVILMTDRIDEWMMSTLTEFDGKHMKSIIKGDIDLNKFETPENKEKFEKEAK
                     DFEKVLKEIKEVLKDKVEDVRLSKRLTDSPSCVVVNDYGMSLHMQKMMEEAGQSFMPG
                     MGMKPILELNAEHNLVQKLKNEADTEIFADLSELLLLQAMFVEGAKIEDPMAFVKLVN
                     KYIR"
     mobile_element  complement(336744..337494)
                     /mobile_element_type="insertion sequence:isftu1"
     gene            complement(337979..339493)
                     /gene="fumA"
                     /locus_tag="FTM_0301"
     CDS             complement(337979..339493)
                     /gene="fumA"
                     /locus_tag="FTM_0301"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase, class I"
                     /protein_id="ACD30358.1"
                     /translation="MAVIKAEDLVNSVAEALQYISYYHPKDFIDAMYEAYQREESKPA
                     KDAMVQILINSRMSAIGKRPICQDTGMVCAFVKVGMDAKFDKTDRTITELINEGVRRG
                     YNDPHNPLRASMVFPPHGSRKNTKDNTPAIVHIDLVHGDKIEVDIAAKGGGSEFKSKF
                     KVLNPSDSIIDWVEEMLPTMGAGWCPPGVIGIGIGGTAEKAMLLAKESLSEEINIQDI
                     IKNGPQNETEQLRLDIYNRVNALGIGAQGLGGLTTVLDVKINEYPTHAACKPVALIPN
                     CAATRHVHFVLDGSGAVDLPAPKIEDWPVIEQAQNDDVKRINLDTVTREEIEALRSGD
                     NVLISGKILTGRDAAHKRLQDMYNAGEDFPVDLNGRFIYYVGPVDPVGDEVVGPAGPT
                     TATRMDKFTPFMLEKAGIMGMIGKSERGQATIDSIKKNKAIYFMGVGGAAYLISKSIK
                     KAEVVAFEDLGMEAIYEFEVEDMPVTVAVDSLGVSAHQQGPKLWKQKIAEINKV"
     gene            complement(340045..340242)
                     /locus_tag="FTM_0302"
     CDS             complement(340045..340242)
                     /locus_tag="FTM_0302"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30359.1"
                     /translation="MILLSVVSILIALLVTLGVAKILYNSSFRKNKLNSTKELLINAT
                     IVTFIFFCVCSLIYVFLLNIV"
     gene            complement(340246..342285)
                     /gene="recG"
                     /locus_tag="FTM_0303"
     CDS             complement(340246..342285)
                     /gene="recG"
                     /locus_tag="FTM_0303"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="ACD30360.1"
                     /translation="MRFVDFNGVGEATIKALAKYNIHDPNDLLTIFPKDYKDTRVITP
                     INHLVAGNRSLIQGRVTNLTYKKFGKKFLRFNINDNTGFCSVILFKFYPNQLAILEKS
                     EYVRCYGKVEFSLSPQMVHPEWATVNNGECALKQGFSAVYRFKKIPDRLISKMILKML
                     QDNRVENIIPSQLLRRFNLISFCDALYYVHALTNFIDEKYLSIARFSIKFEEMLAYKL
                     AEQNIYKNTVKAQAPQLFLTKIQQNEFYEKLPYQLTNAQQRAITEILDDIKKSNAMNR
                     LLQGDVGAGKTIVATIAAYAAVKSGYQVAMMAPTEILAEQHFSFLSQYLASFDIKVIP
                     LLGKLSAKQTRESLDKIKDQKDCVVVGTHAIFQERVEYCNLGLVIVDEQHRFGVEQRL
                     ALVSKSSSNFSDLTPHQLIISATPIPRTLAMTLYGNLKLSILDELPPKRKPIITTVLN
                     RAKKQNLIEKVKQAVLRGEQVYWVCPLVEESENMDFLQDVKTLYQELLEALGKENVGL
                     VYGSMKSKDKIEQMAAFKAKKYAVLVATTVIEVGVDVPNATIMIIDNAERLGISQLHQ
                     LRGRVGRGAKESYCILLYSDKISEVGKRRLSLVRESQDGFYLAEKDLEIRGAGDIIGK
                     EQSGVSTFKTFDINEYYDNYDKVVEFADMLDKHYPELVDKLIQRWFDRRVNYVEV"
     gene            342415..342759
                     /locus_tag="FTM_0304"
     CDS             342415..342759
                     /locus_tag="FTM_0304"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved"
                     /protein_id="ACD30361.1"
                     /translation="MKKQLFAISITTALLVLSACGQTGPLYLPDEDKLNSGSTLAKSG
                     SSIMVKQNQQNNSTSTSDNQSDTSTKVDNDPTAPVRNNNPTTSELFEGENNFNYNNNI
                     QNSQNAGGTPTL"
     gene            342894..343130
                     /gene="rpmB"
                     /locus_tag="FTM_0305"
     CDS             342894..343130
                     /gene="rpmB"
                     /locus_tag="FTM_0305"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="ACD30362.1"
                     /translation="MSKVCIVTGKRPATGNNVSHAQNKTKRRFLPNLHAHRFWVESEN
                     RYIKLRVSSKGMRIIDKKGIDTVLSDLRAQGHKI"
     gene            343157..343312
                     /gene="rpmG"
                     /locus_tag="FTM_0306"
     CDS             343157..343312
                     /gene="rpmG"
                     /locus_tag="FTM_0306"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="ACD30363.1"
                     /translation="MREKIRLVSSAKTGHFYTTTKNKKEMPNKMEIKKYDPVVRKHVM
                     YKEAKIK"
     gene            343347..344033
                     /gene="minC"
                     /locus_tag="FTM_0307"
     CDS             343347..344033
                     /gene="minC"
                     /locus_tag="FTM_0307"
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation inhibitor"
                     /protein_id="ACD30364.1"
                     /translation="MKQAFHFKGGNYTISAININVTEFTQIESLLNSKISQSKSFFHN
                     TPFAIDIRDIDEDEKCSVNFLEKVIATFKANGMIPVGFVVNNKELKIKLARAGHNILK
                     GGKSKEVNVDEDKSFTSAKIVTTPVRTGQSINARDCDVIVTANVNNGAEIIADGSIIV
                     YGRIGGRVIAGSSGNKDAKIICKDLRAELVSIAGKYVTLNNESIPVENTNTDGYIVYL
                     QDDKIHIEGF"
     gene            344073..344897
                     /gene="minD"
                     /locus_tag="FTM_0308"
     CDS             344073..344897
                     /gene="minD"
                     /locus_tag="FTM_0308"
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation inhibitor-activating ATPase"
                     /protein_id="ACD30365.1"
                     /translation="MSEKKQGKVFVVTSGKGGVGKTTSSAAVAYAFAKKGLKTVVIDF
                     DVGLRNLDLIMGCERRVVYDLINVVREEATINQAIIKDKRIDDLYIIPASQTRDKDAL
                     TEEGVDRLIEELRNSFDIVLCDSPAGIEKGSLMAMRCADAAIIVTNPEVSSVRDSDRI
                     LGMLSSKTLKAQREGEFKEIHLLLNRYDAARARAGAMLKAEDVSEILYTPIAGIIPES
                     KDILEASNSGHPITHFSDSIAAKAYFDAVDRILGKDVPMRYTEQKTSFFKKLIGKS"
     gene            344900..345172
                     /gene="minE"
                     /locus_tag="FTM_0309"
     CDS             344900..345172
                     /gene="minE"
                     /locus_tag="FTM_0309"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division topological specificity factor
                     protein"
                     /protein_id="ACD30366.1"
                     /translation="MLAKLFGLSKKQQSASVAKERLQIIVAHQRSELHPRSSKISSHL
                     LAELKDEIIEVVKKYVALSEENIRDIDLKVEDSSKNSTIEVNIPFN"
     gene            345186..345989
                     /locus_tag="FTM_0310"
     CDS             345186..345989
                     /locus_tag="FTM_0310"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, ATP-binding protein"
                     /protein_id="ACD30367.1"
                     /translation="MCDISFKNVSFYRDSRCIYDDITFTIPTNKITTILGPSGAGKTT
                     ILQLIAGLIKPTLGKICIDNAIIEKNTKETQLEKLRRRMGFLFQSGALFTHLSVYDNI
                     AFPLRKNTNLDEKLIRNIVLLKLQAVGLAHTINMMPSELSGGMARRVALARSIAMDPD
                     IMMYDEPFTGQDPASFNKLLELISTLNESLNMTSIIVSHDIQESLSISDHIIIVGNNK
                     IIASDSPENIKNSKDQQIQNFLAGKPLDYNYHNHNDLEKNFFKKEILGR"
     gene            345993..346757
                     /locus_tag="FTM_0311"
     CDS             345993..346757
                     /locus_tag="FTM_0311"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transport system permease protein"
                     /protein_id="ACD30368.1"
                     /translation="MTIFSKVYTLTFSLIYSLVKSLSLILRIVISKLNIRDCIIQIKA
                     VGVNSIIIIVTSGVFIGLVLSLQGYYTLSKFGAHSLLGVMVALSVLRELGPVVTAMLF
                     AGRACSSITSEIGLMKATDQINSFKVMNVNPISFILSTRFWACMISGPILALIFASVA
                     ILAGFILAEAALGISYGEFWSNIQSSVTASDISNGIIKSIVFAFITAWIALYQGYYCI
                     PDSNGIAKATTKTVVYCCMSVLGADLILTSIMFGGV"
     gene            346757..347290
                     /locus_tag="FTM_0312"
     CDS             346757..347290
                     /locus_tag="FTM_0312"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, periplasmic protein"
                     /protein_id="ACD30369.1"
                     /translation="MRNKYFETSVGIFIIIGVLCLLFLTFKVSGTSFKAFNTQEYTIT
                     ADFKNVGSLRTNASVKIAGVEIGRVTKIALEKSYNGFMAVVTMAINSDKKIPANYSAS
                     IAMSGILGDNYVALSPPSEDIMAIAGIADANNSSEQDKYLHQGSVIQLENTQSAIDLG
                     SLINTFVAGKDDDKSKE"
     gene            347364..348026
                     /locus_tag="FTM_0313"
     CDS             347364..348026
                     /locus_tag="FTM_0313"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetcial protein"
                     /protein_id="ACD30370.1"
                     /translation="MLRKISIFLSLIILMVSSAWAIENPVDMLNRTIVKTQDKLIKNA
                     NEYKQDPYKLLRLVDREIIPVVAPSVIAQLVVGTPKWKKATPAEQKQFIRSATEMLAF
                     MYAKNVAYAGKYKLTLFPFNKNDTSWENKPIVIVNGKITNIDNDQSSDFAVKMFQKDG
                     KWHVYDFDVAGVSILRTYQQQFAPYPNVVEMTKAVEKVTTKIKEKTYPKLLDKNYNLQ
                     SV"
     gene            348026..348319
                     /locus_tag="FTM_0314"
     CDS             348026..348319
                     /locus_tag="FTM_0314"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30371.1"
                     /translation="MITVTNHKWTIETELTLKTVANIYRNFRKNLKKIDKTWIIDFAR
                     CDRIDSAGLSLIIEYIKYAQKNNIQIVFKNIDQKTLSLAKVHGAKTILEEYIN"
     gene            348336..348572
                     /locus_tag="FTM_0315"
     CDS             348336..348572
                     /locus_tag="FTM_0315"
                     /codon_start=1
                     /transl_table=11
                     /product="BolA family protein"
                     /protein_id="ACD30372.1"
                     /translation="MTKEQLKDILENSLKNCSADVQSDDNVHFSATIIAEEFNDMPSK
                     VKRQQLVYSKINKYILSGELHAIAMKTIATNEVK"
     gene            complement(348851..349530)
                     /locus_tag="FTM_0316"
                     /note="hypothetical protein; frameshift"
                     /pseudo
     mobile_element  349779..350529
                     /mobile_element_type="insertion sequence:isftu1"
     mobile_element  complement(350533..350940)
                     /note="fragment"
                     /mobile_element_type="insertion sequence:isftu6"
     gene            351129..352783
                     /locus_tag="FTM_0317"
                     /note="adenine specific DNA methylase; frameshifts"
                     /pseudo
     gene            352787..353069
                     /locus_tag="FTM_0318"
                     /note="endonuclease; frameshift"
                     /pseudo
     gene            353138..353638
                     /locus_tag="FTM_0319"
     CDS             353138..353638
                     /locus_tag="FTM_0319"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30373.1"
                     /translation="MKKIIIWVLEQIIALLDKGKNKSNEYNYGNSNKGIQVVESMPID
                     NSVTNNISYGTPELEPNCQIIEEKILGSVFNWIYKPYIMMGTIIYILILVAEIVLYPR
                     FEITIENTWSIIFFTPLVITMMFLLFLLSYEEYRFSVLSEIRKNDWCEDTRNQFVYKK
                     INDEII"
     gene            353839..356565
                     /locus_tag="FTM_0320"
     CDS             353839..356565
                     /locus_tag="FTM_0320"
                     /codon_start=1
                     /transl_table=11
                     /product="type III restriction enzyme"
                     /protein_id="ACD30374.1"
                     /translation="MLFEKQQYQEDCVNNIVNILDECDVFNNDYSNLKNIIKEHYKTQ
                     RYSQFETSSKKQIDVLMETGTGKTFTYIKTIFEINKQFGKTKFIIVLPRTAIKQGVIQ
                     NIKLTDEYFYNEYGKHLKFIDYTGKDSLSAVQQSFICNESDLTVLVSTNSAFNKDANT
                     INQAKEDLVEHSSVWEAIADKKPIVFIDEPHLLKGGATVEALEKLDSLFIRFGATYPT
                     EEEHKLVNVAYALDSINSFENYLVKRIAVKNILTGAEESDIKITKINAKEIFFSNGDT
                     KKVSESYELNDDEIEQMLRVTVSNHFEKEERLFNQGIKELSLFFIPSIADFRGDNPRV
                     RKFFEKIYREIRDEYYHNTTNQEYKKYLDKDFKDGKLQVLEGYFSGDKGDSAKDDDLK
                     KAVDIILNKKEQLLSLDEPLRFVFSVWALQEGWDNPNIFNICKLATTDKETSRRQQVG
                     RGLRLAVNQAGKRQSFKTLAENENAFYDINTLDVVVSGYEKDFIEGIQSEIQKASFGI
                     VGDFLENSLLEANGLNLREVSKLINTLEDNQIIEFDESIEKYKIISSIYDFIENNADK
                     LSFLSNDRLQEIKQLFKSRKSLIEDKNKTIEKLKIRQEQAKKFKELWETINRKAEIVY
                     KDINELDIINKIADAFDTENFSQIDTKVITKVYDPIKDKVVTKEEQSLGKIDFFAKNK
                     LSEFVFEFSKKEKLPLGFVTKLFSKLDLQKIKNNPSKAINFIKTQIKESIHTSILQCV
                     DYDFSQTNIFSKNILQNDDGSFIKEIEYTKLGRNIGDEASDEFLFDRVVYDSDIEKQA
                     ILNDPTSIDGQQITVFAKLPSISMPTPYKAYNPDFAYLVDRGKNQKQLFLVVETKGYK
                     NNSDIPQAEKTKIDYAKKFFEGLQKQLPDVEIRFKTRVNKQELSNILQEYQK"
     gene            356562..357224
                     /gene="ung"
                     /locus_tag="FTM_0321"
     CDS             356562..357224
                     /gene="ung"
                     /locus_tag="FTM_0321"
                     /EC_number="3.2.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-DNA glycosylase"
                     /protein_id="ACD30375.1"
                     /translation="MTWSDILAEEKQKPYFKQILDFLACESAKGKVIFPTKENIFNAF
                     KYTELDNLKVVILGQDPYHNYNQAHGLAFSVQKGVDIPPSLQNIYKELARSIPEFKTP
                     NHGYLVDWAKQGVFLLNTTLTVEAHKANSHKDIGWETFTDTVINKISENKHNVVFMLW
                     GSHARKKKVLIDSSRHLILESTHPSPLSAHRGFLGCNHFVDCNKYLIEKKDQKIDWNL
                     LC"
     gene            complement(357260..358926)
                     /gene="cbpA"
                     /locus_tag="FTM_0322"
                     /note="chitin-binding protein; frameshift"
                     /pseudo
     gene            359184..361790
                     /gene="gyrA"
                     /locus_tag="FTM_0323"
     CDS             359184..361790
                     /gene="gyrA"
                     /locus_tag="FTM_0323"
                     /EC_number="5.99.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase, A subunit"
                     /protein_id="ACD30376.1"
                     /translation="MSIITKESSSINIEKELKQSYLDYAMSVIVGRALPDVRDGLKPV
                     HRRVLFAMNELSNYYNRPYKKSARVVGDVIGKYHPHGDTAVYDTIVRMAQPFSLRYTL
                     VDGQGNFGSVDGDSPAAMRYTEIRMEKLTHELLIDIDKETVDFSPNYDNTELVPDVLP
                     TRVPNLLVNGSSGIAVGMATNIPPHNMTEVINGTIALIDNPNLTIEELIEYIPAPDFP
                     TGSYINGTDGILEAYKTGRGRVIMRAKADIHEDEASGKAQIIVTEIPYQVNKAKLVEK
                     IAELVKDKKVAGISELRDESDKDGIRVVIDLKRDESPEVVLNTLYAQTQLQCSFGINM
                     VALSDNRPKLLNLKEILEQFIKHRKEVVTRRTIFELRKSKERAHILEGLLLSLANIDE
                     MIELIKASPSPADAKESMLARSWNGSMVKSMLEGVDVKMYRKETLASHYGIQVDSSYN
                     LTEEQADAILALRLHRLTGLEQDKIVNEFKELIDRIKYLISILSDIKELIRVVKDELV
                     EIRDNYGDQRKSEIIESRLDLTREDLIAEEDMVVTLSMDGYVKTQPLSMYNAQKRGGV
                     GKSATKTKEEDSIFKLMLASTHDTMLCFSSLGRVYWSKVYDFPVASRISKGRPINNIL
                     PLEKDERITAMMPISQFNEGWYVFMATKLGRVKKVDLSEFARPRSTGKIAIGLNDGDE
                     LSYVALTDGNKQIMMFSDAGKAIRFDESDVRAMGRSAAGVTGMRLHHNQKIVSVIVTN
                     PDEGIVLAATENGYGKRTAVSEYRKTKRASQGVIAISTSERNGKVVVAALVENDEDIV
                     MITDNGTLVRTSSDEVRECGRSAQGVRLINLRNNEKLISLKVVKQDDVEDNQDIENNE
                     DIESSDVTVQSE"
     gene            361796..362953
                     /gene="dxr"
                     /locus_tag="FTM_0324"
     CDS             361796..362953
                     /gene="dxr"
                     /locus_tag="FTM_0324"
                     /EC_number="1.1.1.267"
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
                     /protein_id="ACD30377.1"
                     /translation="MFKKTKITILGATGSIGDSTLAVIRETNDFEVFALTAFSNVEKL
                     AELCQEFKPKFAVVPDLSKKQKLQSLVTDVEVLVGESGLEKVSSLAEIDIVMSAIVGI
                     AGLKPTFAAAKAGKKILLANKESLVTAGHLLIDEVVKNNAQLIPVDSEHNAIFQCIDN
                     HDKKCLPEIDKIILTASGGPFRDKQLHELTDVTPEQACNHPNWQMGRKISVDSSTMVN
                     KALEVIEAYWLFSVSADKIGVLIHPQSVTHSMVRYVDGSYIAQLGVPDMKTPIANAMY
                     YPKRGSVNVESLDFTKYQLTFREACFERFEALKIVFNNLQNKNYAANIVFNAANEELV
                     AAFLNKKIKYLEIIEVNKKVTKELNFENPKNIEEVFEIDRKTREYVDSVLG"
     gene            362959..365337
                     /locus_tag="FTM_0325"
     CDS             362959..365337
                     /locus_tag="FTM_0325"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved outer membrane protein of unknown
                     function"
                     /protein_id="ACD30378.1"
                     /translation="MFFLRKKFVLASLLVGIAFNGWADNDSFILDNVSINGLEGLQSD
                     VVKSRIGYKKGSYITPEDTNQIINNLYGTGFFNSVDLYRKGSNLFINVKERPIIAGFS
                     FSGNKKLSKDNLEKVFTDAGIYVGNVYNPNTMFLLKQSLLNQYSMMGLYGAKIEENIR
                     KLPNNRIDINVNFQEGKPAIIDSINFVGNKSFADSDLDSSVAFEVPSIWNLWGFLAPF
                     DSYSPDGMNQSVQGLTNYYLDRGYLDFKVTSKQASMSKDREHSYITFDVAEGQIYKVG
                     SVSLTGKFILPKSELESLVKIKQGEVFSKSKLVQTVEGIKTLLGSKGYAFATVNPIPT
                     VDKDNHIVSFKIVVDAGKKVYVNRINFFGNNVTNDYVFRRQLQYYEQSQYNKEAIDKS
                     QRRLEQLPYVGAADMELVPVAGSDDLVDVNYNIKERNANSISGSLGFSDLYGFMIGGR
                     LNMPNVFGTGNTFNLNAQLSIPFQQLDISYIDPFFTTSGVSQSISAYINRSNFAKTNA
                     VAAYQLDTIGARLMYGVPISTFSNVSGGITFANNTVKQSDGYQSSIVQWFIRQQGGRN
                     NFNEPALTAGWSYDNSNKYIFATDGGSFNLNGSVNIPVISNINAYKIEVGGTYNIAVP
                     NTDMSALTIRAGVQYGGGYGKTKQLPFYENFYGGGWGSVRGFLQGSLGPRDINLVNGE
                     VGNSIGGNLNIYNNYDVLFPVPFIKDSSKMRIGAFLDIGNTYTIYNLNGVVAPQPKQE
                     TTPSFSNLKYSVGVEFRWASPMGPLAVSFAQPFNVQKGDITQVFQFSLGQNF"
     gene            365473..365976
                     /gene="ompH"
                     /locus_tag="FTM_0326"
     CDS             365473..365976
                     /gene="ompH"
                     /locus_tag="FTM_0326"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein OmpH"
                     /protein_id="ACD30379.1"
                     /translation="MKKIALSICVLVSAFTAAYADTKIAVVNPVEIFNDSDLGSVSVK
                     KLENDLKPDATKLKQEQDNIMQQMKTLQDNSATMTKSELDKKQQQIQQEQQNFAEKAR
                     ILQQKEYTAKDKLSKKFQASFDKAVQTIAKQKNYNVVLTTQALAYVNNVDDISSQVVE
                     LMNKDSE"
     gene            365995..367008
                     /gene="lpxD1"
                     /locus_tag="FTM_0327"
     CDS             365995..367008
                     /gene="lpxD1"
                     /locus_tag="FTM_0327"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-(3-hydroxy-fatty acid)-glucosamine
                     N-acyltransferase"
                     /protein_id="ACD30380.1"
                     /translation="MYSLDFLASKLDGEVKGDKNVEIKKIATLSQAGEGDISFCTNPK
                     YLKALSETKASAVLITEEVLEFCNTNAVVLSNPYMALAKVMELFDKSPRPDGKIHSKA
                     VIAASAIIGENVTIGANAVVGENVVIGDDVYIGACATIDNGTKIGNDTLIKSNVSIAH
                     DVVIGTGCIIHQNAVIGCDGFGNARDEDGSWTKIPQLGRVIIEDDVEIGSGTTVDRGA
                     IDDTIIKKGARIDNLVQIAHNVVIGRNTALAGVTAVAGSTTIGDNCLIGGQSAITGHI
                     SICDNTIIGGASNIGKSITKPGMYYAAFEAKPRIQWGRFVAKLAKIDTLITKVKQLEE
                     KIK"
     gene            367023..367514
                     /gene="fabZ"
                     /locus_tag="FTM_0328"
     CDS             367023..367514
                     /gene="fabZ"
                     /locus_tag="FTM_0328"
                     /EC_number="4.2.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-hydroxyacyl-(acyl-carrier-protein)
                     dehydratase FabZ"
                     /protein_id="ACD30381.1"
                     /translation="MSQFNQNNKQIDVMGIRKILPHRYPFALLDKIVDWSVEDRTIVA
                     QKNVTINEDFFNGHFPDFPVMPGVLIVEAMAQATAILGELMAETLFAHVVEKAGGGRR
                     TFMLAGIDKVRVKRPVVPGDVLVIESRMVKQKNIICTAESVAKVDGQIVCSAELMAAY
                     KDY"
     gene            367517..368296
                     /gene="lpxA"
                     /locus_tag="FTM_0329"
     CDS             367517..368296
                     /gene="lpxA"
                     /locus_tag="FTM_0329"
                     /EC_number="2.3.1.129"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine acyltransferase"
                     /protein_id="ACD30382.1"
                     /translation="MIHSLAVVHESAKIADSAIIGPFCVIGKNVVIGENTELKSHVTI
                     GDNAVIGKNNRIFQYASIGDDPIDYTYKKGDFSQVVIGDNNIIRECATIHGGTAKEIG
                     VTSVGNNNIIMCYVHIGHDCKMGSYINLVNGVGLAGHVHIDDYAILSSNVGVHQFCRV
                     GKHAFIAHAALVGKDVPPYLMVTAVNAGSTPCGINTEGLKRRGFTPEEMKKIKEVYKV
                     LYRKGLMMKEAFEIIKAMAKEDKVLEPFVDVIGTSRRGILR"
     gene            368296..369438
                     /gene="lpxB"
                     /locus_tag="FTM_0330"
     CDS             368296..369438
                     /gene="lpxB"
                     /locus_tag="FTM_0330"
                     /EC_number="2.4.1.182"
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A disaccharide synthase"
                     /protein_id="ACD30383.1"
                     /translation="MRIGIVAGELSGDQLGGTLVEALKQKYPNAIIEGIGGPKMAAAG
                     FKSLYPMDALSLIGFLEIISKGLRILSIRRKIINYFKQNKPDIFIGIDAPDFNLTVEK
                     ELRSAGIKTIHYVSPKIWVWREYRIKKIRKATDKILAILPFETEYYKNRHKFEAIYVG
                     HPLAKNIPIHIDRAKYRDKLGLKGSSLPILSVLPGSRTTEVSRLLPLFLLALQKLVDA
                     GYKFKAIMPLAKPSLKPLFAKYKEQIDSLGIEVFETNSHDVLKASDLSLLASGTATLE
                     AMLCKLPMVVGYKLSWLSALIGRMLIGNHSYWAFPNILHKNEIIKELIQEDCTVDNLF
                     SELKRLFDDKRRNDYIVEEFEKIHKEMVIDTESKIIQVLDTMIEKS"
     gene            369497..370084
                     /locus_tag="FTM_0331"
     CDS             369497..370084
                     /locus_tag="FTM_0331"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30384.1"
                     /translation="MTLILALVLVLVVLIIIDLYRKSLRLKQVEILRNIEQNNAQELI
                     TQAKSFPEYAANIENVQQEYPLLRDGFLLLYFEAIEPIQVKDLATFLKYYGIKYTDDK
                     AFQKVNYKDVIFSILPDNQEQEFSSATDGSVTGIIAVMNYRKLASMDYDVKTCYELML
                     DILEALAKAFHGTLMNEHKVRLTKKDKQNYLAAIL"
     gene            370175..370549
                     /locus_tag="FTM_0332"
     CDS             370175..370549
                     /locus_tag="FTM_0332"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30385.1"
                     /translation="MEYKYHHIGIPVTEPRPGERYSPSMDMYTSGGELPGRVQYHRFG
                     SKCSLDKLIQTMPHIAYKVSDLDQTIKDKNILLKPYFPIEGFRIAIIEENGAIIEFIE
                     TDLSDEEIWDKPNLKNSILYPS"
     gene            370840..371975
                     /gene="bglX"
                     /locus_tag="FTM_0333"
                     /note="glycosyl hydrolase family 3; frameshift"
                     /pseudo
     gene            complement(372206..372282)
                     /locus_tag="FTM_0334"
     tRNA            complement(372206..372282)
                     /locus_tag="FTM_0334"
                     /product="tRNA-Met"
     gene            complement(372346..373155)
                     /locus_tag="FTM_0335"
     CDS             complement(372346..373155)
                     /locus_tag="FTM_0335"
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase 2"
                     /protein_id="ACD30386.1"
                     /translation="MKVLSQEERQKLFLENIFPYKHKIPRNVYEKQKHYLQIELLKFQ
                     KWVKENNKKVLIIFEGRDAAGKGGTIKRMMEHLNPRGAKVIALEKPSEQERNQWYFQR
                     YIEHLPSGGEIVLFDRSWYNRAGVERVMGFCTEREYFLFLEQAPQLEKMLVDSGTMII
                     KFWFSVSQQEQKNRFAARESHPLKQWKLSPIDKASLDKWDDYTEAKERMFIYTDKPYA
                     PWVIVKSDDKKRARLNAIRYILNNVDYDNKDHEVAIPPDPLIVGTSSKIYK"
     gene            complement(373225..373989)
                     /gene="pcs"
                     /locus_tag="FTM_0336"
     CDS             complement(373225..373989)
                     /gene="pcs"
                     /locus_tag="FTM_0336"
                     /codon_start=1
                     /transl_table=11
                     /product="(CDP-alcohol) phosphatidyltransferase"
                     /protein_id="ACD30387.1"
                     /translation="MQVQTIQKIYAWLVHLFTSLGAVFGILAIIFSIEAAKTVVLGQT
                     DLHHYYIKLSMFSIIMAIFIDSIDGSLARLVDIKKLAPIDGALLDNIIDFTTYSIVPC
                     IWIYVSAVVSQQWLIPIIIMITISSSYQFCQLNAKTDDYFFVGFPSYWNVIVMYMLCF
                     QSNQLINEIMITILSIFSFIPIKYIYLSRTEHISKSKLVKIFTFIFTMLAAIATFLAV
                     LLYPLKTPTPLVTIILVFTIFYIIFSLKLNIKPVKS"
     gene            complement(374037..374918)
                     /gene="ispA"
                     /locus_tag="FTM_0337"
     CDS             complement(374037..374918)
                     /gene="ispA"
                     /locus_tag="FTM_0337"
                     /EC_number="2.5.1.10"
                     /codon_start=1
                     /transl_table=11
                     /product="geranyl diphosphate synthase/farnesyl
                     diphosphate synthase"
                     /protein_id="ACD30388.1"
                     /translation="MSSENIIKDFEIFAEKVFDQLNCVSKTLLSAMHYSFFSGGKRIR
                     AQFVYAIGEALAIDKSNCDKIAFAVESIHTYSLIHDDLPAMDNDTLRRGKPTCHIKFN
                     EATAILAGDALQALAFEILQDINYSDIDKLKKINKLFAQYCGASGMVGGQQLDIEGEN
                     KKLKIEELQILHTNKTAKMFRVCIVLPYILSQNQNSQIEDLLVRLSDLIGLCFQIKDD
                     ILDVTKTTNELGKTSAKDIDANKSTYVSLMGLKDANKYLLDKKNEITQIITKLKNNNF
                     SSTSLENLIDLVINRNC"
     gene            complement(374915..376210)
                     /gene="kdtA"
                     /locus_tag="FTM_0338"
     CDS             complement(374915..376210)
                     /gene="kdtA"
                     /locus_tag="FTM_0338"
                     /EC_number="2.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic-acid transferase"
                     /protein_id="ACD30389.1"
                     /translation="MEHLKKFFYVFLAHIYSSIFITLIPILYLKKFKRSFKNINYRKR
                     WAERFAQIPIRLNSSIWIHSVSVGEAVSAEPLVKELLKNFPNENFVITTTTPTGSDVV
                     NSLYSNYPNVHHMYIPYDVIPFINSFFAKTNPKIFIIVETEIWPNILNKCFAEKVPVV
                     ITNARLSKKSMRNYTKIPFAKEFLFKNISHINAQTEKDAKRFYSLAVDKNNISVTGNL
                     KYNLITPENLENKMYSLKDSLKGRPVWIAGSTHQGEEEIILEAHKQILKIHPDCLLIL
                     VPRHKERFQKVEKLIVYNSLKYQKRSSFECQIFSDTQVYLGDTMGELLHLYYIADITF
                     VGGSLIDNGGHNLLEPAALAKPILSGPSLFNFSQISKELIRNKALIRIRNQQEIANNI
                     LKILEDKQLLQQMSSGALKTFKSHSDVLEKQYNNIVKFL"
     gene            complement(376315..376893)
                     /locus_tag="FTM_0339"
     CDS             complement(376315..376893)
                     /locus_tag="FTM_0339"
                     /codon_start=1
                     /transl_table=11
                     /product="RgdB/HAM1 family protein"
                     /protein_id="ACD30390.1"
                     /translation="MKEIVLASSNKGKIREFTNIFKQKNIKILPQTDFNVPDADEIGL
                     SFIENAILKARNCAKHTGLPAIADDSGLEVFSLNGEPGIYSARYSGEHGNDKANIQKL
                     LAKLTGNDNRNARFVCALAYVKHGFDPAPILAYGFLEGKIAHKISGSNGFGYDPIFIL
                     PQLQKTLAEISETDKNKISHRAIALDKIMQLL"
     gene            377000..377797
                     /gene="proC"
                     /locus_tag="FTM_0340"
     CDS             377000..377797
                     /gene="proC"
                     /locus_tag="FTM_0340"
                     /EC_number="1.5.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="ACD30391.1"
                     /translation="MKICFIGGGNMAAAMIAGMTSHGYKSQDIIVFDRNEHKCLNLIK
                     KYNINTSTSLLNTIKLADILILAIKPQNMFELIKNIRDTVTSTQVIVTVAAGIQTSAY
                     EELFNKEISFARTIPNTPSSLGYGATGIFFNKVIAADKKDLVIDIMQTMGVVTVVEDE
                     KEIDIIAAIASSGPAYYFQFMEHMVEAAIKQGLDKKQAEKLVVQTCLGAAQMALNTNE
                     NMSELRKNVTSKKGITYEALNIFEQFNLGGIVDKAIQASTAISYRIY"
     gene            378036..379122
                     /locus_tag="FTM_0341"
                     /note="conserved protein of unknown function; frameshift"
                     /pseudo
     gene            379560..380246
                     /locus_tag="FTM_0342"
     CDS             379560..380246
                     /locus_tag="FTM_0342"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator"
                     /protein_id="ACD30392.1"
                     /translation="MRILLAEDDLHLGEGLLEALQKEGLIVNLVSDGEAAQTFIESGL
                     YDIVVLDIGMPIKTGLEVLRNIRNRGIKVPIILLTARDGLEDRIKGLDLGADDYLTKP
                     FELKELVARIKAISRRIDTRSGKSVNEEIRFGDYSFNPSSETVTKDGVIIPVSKKELA
                     LLAILVQNAGRVVPKTQLLEEVYSTDKEMDTNTLEVHMHNLRKKINIPNFIQTIRGVG
                     YFVQKDKVIK"
     gene            380251..381114
                     /gene="lepB"
                     /locus_tag="FTM_0343"
     CDS             380251..381114
                     /gene="lepB"
                     /locus_tag="FTM_0343"
                     /EC_number="3.4.21.89"
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase I"
                     /protein_id="ACD30393.1"
                     /translation="MEILNYILNLGFTFWLLFLTIASGLIYIIDFVFFQKSRLAAYTD
                     ELKGLSKKQKRQFYKDRGLKAPFIADQARSLFSVFFVVFLLRTFLIGNFLIPTASMTP
                     TLPVGDFIFVNKTAYGIRAPFTNETLIKVGEPKRGDIVVFHFPVNPNVDFVKRVIGLP
                     GDVISYKDKMLTINGKKLEYTNCNRDAMNYYNQSLAAGSGDTVCTENLDGVKHEVDWI
                     QSIKGTDFENLKVPAGQYFVMGDNRDNSEDSRYWGFVPDKDLVGKAKVVWMSWDKIDK
                     KVRWDEIGKVF"
     gene            381121..381813
                     /gene="rnc"
                     /locus_tag="FTM_0344"
     CDS             381121..381813
                     /gene="rnc"
                     /locus_tag="FTM_0344"
                     /EC_number="3.1.26.3"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease III"
                     /protein_id="ACD30394.1"
                     /translation="MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGD
                     SVLSFVIAEVLYKQFTDLAEGKLSQLRSKLVKGTTLAQLASSLKMDEYIILGASEQGG
                     HKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPIISSINLDTIKVKDSKSKLQE
                     ILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAEQKTAEKMI
                     EMLSQQGLHEKK"
     gene            381800..382708
                     /gene="truB"
                     /locus_tag="FTM_0345"
     CDS             381800..382708
                     /gene="truB"
                     /locus_tag="FTM_0345"
                     /EC_number="5.4.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="ACD30395.1"
                     /translation="MKKNRLNLNGVVVINKAKDISSNKVLQQLKYLFNAQKAGHTGTL
                     DPMATGVLPICFGRATKIAQYLLDADKEYIATIRLGIETDSGDAEGEIIAKSINIPEL
                     SAEYLETVLAKFRGDVVQIPPMYSALKYNGQPLYKLAREGKTVEVKSRNIKIYELELL
                     EFNIDSLKIRVKCSKGTYIRSLAIDIGKTLGCGGHLIALQRTQSGPFKLSEAFRLEQL
                     KDLSFEQKIASITNIESVFIDKPIYSLLEEEKDDLYKRGLFADKPHLDGTVRIYDVEK
                     FVAIAEFDKGKLINKKFFDLDILISE"
     gene            382701..384998
                     /gene="rnr"
                     /locus_tag="FTM_0346"
     CDS             382701..384998
                     /gene="rnr"
                     /locus_tag="FTM_0346"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease R"
                     /protein_id="ACD30396.1"
                     /translation="MSKYSIHNDPNKDIEAQKYENPIPSRKVILNYIRDVKLPVSIEN
                     IANALEIFKKNLFEGLVNRLGAMVRDGQLEKDRSYYNLPEMAPIYITSKVTADRDSRL
                     ELFSHTLNTKVGIVSHQAKMVMVGDEVTAKVLGLNKRGRIDAEIKTIVTRAQKTVTGY
                     YYKSFDCDFIKPISKSIISDIVLLPPKQKIEHNSLIEAEIIVYPSISSAAVAKFKQEV
                     EAVSPVKEAMMMTTQKYDLIEQWSKKALRYLDNISDDVVVGNRVDLRNQHFVTIDGED
                     AKDFDDAVYAHKTKSGSWKLYVAIADVSNYVEKDSALDLDAKRRSTSVYFPGYVIPML
                     PEKLSNGLCSLRPNEDRYSLVCEMNISKEGKLSRYKFYSAVINSKARLTYTEVAKLLE
                     KKQNTIVENTPELVPNIFDLYELYKVLHQARQERGAIDFDTVETQIILDEHNHIESIV
                     PRHRNDAHRLIEECMLVANVAAAKFTIKHKKTSPFRVHSEPKEDRMETLKKYLAKHGI
                     HLAHGKDGKVTPKALAQMLDSIKDRPDYDDIQMMTLRSMNQAVYSINNDGHFGLAYSE
                     YTHFTSPIRRYPDLVVHRIIKSIIGEYEHGAADYKPSELANICENASDQERNADAASK
                     QVENWLKCYFMQYYIGHILEAQIKHVNGLGLFAELKDMYIEGLIHVSAIPGDYYIYDE
                     AKDILIGKRTHKVYKIGQDITVRVVRADLERIHIDFELYDPHKPFAENSSDKPFAKKT
                     KKLKKAKKKKVRSRKKNKTKAKLAH"
     gene            complement(385022..385441)
                     /locus_tag="FTM_0347"
                     /note="stearoyl-CoA 9-desaturase; An in-frame deletion of
                     137 aa inside gene compared to F.novicida and SCHUS4"
                     /pseudo
     gene            complement(385455..386198)
                     /locus_tag="FTM_0348"
     CDS             complement(385455..386198)
                     /locus_tag="FTM_0348"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="ACD30397.1"
                     /translation="MQKFVGKTIWIIGATDGIGKAVLKKLDNSIQADLIISARSLDKL
                     QNIAANLKNTAHVLSFDVADFAEFEKVAASALNYKPDFIIYFPAFYEPSLIADIAIAN
                     LNKTIQTNLTAVFYLIRFVLTFLKKNPHCQLAITASVAGYIGLPRSQPYAATKAGVIN
                     LVESLKTENPELDIRLINPSFVKTKLTDKNNFKMPSLLKPEQAADSIIKGLQTSKFEI
                     HFTKKFTIILKLIAALPYKLYFKIAKKMI"
     gene            complement(386200..386705)
                     /locus_tag="FTM_0349"
                     /note="conserved hypothetical protein; frameshift"
                     /pseudo
     gene            complement(386781..387254)
                     /locus_tag="FTM_0350"
     CDS             complement(386781..387254)
                     /locus_tag="FTM_0350"
                     /note="frameshift compared to novicida makes this ORF 15
                     aa shorter"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30398.1"
                     /translation="MLRKLLIIIFISLPLFGVAEELTLQQIKSQQSQQVGKVHFSKWF
                     FDVYDAELYSENGHFSWDKPFLLKIHYLRSFSGKNIANHTVKEIAEQHPQLAHTTLDK
                     YKEIFTRLMPDVKNGTNLYGYMDKDGNGYIYSDKGLLGEIPNKTLSKYFFEIWLS"
     gene            complement(387247..387900)
                     /gene="cfa"
                     /locus_tag="FTM_0351"
                     /note="cyclopropane fatty acid synthase,
                     methyltransferase; IS insertion"
                     /pseudo
     mobile_element  complement(387905..388655)
                     /mobile_element_type="insertion sequence:isftu1"
     gene            complement(389350..390124)
                     /locus_tag="FTM_0352"
                     /note="conserved hypothetical protein; frameshifts"
                     /pseudo
     gene            complement(390118..391371)
                     /locus_tag="FTM_0353"
                     /note="NAD/FAD-binding protein; stop codon"
                     /pseudo
     gene            complement(391448..392485)
                     /locus_tag="FTM_0354"
                     /note="two-component regulator, sensor histidine kinase;
                     stop codon"
                     /pseudo
     gene            complement(392469..393158)
                     /locus_tag="FTM_0355"
     CDS             complement(392469..393158)
                     /locus_tag="FTM_0355"
                     /codon_start=1
                     /transl_table=11
                     /product="two component response regulator"
                     /protein_id="ACD30399.1"
                     /translation="MSDNPKVLVADDDKKIAQFIKTKFEENGIDTTVAFDGKEALFLI
                     NTNNYDVIVIDWMMPYLDGISLLKILRKQNINTPVIILSALDSTENKIEGLKSGSDDY
                     LTKPFSIDELIIRVNILYKRTKQITEAQTHKLSCGDIVLDELAHEVRRNRELILLQQR
                     EYKVLHLLLKHKNEVVSKTMILKEVWDYDFDPQTNVVEVHISRLRNKLTEGGLSDPIK
                     TIRGFGYVIQE"
     gene            393301..393840
                     /locus_tag="FTM_0356"
     CDS             393301..393840
                     /locus_tag="FTM_0356"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30400.1"
                     /translation="MKRIIATILGLTVVSGVYADSYTMYAKPDTKSPKLATIDDQDPN
                     YKAIFSKGEWIEVVDNKDGSVGWVKQKPQDKTSQAISKDPIEQMMANFQKQQQLLDQH
                     FNKILANIDQNIAQMQQAQPNSTKAKNNPQVLKKFSSITINSDGKTAKIVKKTEDGNG
                     NIQTVEKEIPADQLGTIKL"
     gene            393958..394359
                     /locus_tag="FTM_0357"
     CDS             393958..394359
                     /locus_tag="FTM_0357"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30401.1"
                     /translation="MYEEQFLAEKLQQFSLLDIALVKIVYFLVGLLVATNYIVLTSVS
                     WIFYLLMFLIAVFPIVIHLFSFEGSYIQKARKYLKTNKPSYQVLLFFSMFFFACTLAV
                     LIPALSLVPWYVYLILIVIFAIKPMRSNMFW"
     gene            394534..395142
                     /locus_tag="FTM_0358"
     CDS             394534..395142
                     /locus_tag="FTM_0358"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein, putative"
                     /protein_id="ACD30402.1"
                     /translation="MKKKLLFITISASLALALSSCGKTTVAYEDPNGVDTTSINFSST
                     DLQAITNKMAEDMLNSPAVKRITAMDTPTLFFSNIRNETREHINTTMLSNTAQTQIIK
                     SGLFQVTDMSQIKNVREQLGYQANSGMVDQATATKIGQHIGARYMVYGSIQDIDNTNV
                     DGDKRSKFFLATLKMMDLKTGLVVWQDDKQIRKSQTKSTFGW"
     gene            395199..396629
                     /locus_tag="FTM_0359"
     CDS             395199..396629
                     /locus_tag="FTM_0359"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30403.1"
                     /translation="MKKKILTSLIASSLLAISLFPADATVVDSKTTQQQTQAKVDMGA
                     DVANLNNAISTDSKPVATTSQDKRSAEEILNDVMENYIDQNNLRDRYDYVGSAIGTAS
                     VNQTNSNYVDSAQLAFEKALIKAQAEYISFISANTKVDKSLNIDSTQGSTANEIDTDA
                     DKPKQGTQAAIDAKQKALDEAKLDNQLKEQGLNPNDFATPEEKKKALLSQQMTIKSLT
                     TGFGNLSGLLPIKTFVVEKDGNAAIGVVVIYSDKIKGMFEDIKHGNEPVIVGKGGQSP
                     SDLYKDKSGEDMMGDYGIRVGFGEDNKQYILAYGQGSYNGPSIQGVSAGDYGYKQAAI
                     MARANLVTLIAGQMSTQEALTMSEDISSTLAKNTKTQQTRRIDATDIEKTLSTYYKTK
                     ANLDIVGLKTVKRWRYKLPGTENIVYGVVLKWDPKQVATANKIKNFSYDEYRKQNTQN
                     TESGQSSLNGKVIIRQSDDNKYLNQY"
     gene            396640..397623
                     /locus_tag="FTM_0360"
     CDS             396640..397623
                     /locus_tag="FTM_0360"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30404.1"
                     /translation="MQKRLITFLVSSMSFMTATGVATQNNLADTNMLSGSTVISSASS
                     ILSSASSTYKGVDERSKLKMFRVAILPFDTKGAKIDGDIDQEQLQSGLNDSIVAQITQ
                     SRKFRVSNRDVNDEKAYESEIKRILNSNTDNDKGMLNQKIGADFILTGDILNLNITKN
                     KTSYYGEDFTTLNVSATVAYRMVELATMEVKWSNVVTIEVPTNIANQYANADDANYMQ
                     LLSYLGKQLGKTISDQVIGAICPLQVLKVDDGEIYFNQGGDRIIKGSVYEVRQDGGVT
                     LDPATGQHIVLDSKVLAKIKITDVMPKYSIGIVIDGSLAKVQPGLRAYLTK"
     gene            397629..399023
                     /locus_tag="FTM_0361"
     CDS             397629..399023
                     /locus_tag="FTM_0361"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein, putative"
                     /protein_id="ACD30405.1"
                     /translation="MKTKSYSLLLLLCGVISSCTTFSGSHPDKVDNAKKAIETCQYKP
                     TETKFIKTFDNDGVDAAIGFLETGRFEQLISNTTLSQKKYTKATDYVAKSEAEAKIRV
                     RNILKDTQATLLSDKERYYYITDYEITFLYAYQALNYLKQHDLENAAVSIRNLSYAQY
                     ATFQAKDLATQTRDTNYQELSHVNSRQISSNISNSKQYRQLATIASRVRNSYENAFGY
                     YLEAIIYQSYDTDLNNANLSMSNAFRVVPDNPYVSADYQQIKKAFDSGGNIYPQDQGK
                     LVIIYESGWVEPLKKFDIPKTIFFQQAGVQKISLPYYGSYNLAQNADIQIFKDNKLID
                     HGKSALLVDTTAMAAKSLSDQYPAIVTREVLRLVTKTAISVAAIRSSGDYAALAAIGT
                     SIYNLATTEADQRSWNLLPKNVDLFSKNLAVGKYTLKINNKSTTVTLQPQKITLVWLT
                     KEGCYEQILLNQVL"
     gene            399163..400077
                     /locus_tag="FTM_0362"
     CDS             399163..400077
                     /locus_tag="FTM_0362"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30406.1"
                     /translation="MNKYIANTVVMVEPKYFCFNQETSVNNAFQNQLDISNDELQNRV
                     IHEFENMVAKIRANGIEVIVLESKPNTPDAVFPNNWFSTHLIDNQPYVFIYPMYTQNR
                     RNEVQVDKLLEQLNKLTTTNYKVIDLRGDYSKALEGTGVFIFDHEFKTAYMSLSPRAD
                     AQLAQQVCDKIGYKLVTFTSYDKKGPIYHTNVMLSIGEHLAIVCLESIKSAIERELVI
                     KTLQQSNKQIIDISLEQMYQMCGNVLEVKNKADKSFLILSQTAYNGFSQSQLALISKY
                     ATPIACDITNIEVVGGGSARCMLAEVFL"
     gene            400325..401338
                     /locus_tag="FTM_0363"
                     /note="ornithine cyclodeaminase, mu-crystallin homolog;
                     frameshift"
                     /pseudo
     gene            401409..402824
                     /locus_tag="FTM_0364"
     CDS             401409..402824
                     /locus_tag="FTM_0364"
                     /EC_number="2.4.2.12"
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinamide phosphoribosyltransferase"
                     /protein_id="ACD30407.1"
                     /translation="MSFDNLLLMTDSYKHSHRYQYPRDTHYLHFYLESRGTANKDLGN
                     YTKFFGLQYYVKKYLSQPITQQMIDDAEKILLAHGLPFYRSGFEKILNNYNGYLPIRI
                     RAVREGSLIPLHNVLMTIESTDEELFWLPGFVETLLLKVWYPTTVATISFNIKQLIKR
                     YLLETADSLDKLDFMLHDFGYRGVSSEESAGIGGAAHLTNFLGTDTLAALHVCKEFYA
                     EDMAGFSIPASEHSTMTSWGVGTECEREAFENMIAQFGDSSVLYACVSDSWDFKKAIQ
                     TWVDLKDRVTAKKANLVIRPDSGDAVDNILYALYELDKGYGSRLNSKGYKVLNNVALI
                     QGDSVSISLAKKVLEAMKIQGYSAENIAFGMGGALLQGNYESSINRDSFKFAIKCSAI
                     MRGNTLIGVKKEPITDLAKKSKQGRLDLIKDAKGNYKTIVLDDSYALGEYHPESQLQT
                     YYDNGEIKFEQSLAQIRNYTN"
     gene            403285..404409
                     /locus_tag="FTM_0365"
                     /note="sugar porter (SP) family protein; frameshifts"
                     /pseudo
     gene            complement(404402..404890)
                     /locus_tag="FTM_0366"
     CDS             complement(404402..404890)
                     /locus_tag="FTM_0366"
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase family protein"
                     /protein_id="ACD30408.1"
                     /translation="MINLDDYKPIDFPWNFTCFSDIAKNPLGVKLPLYHIGEHMYTKF
                     KCLPNHVGWDNVIHGGIIALICDDILGKHVLSISKSFCMTRNLNIKYLKPTYSKVEHI
                     FKTTVIRKGRTTVWIKVDIFNEKGDLCAYADADFALLEEHHAKQKDIANYKLDDLVAH
                     LK"
     gene            complement(404952..406139)
                     /gene="fadA"
                     /locus_tag="FTM_0367"
     CDS             complement(404952..406139)
                     /gene="fadA"
                     /locus_tag="FTM_0367"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="ACD30409.1"
                     /translation="MSENVYIVAAKRSAVTKGKKGGFAKKRPDELLADVLRRTVAEAN
                     INPNDIEDIVVGCAMPEAEQGLNVARISSLLAGLPNSVPAFTINRYCSSGLQSIAIAA
                     NEIAQGNIDVAIGAGVESMSMIPFGGNKMSFSKEIFAKDENVAIAYGMGITAEMVAKD
                     WNVSRQDQDAFALESHQKAIHAIESGYFKDEILPIDVDHNKPDEATGEIINHKQTITE
                     DEGARKDTSLEALAKLKPAFANGGSVTAGNSSQVSDGAAAVILVSEKYLKEHNLKPLG
                     KFLGFAVAGVDPRIMGIGPIKAIPKVLRQTGLNIDDIDWIELNEAFAAQSLAVINDLK
                     LDKNKVNPCGGAIALGHPLGATGTILTVKALHGLQRTSKKYAMITMCIGTGMGAAGII
                     EAC"
     gene            complement(406152..408848)
                     /locus_tag="FTM_0368"
     CDS             complement(406152..408848)
                     /locus_tag="FTM_0368"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional protein: 3-hydroxacyl-CoA
                     dehydrogenase/acyl-CoA-binding protein"
                     /protein_id="ACD30410.1"
                     /translation="MTELEKKFEEMLIAVRDATIDFKPDNSQKLKLYAFYKQVKEGDN
                     NTKKPSALKMVERAKWMAWDAIKGMSKEDAMRGYLRVFGEEYLPAGESDNDSPSSTIA
                     SKLEPVESKSQRKAIDKIAVLGAGTMGAQIAAHFANAKFPVVLFDLKSQQGSANVIIE
                     DSLAKLTKLNPAPFGSKDSIKYITPANYEYNLELLADCDLIIEAVAERIDIKESLYTK
                     ISSHIKENAILASNTSGLSITKLAQVLPENLKVNFCGVHFFNPPRYMPLVELIPHADT
                     NSEILDKLETFLVEKLGKSIIRAKDTPNFIANRLGVFSMLVTCYYTEQMNIPLEVVDE
                     LTGKKLGRAKSATYRTADLVGLDVLSHVVETMKDNLEDGWQKLYNTPNWIQNLINNGS
                     LGQKTKKGLYIKASDGIKVLDLGTNEYRPADKKADKEILDILAERDWSKKLEGLRNSD
                     NHQAQFLWATFREMFLYAAHLVGDISNFPKDMDLAIRWGFGWKQGIFEIWQLAGWHKV
                     ASWLKDDISTGKALSTNTLPSWIDTLDISVYQNNKEFSYKDKELISRDSLDVYKRQLF
                     ADNIVEHTSTLATQTLYENDGVKLWQIDDYSNIGILSFKSKMCAIGDDVLDGISESIN
                     YAEEKLDGLVIWQEQDVFSVGANLEEFGIKFAMNGEAAIEEVIRKGHSIISKKLRYSK
                     IPVVAAVKGFAFGGGCETILHSDAAVAAYESYIGLVEAAVGIIPGWGGSKEMAVRASQ
                     AQDHWKDFERRYKNLALAQVAKSAYEAKEMGFLRDDDIVVMNTKEILLVAIKKAQLMA
                     LAGYQPPLKQKVPVFGETGIATIKALLVNMRDGNQISEHDYKIAVNLADTMCGGQIEK
                     DTEVSEDWLLERELINFKELAISEKTEARMKYMLETGKPLRN"
     gene            complement(408921..411161)
                     /gene="fadE"
                     /locus_tag="FTM_0369"
     CDS             complement(408921..411161)
                     /gene="fadE"
                     /locus_tag="FTM_0369"
                     /EC_number="1.3.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-coenzyme A dehydrogenase"
                     /protein_id="ACD30411.1"
                     /translation="MFNKIYKIAKKATPAISQTEQTALNAGNNWFEQDIFQGKPDFNK
                     LHSLKKFELTAEEKSFLANETTELCKLIDDWKINYQEKDLSVEAWDFIRNKGFLGLVI
                     GKEYGGKGFSAAAHSEIVMKLATKSITAAITVMVPNSLGPGELLVHYGTDEQKDHYLP
                     RLASGQEIPCFALTGPTAGSDATSLPDYGVVCHEEFNGKKTLGIKLKNINKRYITLAP
                     IATLVGLAFQLQDPDNLLGDTGKEGITCALLPYNHKGLEIGKRGFPLGQTFMNGYIKA
                     KDVFIPIDWIIGGQKMAGEGWRMLVECLSIGRAISLPACGTANTLMSAVMTAAYASVR
                     EQFKVPIAQFEGVQEKLAQTAGLAYIANATRQFTVAAVDSGLRPSVSSAIAKYHLTEM
                     GRTTINNAMDIHGGRAIIMGPNNYLAIPYMATPIGITVEGANIMTRNLMIFGQGAMKC
                     HPYIRNEIESLMNDDEEQFTTNFKSHFKYMALNGSRTLWYGLSGGFTAPSYPSKFKRY
                     YRYISHMSTAYSYVNDISITVLGAGLKRKERLSARLGDIMSYLYMAVAVLKYYKDTGE
                     PQSDDIYVDWSIQHCLYQAQQAMLDLFRNFPNRIFATKMKLFVFPYGKKFRRPSDKLE
                     AQICNSLVSNSDTRQWMKDKCYIPNDDNDPIGRVENAYLASLTTQPIKKKIIDAIKTA
                     KLPKASWQNSIDIALENKIITQQEANIAHEMLTKVNNIIQTDEFDDYALGPKNAHLEW
                     QKDTDK"
     gene            complement(411199..412887)
                     /gene="fadD"
                     /locus_tag="FTM_0370"
     CDS             complement(411199..412887)
                     /gene="fadD"
                     /locus_tag="FTM_0370"
                     /EC_number="6.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="long chain fatty acid-CoA ligase"
                     /protein_id="ACD30412.1"
                     /translation="MITKPWTKNYPKKVPLNIDIPDITLKDMLEEATKTFANKKALSC
                     HGEKLNFSEIDSYADKFAGFLQNKWKLRKGDHIAIMLPNLLQFPIIIFALVKLGCVFV
                     NINPLYTSREVKGILQDSKAKGVIVLSGLAHNVEAIADECKDLKYKMVTGIADLYPMP
                     KKQIISFVVKYIKGMKDKYSKDKFDSFTDAIESSHTPDYSSIGLKPDDIAALQYSSGT
                     TGTPKGTILLHKNIVANIYQIKAWTEGFDIELSEQIVLTALPIYHIFSLTANLFLFYC
                     FGAFQILIPNPKDIKSLVAEMRKSNFSTIFAVNTLYIALLNNKKFRKSNFSNFKLSIS
                     GGMSTSEAVANEWKKVTGVNIKEGYGLSEMSPVVTVNSLEDSDFNGSVGFPLPNTDVK
                     IYDDKGNELPQGETGEIWVAGPQKSPGFWSLPEINKEHFTDDGWLKTGDMGYLDAQGR
                     LVISGRIKHMIIVSGFNVFPKEVELVLTEREEIEDAAVIKGHSNETGEMPVAFVVLKN
                     DKKLTEKEIFKYCETKLAHYKLPRKIIFTDELPKNTVGKIDVNALQKEYAEKYE"
     gene            413031..413450
                     /locus_tag="FTM_0371"
     CDS             413031..413450
                     /locus_tag="FTM_0371"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase"
                     /protein_id="ACD30413.1"
                     /translation="MDYFYDFYTNVIYNCSYSKNIINVMKFYHNPKCSKSRQAKQILD
                     QNNIDYEIHLYLDKPLSKDQVVVLLQKLKLSIRDIIRTKENIWKENFSDKEFTEAELI
                     EIVVANPGLLERPIIENGDFAVVARSDEKIQQILNTY"
     gene            413499..415715
                     /gene="icd"
                     /locus_tag="FTM_0372"
     CDS             413499..415715
                     /gene="icd"
                     /locus_tag="FTM_0372"
                     /EC_number="1.1.1.42"
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate dehydrogenase, NADP-dependent"
                     /protein_id="ACD30414.1"
                     /translation="MHKIFYTFTDEAPALATGSFLPIVESFTKVADIELETKDISLSA
                     RILANFNDYLTAEQKCSDDLAILGELAKTPDANIIKLPNISASIPQLTAAIKELQSKG
                     YKIPDYPYEPKDDKEQEIKARYAKVLGSAVNPVLREGNSDRRVADAVKKYAEKHPHSM
                     GEWTKDSKSHVASMSADDFYANEKSYIVPKATKVKIVHIDTKGTQTVLKDNLALEEKE
                     IIDATKISIKALREFYKNEIAKSKKEGTLLSLHLKATMMKVSDPILFGHAVEIFFEDI
                     FKKYAKEFKELGVNPRNGWGDAVEKIKQLPQELQDKINADIEKVFAKQPDIAMVNSNK
                     GITNLNVPSDVIIDASMPAAIRSSGKMWNKDGKLQDMKAMIPDRCYAGVYAATIDFCK
                     ENGAFDVATMGDVSNVGLMAKKAEEYGSHDKTFEIQADGKVEVIDAEGNVIFEHQVEK
                     GDIWRACQTKDIAVKDWVKLVVNRAKITQNPAIFWLDSKRAHDRNLIAKVNEYLTHHD
                     TTGLDIQILSPVEATKYSLKRMKEGKNTISVTGNVLRDYLTDLFPILELGTSAKMLSI
                     VPLLAGGGLFETGAGGSAPKHVEQLIEENHLRWDSLGEFLALGASLEDLAIKTRDAKI
                     KVLAETLSQANKDFLDNDKSPRRKVGELDTRGSHFYLAYYWVKALAEQTGNAELKAKF
                     EPIYIELKANKDKIVKELNDAQGKKVDVGGYYHMDRVKLDAVMRPSKTFNTILAQI"
     gene            415729..416616
                     /locus_tag="FTM_0373"
     CDS             415729..416616
                     /locus_tag="FTM_0373"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30415.1"
                     /translation="MAEIKNDEYIEISLIKILVGLFSNIKTFLVVLVLGCCLTAVAAW
                     LFKPSYSYLQMIQPPYYLKGYSANSIISDNKLNVILNNILQDAQQSQPDNKILNNIDI
                     IKPGDDVYVKSNKDEKAIYFGLSTSAKLSDKGAIDSVFSDVMERFSNSNIVQRQIKLW
                     KDDLQRTILANQQNIDRYKQIIKSDQDYVKQLSSSKNVGSLQGQTLLASYMERIDSYQ
                     NKVFSLEDSQKDLKLTLESLQSKVVGIGNIVYVKNSETSKVKLVVIGLVLSVVIALIV
                     VFLKVIFSRAITEYRNLKQ"
     gene            416640..420908
                     /gene="hrpA"
                     /locus_tag="FTM_0374"
     CDS             416640..420908
                     /gene="hrpA"
                     /locus_tag="FTM_0374"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase HrpA"
                     /protein_id="ACD30416.1"
                     /translation="MSIHIDAFLNQIPTKFRGKFISVINNKNLPNQQLLEQLQVLAEQ
                     TKQKILPKITYPDLPVAERVDDIKKLLQDNQVIVVAGETGSGKSTQLPKICLDLGLGK
                     RGLIGHTQPRRLAARSIASRIASEIGDQSKVSFKIRFSDQTSENTLIKVMTDGVLLSE
                     IKNDRFLSQYEVIIIDEAHERSLNIDFLLGCIKKILPFRPDLKVIITSATIDHQKFIN
                     FFQNAKDIIISGRTYPVEIRYQNDEDFDEFSLQERILYALDELGRGDVLVFLPTERDI
                     HETLAYLNKQNLRFTEVLPLFSRLSNKDQNKIFNPEGSVRRVILATNVAETSLTVPRI
                     KYVIDSGLARISRYSYRTKVQRLPIEKISQASANQRAGRCGRLSAGICIRLYSEEDFN
                     NRKEYTEPEILRTNLASVILQMLFLKLGSIQDFPFIDAPDARFVKDGFKLLFELQAIS
                     ELNYSKPKITDDGMKMAVMPLDPKLAKIVIEGYRQKTLREIVSIVSFLSVQDPRERPL
                     NLQQKADEKHSVDKDKSSDFVAILNLANRLNSDLKGLSNREKKEYFKKNFISSVRFNE
                     WNDIYRQIIEVIHGFGWKLNSQLVIKKDSGHSGLDPESFEHIGKSHDNEILKQVHNDR
                     QILTNSSNIKINRHSHESANLIANDQNLKDTRLHVYDNGSAMINYENLHKAIASGFLS
                     NIGYNYENAEYLGARGLKFFIFPGSSQFKAKPKWLLSSEIVETTKTYARNVAKIEPEW
                     LESLASHLVKKHYDEPVWSKKRRAVIVNERVTLYGLEIVSKRVVQYSKINPREAREIF
                     IREALVKGDFDSKTYFYQQNLKLINQVEDLENKSRRKDILVDEQTMFEHYDAFIPDEV
                     CDGATFDKWLKTVRKAQQQKFIFGLESLMQHGAKEITQQKFPDVLTIGDMHLPLEYNF
                     DPLDERDGATVTVPIVFINNISSAVLEWGVYGFLYDKIVALLRALPKNIRKNCVPVPT
                     YAQAIFESLDFDKDRYTPLKSVIAKHITRIVGFVVDETVWQNEELEKYLVLNIKVVDE
                     HGKTLALGKDINTLKQKLKNLVNKPKQAVDEKIYYDWDFADIALTNQIKEYGIVVKVY
                     NCLEEYKGGVKLSYKATLAEAQSCMKRALKRLIKIRLQNQLSQKIKNNDLTSLSMSLK
                     LSDSKDNVVDKAIDLSFFDDVISSDLSTEFKKQNSSRNYYENGNLTVNLRNQRDNRFD
                     RHDNKSVITDCDQESSILKHDSKSSETMFSDYAQQSVQDDSNVNLAGLPYTKSDFEQF
                     FKAGISSFVANKTKVELLFTEILRAKEQLDKKLNIKKIPLNFIELFIAVRNELNELFT
                     DNYLSQPMIYLQRYKYYIQALENRLDKAKLNLQRDRNYQLEADELKAKLAKKLVTKHL
                     STGDEEVTKIRFLIKELWISWYLQNIKTSESVSVKKILVYINQI"
     mobile_element  421391..422133
                     /mobile_element_type="insertion sequence:isftu2"
     gene            422409..423092
                     /locus_tag="FTM_0375"
     CDS             422409..423092
                     /locus_tag="FTM_0375"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30417.1"
                     /translation="MNSQQHALDKIAQARQLIVVVTDSWQTKLARLFYFGRKNLSNCI
                     VIKPATAVVIGKNGLAWADSSYLNLAKAPLKQEGDSRSPAGVFSLGKIFGFANKTFTD
                     YIHIKTGIECIDDSNSKYYNRIVNSQQINDKDWHSAENMSEISLYKYGIEVLYNTNPI
                     VPRKGSCIFMHIWKSATIGIEGCTAMAEEDISDIQSLLDSNKNPVLVQLPQHIYHQVK
                     DDWQLPDLL"
     gene            423105..424288
                     /gene="lysA"
                     /locus_tag="FTM_0376"
                     /note="diaminopimelate decarboxylase; frameshift"
                     /pseudo
     gene            424300..425678
                     /locus_tag="FTM_0377"
                     /note="glutamate:GABA antiporter (APC family) protein;
                     frameshift"
                     /pseudo
     gene            complement(425720..426070)
                     /locus_tag="FTM_0378"
                     /note="conserved hypothetical protein; stop codon"
                     /pseudo
     gene            complement(426155..426727)
                     /locus_tag="FTM_0379"
     CDS             complement(426155..426727)
                     /locus_tag="FTM_0379"
                     /codon_start=1
                     /transl_table=11
                     /product="methylated DNA protein cysteine
                     methyltransferase"
                     /protein_id="ACD30418.1"
                     /translation="MLKETHQIYLAAINKKSYKTVFYAQEIQTPIGNLIAVADDDYLY
                     ACFFISDSNIYSIEKLLKIYNAKISFNADNITNQTKDQLNKYFKRELKSFSVPLRLTG
                     TDFQKQVWRELIKIPYGETISYRKEATNIGKPTAFRAVANANGKNLLPIIIPCHRVIN
                     TNGKLGGYTGGLYKKEFLLNLEHSILIHKN"
     gene            426757..427476
                     /locus_tag="FTM_0380"
     CDS             426757..427476
                     /locus_tag="FTM_0380"
                     /codon_start=1
                     /transl_table=11
                     /product="snare associated golgi protein"
                     /protein_id="ACD30419.1"
                     /translation="MITQTMFNSKFYRFLPVVFLIIGIIAFFSFGGQSYLSLNALKEN
                     YQSIIVFANNHFLLSILVFSCAYIIVVALSIPGATIMTLLGGLLFGLLLGSFVVVVAA
                     TVGASVVFFAVKTALGDSLKTKAKGGIEKMRRGFERDVFNYLLLLRLIPIFPFFIINI
                     AAGMFGVKFRDFFWATLLGIIPGSVVYVWVGTSFAYAIQQGDEINLGIILEPQFIVPI
                     VALAILSVVPVFIKKFNKKAY"
     gene            427479..428897
                     /locus_tag="FTM_0381"
     CDS             427479..428897
                     /locus_tag="FTM_0381"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="ACD30420.1"
                     /translation="MIKADICIIGGGSGGLSVAAGAVQMGAKVVLCEGNKMGGDCLNY
                     GCVPSKAIIEASRVIAKVNKAQAFGINIDNNNIEIDYKKVQEHIKTTIAKIEPHDSVE
                     RFETLGVNVIQEYAQIIDQYTVKAGDNFIKARYIVIATGSRAAIPKIKGLAEVNYLTN
                     ETIFDLKEKPEHLMIVGGGPIGVELAQAYALLGSKVTIFEASDTILGVLDNDCRKIIL
                     KEFDRLGISIITNVNISEIAQDDQEINLYCGSKLYQGSHLLIAAGRVPNLDKLDLDNV
                     GIKYTSRGIKVDSRLRTNHKNIYAIGDVVGRYQFTHVAGYHAGVVIQNILFKLPIKVD
                     YNSLPWSSYTSPEVAHVGQNIAQAQTHGAKILKLSYQNNDRAVASLATNGLIKVAINK
                     KGYILGATIVGENASELIVQWTIAIKNKLKIKNMASHIVAYPTLSELNKRLAGNYFIP
                     VLYSNKVRSLVRFLMKIFGKKL"
     gene            428894..429439
                     /locus_tag="FTM_0382"
     CDS             428894..429439
                     /locus_tag="FTM_0382"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidyltransferase"
                     /protein_id="ACD30421.1"
                     /translation="MIEQKIRPVFQRIFVDGIAKFIAPVIAPNLITLISLIVGLVAAI
                     AFFINQYLCIFLLLLSGYFDILDGSVARLQGSSSSFGTILDILSDRFVESFIIIAIFI
                     NQLDIAWVGLLMMMSIIVCISSFLLVGIFSQKESSKSFYYSPGLIERAETFIFFIVMI
                     LFPNIVVVLGLIYTLLVLWLV"
     gene            429424..429706
                     /locus_tag="FTM_0383"
                     /note="hypothetical membrane protein; frameshift"
                     /pseudo
     gene            complement(429721..430440)
                     /locus_tag="FTM_0384"
                     /note="amino acid-polyamine-organocation family protein;
                     frameshifts"
                     /pseudo
     gene            430639..431565
                     /locus_tag="FTM_0385"
     CDS             430639..431565
                     /locus_tag="FTM_0385"
                     /codon_start=1
                     /transl_table=11
                     /product="subunit of DnaJ/DnaK/GrpE: chaperone with DnaK;
                     heat shock protein"
                     /protein_id="ACD30422.1"
                     /translation="MADYYSLLGVSRDASEADIKKAYRRLAKKYHPDVNKEKGAEDKF
                     KEIQTAYDVLGDKEKKKLYDTYGENWDKVQQGGFGGAGGGFGGFSQSGRAQSFNFEDL
                     GDIFGDLFGGGAGARGFGGGQPRARKGEDINISLRLNVEDAIKGGSRTVSYNYQEVGA
                     NGMPTMQHQSVDVKIPPAMGNGKKLRVKGKGGAGIGANAPAGDLYIKIEVVDHKNYKV
                     DGNDIYEHINIAPWEAALGTSLEIDTPYGKKKMKVPEGSQSGRKMRIKGKGLGDGDFY
                     IVYDVKLPLADTDEKKEFYKQMQEKMNFNPRA"
     gene            complement(431555..432439)
                     /locus_tag="FTM_0386"
     CDS             complement(431555..432439)
                     /locus_tag="FTM_0386"
                     /codon_start=1
                     /transl_table=11
                     /product="10 TMS drug/metabolite exporter protein"
                     /protein_id="ACD30423.1"
                     /translation="MSIQRKAILALFIVTIFWGVTFPLIKISLAYISPGLFVAIRLSL
                     SCLLFLPLILRAKFNNKLYLLKVGAIFGSLEGLSFYFQTHGLYTVSSSQSAFLTALSV
                     VMIPFIGSLFKVDRLTIYGIIASCVSLIGIYALSGASFDNFTIGYLWSVLCALMYAVS
                     VVYLSYETRKDHRSEAFRDLRLLIILQIAFGIPLPLITDISSFMYLHFNYILIIALTF
                     CAISTITCYYLQNTYQKHLSMSQVAVIFSFEPIFATIFGKLINNEKIYLSTIIGGTLI
                     LTSYFIIEIGNRKRQSKP"
     gene            432611..433498
                     /locus_tag="FTM_0387"
                     /note="hydroxy/aromatic amino acid permease (HAAAP) family
                     protein; fragment"
                     /pseudo
     gene            433532..433888
                     /locus_tag="FTM_0388"
     CDS             433532..433888
                     /locus_tag="FTM_0388"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30424.1"
                     /translation="MKKPNFDINKKSFPNDDLVGDEYSKSPSVEEFSIDKLKQFPNDM
                     IELFKLIQAVRYDRTCLQEEYNSYRLKLNNDRMDLESEVIKIKKQYNAKICALQEEYN
                     SVKSNNNIELAKIREN"
     gene            434192..436201
                     /gene="relA"
                     /locus_tag="FTM_0389"
     CDS             434192..436201
                     /gene="relA"
                     /locus_tag="FTM_0389"
                     /EC_number="2.7.6.5"
                     /codon_start=1
                     /transl_table=11
                     /product="GDP pyrophosphokinase/GTP pyrophosphokinase"
                     /protein_id="ACD30425.1"
                     /translation="MTVYYRTRLIDWLCIFYKKWVIMQVIDSKLLDSDGQIKDELLIS
                     ELKSFYTSDKFEIIAAALELLKNKSTESVRHPTGISSFLYAIEMAYVLFKIRADEESV
                     SAGILYELYNFGDISDEDIEQATNQTVLKILQGTRKMSAIRMYRSDNISLEQIDIFRK
                     MLLTIIEDVRIVLVKIVDKLCTIRHLKSLSSNTQRVIARETLDIYAPLANRLGLGAIK
                     WELEDRAFFFLQQDEYKRIAKSLGVTRKQREDFLHQVIQELKSTLKKYNLHAGIQGRV
                     KHIYSIYKKFKNKGYQELDDLYDITAVRVITNNVDECYKVLAEVNNLYSPIPEEFSDY
                     IAHPKPNGYKSIHTVVKVGEQNIEVQIRTQQMHEESELGFAAHWRYKEGVKFDASYEA
                     RVAWLRSLLEWEKEINEDDSQITKELNKKLYVFTPANELIDLAEGSTVLDFAYSVHTM
                     VGHRTKGAKLNGKIVPLTTKLKTGDKVEILTGKEPNPSKDWASENLGYLTSARNRSRV
                     TKWFNEQNKEDNIALGKDRLLKELRGYDLKEVDFVEVAAKFNMKTSDSLFAAIEGGSL
                     KTNSVVNYIIDTYSAEEKLIKKKHKVTNLKAKAPKVLVSGFDGMKYEMAKCCHPVYPD
                     QIQGYMSVSKGVVIHTTNCPNLNHLKEKSPEKFIEVNWDDNEEVS"
     gene            complement(436317..436949)
                     /locus_tag="FTM_0390"
     CDS             complement(436317..436949)
                     /locus_tag="FTM_0390"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30426.1"
                     /translation="MSKFHKNIFSVICILSFLSLAKAADTKVYSWRAENGNVVFSEEK
                     PNDDVDYRIIEVGQPTVIDTKAPQNLGNDKPIKINQSDVAKLASSELAEKNKEVLEEG
                     QNADLSVQITSPANDANIFTKEDKIAISTNPQIASNDSPTFLINGSAIPATYEDGQWK
                     IARPTPGENKLSISGHTAQGNEIKSTNEVTFYIKNGWLQQAKNTGNYSGN"
     gene            complement(437029..437607)
                     /locus_tag="FTM_0391"
                     /note="protein of unknown function; stop codon"
                     /pseudo
     gene            437695..438309
                     /locus_tag="FTM_0392"
     CDS             437695..438309
                     /locus_tag="FTM_0392"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30427.1"
                     /translation="MITLGYVIYDCIANASILIFAFLLYKKNNYAWLFVLASLIIKVF
                     IYGKYGISTSLIYLSAQLLTAILAAIIWLRNPTYVKVSKQKKLLVIVIALIILAIWIG
                     LMYQYVNPYILNYELLFGFDYLCYMLVVIGGVFLIFRLAVGLLFFSVVYISYAVNYAN
                     SAMVIQNAPQYYRDFILYYWLSALFLFIAGIIIVATYTNAKRSV"
     gene            complement(438316..439041)
                     /locus_tag="FTM_0393"
     CDS             complement(438316..439041)
                     /locus_tag="FTM_0393"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30428.1"
                     /translation="MQINISNLDVKNHLDKFIEDRLEYEFCKQDKYLYLENDNLKLHY
                     NNKELFIDFNDSEILNRINPKTKKCSVVQAIEGRSKAKLTILDTTAGLGRDTFTLAAR
                     GHTLLTLEKDSYLYLLLKDALQRAQQINYLKEIANRITLINIDSNEYILTTDKSFDCV
                     YVDPMFPPRKKSAKVKQGMQILHQVGFNDEVSNSNLLDNIIQTQISPKAVVKRPINAE
                     FLSNKKPSSQLKGKTNRFDIYSL"
     gene            complement(439041..439919)
                     /gene="xerC"
                     /locus_tag="FTM_0394"
     CDS             complement(439041..439919)
                     /gene="xerC"
                     /locus_tag="FTM_0394"
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific recombinase"
                     /protein_id="ACD30429.1"
                     /translation="MTNLEHINNFLDNLLYLKNYSQETINNYQRDLLQLNQALSDKNI
                     ISLTHSDILIWIKKLHAQGNSPKTLQRKLSSVRSFFNFLINSEIVSQNPANGIKAPKD
                     SKRLPKVVNTDELAYLLDINPSNDIEARDIACFDLLYSCGIRLSELSSVELKDISISQ
                     KNIRVTGKGNKQRIVYFGTKTLSNLSRWLKIRDSLKPSSDYLFISRDGKHLTNRSIQK
                     RLEIFAQKYASRHIHPHMLRHSFASHVLDSSKDLLAVKDLLGHADISSTQIYTHLNFQ
                     QLASVFDKAHPRAKKK"
     gene            complement(439929..441101)
                     /locus_tag="FTM_0395"
     CDS             complement(439929..441101)
                     /locus_tag="FTM_0395"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxy/aromatic amino acid permease (HAAAP)
                     family protein"
                     /protein_id="ACD30430.1"
                     /translation="MIIVGTMIGGGILALPIITAKLGFVIGSILIFVVWSIMTYTAVV
                     ISDISCSMPYGSSFKTIAEKYLGKSGGVVASIAFLILMYFISTAYISAAASSLSTTFP
                     SLDEKLSSLIFVIIFGSIVVLGTRFVDYANRFFIILKILVLVILCVVFNRYIDIPNLF
                     VAPVDLGISLVIAIPVFTTSFTSHIIVPALSDYLGKNSKDMKRIVIIGSIIPLILYLV
                     WVVTILGVLPLHGPVSFMDSIFNHIPVDKANIGDILKTLGTKVRTPTTDAVLHIFTYV
                     AIMTSFLSVNLSLFHFNLDTYKLYKTKKVIGYSIAAVLTFAIPLIINQMDPDIFIYAM
                     TCVGLSIAILLMIMPALMAFKINNLGENFNYKISTYKSLWLISLVSGVIVILCVVA"
     gene            complement(441164..442385)
                     /locus_tag="FTM_0396"
                     /note="conserved hypothetical protein; frameshift"
                     /pseudo
     gene            complement(442579..443022)
                     /gene="secB2"
                     /locus_tag="FTM_0397"
     CDS             complement(442579..443022)
                     /gene="secB2"
                     /locus_tag="FTM_0397"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase, subunit B"
                     /protein_id="ACD30431.1"
                     /translation="MQNNEIQPSFLIQKVYTKDVSFETINSPACFKEQWNPSSDFNID
                     INTTKINDENFELDLTITVTTKNNETNAYIAEVTQSGIFTITSMSEEQIDSVLNTYCA
                     NTLFPYAKRIIDSSIIKGGFLPLNLAPINFDAIYLQKKSSPKREH"
     gene            complement(443099..445633)
                     /gene="mutS"
                     /locus_tag="FTM_0398"
     CDS             complement(443099..445633)
                     /gene="mutS"
                     /locus_tag="FTM_0398"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="ACD30432.1"
                     /translation="MQDISNHTPMIQQYLKIKSQYQDILLFYRMGDFYELFFDDAKKA
                     AELLDITLTARGKSNGESIPMAGVPYHAAEAYIAKIVKKGLSIAICEQTGDPNTSKGP
                     VERQVTRIITPATVSEEAFLDNNQDSILVSIFEKNNKYYLAYTSYTQGKIYLVKTLTS
                     LNELKNTVLKLSPQEIITNSRELAQQNPFKKPIKALEEWYYSNFEAKKYINDSLDTNI
                     ANNILNLYKNDKLTTIGSILSYLTNILKDTPRHITDISYEQEQDTLNIDINSRINLEL
                     DNNSKSSLLSIIGKCKTSLGSRLLKRYFSNPTRNLNILATRHSIINSLGENQHFLKIQ
                     DVLSYISDIERIISRVALGTVKPKDLVALRDSLEQLPILKKLLSEKNTPEITNINNRI
                     HQLDELVTLLDKAIIENPPTTIRDGGVIKEGFDKELDELKSIKDNSYDFLIKFEELQK
                     QKTGISTLKVGYNRVHGYYIELSKQHADKIPTEYVRRQTLKASERYITEELKNFEDKV
                     LSSKEKALAREKLIYDTLLKKVIEYYKQIQETAASIAEIDVLANFAERAIKLKLSQPK
                     FNNLAKLELKEVRHLAIEHNIDEPFIPNDTLLSKDTNTLQIITGPNMGGKSTYMRQVA
                     QLIFLAYIGSFVPASYADICDIDTIYTRIGASDDISSGRSTFMVEMTETAYILNNASA
                     KSLVIMDEIGRGTSTFDGLALAKACAEKFAQIGAFTLFATHYFELTELAKQYPNVCNI
                     HFEAKEYKDNIYFMHKAVTGAAKKSYGIQVAKLAGISQDVLESAKQNLYNLEKKQQLT
                     ESTQVQAQFQLEPTTQNPLQQKLDAIDINTITPLEALNILFELKKR"
     gene            445800..446747
                     /gene="accA"
                     /locus_tag="FTM_0399"
     CDS             445800..446747
                     /gene="accA"
                     /locus_tag="FTM_0399"
                     /EC_number="6.4.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase, carboxyl transferase,
                     alpha subunit"
                     /protein_id="ACD30433.1"
                     /translation="MNYLDFESKIKEIEDKITSLSHVFEDEKTEAEIKKLSKKRFELM
                     ESTYSKLTDWQVVQLSRHPDRPYFKDLLPLIFTDFQELHGDRTFGDDLAVIGGLAKLN
                     NKPVMVIGQEKGRDTKSKIKHNFGMMHPEGYRKALRLMKLAEKFNMPVVTFIDTPGAY
                     PGIKAEERGQSEAIARNLLEMSALKVPVVCIVIGEGCSGGALGIGVGDRLLMLQYSYF
                     ATISPEGCASILHKTAEKASEVTQMMNITSGRLKELKIVDEVIPEPLGGAHRDYETTA
                     TNIRKAVAAELKILSEMTVGQRNSRRYDKLMSFGRFKEA"
     gene            446767..447270
                     /locus_tag="FTM_0400"
     CDS             446767..447270
                     /locus_tag="FTM_0400"
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein"
                     /protein_id="ACD30434.1"
                     /translation="MLLQQIKSQAGFGIVESMLAALILLFVLSSGFLLLNSVLVNITL
                     ENKKDEIATILDERISIYRLTGVFDDTKTKDGIEFIKTVVLEKQNEAKPEENLETVNR
                     FKPLSVADIRKMAEKADKKNQKAAANDVDIIYKVVNIAAIDNQLGVADCVKIIEREVK
                     QDDNQAQ"
     gene            447251..448264
                     /locus_tag="FTM_0401"
     CDS             447251..448264
                     /locus_tag="FTM_0401"
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein"
                     /protein_id="ACD30435.1"
                     /translation="MITKRNNKAAGFTLPELMASMVIAAIVMAMAIGIYIDMKKQYIK
                     LSDKHKINTNQLLIKQIFYNAIGHSGFTTKYGDIYQQLVDNSGDNFGDIFGKMGVITI
                     GKAPIQNLEGLPKGLSLSVEACKERMLQDEDLKNMNINESIHCVQPDTDFLIIQRSSL
                     DSTLKTNSSNNIFKINEFQKGTPPEKDLKANDYLVLCNAFECELVKVGAVTLDFISTT
                     KLVEDKFKIGDYVGKYILEVFFIAASGKKDKDGQEIYSLYEYVKQNSADSEIYELIDN
                     VSDLKIEYVLNSDIHQGSAKLKWQSPQQQPIKLKSSTIAALKISFKVSDQPTSKIFLL
                     SQV"
     gene            448273..450237
                     /locus_tag="FTM_0402"
     CDS             448273..450237
                     /locus_tag="FTM_0402"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30436.1"
                     /translation="MYKSLNTKVSGSALLMALIFSFVIMVMLTELLYTFKMGLLTTKS
                     IIKNNNEKVLGETYISKVRDDINFTKSAELEIGDSKFQIIVNKDDVSSFFPNNTNAEL
                     FQSQQYNSYDVIYKAFNLGTHVDLTEKIIYNALVANSYQNFDGDFIPINVPMINPDAM
                     TVYQERIYRLKSDGTIDDMPKGFIGLIQKQNRQLSIFTKNAKIGVPIPEKMATDYKVK
                     VGWNLEKGKWRLYLLLYDTDKLFTTDILLDDLLDEEKVKGLEADNEALGNQIGKWQAV
                     ISGGGREMSSAGEQFIKNGIIDVVWYFDKNDAPPELMMVRSVRQNQTGSDTKKKTSKF
                     KKITRQQLEIYYSEYSSGNKNYVVKLADRLEFKEELNEDTVKLLVPDMASNLEANMVL
                     IFHPNEQSKTLMGISDFNYNGDHRVGKSLDTYIDGESFGKPVIVSKSNDSMYIITFEP
                     NKLHRYEYKKGFGSFISLEFGSNGLEKEFDFDSENNGDMVVVGLSNSKKEDDKKDAGI
                     QLVVPKFGYLFVFTPDKVMQLNYDFEILQEIDLGVSNPQILADFDAVKNTINKIYIQS
                     EALEVKAQEISDELGDEAKPQDSSEINDKNKSSSQNKSKPKSITERKKQELAKNNAKA
                     KDEEDNQPAERIYLDTKYLYPLGIVKEVKL"
     gene            450234..451118
                     /locus_tag="FTM_0403"
     CDS             450234..451118
                     /locus_tag="FTM_0403"
                     /EC_number="4.2.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glucokinase regulatory protein"
                     /protein_id="ACD30437.1"
                     /translation="MNILENINTEKRNPRSLNLDSMSIAEAVSLMIDEEYGVIEALKE
                     QHRNITEVILATSYSLRNGGRIIYIGAGTSGRLGILDAVECPPTFSVDYNTIVGLIAG
                     GEKAFIQAQEGAEDDANFGKEDLQSINLTAKDIVIGIAASGRTPYVIGALEYANSIGA
                     TTVALSCTKQAKISKYAKYSIEAVPGPEVLTGSTRLKAGTTQKLILNMISTLSMVSVG
                     KVYQNLMVDVKPTNQKLIERLKNIICEVMGVDYTTAEKFYLKANKSVKVAIVMILNNC
                     DYEKALAILKNNNNFIKS"
     gene            451120..451512
                     /locus_tag="FTM_0404"
     CDS             451120..451512
                     /locus_tag="FTM_0404"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30438.1"
                     /translation="MRLLILFIAVMFSFDSYATIYEKYQNGVPEFSNQQSQGAKQLNL
                     SDNPVSVIDMNSIPHTIVWGRAQQQYLPYSQPQEDTLQGAFPEEFTDNYFDFYGRNYQ
                     YHSLMSSTMGVSMYAPFGANNMRLQRNY"
     gene            452023..453038
                     /locus_tag="FTM_0405"
                     /note="hypothetical protein; frameshift"
                     /pseudo
     mobile_element  complement(453201..453951)
                     /mobile_element_type="insertion sequence:isftu1"
     gene            complement(454242..455540)
                     /locus_tag="FTM_0406"
     CDS             complement(454242..455540)
                     /locus_tag="FTM_0406"
                     /codon_start=1
                     /transl_table=11
                     /product="monovalent cation:proton antiporter-1"
                     /protein_id="ACD30439.1"
                     /translation="MSEYFLFSLLTVVAALISYINTKFLKLPKAIGLTILSITFSALC
                     ASFLSPSNFLVVALSSFDFKKTVLDGMLSFLLFANALHFNMIDLKKELKAIFGLASIG
                     LLLSALTTAILIYGFCLLVGFEISLGYCLVFGALISPTDPIAVISTLAGNKSIPKHIK
                     TRVVGESLFNDATGIVLFVVLSNIVFFGSGGEFEQAINGHGIEYIWIIAKQIGSEAGG
                     GILLGYIFARVALIFLKTNQDSETSIFVTLAVASMGYVIAHSLNVSGPIAMVVAGLFI
                     GNNLSDRKKTSPDQVEKLDNFWMVIDNMLNSFLFILIGLELTSIPFNHGAFWVGAAGI
                     FIVTFARLVSISIPITVIDKKLTRASAKDNLLVAWSGVRGGISLALALSLPDEGNVIV
                     SITYTVVILSILAQGSTLKIVLNMIYPHNITKKAANTVDN"
     gene            complement(455550..456275)
                     /locus_tag="FTM_0407"
     CDS             complement(455550..456275)
                     /locus_tag="FTM_0407"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30440.1"
                     /translation="MQKLDNIIIANYSIHSLALICWAKQNLSGNFCILSVDTGFAAAN
                     WNSYLEAVFDWLTKENISYFHLKSENTFQELVLARKQFPSQQFSWCASFLKGITLLNK
                     IDELDANGNATILLSHRSDMSSVSRLLKNLDEEERYDYRPLAYPLLNHSYDDILDLTK
                     ELPFKAAKYSLECQPCIHLTQQQFKILTKEDIEKVTDLEVKTNSFMFGDMPFDKLDDG
                     FFTQKDLLEELSKACSWEYSCGL"
     gene            complement(456277..457281)
                     /gene="trpS"
                     /locus_tag="FTM_0408"
     CDS             complement(456277..457281)
                     /gene="trpS"
                     /locus_tag="FTM_0408"
                     /EC_number="6.1.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="ACD30441.1"
                     /translation="MSQKIILTGVTPSGTPHLGNYIGAIKPAIEMIKNDQYKCMYFIA
                     DQHSLIKLWDKKLRQQYIYEIAASWLALGLDPDKAYFYRQSDIPEIMELTWIISTTTA
                     KGLLNRAHAYKALVDQNLQEENADPDKGITMGLFNYPVLMAADILIFDADLVPVGKDQ
                     IQHIEIARDIANRFNHIYQKPVLKAPQALTSEDSQTILGLDGRKMSKSYDNTIAIFSM
                     EKKLRKQVMKIITNSQMPEEKKDPNNCTIFAIYKSIASQTEIAALEEKYLAGGLGWGD
                     AKQILFEKINEYLRDAREKYDYYINNPKIVDDILNQGAAKVRPLAKDKLKEVKDIIGM
                     "
     gene            complement(457381..457455)
                     /locus_tag="FTM_0409"
     tRNA            complement(457381..457455)
                     /locus_tag="FTM_0409"
                     /product="tRNA-Gly"
     gene            complement(457470..457546)
                     /locus_tag="FTM_0410"
     tRNA            complement(457470..457546)
                     /locus_tag="FTM_0410"
                     /product="tRNA-Arg"
     gene            complement(457578..458192)
                     /gene="coaE"
                     /locus_tag="FTM_0411"
     CDS             complement(457578..458192)
                     /gene="coaE"
                     /locus_tag="FTM_0411"
                     /EC_number="2.7.1.24"
                     /codon_start=1
                     /transl_table=11
                     /product="dephospho-CoA kinase"
                     /protein_id="ACD30442.1"
                     /translation="MNFINTYPIGITGGIASGKSTATRILKEKLNLNVVCADTISREI
                     TKKPSVIKKIAEKFGDEIVMNKQINRAMLRAIITESKEAKKWLEDYLHPVINKEIKKQ
                     VKESDTVMTIVDIPLLGPYNFRHYDYLKKVIVIKADLETRIRRLMERDGKNRQQAIAF
                     INLQISDKEREKVADFVIDNTELTYQELESKLITTINEITNLTN"
     gene            458321..459457
                     /locus_tag="FTM_0412"
     CDS             458321..459457
                     /locus_tag="FTM_0412"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30443.1"
                     /translation="MSLKNIILERIKSSKQPLLFRDFMQMALYYPQLGYYSRAKEKIS
                     SQGDFITATSQTSLFARTFARQFATIISQLGNDCSVIEFGAGNGKFAADCVDELESLA
                     ILPKRYIIVELSNDLRLRQQQYIKENLSHLYDRFIWLDKLPAEKIKAIVFANELLDAM
                     PVDIFRSENNKLIQQGVIRKGDTFEFSDMPKNDVRFEYESTKILNDGITFNDGYTSEI
                     NTWIRPWVKSLREVLSQGIVFLCDYGYHRSLYYSKDRYMGTLACYHQHHVNFEPFINI
                     GEQDITAHVDFTTVAEAAIEEGFQLDGFMTQANFLKRANIAEVFSNISQRLSTNQLLK
                     YSNDIKDLLLNDKLAEVFKVMAFSLDFDFVLEVFDNQDNIDYLL"
     gene            459757..462438
                     /gene="aceE"
                     /locus_tag="FTM_0413"
     CDS             459757..462438
                     /gene="aceE"
                     /locus_tag="FTM_0413"
                     /EC_number="1.2.4.1"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase E1 component, homodimeric
                     type"
                     /protein_id="ACD30444.1"
                     /translation="MSDFTKDIDVLETQEWLEAFEDVIKREGADRAKFLFEQLLAKGS
                     EFGIKSAYSTAKVKNYVNSIDVSEQPSYPGDIELEQKIEAINRWNSTVIVAAANKKDG
                     SIGGHIGTGAGAMTLYEVGFNHFWKAPNDEHAGDLIFYQGHLSPIVYARSFLEGRITA
                     EQLENFRKQAFNGQNAVSSYPHPYLQPTYWQFPTVSMGLGPLQAIYQARFMKYLEARG
                     LAKTSDRKVWAFCGDGEMDEPESIGSITRAGREGLDNLIFVVNCNLQRLDGLVNGNGN
                     IVEELADVFAGAGWNVIKVLWSSDWDKLLQDPRGGKKLAQRLSELNDGQFHTIKAHGG
                     AECRRVVFSGDEDLEALAKDMTDDDIQALRRGGHDPLKIYAAYKKAVENPNGRPTLIL
                     PMTVKGYGLGEWGESKNIAHNVKKLDTDALEHIKNRFNVPASKEDIENYRLIKLDENS
                     PEMKYLHSKRKDLGGYIPKRLENKQALEIPSYKDFAKSLLDDSGDREFSTTTAFVRIL
                     SHLAKDKNLGKHIVPITVDESRTFGMEGLFRQLGIYNPHGQQYVPEDKQQVMFYKESV
                     DGQILQEGINEQGGFCSWIAAATSYSVHKVPMIPFMIYYSMFGFQRFGDLAWAAGDSM
                     AKGFVIGGTSGRTTLNGEGLQHEDGHSHIQAGLIPNCISYDPTYAYELAVILGEGMKR
                     MYVDGDHVYYYITVMNENYSHRAMPEGCEEGIIKGLYKLDEEKKPASKHVQLLGSGSI
                     LREVEAAAKMLKEEYGITSNVWSMTSANELYREAKDVARANMLHPTAEKKESYIEKCF
                     KNEQGPVIASTDYIKLYTDQLREFIPHTFVNLGTDGFGRSDTRAALRSFFEVDRYHVV
                     VASLYALYLDGKVEASEVKAAIEKYDIDPERMAPFYN"
     gene            462456..464039
                     /gene="aceF"
                     /locus_tag="FTM_0414"
     CDS             462456..464039
                     /gene="aceF"
                     /locus_tag="FTM_0414"
                     /EC_number="2.3.1.12"
                     /note="Deletion of 104 aa in FTM that is not present in
                     SCHU"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase complex dihydrolipoamide
                     acetyltransferase"
                     /protein_id="ACD30445.1"
                     /translation="MSIEIVKVPDIGDYDNVDVIEVNVAVGDVIAEEDSLITLETDKA
                     SMEVPSPVAGKVVEVITKVGDKVSQGSLILKVETGSSAQAPAQEQSQQSAPVKSAAEE
                     IIDVKVPDIGDYDSVDVIEVSVAVGDKIEEEDSLITLETDKASMEVPSPVAGEVVEII
                     TKVGDKVSQGSLILKVKTQGSAPVEQTSSQPAPAKQEQAKQQAATPAAPTPASSSVNE
                     YAIDNSNAHASPAVRKLARILNIDLSKVKATGRKGRVTKEDCYNYIKHAVTQVQTGKV
                     AASGSGLDLLDDPVVDFAKFGEIETQPLSRINKISAKNLHRNWVKIPHVTFYDDADVT
                     DLEEFRNAKKAFAEKKGIKITPLSFLVKAAAAALQEFPRFNSSLSNDGENLIIKKYYN
                     IGFAADTPAGLMVPVVKDADKKGIIEISKDIMELAGKARDGKLGAKDMTGATFTISSL
                     GVLGTTSFTPIINMPEVAIMGVSKTAVKPIWNGKEFIPRTMLPLSLSTDHRVIDGALA
                     AKFLTRYCQILSDLREIIM"
     gene            464053..465477
                     /gene="lpdA"
                     /locus_tag="FTM_0415"
     CDS             464053..465477
                     /gene="lpdA"
                     /locus_tag="FTM_0415"
                     /EC_number="1.8.1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase complex, E3 component,
                     dihydrolipoamide dehydrogenase"
                     /protein_id="ACD30446.1"
                     /translation="MSDIKTQVVVLGSGPGGYSAAFRAADLGLEVVLVERYAEIGGVC
                     LNVGCIPSKAMLHIAKVINEARHLESLGIIEMGGLKINRENLLKYKDGVIGKLTGGLK
                     GMAQMRKVKIVQGYGKFTSDKELAVEAADGKVTKIVFDNCIIAAGSSVIKLPFVPEDD
                     RIIDSTGALEMKEIPETMLVVGGGIIGLEMAQVYSELGTKITVVEFADQLMNGVDKDL
                     VKAYQKVNSRYDVRLKTAVTAMEAKEDGIYVTMEGDHPAKDERFDRVLMAIGRKPNGK
                     LIDAEKAGVKVDERGFIPVDKQLRTNVPHIFAIGDIVGQPMLAHKAVPEGRTAAEVIS
                     GLNHSFDPLVIPSVAYTDPEVAWVGETETSAKAKGIKYEKGVFPWAASGRSLSIDRSE
                     GMTKILFDENHKIIGASIVGTHAGELISEAALAIEMGCDAEDIALTVHPHPTLSESLM
                     MATEVYEGTATDLPPQKKKSKGLS"
     mobile_element  complement(465465..465770)
                     /note="fragment"
                     /mobile_element_type="insertion sequence:isftu6"
     mobile_element  465818..466568
                     /mobile_element_type="insertion sequence:isftu1"
     gene            466696..467343
                     /locus_tag="FTM_0416"
     CDS             466696..467343
                     /locus_tag="FTM_0416"
                     /codon_start=1
                     /transl_table=11
                     /product="MutT/nudix family protein"
                     /protein_id="ACD30447.1"
                     /translation="MWYILFYLLGKDKLMHKDKIFEFIKKVQAISHTGIVYSKCPYAL
                     DNYHELLELSSKMLHEYIKSDVQPYDIYRDMYYPTPQPGVRVVIFKDDKLMMTEDADT
                     PNEWTIPGGWCDIDLSPVETCIKEVKEETGYDIKVVKFLALMDRNKYTQSEIYNVYSL
                     VFLAQIIGGENNPNFEVKKVDFFEIDKLPKLSHKLTKTELNIILEAYKQDIIYFE"
     gene            467361..467714
                     /locus_tag="FTM_0417"
     CDS             467361..467714
                     /locus_tag="FTM_0417"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase"
                     /protein_id="ACD30448.1"
                     /translation="MIKVFGINNCTSVRNTLKFFEEKDKKVEYVNLRQEKPTWQEMQK
                     IKQIGNFETIDLFNSNGKLFAEMGLKDRFDSLSEEEAFKLLVTDALLFKRPLVVDGNY
                     ARTGWNKKEYEEKWG"
     gene            complement(467738..468073)
                     /locus_tag="FTM_0418"
     CDS             complement(467738..468073)
                     /locus_tag="FTM_0418"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein, putative"
                     /protein_id="ACD30449.1"
                     /translation="MTIKKLSTLVLTSFVCIMLLASCGPNKKERTLQDLEQQQQQLNQ
                     QAKDDQLQANNLTTDAANLDKESKADSSKSQYEKDQANVLNAEAQQNLSKAASLDAQI
                     EKAKSDATE"
     gene            complement(468573..469886)
                     /locus_tag="FTM_0419"
     CDS             complement(468573..469886)
                     /locus_tag="FTM_0419"
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="ACD30450.1"
                     /translation="MLDKIESFFNLKTYNTSIRKEFLAGLASFLAISYIIVVNPKILA
                     TTGMPSNALVTSTILISAFGSITMGLFTRNPFVIAPGMGMNIFFAYTAVSVYHLPWQT
                     VLGATFWSGIIFSLLVILNIRTKIMLSLPKSIKQSLGAGIGLFIAYIGFMNSGFITSN
                     EGLLTLNSLNVHTLLFIVCLIILIILFIKKIPAPIIIVITLGYILCLPLEYFSQQKIV
                     SLPTHIVSLPDFSLIGQIDFINGLKFAILPTIFTFCFLSLFDGTGTISSLYGSMGKEH
                     NHHDRELKKTFLADATSATISGILGSSPSTVVVESGVGIAQGARSGLTAIFAGLMFLP
                     FLFLSPLISSIPIEVISPALVLIGIMMMQQVANVDWSDFVQATPAFFTIIMMTLASSI
                     STGIASGIIVWFLISIFCNKKELNLTAAIITIFCVIMFLHAVNLF"
     gene            complement(469953..471539)
                     /locus_tag="FTM_0420"
     CDS             complement(469953..471539)
                     /locus_tag="FTM_0420"
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="ACD30451.1"
                     /translation="MSQQDLSPFEFKDELIKLATSKADRLMLNAGRGNPNFLATIPRH
                     AFLRLGDFALRESERSYSYLNNVFGGLPEKKGITERFDYYCLAHDKQDGIDFLRAAIS
                     FVDDHLGINKEEFLYEMTNAYLGCDYPSPPRILPIIEKIVMHYLREELYQNTDTPLEF
                     DIFATEGGTAAMTYIFQSAKINGLLNAHDKIAMITPIFSPYLEIPELPEYNNPIVHIY
                     ADENVHWQVTDKELEKLLDPTIKILCLVNPSNPPSVKISDLVLEKIAYIIDNHRSDLM
                     IITDDVYATFSDDFESLFSKCAYNTLCVYSFSKYFGATGWRIGTIALHKDNIFDKLIS
                     NLDDKKLDELDKHYSSLTTDSRTLKFIDRLVADSRSVALNHTAGISLPQQLQMGLFAL
                     SSLLDNQNIYRKEAKDLIRRRYNILYSSISPKLQQSLDENNVGYYTLLDLEELSYKIY
                     DKDFSQWLIKNHSGPETLKILATETGIVLLPGKGFDVLHPSARVSLANLREYDYRQIG
                     ISIRQQLDNLYSQYKKQTKD"
     gene            complement(471552..473267)
                     /locus_tag="FTM_0421"
                     /note="aspartate:alanine exchanger (AAE) family protein;
                     stop codon"
                     /pseudo
     gene            complement(473342..474447)
                     /locus_tag="FTM_0422"
                     /note="DNA uptake protein, SMF family; frameshift"
                     /pseudo
     gene            complement(474447..475700)
                     /locus_tag="FTM_0423"
     CDS             complement(474447..475700)
                     /locus_tag="FTM_0423"
                     /codon_start=1
                     /transl_table=11
                     /product="OmpA family protein"
                     /protein_id="ACD30452.1"
                     /translation="MKKLLKLCLMTSLLTTLSACQTLDDKDKDSGPLTFPTLEPCTAE
                     LLQSNQSFICVKEQTGPDLIETNIKFDADSYTLNTQAKEVLDKLFAYLKLTDTTNFTI
                     KGYAGKVESKILTDQKILTDYNIRLSKNRASSVEEYLVNKGLGSSDGITIKALGYQDP
                     IAPNDSTSSRAINQRVEITLKSRLIEQIDNIENNLEHVRPAEYTKFFSNVYLLNDNQI
                     DNISRIYNSREKRPILGINFKIFANKEYTAAKDNSNFIIISEPKPISSFNDDKKVYRL
                     GSAKYDYTFKGITALTITNLSREASVGNYVIPNDIVSQQLPEQTFKMKSKITANVLED
                     VMNTNTFSSSYNSILLNKGAADGLKVGAQVILYEPETRVDGFPVPPKYIGYGFIYRES
                     QHYSIALIVNSLQEITNNSMATTIL"
     gene            475892..476356
                     /gene="fkpB"
                     /locus_tag="FTM_0424"
     CDS             475892..476356
                     /gene="fkpB"
                     /locus_tag="FTM_0424"
                     /codon_start=1
                     /transl_table=11
                     /product="fkbp-type 16 kda peptidyl-prolyl
                     cis-transisomerase"
                     /protein_id="ACD30453.1"
                     /translation="MKIASDSFVKMHFKFRLKDGSIAEDTENYNRPFVFQMGQGCFTE
                     KVENELVGTTIGETKRVVLMPEEAFGEKHPASIYSVPKYRFPKDMHLEEGLIVSFSQK
                     DGSKLPGLITEINEQDVTVDFNHPLSGQIIVFEAKILDVAEKEEDLGEDITS"
     gene            476337..477293
                     /gene="lytB"
                     /locus_tag="FTM_0425"
     CDS             476337..477293
                     /gene="lytB"
                     /locus_tag="FTM_0425"
                     /EC_number="1.17.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="1-hydroxy-2-methyl-2-(E)-butenyl 4- diphosphate
                     reductase"
                     /protein_id="ACD30454.1"
                     /translation="MKILLANPRGFCAGVSRAVETVEKVLEVEKSPVYVRHEVVHNKV
                     VVDSLKKKGVVFVKEVDEVPDDAVCIFSAHGVSLKVEEAAAKKNLVLYDATCPLVTKV
                     HRGVRLASNNDAECILIGHKGHPEVQGTMGQYRSKKGAIYLIESEEDLNKLTIKDPDN
                     LYYATQTTLSVDETQGIIQALKDKYPNIKGPKKEDICYATQNRQTAIKAMLKHIDVLV
                     VVGSQNSSNSNRLKELATLEGIDAYLVDNPKDVDKLWFDNKKVCGVSAGASAPEYLVQ
                     QIISQISKVCSTEVEEFEGIKEEVYFPLPRLLKQKIGTGKVE"
     gene            477295..477657
                     /gene="aroH"
                     /locus_tag="FTM_0426"
     CDS             477295..477657
                     /gene="aroH"
                     /locus_tag="FTM_0426"
                     /EC_number="5.4.99.5"
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate mutase"
                     /protein_id="ACD30455.1"
                     /translation="MQRSIRGATTVDKDSKGNVISATKELLQQIIKHNNVSPSDIVNI
                     VFTATTDIKSEFPAVAARELGLVDVPLIDCQQMMREGALGFCIRVMLTYNTDKTQTDI
                     KHIYLRGAKVLRPDLLRK"
     gene            477666..478487
                     /gene="pssA"
                     /locus_tag="FTM_0427"
     CDS             477666..478487
                     /gene="pssA"
                     /locus_tag="FTM_0427"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine synthase"
                     /protein_id="ACD30456.1"
                     /translation="MIMWLLENIDMKKSKYILPSLFTSASLLFAFLAIIAAFNGNFVS
                     SAVYMLLAGFADAFDGRVARYTHTQTEFGAALDSLADVVSFGATPALVMYFWSLHNIG
                     ALGAAISFLYLLAVALRLAKFDTMPAGDNSEENIIERRLYFYGMPCPAGAVTISGLIW
                     MGQRTFVGDYAFITVILTVFTALYLAFMMVSDIKFRSFKDSDGKGNISKLYVICFILI
                     ILMLFTMPDKLLYLIMIGYALSGPISHYRYKAKIKNSDLNEESSVDGKKIIDIEK"
     gene            complement(478492..478716)
                     /locus_tag="FTM_0428"
     CDS             complement(478492..478716)
                     /locus_tag="FTM_0428"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein, putative"
                     /protein_id="ACD30457.1"
                     /translation="MKKTTLLTLAVICTALISCASSQGDSFGYVAPPPTQQDSESNEP
                     GPMQQPGGVSAGIIAEQGHPSHDAFITIKE"
     gene            478869..479576
                     /gene="tolQ"
                     /locus_tag="FTM_0429"
     CDS             478869..479576
                     /gene="tolQ"
                     /locus_tag="FTM_0429"
                     /codon_start=1
                     /transl_table=11
                     /product="group A colicin translocation; tolQ protein"
                     /protein_id="ACD30458.1"
                     /translation="MDNSISLVELVLHANFIVQLIMLALVAMSVYSWAIMLEVNNRVK
                     KYRNEQVQFDKLFWAGHHIQKLHDYYLQHKENIFGKSIIFCSGLREFNNLKDTCMLRG
                     DTILEGMERTVSIAIAQEAKELDRKLPALATIGAVAPYIGLVGTVWGIMSSFNTLGGV
                     EQATISVVAPHIAEALIATALGLFVAIPAVIGHSKLSNQVDDILSSYESFQDDLCILL
                     LKEAHRDEIQHQNQESL"
     gene            479592..480032
                     /gene="tolR"
                     /locus_tag="FTM_0430"
     CDS             479592..480032
                     /gene="tolR"
                     /locus_tag="FTM_0430"
                     /codon_start=1
                     /transl_table=11
                     /product="group A colicin translocation; tolR protein"
                     /protein_id="ACD30459.1"
                     /translation="MKKRNKRFFRKQRPMVQINVVPYIDVMLVLLVIFMITTPILTQG
                     VKVDLPKAQSEKIPSNDSKPIVVTVNKQGEYFINQGVNDPKTALSSGALANAVVSLSQ
                     QNPGKPVYVRGDSSASYGEVVKAMALIQKADIDKVGLVTEDGKS"
     gene            480019..480906
                     /gene="tolA"
                     /locus_tag="FTM_0431"
     CDS             480019..480906
                     /gene="tolA"
                     /locus_tag="FTM_0431"
                     /codon_start=1
                     /transl_table=11
                     /product="group A colicin translocation; tolA protein"
                     /protein_id="ACD30460.1"
                     /translation="MANLNYHKFLRFCNKQIDENPFLVKAILIHIALIILLYILSFVS
                     SLKFEKTQASLTAQVSNMPKKFEIIQATSISSSELNKQISAYENHQQELKQAKEDIKQ
                     AKLQALRKHQQQLKEKAEAEKKAKQQAILEAKKKAQQEKQAKLEAERKAKAETEQKAQ
                     QELQRKKEQELKAKQQAEEKARQEKLAKARAEAEAAARKQIEQNQAQSAISSYIAAYQ
                     DRVGANWIKDSCRGIYDLPHAIIRDGKFIKLTGTSGNYRCDQSLIDAIKNTTPPTIIN
                     NVARKTIQTENISFIFKQS"
     gene            480918..482225
                     /gene="tolB"
                     /locus_tag="FTM_0432"
     CDS             480918..482225
                     /gene="tolB"
                     /locus_tag="FTM_0432"
                     /codon_start=1
                     /transl_table=11
                     /product="group A colicin translocation; tolB protein"
                     /protein_id="ACD30461.1"
                     /translation="MRKIIAGVFIFVFLISNLYADLVAEVTTGVIQKPLVTVVSDNVV
                     DQFPQQVNFVIVADLNHNAKLQANDTIKYEIKQKQNIPWKSLKSDYVVLTKYTNNSYN
                     NYTVEVQILKRNDTSYLQAITYKNINVSLMRALAHKISNYVYQKLTGNQGFFLTKLAY
                     VKVSNPYARYGRLYELIISDYDGYNKHVVLRQTDNPIATPSWSNDGRYIVYSSYSGGS
                     MGVYTLEIATGKVTRITNYKGINSSPSFSPDGKEIALALSKGYSDQTNIYIMNLSTKA
                     LKRITINGINTAPKFSPNGQSIVFTSDREGRPNIYVASVNSKYPQSSILSTKIHQAYE
                     PNYTPDGKNIVFMNQSSRTSGTQIADFNLANGSVTNITNGKADSSPTVSPYGDMVAYI
                     STNTRGYSSLDMVSLDGDNHFNIETADNGNILIQSPSWSPKNF"
     gene            482235..482480
                     /locus_tag="FTM_0433"
     CDS             482235..482480
                     /locus_tag="FTM_0433"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein, putative"
                     /protein_id="ACD30462.1"
                     /translation="MQVAIKIYLIGFFALLVTSCAWYKGPSLMPNANGSLDGSSLNES
                     SGPGFISTLKSADNYGASDTGFADGGGNYVVSSFDND"
     gene            482499..483122
                     /gene="pal"
                     /locus_tag="FTM_0434"
     CDS             482499..483122
                     /gene="pal"
                     /locus_tag="FTM_0434"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-associated lipoprotein"
                     /protein_id="ACD30463.1"
                     /translation="MMKKRIMNLSVIGSMLMLASCSSTRPDNSDLIKDKYAGVDSSQA
                     LEMSSQIYGSDKLSSDQVEQMKKELMNINCRSVYFGFDSYNITDDAKECLDKTADYLI
                     AHPDQPIKLSGNTDPRGSEKYNFNLGQKRAEAVYNYLLGKNVNKDQICVVSYGKLKPA
                     AEPTQFYDEFCKDGVNDACMYKASEKAFYLDRRTEIDFGAKCDESNS"
     gene            483229..484550
                     /locus_tag="FTM_0435"
                     /note="tRNA-methylthiotransferase MiaB protein;
                     frameshifts"
                     /pseudo
     gene            484653..485375
                     /locus_tag="FTM_0436"
     CDS             484653..485375
                     /locus_tag="FTM_0436"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="ACD30464.1"
                     /translation="MSGNLVVIGGSGAIGNAVIKRLRQLYPNANIYAFSRAKVVDCVE
                     GVVYEHIDYTDESTIEKAAKYVYDKSGSINLIFVATGILHTQDIKPEKSLKELSADKF
                     IELFKANTIFPALVAKHFIPKLAKDTKSIFAAISARVGSISDNQLGGWYAYRASKAAL
                     NMFIKTASIETKRLNPNAVIVRLHPGTVDSHLSEPFQARVPEGKLFTPEYSASKLIEV
                     LDGLKADDSGKCFAWDGNEIIP"
     gene            485438..485629
                     /locus_tag="FTM_0437"
     CDS             485438..485629
                     /locus_tag="FTM_0437"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30465.1"
                     /translation="MAWCDKTSFDAIKEITGLSEPQVIKIMRNNLKPSSFKLWRKRVT
                     GRVAKHQKRLNHINADSLV"
     gene            485610..487109
                     /locus_tag="FTM_0438"
     CDS             485610..487109
                     /locus_tag="FTM_0438"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribodipyrimidine photolyase"
                     /protein_id="ACD30466.1"
                     /translation="MQIVWFKRDLRVTDNLALSLASEKGDILQLYIIEPELWQQPDMS
                     HRQYLFLSECLEELNTELTKLGQSLAIMLGDAVEIFEQLIQKYNIKNVWSHQETWNDW
                     TYQRDIKLEKFFKQNNIVWHQPYQNGVVRCLADRDNWALLWHQRMSEKIIRAPTKLKF
                     ICENQIKIPTAESLGLEYDDCYKRQKGGRIRALRILDSFLYQRGCGYTKEMSSPVTAF
                     KSCSRLSPYIAFGAISLKEIYQKANQRKNEIKESSVKNKTKWLSAMRSFLSRLRWHCH
                     FMQKLEDQPSIEYENLHSAYDQLRTEPLNQQCFEAWKTDNTGYPMIDACMRALIATGW
                     LNFRMRAMLMSFASYHLWLDWRVTSLYLARLFTDYEPGIHYSQVQMQSGTTGINSIRI
                     YNPIKQSIDQDPNGEFIRRWLPELENVSNENIHTPWLEKHNSLDYPDPTIDEKQARKF
                     AADNIYKIRKSSKNSQETKNIVKKHASRKTSRKIKSKQHKVESIQGELF"
     gene            487109..488636
                     /locus_tag="FTM_0439"
                     /note="deoxyribodipyrimidine photolyase-related protein;
                     frameshift"
                     /pseudo
     gene            488896..489825
                     /locus_tag="FTM_0440"
     CDS             488896..489825
                     /locus_tag="FTM_0440"
                     /codon_start=1
                     /transl_table=11
                     /product="bile acid symporter family protein"
                     /protein_id="ACD30467.1"
                     /translation="MMKMNFIQKYFAIIVIAGVILAISIPSIFIPLKPYITYLLAAIM
                     LIIGLHLQAKDFVKVANLKGKLLVILFLKLTVTSIAAFIIGKLFGLSLTALIGLVIVG
                     ACPGGTASGVMALLARANISLVVSLTFLTTLLAPIFMPLIIYFFFSKSIKLDWFGMFE
                     TMAIIVIVPIVLGILISKFTKLNDSTLKKISNIPILLIMLIVMVVTALNKDTMMLVPT
                     DIILSVIILSIFANIFGYLIGRVLGLDIDSRLALLFEFSILNVGLGIVIALAFFGNQA
                     AIAATFYAIWQNIIGPIIVNLVNICRNTKFKSS"
     gene            489877..490495
                     /locus_tag="FTM_0441"
                     /note="conserved protein of unknown function; frameshift"
                     /pseudo
     gene            490519..491277
                     /locus_tag="FTM_0442"
     CDS             490519..491277
                     /locus_tag="FTM_0442"
                     /codon_start=1
                     /transl_table=11
                     /product="domain of unknown function, putative"
                     /protein_id="ACD30468.1"
                     /translation="MLIIFGAIVGFVASFMSTLLGGGAGLIAVPAFYFIIVHTYGPNF
                     AMQIALATCCGMSIFLGSIATFKHYKKGNIDLGELKYYLLYLSIGALIGSIIAKYINI
                     ELLKMVFAILLFGSGIWMILYNDNKVIKLPRSARYSIFSFCGLLSVLASSTTFATMFF
                     IKIGTNLKKAIAITSVCVVINSSVATFVLTYGININVPLTFGYLSVPLLISSGLFALA
                     GSLLAINYLGIISPKLLKNLFITLMFVSAIVMIV"
     gene            491322..491411
                     /locus_tag="FTM_0443"
     tRNA            491322..491411
                     /locus_tag="FTM_0443"
                     /product="tRNA-Ser"
     gene            491814..492800
                     /locus_tag="FTM_0444"
     CDS             491814..492800
                     /locus_tag="FTM_0444"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30469.1"
                     /translation="MRLLITTLSLIPSIILAAPQLYNSKDKFINEEIKKHYLKFSTFT
                     YPGLYQDKLKNDLPDDIREIGLLVRKNFIHRTTLAAGNTGTNADLKFGNMQKVPWWRQ
                     PEDDILVTAGAMLTELYRRNNSGFVEDREPKDKLVLTCRFVSIMVANILKSKGIPARV
                     SAGHAAYFDMSELGNVSTDHWINQYWNEQENRWITIDVNGSFSLNENFDPYDMPERKF
                     DFPADAWLGIRAGKLDPQHFYNAKSERGAIVVLWSLFYDFHALMNNEIIYTYGPAGGY
                     GGYDKFNSLTKDEFEKIDNLARLMQNPDENFDELVKIWETEKDFRLLMGGLL"
     gene            493061..494209
                     /locus_tag="FTM_0445"
     CDS             493061..494209
                     /locus_tag="FTM_0445"
                     /note="ORF shortened compared to SCHU and novicida. RBS
                     site more suited to shorter version"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenite permease family protein"
                     /protein_id="ACD30470.1"
                     /translation="MLLGAIIVLITRQISVANALKSINLDVMMFLFSMFVIGVALEES
                     GYLSFLSYRIFKRAKNINQLLLYILFGAGLASAVVMNDTLAIIGTPMLLLVARKYAIN
                     PKVLLLTLAFAVTIGSVMSPLGNPQNFLIATQANLGNSFITFFRYLCIPTLINLFAAF
                     LLIKIFYKKQLNNDYQLNHSYESIKDPYLALLVKISLTILLSLIFIKIILTFLHFQIQ
                     IKLVYITIIAALPILLFSKSRLRIITKVDWHSLIFFAAMFILMASVWQSGFFQLVINN
                     LDINLISIPVILVVSVVLSQLISNVPLVAIYLPLISHLGATDKEIMVLAAASTIAGNL
                     LILGAASNIIIIHNAEKKAAITITFLEFAKIGIPMTIINIFIYWIFLA"
     gene            complement(494188..494610)
                     /locus_tag="FTM_0446"
     CDS             complement(494188..494610)
                     /locus_tag="FTM_0446"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30471.1"
                     /translation="MNLIIGAILGFISVAFGAYAEHGLKSQISAEHFNFIMTALRYNQ
                     IYAIIISGIGLALISSKHVAQSLMLKLSSSLFIIGTVLFSFSIYISIICNIQSLMKIA
                     PIGGTILMLAWISLAIAAISLKKRLSNNFIDNHAKNIQ"
     gene            complement(494630..494989)
                     /locus_tag="FTM_0447"
     CDS             complement(494630..494989)
                     /locus_tag="FTM_0447"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30472.1"
                     /translation="MIKVFYDGKCGLCTKEINLYKKIAPKNIFSWIDITEIDQSVIAK
                     ENLDVISCLKALHVKDNNDKLHIGIDAFIIIWSQLNRWRKLATIVKLPLIYNFAKIIY
                     SLFAKWRFNRLDHCKIK"
     gene            complement(495003..495857)
                     /gene="ubiA"
                     /locus_tag="FTM_0448"
     CDS             complement(495003..495857)
                     /gene="ubiA"
                     /locus_tag="FTM_0448"
                     /EC_number="2.5.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate polyprenyl transferase"
                     /protein_id="ACD30473.1"
                     /translation="MNKQQLKAYFMLMRLHRPIPILLILWPTLTALVLASHGLPDISY
                     LVIFTIGVVVMRTVGCIINDIADVDFDKHVARTNTRPLTSGQLSIKNAIWLCISLTLV
                     AFICVLFLNLYTILLSFVALFLAILYPFCKRFFAIPQLILGLAFNFGIFMAFSAIQNQ
                     IPVEAWIFYIATICWTIAYDTIYALADREFDLEIGIKSSAVLFGNKVFRYILLFNFLS
                     LLLLIILGIYCDFNSFFYLGVVICSLFFVRNYFLYKKLGITNCINAFSANHWIGLIIF
                     IIAVIQYI"
     gene            complement(495860..496366)
                     /gene="ubiC"
                     /locus_tag="FTM_0449"
     CDS             complement(495860..496366)
                     /gene="ubiC"
                     /locus_tag="FTM_0449"
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate pyruvate lyase"
                     /protein_id="ACD30474.1"
                     /translation="MNVINKENLTKQQRYWLNDAKNLVTSLSKFYGEITLDKISQQFT
                     NINSLEQSLLATQTALVRQITLSSINQTLVFARTIIPDSTYKHFTQELDNLGTKPIGD
                     NLLFDKAKFARDKFIIRELTVKDFYNETNRDITDKIFSRSSIFEYKDNSELKFLITEY
                     FLVLPEQY"
     gene            496465..497172
                     /locus_tag="FTM_0450"
     CDS             496465..497172
                     /locus_tag="FTM_0450"
                     /EC_number="2.7.7.56"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH"
                     /protein_id="ACD30475.1"
                     /translation="MRPSGRNNDQLRNLKVTHNFTKHAEGSVLIEFGDTKVICTASVV
                     AGVPKFKKDSGEGWLTAEYGMLPRSTHMRMDREAARGKQSGRTQEIQRLIGRALRASV
                     DLTAIGENTIKIDCDVIQADGGTRTASITGASLAIADAIEYMKQNGMLDEQANPLLSQ
                     VAAISVGIYNNEPVLDLDYDEDSNAETDMNVVMNSNGGIIEIQGTAEGKDFSEEEFAK
                     MLGLAKKGIKEIFATVF"
     gene            complement(497226..497549)
                     /locus_tag="FTM_0451"
     CDS             complement(497226..497549)
                     /locus_tag="FTM_0451"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30476.1"
                     /translation="MSEQQPRKKLSLGDRKKPSTTRVSSLSVNLKTKLQAKTEDNIQN
                     FFKNTNKELQELYQQRKTLEEQIKQIEQRLLFAKSEPLQDFLFELKSKDFELLVKINS
                     FINNL"
     gene            complement(497654..498561)
                     /locus_tag="FTM_0452"
                     /note="Type IV pili, pilus assembly protein; frameshift"
                     /pseudo
     gene            complement(498666..499739)
                     /gene="htpX"
                     /locus_tag="FTM_0453"
     CDS             complement(498666..499739)
                     /gene="htpX"
                     /locus_tag="FTM_0453"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent protease with chaperone function"
                     /protein_id="ACD30477.1"
                     /translation="MSAADNLEYGSVNWREIVRKNTYRTYFVIATFLIVFFLLGIFID
                     TIWRYSEFVNAHYSYYNSEPQISIGKVFLLLLTFQILPYATMIISTVAVIWVFVTFSM
                     YDKIMLSGTEYQEITADNQDPLARRVYNVVEEMKVAAGMRYMPKVFLIDANYMNAFAS
                     GYSEKSAMVAITTKLANALNRDELQAVMAHELTHIRNQDIKLNLFTMVLSNMMLIIMD
                     FLFYSALFSSNSNNNNNNRNNNAAAFFIIIMILRYVLQIFTIFMMLFLSRTREYMADA
                     GAVELMRTNMPMANALIKIANDSKSVEAQYSYKHNKNENLRRASYIFDPLSAGISSGD
                     MSDLFSTHPSIEKRLASIGVKLR"
     gene            complement(499743..500318)
                     /locus_tag="FTM_0454"
     CDS             complement(499743..500318)
                     /locus_tag="FTM_0454"
                     /codon_start=1
                     /transl_table=11
                     /product="LemA-like protein"
                     /protein_id="ACD30478.1"
                     /translation="MSIGIILLIIVVVIAVYVVMTYNKLIAEIETVKNSEKQIDVQLD
                     RRAKVFDSLVNVVKKYMDYEQTTLKQVVALRNQANLAKENGDIQERINAENKISDLAK
                     GINVQFENYPELKANQNVIQLQEEITSTENKLAFAKQALNDSIERYNAHKKSFFAGIV
                     VSIFKKLNEDFVYWNISEEKKQQLEDSRVEL"
     gene            complement(500366..501263)
                     /locus_tag="FTM_0455"
                     /note="transcriptional regulator, LysR family; frameshift"
                     /pseudo
     gene            501402..502457
                     /locus_tag="FTM_0456"
     CDS             501402..502457
                     /locus_tag="FTM_0456"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30479.1"
                     /translation="MKNLKKYKWAVVGAGLAGMTVIGQLLDNDIKAKDILWLDPNFSV
                     GDFGIKWGEVSSNTTVELFLRFLNNIQAFEYAKKAYKFAIDDYAKQGFTQLKDVSEPL
                     QWIIKNLLQKVDHSFDTISNMKIAQGVWNLYGTRENYIAEKVVLATGSLAKSLNIHNF
                     EITKEIHLTKALAPSKLKNELCKGDNVAVSGSSHSAMIIIRNLLELGVEDVANFYQQP
                     LRYAVNTGDWILYDNSGLKGETAKWVRENISQNLDSRVKRYLSTDEEINKHLHKYTKV
                     IYAVGFEQRVPSVEGIDVRIYDPTIGIIAPGLFGAGIAFPRRVTDPNGNVELNVGLFK
                     FMKDIRHFLPLWLKYDI"
     gene            complement(502459..503141)
                     /locus_tag="FTM_0457"
                     /note="heavy metal cation transport ATPase; IS insertion,
                     fragment, frameshift"
                     /pseudo
     mobile_element  503236..503828
                     /mobile_element_type="insertion sequence:isftu2"
     gene            complement(503853..504218)
                     /locus_tag="FTM_0458"
     CDS             complement(503853..504218)
                     /locus_tag="FTM_0458"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, ArsR family"
                     /protein_id="ACD30480.1"
                     /translation="MKLANIVDFQKALGDETRIRILMVIYQHQLCLCHLAHIFKLANS
                     TLSKHLDILRRNGFIHKRKQGRFHYFYFNSAYQQQLNWLFDILADDEIIQSDQKLVKQ
                     LIAQELEHLPEIHAKENIL"
     gene            504361..505014
                     /locus_tag="FTM_0459"
                     /note="conserved protein of unknown function; stop codon"
                     /pseudo
     gene            505334..506332
                     /gene="gpsA"
                     /locus_tag="FTM_0460"
     CDS             505334..506332
                     /gene="gpsA"
                     /locus_tag="FTM_0460"
                     /EC_number="1.1.1.94"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase [NAD(P)+]
                     (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase)"
                     /protein_id="ACD30481.1"
                     /translation="MQKNILVLGAGAWGTALALQLAYRGHNVRINSWKAEHNEQMLED
                     NNNHKYLPSIEKFPSRLKAIQDWQANIIEFDSILVATPSSGFKNTVLELKECILPQQN
                     IISATKGFCHDSYALLSEIAEDILPTTKFALLTGPSFAKELANQLPTAVVVASKDINY
                     ARYVQELFSNENFRCYTTTDIIGAQVGGAVKNVLAITAGIAAGMEFGVNAHAALITRG
                     LAEIKKLGLKLGANSETFIGLSCLGDLLLTCSDNQSRNRRFGLYLGQGMTIQQALKEV
                     NNVVEGYFTAKAVYNLAKKHNVEMPLVFATYRILYEAADPRDIVKELMTRQLKNEN"
     gene            complement(506333..506869)
                     /locus_tag="FTM_0461"
     CDS             complement(506333..506869)
                     /locus_tag="FTM_0461"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30482.1"
                     /translation="MEFLSSLNFLDILIMIVILILSLFAAVKGLFKNIVLLLLMVFAV
                     VLSGILAQKIQQIYVGSLIEDPGTAYVVSFILVLLCAYLIIFGIMKVFLRNNKEKESL
                     SNTLFAFFIALVRFSFIFAIACSTLNSIDAVKDNSLWQNSTLVQPLVKVGDYAFNTKV
                     KMQQTNLKDYVPKQVAGG"
     gene            complement(506874..508244)
                     /gene="radA"
                     /locus_tag="FTM_0462"
     CDS             complement(506874..508244)
                     /gene="radA"
                     /locus_tag="FTM_0462"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="ACD30483.1"
                     /translation="MAKQKTVFICQECGATSPRWQGQCHSCNQWNTFVEELKSDPQKV
                     VKSRAGFAGSISKATSLSAIKGKEHSRVSTHIGEFDRVLGGGIVKGSVILVGGDPGIG
                     KSSILLQIMSFLSLQKKVLYVSGEESLEQIALRAERLNLAKDNLLVMCETNIEQIASY
                     MVEHKPEVVVIDSIQTMYNPEIQSMVGGVSQVRESSAYITQIAKQYEIAVFLVGHVTK
                     SGEVAGPRVLEHIVDAVIFIESQDNGRYRMMRALKNRFGAVNEIGVFAMTDKGMKEVK
                     NPSAIFLNNGRTNLIGSVIVSVWEGTRPLLVELQSLVVDKNINQPPRRLCVGIDSNRL
                     AMILAIIQRYMHIDLYDKDVFLNVVGGIKINETSIDLALILIIYSSIKEIEIPHDMLI
                     MGEVGLSGEIRPIPYGIERINEAKKHGFKKIIVPQANVSKSLKTADIEIIGITNLNQI
                     KDIITG"
     gene            complement(508252..509022)
                     /locus_tag="FTM_0463"
     CDS             complement(508252..509022)
                     /locus_tag="FTM_0463"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30484.1"
                     /translation="MSRLDLLKKATPQSKKPQNTTKRNPRGGMLAEKTQKSQQRIDDL
                     NDDILAENDFENELEDTPITEYQIDDDTNNEESQENINIIEIDIDQSEGLAIDPTLIS
                     EDDESSEDESPKQKPLSDNHSVDDSDDYEANDIVEGNISVDYSEEDIKLELEYSFDQR
                     DQLYNHYVKLIKDGGIEVSSPKILYLHDIIRISVTLTELKEQVGCEARVVSVFPQSIP
                     SSIEHNNDKYRYIVQFIGPNAPETERVLSKYLLGYKQK"
     gene            complement(509019..509618)
                     /locus_tag="FTM_0464"
     CDS             complement(509019..509618)
                     /locus_tag="FTM_0464"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30485.1"
                     /translation="MSESEFSSLLIDWGYLAIMLGVFIEGEIFLIMVGIATATALFSY
                     PLAILAATFAAILHDNGLFIFSKFMGKKIFEKKASWHYKAQKSLEILDKYESLAILSI
                     RFLYGLRTITLLVVGLSKVNRVKFICLDSISSFVWSIIYISLGYLFGNTILKFIDNSD
                     IKDWISHNKHLSIFILILVSSIIYLSYRILRSRSKRRIR"
     gene            complement(509621..510679)
                     /gene="aroC"
                     /locus_tag="FTM_0465"
     CDS             complement(509621..510679)
                     /gene="aroC"
                     /locus_tag="FTM_0465"
                     /EC_number="4.2.3.5"
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate synthase"
                     /protein_id="ACD30486.1"
                     /translation="MSGNTFGKIFTVTTCGESHGDSLAAIIDGCPSNIPLCEADIQLE
                     LDRRKPGQSKFTTQRKEPDEVKIISGVFEGKTTGTPIGLIIKNQDQKSKDYSEIKDKF
                     RPGHADYTYFKKYGIRDYRGGGRSSARETAMRVAAGAIAKKILKHYGIEIYGFCSQIG
                     SLKIDFIDKDFINQNPFFIANKNAVPACEDLIHSIRKQGDSIGAEVTVVATGLEAGLG
                     RPVFDRLDASIAYAMMSINAVKAVSIGDGFDCVTQKGSQHRDEITQQQGFLSNHAGGI
                     LGGISTGQDIIAKLAFKPTSSILQPGKSIDVQGNDTTVITKGRHDPCVGIRGVPIAEA
                     MLALVLVDELLITRSYRD"
     gene            complement(510819..511472)
                     /locus_tag="FTM_0466"
     CDS             complement(510819..511472)
                     /locus_tag="FTM_0466"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30487.1"
                     /translation="MILLNQFIRSWSCTINTHFFGQIALNASFLLYSVQFIPQIIHNF
                     RNRQALSNISILTQFGIFITVLCNIVETIGFGYEWQYAVVAIIYLLGVCIQQLQISIF
                     CKKIPEIVNISFIFLFAIAMLAMGSNYHLVYQLAGYFGFVINTVYWFPQIYKNYTQKR
                     FDGFSLTFILIALIGTCLYITSSFILGWDLIFKINAVVMLPIISILVIQKFYYRQNH"
     gene            complement(511487..511999)
                     /locus_tag="FTM_0467"
     CDS             complement(511487..511999)
                     /locus_tag="FTM_0467"
                     /EC_number="1.8.4.-"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide methionine sulfoxide reductase-related
                     protein"
                     /protein_id="ACD30488.1"
                     /translation="MKKIILILAFIPIITLADTQNWQSFDKTQALAKLTRLQYYVTQK
                     GGTERAFNNKYWNNHRQGIYVDVVSGEPLFSSTDKYDSGTGWPSFTKPIDNSFIKTKT
                     DNSWFMTRTEVLSRYANSHLGHVFDDDPQPTGKRYCMNSAALKFIPKEDIQKDGYGKY
                     LYLFTNKNLQ"
     gene            512160..512717
                     /gene="sodC"
                     /locus_tag="FTM_0468"
     CDS             512160..512717
                     /gene="sodC"
                     /locus_tag="FTM_0468"
                     /codon_start=1
                     /transl_table=11
                     /product="copper/zinc superoxide dismutase"
                     /protein_id="ACD30489.1"
                     /translation="MTAFYKLCGMSMLSLVLADCTFLSANKPYDRDHDGELIVHMKDV
                     NTHKEVGTITISPYIHDGNQEGMLITPHLYNLPANTTHGMHIHINPSCEDNGIAAGGH
                     WDPDNTQKHLGPYNDNGHKGDLPVLVVNADGTATEPVVAPKLNSLEELAGHSLMLHAG
                     GDNYSDKPQPLGGGGARMWCGVIAD"
     gene            512721..513512
                     /locus_tag="FTM_0469"
     CDS             512721..513512
                     /locus_tag="FTM_0469"
                     /codon_start=1
                     /transl_table=11
                     /product="sterol desaturase"
                     /protein_id="ACD30490.1"
                     /translation="MSYELEVRLGFFLLILVTVSLWELLAPMRRLKISKQTRWINNLL
                     LVFLNTLLLRLIFPTAAVGVAVFCQHYNLGLLNITAIPIWLKVLIAFLVLDFTIYLQH
                     VLFHYLPLLWRFHKVHHIDLDYDVTTGLRFHPVEIFLSMLIKFMTVFLVGAPVSAVII
                     FEIVLNGTSLFNHGNIRLPRYFDKFLRLFMVTPDTHRVHHSTIPKETNSNFGFNLIWW
                     DKLMGTYLAQPKKGHIDMDIGLSEYTDPKQTQNLISMLKIPFSKK"
     gene            complement(513487..514881)
                     /locus_tag="FTM_0470"
     CDS             complement(513487..514881)
                     /locus_tag="FTM_0470"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid transporter (AAT) family protein"
                     /protein_id="ACD30491.1"
                     /translation="MALAKTLKPRHIELIALGGIIGSCFFLGTGYVLAEVGPAAILAY
                     ILAGIIVYAVTLCLAELTANSPNSGSFIYYTAKYVSPAIACGMGWSYWLNWIIYIPSE
                     CIAGGIIMHTFLPAVPIYMWATLFGLFITIINLTKVKIFGEIEFWLALVKIIALGLFS
                     VIAILIFFDIIQNNTGGVLGGTYIVSDGGFFPKGKLILITTMVILLVNFQGSEIIGLA
                     ASESNNAEKQMPRIAKHVAIRIVGLYVIPVFLLATIFPWQKMSLSDSVFATALQYYHL
                     DKFAAVFAFVVLVAAFSCANSGFYAAVRSLYGLSRARMAPSIFRKLNSSAIPHFAVYI
                     SIIAVWTFLILSFKLSASAAFTNLLAMSGFTATICWICICWSQYNFRKQLIRRNATDK
                     ILFKAPLFPYISLFGIWIQVLCLVLTLFNDELRGAFYFGAPAMIIPCCIYFFVSKKKN
                     TKIVQRTISLKKVF"
     gene            514921..515393
                     /locus_tag="FTM_0471"
                     /note="mannose-6-phosphate isomerase; frameshift"
                     /pseudo
     gene            515486..516598
                     /locus_tag="FTM_0472"
     CDS             515486..516598
                     /locus_tag="FTM_0472"
                     /EC_number="1.1.1.284"
                     /EC_number="1.1.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent alcohol dehydrogenase"
                     /protein_id="ACD30492.1"
                     /translation="MTIKSKAAVAYRAAEPLSVEIVNVALPKDNEVLVEIKATGICHT
                     DAYTLSGRDPEGLFPAILGHEGAGEVVAVGKNVTSVKPGDHVIALYTPECRECEYCLN
                     PKTNLCQAIRQTQGRGVMPDGSSRFSTLDGREIYHYMGCSTFSNYTVLPEIAVAKIRK
                     DAPLDKVCYIGCGVTTGIGAVVKTANVEAGSSVVVFGLGGIGLNVIQGAKFVGAGQIV
                     GVDINSDKKQLAEKYGMTDFVNPNEIDEDLVQHLIRLTGGGADYSFECIGNTTVMRQA
                     LECAYKGWGVSVIIGVAGAGEEISTRPFQLVTGRTWKGSAFGGMRGRTDVPMIVDWYM
                     DGRIDIDNLITANIKIDDINKGFAEMHNNIRTVVTF"
     gene            complement(516647..517837)
                     /locus_tag="FTM_0473"
     CDS             complement(516647..517837)
                     /locus_tag="FTM_0473"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate/tyrosine/aromatic aminotransferase"
                     /protein_id="ACD30493.1"
                     /translation="MQLSRRVKAMQASPVRKLVPYSIQAEKQGKKVYHLNIGQPDIKT
                     PNEFMDAIRAYDKETIAYSIASGEPSLIKAISKYYKRFDMDFAEDEILITNGGSEALI
                     FAAIATCNAGDEILVPEPFYTNYNGFTTAVDVSIRPITTKAEEGFHLPSKEEILACVT
                     DKTRAIMISNPGNPTGVVYTKQELETLAEVAKEKDLFIISDEVYREFTYDGLVCTSFG
                     NIKGVEDRVIIVDSVSKRYSACGARIGSLCSKNKEFIKEATKLCQARLCVPTLEQIGA
                     AALYEVSEDYLKEVNTEYQKRRDITFEALSKMDNVVCEKPTGAFYVIAKLPIDDAEKF
                     ALWLLTDFEDNRETVMISPAGDFYATKGLGKDEIRIAYILEEKSLRRALELLDKAIKA
                     YNSK"
     gene            518040..518927
                     /locus_tag="FTM_0474"
     CDS             518040..518927
                     /locus_tag="FTM_0474"
                     /codon_start=1
                     /transl_table=11
                     /product="cation diffusion facilitator (CDF) family
                     protein"
                     /protein_id="ACD30494.1"
                     /translation="MKFGQQLEKKTLKTNLIVASIYALFSIIIVYFAQSLTVLLDTGY
                     SVISILIYAVSIYVLRKINQPANKYYHYGYYRLEPIFIMLESWFVLLIAFSVILIALF
                     NIFTHTIKPNYGIALLSEIVGTVVCVVMFLFVNKRAKKTGSKILFSDALMWKADALLG
                     VGVIFNISIGFALEELGYARLALYVDPVVAILIGCYIMINPIKLGKEAYSHLLDAAPN
                     IEFRNQIRQITKQVAENYFLLIDNIKITQSGRFMFIDVYLDLPEVIETKKILMFKSKL
                     QQQLQNSFAQNKLKVYVSF"
     gene            519013..520662
                     /gene="recN"
                     /locus_tag="FTM_0475"
     CDS             519013..520662
                     /gene="recN"
                     /locus_tag="FTM_0475"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RecN"
                     /protein_id="ACD30495.1"
                     /translation="MLLHLSIKNFAIIKSTEIDFREGMTVLTGETGAGKSILLDALSF
                     VLGARLEKTFLQDDKLTEVSATFSIKDNHKAKRLLDELFIDYENDECTFRRVVNKSKQ
                     SRLFINGSVAKAADVKKVSDKLINIYSQNSHQDLLDPKSQLSLLDSFANNDELLKKVT
                     DSFYQLQKINSEIAQLQEYIDTQNSQRELLEYKLDELVALELGENEFEQLAQRQKCLS
                     SVDDIGYSLNHITSLMYDDEINIIAMLSELEKEVAKLDEGAFRNLQELISQTKVYAQE
                     SYAEAQNQLESLEQDPEELAKVEQRMSQIYDLARKHKIEPNYMYQYIQELQTELDNFT
                     QDSTRLSQLNEQKQNLQQQYSEYANKLSQARKQAAKEFSKQVEKNIRSLNIPKGSFEA
                     QILPAQSKTSKGVDECQFMINFNLGEQLAPVKKVASGGELSRIGLSIQAVSAAKRSYP
                     TLVFDEVDVGISGATAEIVGKLLKKLSARLQVLCITHQPQVAAQGQTHLHVSKKYLKD
                     TTESKIIELNQQQRIEEIAKIVGGVDISENTLSHARELLGL"
     gene            complement(520963..522196)
                     /gene="pilV"
                     /locus_tag="FTM_0476"
                     /note="Type IV pili, pilus assembly protein; stop codon,
                     frameshift"
                     /pseudo
     gene            complement(522866..523306)
                     /locus_tag="FTM_0477"
     CDS             complement(522866..523306)
                     /locus_tag="FTM_0477"
                     /codon_start=1
                     /transl_table=11
                     /product="Type IV pili, pilus assembly protein"
                     /protein_id="ACD30496.1"
                     /translation="MQTHKQTGFSLVELMVVIAIIAILAAVAIPIYSNYKERAAIIES
                     MNIIGNVKASIQNDINNNLDISQQTYDTPTGVTVTGSTSGATIDINLSQTSPQHFTND
                     NDIIRLSGVVVSGSTSQWTCSHNVNASTLTASNVPHTCSSTFSA"
     gene            complement(523437..523844)
                     /gene="pilA"
                     /locus_tag="FTM_0478"
     CDS             complement(523437..523844)
                     /gene="pilA"
                     /locus_tag="FTM_0478"
                     /codon_start=1
                     /transl_table=11
                     /product="Type IV pili, pilus assembly protein"
                     /protein_id="ACD30497.1"
                     /translation="MKKKMQKGFSLVELMVVIAIIAILAAVAIPMYSNYTTRAQLGSD
                     LSALGGAKATVAERIANNNGDASQVTILQANAAANGLPSGASVAAGTISYPSTVSGAT
                     IQLAPTVSSGAITWTCNISGVSASQVPSNCNAI"
     gene            524226..524945
                     /gene="lpxE"
                     /locus_tag="FTM_0479"
     CDS             524226..524945
                     /gene="lpxE"
                     /locus_tag="FTM_0479"
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A 1-phosphatase"
                     /protein_id="ACD30498.1"
                     /translation="MLKQTLQANFQGFKDIFKKPKLHNHKLPRYLQLKYTFIPLLILV
                     IFAYYNLDTPVENYIKHSMPNIVGVIFGKITDVGKAEYILIICGVIVLARLFTDSQKL
                     SANARVMFDKVSAYAGFILATVAISGILGQILKMIIGRARPKFFLEYGSHYFQHFHAP
                     GYDFASMPSGHSITVGAMFIAFFYIFPKLRYFWYLLIVVFAGSRIMVSSHYPSDVIFG
                     VAFGCYCTAYIYYWMRNREII"
     gene            525084..525932
                     /gene="folD"
                     /locus_tag="FTM_0480"
     CDS             525084..525932
                     /gene="folD"
                     /locus_tag="FTM_0480"
                     /EC_number="1.5.1.5"
                     /EC_number="3.5.4.9"
                     /codon_start=1
                     /transl_table=11
                     /product="methyleneTHF enzyme/ methenyltetrahydrofolate
                     cyclohydrolase/ methylenetetrahydrofolate dehydrogenase"
                     /protein_id="ACD30499.1"
                     /translation="MILIDGKSLSKDLKERLVTQVQEYKHHTAITPKLVAIIVGNDPA
                     SKTYVDSKEKACAQVGIDSQVITLPEHTTESELLELIDQLNNDSSVHAILVQLPLPAH
                     INKNNVIYSIKPEKDVDGFHPTNVGRLQLRDKKCLESCTPKGIMTMLREYGIKTEGAY
                     AVVVGASNVVGKPVSQLLLNAKATVTTCHRFTTDLKSHTTKADILIVAVGKPNFITAD
                     MVKEGAVVIDVGINHVDGKIVGDVDFAAVKDKVAAITPVPGGVGPMTITELLYNTFQC
                     AQELNR"
     gene            526166..527209
                     /gene="purM"
                     /locus_tag="FTM_0481"
     CDS             526166..527209
                     /gene="purM"
                     /locus_tag="FTM_0481"
                     /EC_number="6.3.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine cyclo-ligase"
                     /protein_id="ACD30500.1"
                     /translation="MAGLKYEDAGVNIEAGNQAVERMKQHVKKTFTQDVLTGLGSFGS
                     LYSLKNIINNYDDPVLVQSIDGVGTKTKVAVMCGKFENLGYDLFSAATNDIVVMGAKP
                     ITFLDYVAHDKLDPAIMEELVKGMSKACAECGVSLVGGETAEMPGVYQAGEIDMVGVI
                     TGIVDRKGIINGENVKEGDIVFGLSSSGLHTNGYSFARKLFFDVAGNKHTDTYPELEG
                     KTIGDVLLEPHINYTNIIHDFLDNGVDIKGMAHITGGGFIENIPRVLPQGLGAQIDKD
                     SFATPAIFKLMQRIGDISEFEMYRSFNMGIGMTIIASQDQFDKMQELAKKHTNTKLYQ
                     IGKITNSGKVEII"
     gene            527209..529521
                     /locus_tag="FTM_0482"
     CDS             527209..529521
                     /locus_tag="FTM_0482"
                     /codon_start=1
                     /transl_table=11
                     /product="saicar synthetase/phosphoribosylamine-glycine
                     ligase"
                     /protein_id="ACD30501.1"
                     /translation="MLDKQIIANNIKNVLKSTNLAIKNKYIGKVRDMYFTDDKSILIS
                     TDRQSAFDRSLGFIPFKGQILAQSSVWWFKETAHIVKNHFIDSPDPNVVIARKAKVLP
                     IEFVVRGYITGSTSTSLWTHYKNGSRDYCGNILPEGLKKNQKLPQNILTPTTKEQDHD
                     RPISAEDIVKEGWLTQQQWDFASQKALELFEFGQKKALEHGLILADTKYEFGIDEQTG
                     EIILIDEIHTPDSSRFWLKDSYATRFENGEEPENIDKEFFRLWFAKNCDPYNDEVLPQ
                     APQELVVELSQKYITLFEMITGQKFEVPRDLENINQRIVKNVTDYLNMEKPVNILLVG
                     SGSREHAIAEAVKRSSIANKLFCISTAINPAIDKITQGYQIADICNCDEVLEYAKSQS
                     IDIAIIGPEAPLEAGLADALKTAAIGVVGPTKKLAQLETSKGFTRDLIRDYDIGANPF
                     FRKFNSMDGVEETLKKYQNQFVIKADGLCGGKGVLVWGDHLHSLDEAIRHCQSLVDAG
                     KEFVIEERLVGQEFSLISFTDGKNFIHMPAVQDHKRAHEGDKGPNTGGMGTYSDANHS
                     LPFLSAADIERAKQINEKVVRALADKFGEPYQGILYGGFMATKDDTKVIEYNARFGDP
                     EAINLLTLLETDFVEIAQAITQGKLDTVKAKFKNQASVCKYLVPLGYPNQSVKNFEID
                     ISQCPDNVELFLGAVDYKDGKLIGTGSRAIAVLGLGDTIAEAEQKAENAIKNIYGKLF
                     HRPDIGTTELINKRIKHMNLLRGDKYQELK"
     gene            529525..530100
                     /gene="purN"
                     /locus_tag="FTM_0483"
     CDS             529525..530100
                     /gene="purN"
                     /locus_tag="FTM_0483"
                     /EC_number="2.1.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylglycinamide formyltransferase"
                     /protein_id="ACD30502.1"
                     /translation="MSKLNLVILGSTRGTNMQAIIDAIANKQLNAQISLVISNKSDAY
                     ILQRAADYNIPTKYIAAKGLTREQYDELVVTEIQKYNPDLILLIGFMRILSSVFIKAF
                     EGKILNIHPSLLPKHRGLMDLAVHQSVIDAGDSISGCTIHQVSEEVDGGDIVLQLKCD
                     VVKEDTVDSLKEKVQALESKAWIEVIKNWDK"
     gene            530217..530708
                     /gene="purE"
                     /locus_tag="FTM_0484"
     CDS             530217..530708
                     /gene="purE"
                     /locus_tag="FTM_0484"
                     /EC_number="4.1.1.21"
                     /codon_start=1
                     /transl_table=11
                     /product="N5-carboxyaminoimidazole ribonucleotide mutase"
                     /protein_id="ACD30503.1"
                     /translation="MSVQVGVIMGSKSDWSTMKECCDILDNLGIGYECKVVSAHRTPD
                     KMFDYAETAKERGLKVIIAGAGGAAHLPGMVAAKTTLPVLGVPVKSSTLNGQDSLLSI
                     VQMPAGIPVATFAIGMAGAKNAALFAASILQHTDINIAKALAEFRAEQTRFVLENPDP
                     REH"
     gene            530712..531809
                     /gene="purK"
                     /locus_tag="FTM_0485"
     CDS             530712..531809
                     /gene="purK"
                     /locus_tag="FTM_0485"
                     /EC_number="4.1.1.21"
                     /codon_start=1
                     /transl_table=11
                     /product="N5-carboxyaminoimidazole ribonucleotide synthase
                     monomer"
                     /protein_id="ACD30504.1"
                     /translation="MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVT
                     DIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEK
                     SFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITK
                     AWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPF
                     ENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDEIIVNEIAPRVHNSGHWSIDGAV
                     TSQFENHVRAIARLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGR
                     KVGHLNLNLNDETDEYQLLQAKKLIALSEEI"
     gene            complement(531806..532159)
                     /locus_tag="FTM_0486"
     CDS             complement(531806..532159)
                     /locus_tag="FTM_0486"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30505.1"
                     /translation="MQTIEIGNKAELQACKFLHTQALEILAHNFKALPYGEIDIIALD
                     KDTLVFIEVKYRSKTKFAQAEEMLTYSKQQKLVNSASIYLQHNPQYQDYQCRFDLIAI
                     NESNINWIKNAFGVI"
     gene            complement(532226..534247)
                     /gene="prlC"
                     /locus_tag="FTM_0487"
     CDS             complement(532226..534247)
                     /gene="prlC"
                     /locus_tag="FTM_0487"
                     /EC_number="3.4.24.70"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptidase A"
                     /protein_id="ACD30506.1"
                     /translation="MNSIIEDSKLPKLAEFKVDEVKPAIDKLFSLAQSNLENALQTQN
                     PNWQTLLKLEEDDEKISQAFSTISHMNAVCNSKELRESYEYAIAKLTDYYTKLGQNKD
                     LYDLYKQIQKDNLTNEQAQAVRKAIIGFEQSGVNLDEAKRKRLQQISQELAQLSTKFE
                     NNVLDATMDWLYTTDDEKELKGLSQHTIESAKAKANQKNIAEKYALGIDIPTYLAVMQ
                     QADNRKLREKFYKAYCTKASKEADNKNFDNDENIEKILKLRIEKSQILGFDNYAENSL
                     FTKMAETPEQVLELLNKLLEKSLPQAKKELNELRRFAEDAGLVDALQPWDSAYYSEKL
                     KKAKFDFTEEELREYFPLEKVQDGLFKILKQIYNLDVKENTQYTKYVPEQQTFDFFKN
                     DQYVGSIICDFFARDNKRGGAWMDGSRTAFTTSSGSKQNPVAYVNCNFLPPSKDGANL
                     THNDVVTLFHEFGHALHHILSQVTIPSISGTNGVEWDAIELPSQFMENFCWCQEGLAV
                     ISGSRDGKVLSSKQIDKLVGTRHFHSALMMVRQLEFGIFDMNIHYKKLTSATEVQKEL
                     DSIREKINLIKTPSYNKFQNGFSHIFAGGYAAGYYSYKWAEILSSDVFSRFEQEGILS
                     HKVGNELLENIISKGSSRDAMDNFVAFMGRKPNEDALLRHSGINYKIYI"
     gene            534339..534710
                     /locus_tag="FTM_0488"
     CDS             534339..534710
                     /locus_tag="FTM_0488"
                     /codon_start=1
                     /transl_table=11
                     /product="13 kDa major membrane protein"
                     /protein_id="ACD30507.1"
                     /translation="MMTLQEEKIQAPVFFKEYVKGRFILNIGEYNHPLILSATQVLEY
                     QDKIDDIQSIKKSHLDLILATNPEIILIGTGEKQLLPPLEIINQIAKAGKSVDFMASD
                     TACKTYNLLVNENRNVSCIII"
     gene            534786..535235
                     /locus_tag="FTM_0489"
     CDS             534786..535235
                     /locus_tag="FTM_0489"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30508.1"
                     /translation="MKKIIKLSLLSLSIAGLASCSTLGLGGSDDAKASAKDTAAAQTA
                     TTEQAAAVSKPTAKVSLNKLGQDKIKATVYTTYNNNPQGSVRLQWQAPEGSKCHDTSF
                     PITKYAEQNDKTWATVTVKQGNNFCSGKWTANVVYDKEVIASDSINI"
     gene            535392..535871
                     /locus_tag="FTM_0490"
     CDS             535392..535871
                     /locus_tag="FTM_0490"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein, putative"
                     /protein_id="ACD30509.1"
                     /translation="MKNIISLLMIFSMLVVLSSCAPTTAEQIQQLQQTQTSLNNHASA
                     NLAKIADLHTKITNYRLEADQLQKQSNSLADDIASINKAYSNFKDPNSDSAIAVSKEL
                     VQRTLQKVKIDEKINQYRTLANDYQAQINDLKAISQTQANQAAKISQQISQLKSQVK"
     gene            535971..536474
                     /locus_tag="FTM_0491"
                     /note="conserved protein of unknown function; stop codon"
                     /pseudo
     gene            536507..536974
                     /locus_tag="FTM_0492"
     CDS             536507..536974
                     /locus_tag="FTM_0492"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30510.1"
                     /translation="MKKILIFTLMTATLAGCSKYNAFIDKLYDSDNSIKVNPDDNLDN
                     PDQDGEVVSEDKPTATLKLKYKATTHEIDARIITNWNGAPQGTIYLTWVAPKDTNCYS
                     TSFPITKFNETQDYTVDSQSVLSDDKVCNGTWTALIVNKSDNLELAKASLEIK"
     gene            537047..538489
                     /locus_tag="FTM_0493"
     CDS             537047..538489
                     /locus_tag="FTM_0493"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30511.1"
                     /translation="MIEVINYLKKISYADYIFYFLTLAIFFVFLMPFMHYTVLNLVKV
                     TSGSTVSYFNDTLAANIYLFIDRYYIFYTVLGVASVAIFLNKRIFSEVIELFSSFNLS
                     IRYAIALFFIFGVISSVFAISPSIAFKGVSVTFLQFFCILFIAVYIRDNSKAVRFFYT
                     IILLSLIFFGGSLFLQLSLANYSVYGSYIAGNIQKVLLYMYNCLNPRFLDNYFSWFMP
                     LLLLPWFVDLRPIYKLGSFIALILAWFILINHGFRTIFAEYIIILPLLYIFARRYFKI
                     AFVVLVLALVCAGLLELFYNYFIAVVDHSNVKSSADLVRGGFSGRIPLWKEAFWVGVE
                     HPLTGVGQWNYLAITKRPDGYPHNLLLEIWSQWGIPAFIAAAVVIITTVRNLYKKRLE
                     ICLNPYQCIFVMMLTAGMIDGMLNAMFKTSLGLFGCVFVFGFCLSIFVKQPQQDTSVS
                     ATSYAIVGLSIFASIFCIAILPLIFPPLWI"
     gene            complement(538543..540837)
                     /gene="topA"
                     /locus_tag="FTM_0494"
     CDS             complement(538543..540837)
                     /gene="topA"
                     /locus_tag="FTM_0494"
                     /EC_number="5.99.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase I"
                     /protein_id="ACD30512.1"
                     /translation="MAKNLVIVESPAKTKTIKKYLGNEFEILASFGHVREIPSKDTSI
                     DVNDNFKIKFTTSEKSKKHLDAIKKAAKDAQNIYLATDPDREGEAISWHVQEVLKSAR
                     LLKDKNIYRVTFNEITKSAVTNAIANPKELSMDLVGAQKARQALDFLVGFNISPLLWR
                     KITSGLSAGRVQSPALRMIVEREIERENFIKQDYWSLTADTFKQKQIFANLLEFNNNK
                     VEQFTFTTAEDAENAKAHILKDAKGFLIVDGITEKKTRRNPYPPFITSTLQQEASKKL
                     GFTAKRTMSTTQKLYEGIDLGNGESVGLISYMRTDSTNLSNDALNDIRNFIQAKYDKD
                     MLPAKPRVFEKKSQNAQEAHEAIRVTAANRTPESIKQFLTNDEFKLYSLIYNRTIACQ
                     MKHATLNSTSVDLITENTKHRFRVTGTVIVDAGFLKIYNVEKDEDEKDSDDEQTLPKF
                     EKGEKIILNDVITKAHSTEPPPRYTEASLVKALEKYGIGRPSTYATIISTLQQREYVE
                     VDKRRFIPTDKGRIVNKFLTEYFKKYVEYSYTAGLEKELDEIAHHKNDYLSVLNNFWH
                     PFIERINKISEDVSRKDVVQEELEEDCPECGSKLSLRLGKNGRFIGCTNYPTCKYTRP
                     VDSDPKEVIKEEPIVVEDRKCPKCNSGLHIKQGRYGKFIGCSNYPECKHMEPLEKPKD
                     TGVVCPKCNKNHIVEKKSRKGKVFYACAGFPKCKNAYWYPPIKEECPKCHSLILLHKI
                     TKKDGEQKACPNSECDYAVAFETK"
     gene            541036..541677
                     /gene="parA"
                     /locus_tag="FTM_0495"
     CDS             541036..541677
                     /gene="parA"
                     /locus_tag="FTM_0495"
                     /codon_start=1
                     /transl_table=11
                     /product="chmomosome partition protein A"
                     /protein_id="ACD30513.1"
                     /translation="MKQKNAKVVSLLQQKGGSGKTTTAINIACGLKELGYRVAIIDMD
                     KDKPDAYMWMTKNNQESNFVYSLDEKNVREKVIELKQGLDFIVIDTPPNFQTAALKSA
                     LLSDLVVIPCSPSGMDLSGLIEAKDLALTAEKPYKFFANRVQMQSNMAKSLLEFFEED
                     GNFFEAYVSQSVKFIEAEAEGVYVGDYAKQSKVHIQVKKLAREIVEFFGEHNG"
     gene            541670..542584
                     /gene="parB"
                     /locus_tag="FTM_0496"
     CDS             541670..542584
                     /gene="parB"
                     /locus_tag="FTM_0496"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partition protein B"
                     /protein_id="ACD30514.1"
                     /translation="MAKKVSLMNRKINHKIHDTVAQEKKDILRAMQLQELNEQASKVG
                     QLFELPLTIIKPNANQPRKTFKNIDSLADSIKENGVIQPIIVTAKKANGIHYIIAGER
                     RYLASKQAGLTTIPCIVRQEESDANIVLLQLLENDQRENVSPFEEADALRDLIENKDV
                     KKSDIAKILGRDNSWISMRLKIADANADIRELSNRGIIDDVRTLYELKKFAEEIPQGA
                     QEFVKKALENKISGSYRSAITRYRDNWKRKAEILDSTKIDVITIKDIAKDGNLLKIKG
                     SRCGTKNYTYTFEITPEFKKILFDALIN"
     gene            542598..543305
                     /locus_tag="FTM_0497"
     CDS             542598..543305
                     /locus_tag="FTM_0497"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase, class I"
                     /protein_id="ACD30515.1"
                     /translation="MKIAILQTDHIPEHRRGVAGGNYPEMFANLFFKLSVVVDFDIFD
                     VTMQEYPQDYDIYDGFIITGSKATAFDNLVWIIKLKTEIVKLHDNHTKIIGICFGHQI
                     LAQALGGRVERGPKGFAVGVRNVEILTRKPWMEPFHSYLSLLFYHQDMVVKLPQGAEL
                     ISTSDYCKVQMFCINNHILGIQAHPEMLKVHKHALIKEYQDDIKNEFHHALESLRIRD
                     NSLIIAHWMANFFQYKD"
     gene            543308..544189
                     /locus_tag="FTM_0498"
     CDS             543308..544189
                     /locus_tag="FTM_0498"
                     /codon_start=1
                     /transl_table=11
                     /product="lipolytic enzyme"
                     /protein_id="ACD30516.1"
                     /translation="MRQINRLVVFGDSLLDNGNIMKTLDIPGKPYHDGRFSNGLVSTE
                     VLAQMLAKDQKLSEIKHKNYAIGGALTHGTNPSSLLRFHSFSVSEQIIRFENEEGRFA
                     DDDLVVINGGANNFMFMVYNEIPYINLVPKFRVARDLNKIVRKTIKMGAKNIILWNIP
                     DVTKAPAYKDYLSNWVGKFFKSYMQINVNLQNGLLRNRVSELQAIFPHINLKLFDFYS
                     LLNDCVENPAKYGFENVTDACIDSYGGADSLGNIQYDIEIMGDPEKYLCWDYCHPTAK
                     ANRLVASKMFDLWKLDI"
     gene            544186..544775
                     /locus_tag="FTM_0499"
                     /note="hydrolase, HD superfamily; frameshift"
                     /pseudo
     gene            complement(544835..545455)
                     /gene="rrmJ"
                     /locus_tag="FTM_0500"
     CDS             complement(544835..545455)
                     /gene="rrmJ"
                     /locus_tag="FTM_0500"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA methylase"
                     /protein_id="ACD30517.1"
                     /translation="MSKGSSTKKWLHEHTSDYYVIQANKLGYRSRASFKILEIQDKYQ
                     LFKPNMFVVDLGAAPGGWSEQVIKYIGKNGKLIALDLLEMAPIAGVEFIQGDFSSDET
                     YQKLNTLVNNQKIDCVISDMAPNLSGNKTSDQAKSIYLLELALDFANTNLNKNGSFVA
                     KVFQGQGSDEYLKLVRESFNKVIQFKPKSSRAKSREFYVIATEFKG"
     gene            545613..546080
                     /locus_tag="FTM_0501"
     CDS             545613..546080
                     /locus_tag="FTM_0501"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30518.1"
                     /translation="MSKKIFTLCLASLALASCTVKSDIEDNITHYEKLTRYSMIKQLD
                     FSKHTNDIDGARFLVANYPDQVIRLNGTDFDNKYDKLVSYLKTNGYTIMVNEKLPLTA
                     TIIAEINKPLPDVKYIGIIMQQDSRMDQTIYNISYGGNEFKARQFYTDYKKTL"
     gene            complement(546075..546560)
                     /gene="lspA"
                     /locus_tag="FTM_0502"
     CDS             complement(546075..546560)
                     /gene="lspA"
                     /locus_tag="FTM_0502"
                     /EC_number="3.4.23.36"
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase II"
                     /protein_id="ACD30519.1"
                     /translation="MNLLRPKLKYFILAILIIAADLYTKYLANTYLEFAQSLKITSFF
                     NLTLLYNHGAAFSLLSNDQTSWQMIMFSTISLIAAIVLIYLIIKQPITEKINLFSFAL
                     ILGGALGNFYDRAFQGYVIDFLDFHIGNYHWPSFNIADSAITCGVVILIAASLFTKKK
                     S"
     gene            complement(546547..549354)
                     /gene="ileS"
                     /locus_tag="FTM_0503"
     CDS             complement(546547..549354)
                     /gene="ileS"
                     /locus_tag="FTM_0503"
                     /EC_number="6.1.1.5"
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucyl-tRNA synthetase"
                     /protein_id="ACD30520.1"
                     /translation="MSDYKDTLNLPKTSFSMKGNLANKEPMILNKWEKQGIYKKIREH
                     FAGREKFILHDGPPYANGSIHVGHAVNKILKDIIIKSKTLSGYDAPFTPTWDCHGLPI
                     ELQVEKKHGKAGQSISEDDFRKECRKYAKKQVEIQKKDFKRLGVLGDWEQPYLTINFD
                     YEANMIRTLAKIIENGHLSKGFKPVHWCTDCGSALAEAEVEYADKVSPAIDVKFKIKD
                     KDKLAQAFGLDSLNHDAFAIIWTTTPWTLPANQAIAVNNQLNYSLIKIEDFYIILAEN
                     LVEQTLKRYAIENAQIIATTTGNKLTGIIAEHPFYSRHVPILHGDHVTDDSGTGLVHT
                     APTHGVDDFTLGKEHNLSMEIFVKGNGCYSENTKLFAGEFIFKANDRIIELLGEKKRL
                     MNSDKIKHSYPHCWRHKTPLMFRATPQWFISMEKQGLRDKALQAIKETSWAPSWGQAR
                     IEGMVKDRPDWCISRQRTWGVPLSLFIHKETEELHPNTIEILYKVAEKIEKDGIEAWF
                     NADDCEFITETAQYKSVKDTLDVWFDSGSSSMCILDLDKRLSYPADLYLEGSDQHRGW
                     FQTSLLVAMSAKGSQPYKEVFTHGFVVDEHGRKMSKSLGNVTSPQDIYNTLGADILRL
                     WTASTDYKSEMAVSDQILKRTADTYRRLRNTARFLLSNLDGFNPVTDIIEFDKLVKLD
                     QWAIAKTKEFQDKIIEAYDKYQTHTVAQLIHHFCSIEMGSFYLDIIKDRQYTAKTDGH
                     PRKSAQTAIYHIVHALVRWMAPILSFTADEIWDATLKTTDLPIQLCEWYTGLKSFDQD
                     AELDLEYWAKIQEIRSEVNRVLEIKRNEDVIKASLEAEITIYADKYNYKLLEKLGNEL
                     RFLLISSKADLKVIEESTSSSIAANIPGLLIEITKIEEPKCERCWHRSSTVGDNPQYK
                     DICSRCVENITTEAGESREFA"
     gene            complement(549447..550367)
                     /gene="ribF"
                     /locus_tag="FTM_0504"
     CDS             complement(549447..550367)
                     /gene="ribF"
                     /locus_tag="FTM_0504"
                     /EC_number="2.7.1.26"
                     /EC_number="2.7.7.2"
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin kinase/FMN adenylyltransferase"
                     /protein_id="ACD30521.1"
                     /translation="MKIITNLNKTKDPLPKAIAIGSFDGVHLGHQAIIKKLLTIAKEN
                     NLVPYILFFEPLPKEFFLKDKAPFRIYDFRNKVINIHKLGIKHIICQKFNTKFANITA
                     NEFIEEFLVKKLNTKHIIVGDDFKFGKNRGGDYALLNQYSQTHDLNVDKVSTLNLDNH
                     RISSSDIRQALTNHDLIEANKLLGESLKINSRVIHGQKNGRKIGFNTANQKLPKNSAL
                     KGVYLTRVFIDDVIFYGVANAGTRPTIDGKNNLLETHIFNFNQEIYGKHITTEIVSFI
                     RTEMKFNSFEELKLQISKDIQTAKKLISTL"
     gene            550518..552332
                     /gene="maeA"
                     /locus_tag="FTM_0505"
     CDS             550518..552332
                     /gene="maeA"
                     /locus_tag="FTM_0505"
                     /EC_number="1.1.1.38"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent malic enzyme"
                     /protein_id="ACD30522.1"
                     /translation="MERREKRIRKLRNKSGKVFAIETNLTGRQLLNNRVFNKDVAFSQ
                     EERVAFDLIGYLPEKVESLEEQAIRVRRQLDLKPNSLEKYVFLNRLHDLNTTLFYHFV
                     RENLEEIMPIIYTPTVGEAVQKYSSSFRKQNGLFISISHKKHIARILERYEYNSIDLV
                     LVTDGEAVLGIGDQGIGGMNISIGKIMVYVAASGIDPARVLPVQLDMGTNNDALLNAP
                     GYLGVRLPRVSGETYDEFIEEFVTQVKARFPNVFLHWEDLGRDNATRILEKYKDKLCT
                     FNDDIEGTGIVATANCIAGVKTASTIRINAGEITVEEALSGICDIKVVIFGAGSAGCG
                     IARQLADVIADRAGVFIEKARSSIYLVDRYGLVCDRLRAKRITPEQKLFVKTSEEIDK
                     WNVEDFNYITLEETVKNTKCDILIGTSGQPGSFTKEIIKTMAKNNNYPIIMPLSNPTS
                     LCETLPEDIIKWTNGKALIATGSPFPDVTYNGRDYRISQGNNAFIFPGLGLGSVAVHA
                     RVLTKGMIRAACYRLSELSPMVINEDITQPLLARITDLVDVTKEITKAVAKQAILEGV
                     HGVDIDLEDLTETELDEEIERLINLSSWTPTYAPYMPI"
     gene            552495..554168
                     /locus_tag="FTM_0506"
     CDS             552495..554168
                     /locus_tag="FTM_0506"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein, putative"
                     /protein_id="ACD30523.1"
                     /translation="MVRKFKKTCLIVSSLLACSGLAYSEDSPQVVSQGGPLGATSIGD
                     QNLGQPDPNASGASSTTQTTGSNLNDRELLLKLQQQVQQLQGQLQQLKAQGNGGGLQN
                     TSNGSSQFTTYSSKVDGNKNPRTLGGNGESKDLSQALIGGQTSSDIMGNVNASNSIIN
                     LASEPLGGVFNQKGGIDVGGAPAITTQGQVTYLGSYSGNNSIPIGQISSNLFASTLLG
                     QREKFDDYSVFFGGFIEADAQAWFGSAVTKVQNAGQLSSNGQNIYLTSANLYFLSNLG
                     HYVTAQFDFDTNESGSFSLGNAFVIFGNLDISPFFVTAGRNKLSVGSYGGGGTWTSGI
                     TKFLSPNQVTNVSIDYKDQVWNANIAVFGSDDRRANFSTGLFYADSWTPNLAAGFNVG
                     YVFNIAGAGNSSIANSLANLNRSSDNVGALNVDGNLTYAIWDGFLNLGAGWASTTTKE
                     DFNNNGGSVLAGAWYGALNYSAILGGRNTNFGVTYGQSYNAAAIPMETANASPTFGQT
                     ASGIKQQLIFSAQRAYFDDNVLFGPEYAYQRLYTGEHMNTITLDMSVYV"
     gene            554185..555630
                     /locus_tag="FTM_0507"
     CDS             554185..555630
                     /locus_tag="FTM_0507"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30524.1"
                     /translation="MFRKKLLVLITILFFFLNTSYAVVNQVNNSQQLDANEVSKLAKE
                     IQLLQAQIANHDTQKITDDIVVGLGSQQKVSNDQFNDFDKSTKVREQYLQQQVSLSSS
                     DDREVDVGNQVKITTQGEVSYVGSFSSNNTVPIGQLPSNLFASSILRQRAFFDDYSIF
                     FGGFIQADAQIWNGTDITTRNGGNFTGNGENIYLTSATLYFLANLGHYVTANLDFVAN
                     QNNNYDLQDAFVIFGNLDTTPVFVSVGKYRPSVGSFGGGGPWTSGITANMFRPLRVTN
                     AAINYRGDTSNANFTVFDAKNHATFSVAYFDAVSIPNIAQVGFNLGYMHDIRGANNRF
                     NFIDKRVGEFNIDTAISFEGIPFLPGNLNVGAGWATTTTQSTQFNGRSNAFAGAFTVQ
                     AAYTFKLFGSGQNINASYGHSYNADNIPMPLSAGGSFFLAASGIKDQILVSTQRSFFD
                     DNVLIGPEYSWQSLYNGQRMNTLTLDLSVYI"
     mobile_element  555765..556515
                     /mobile_element_type="insertion sequence:isftu1"
     gene            556850..557457
                     /locus_tag="FTM_0508"
                     /note="hypothetical protein; frameshift"
                     /pseudo
     gene            557523..558041
                     /locus_tag="FTM_0509"
     CDS             557523..558041
                     /locus_tag="FTM_0509"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30525.1"
                     /translation="MYATQVSAQLKIQNNSNAMMHVEMSKELSSKATFEGNTVYDIQP
                     GKVQKVIVLIDYGATGDVQVKVDAQCKFNASIGAGVWELISSGGKHLANFKTEVGCNF
                     AANASAFATLGISQLTSLVANVSFTKSDGLHECSLSEGYINIYPRSSNQVGIDYHIPD
                     TLGGGLVWMPNK"
     gene            558258..559655
                     /gene="engA"
                     /locus_tag="FTM_0510"
     CDS             558258..559655
                     /gene="engA"
                     /locus_tag="FTM_0510"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="ACD30526.1"
                     /translation="MSFLVAIVGRANVGKSTLFNVLTNSHDALVFDFEGVTRDRQYGQ
                     AKYDDLDYLVVDTGGISDKDVGFDEFMAKQSQIAIDEANLVFFVVDGRSGLTTGDEYV
                     ASLLRQKDKKVVVVVNKVDGTDEEAAMAEFYSFGFDKVFAISAAHRRNTQKLVDKFLK
                     KPLNEYYQDYTQTQEHKEQQRHGIHFSLIGRPNVGKSTLTNRMLGEDRVVVFDMPGTT
                     IDSVSIPFERHGQKYTIVDTAGVRKRGKVKQTLEKFSVIKTLQAIQDSNVVVAVVDAR
                     QGISDQDLSLIHFAIKNGRALVLAVNKWDGMTEEDRIQVKQDLKRKLFFLQDYVDIHF
                     ISALHGTNVGHVFESIDTAYACANKKITTADATCLMQLAVEAHSLPMVGKFRIKLKYA
                     HVGGHNPPVIVIHGNQVSRLPNSYKRYLENFFREALDFRGTPIVFEFKQSENPFADRK
                     NKRSKDEGSKSKKVK"
     gene            559624..560928
                     /gene="murA"
                     /locus_tag="FTM_0511"
     CDS             559624..560928
                     /gene="murA"
                     /locus_tag="FTM_0511"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine enolpyruvoyl
                     transferase"
                     /protein_id="ACD30527.1"
                     /translation="MKAVRVKKLSKLADEITINISGAKNALLHLIFASLIPDTKTKFT
                     NVPTTLLDYKGAKEILENVGAKVIEKDEEVTIDTAAISNETLELCGEMTSKTRCSLML
                     LGSLLKKKGRVKIGFPGGCSFSEKRPFDIHLNGLEALGAEVKLADDHIEVIYKEEKNA
                     EFKMPFPSVGATMNLLMYAVTGNSEVVLENVALEPEVVTLIDYLNQCGANIDFDADSR
                     KIKILGVMRLNGCEFEIIFDRIQAMTYAAMAYLYKTNVTITNINTQDTYSIKKPLEKL
                     TNAGAKWEYNQANRSIKFFGKDSCIKGVDIIAAPFPHFPTDLQPIYAVMLFMANSSST
                     IQDTVYPERINYVYQIRKMGFNISIDNTLIKINPLKNLNDIRPAVMSVKDLRAGMACL
                     MTGSLLDEFSTINNAHQIFRGYNNLIENMSHFMRIEILNDNV"
     gene            560936..561784
                     /gene="murB"
                     /locus_tag="FTM_0512"
     CDS             560936..561784
                     /gene="murB"
                     /locus_tag="FTM_0512"
                     /EC_number="1.3.1.98"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate dehydrogenase"
                     /protein_id="ACD30528.1"
                     /translation="MSEYISLEQYNTYRIKSFAKYVYFPTNNQELLDIVNNHNKLFFL
                     GNGSNVIFSKEYYDDVAFVIFTKKFNSFNIIDNYASVQAGVLLQDLAFATYNASLSGI
                     ETFYDVPASVGGALIMNAGAYGDEIYTCVKSVTILDLNTKQIKKYLKKDIEYGYRYSM
                     FKYMKDICILSAEFEFEYKSKQEIKAKLDDIYSRRLSNLPQKPTAGSVFKRPQADMPV
                     GIMVEQLGLKGKQIGDAQISPKHGGIIVNNGNATGQNILDLIEFIKQQILEHYNIELH
                     EEQIVI"
     gene            561863..562738
                     /locus_tag="FTM_0513"
     CDS             561863..562738
                     /locus_tag="FTM_0513"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved protein of unknown function"
                     /protein_id="ACD30529.1"
                     /translation="MKKKVLTSFIIISLCYCSAIADTITAKAQQAVKIDVKDNPLRQY
                     AAKSSIKSDSALVSENEVVSGSTIKQDQAPKANDYGDALSSLVDTSDDGYEKLLAEAE
                     EILKDNSPSETKKKIDVFNHELEAKAEKEKQKIKESATTVLDEVHNIIKENHNINQDY
                     KKSQNYYKSKSARDYIDENVKKYNSEYKIKNYKNLLDNISTPEEIDKSFEQIDDDDED
                     SQGFKYKLSDDYPIEQITTVGLLSGEQKRFDKCLIMKTYGGGTWRTYCQPLKKPTQCS
                     DYDWQQLSTMPVMYC"
     gene            complement(562740..563516)
                     /locus_tag="FTM_0514"
     CDS             complement(562740..563516)
                     /locus_tag="FTM_0514"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30530.1"
                     /translation="MFNYNLFLNRLSKRKLYPKSFIKNEIAQRLLKRLEFIKLDPKDI
                     LVTGYSDSDYLERLQKRFPNADIHTSQNLKQHFDIIFSNSIIHITDNLSQELDDYYQL
                     LNDNGILLFSTFGDKSFATLKEAFTSVSNYKHTNTMIDLLTWGNTLQASQYKTPAIES
                     DLITFTYENINTLFEDIRYLNEPLADTNMQFGLTGKNMWLRFVEKFKQNLQLEIEALY
                     GYAVRKAQDNTLKSRANPNRITLEELKKQIADFKKNSQNN"
     gene            563577..564192
                     /locus_tag="FTM_0515"
                     /note="conserved hypothetical protein; frameshift"
                     /pseudo
     gene            complement(564707..565045)
                     /gene="hitA"
                     /locus_tag="FTM_0516"
     CDS             complement(564707..565045)
                     /gene="hitA"
                     /locus_tag="FTM_0516"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine triad (HIT) family protein"
                     /protein_id="ACD30531.1"
                     /translation="MSDCIFCKIITGEIPSKKVYKDENIFAFHDINPAADVHILVIPK
                     KHIASLNDLTEQDQELMGKFILSIPKVAKLMGLKGFKTIFNTGKEGGQMVFHLHAHIL
                     GGKIRSKLPE"
     gene            complement(565051..566709)
                     /gene="ubiB"
                     /locus_tag="FTM_0517"
     CDS             complement(565051..566709)
                     /gene="ubiB"
                     /locus_tag="FTM_0517"
                     /EC_number="1.14.13.-"
                     /codon_start=1
                     /transl_table=11
                     /product="2-octaprenylphenol hydroxylase"
                     /protein_id="ACD30532.1"
                     /translation="MIKKFLRLIYIFYVINKYCLLNEPIRATKIKTLRALLLLNPFYY
                     SRRVRRLEHGVRIREALEKLGPIFIKFGQALSVRADLLPPDVIKEVSKLQDNVPLFDN
                     KIAAEQIEKAAKKPINEIFKSFESSPLASASVAQVHAAILQNDDKVVVKVLRPGIEKI
                     LKLDTSLMLFFATLLSKLKEIRRFKPVEIVKEINQSFFDELDLVREASNASQIRRNFE
                     DSAIHYVPKIYWEYTSSTVIVMERVGGVRVSDIETLDALGVDRRLLAQRGVEIFYSQV
                     FDDCFFHADMHPGNMFIDVSNPADPKYISIDFGIVGTLNRDDQRYLAGNFLAFFKRDY
                     RKVAELHIESGWVPSDTRVDVLESAIRTVCEPIFEKPMKEISLGYTLMQLFAVARRFN
                     MNIQPQLTLLQKTLFHVEGLGQKLCPELNIWETSRPILEKWMKEQMGLRGFYHRSMEN
                     MPRVSDKLPELPRMVFDILQQTQINLKNTTTSTQFNNLKEPKKKYRFALGCGLVLTTI
                     GVIYTLNKDTTPLIKLQNFISNYSTSFIIVGVACLIYYSFKKEK"
     gene            complement(566702..567289)
                     /locus_tag="FTM_0518"
     CDS             complement(566702..567289)
                     /locus_tag="FTM_0518"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30533.1"
                     /translation="MLKLVNTALSLLPKFDPQVSALLLPINGKALSVNITDIDLIITL
                     EVEDSKIYASNELTKNILKGKLAYILELIFNKNLQELIIVEKLDYQGSLKDLNAFNKF
                     LNAIDIDLVYRISELTSPEFAGIVAKPFQKAKQYLKTSRQETIVDIKDFLTEEKKTLI
                     SQNEINIFYRQVQELKQATDRIEAKLKLLEGLNND"
     gene            complement(567291..568043)
                     /gene="ubiE"
                     /locus_tag="FTM_0519"
     CDS             complement(567291..568043)
                     /gene="ubiE"
                     /locus_tag="FTM_0519"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone/menaquinone biosynthesis
                     methyltransferase UbiE"
                     /protein_id="ACD30534.1"
                     /translation="MSKENKTTDFGFTQVPWEEKQKKVAGVFHSVAAKYDLMNDLMSF
                     GIHRIWKKQTIAKSGVRKGDNVLDLAGGTGDLAYKFCQMVGQQGKVILSDINSSMLEV
                     GKEKLTNKGCVGNIEYVQANAECLPFPDNYFDCITISFGLRNVTDKDKALASMCRVLK
                     PGGRLLVLEFSKPIIPLLSKVYDEYSFKALPFLGKIITQDAESYKYLAESIRKHPDQQ
                     TLKQMMYDAGFDNVEYQNMTGGIVALHIGYKY"
     gene            568137..569153
                     /gene="glk"
                     /locus_tag="FTM_0520"
     CDS             568137..569153
                     /gene="glk"
                     /locus_tag="FTM_0520"
                     /EC_number="2.7.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="glucokinase"
                     /protein_id="ACD30535.1"
                     /translation="MYILSGDIGGTNTRLEVSLLENGATQSIAIRKYKGANFNCLSDI
                     IDKFLSEVDLVGQIDSVCLAVAGFVSNGEVEVTNLPWMVSEQYISEGLGIDKTKVKVI
                     NDFEAIGYGIESLDREKDIITIQEGKKDDDNLCAVVGAGTGLGMCLVSYDKDDKPRVY
                     KTEGGHVDFSPVDDEQVELFKFMRKTFHRISPERFCSGYGIYNIYKYVVRHPLYDQPE
                     CMELRRALFSVSDSDKAAVIVKYAIEHREPSALRTIDIFLSIYGSVAGNLALTSLPFR
                     GLYIAGGIAPRLIKQIKESKFLEKFRDKGRMSNMMKDFPVHIIMNTDVSLIGARTYAA
                     GLVK"
     gene            complement(569467..569997)
                     /gene="ispZ"
                     /locus_tag="FTM_0521"
     CDS             complement(569467..569997)
                     /gene="ispZ"
                     /locus_tag="FTM_0521"
                     /codon_start=1
                     /transl_table=11
                     /product="intracellular septation protein A family
                     protein"
                     /protein_id="ACD30536.1"
                     /translation="MNKMINDLLPAIVFFGIYKIYDIFFATAALIIVTIAQVIWEYIA
                     HRKVAKTQIFIAILVAIFGGATLYFHNEEFIKWKVSIINWLMGIGLIITTYTMKETPM
                     QKILKDAIDLKEHKWKEINNMWGAYFTVLGTLNLFVAYFFSTDIWMDFKLFGLLGITF
                     VFLIIQSIYLSKHIKR"
     gene            570058..570672
                     /locus_tag="FTM_0522"
     CDS             570058..570672
                     /locus_tag="FTM_0522"
                     /codon_start=1
                     /transl_table=11
                     /product="Sua5/YciO/YrdC family protein"
                     /protein_id="ACD30537.1"
                     /translation="MKSLIELYSYGNNLSELKELANILDNDGVIAIPTDSGYALACRM
                     KSKKGIDKIIKIRNLDSSHNFTLCCKDLSEISEYAKVDNNAYRLLKRYTPGPYTFILN
                     ATKKVSSLLVTKSKNTVGIRVSEHYVPRAISAEIGEPLVISSFIVPGHQHVVTDCDEV
                     DSQIMNYLDAVVESDYCGYDPTTVVELLELPYQILRQGAGEIDL"
     gene            570722..571324
                     /locus_tag="FTM_0523"
     CDS             570722..571324
                     /locus_tag="FTM_0523"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30538.1"
                     /translation="MNGYKTISENIEFEIAPIKKSRFIVFIYKVANHIEVLNSLDAIK
                     NSYPNANHYCWAYSLADNNQFRFNDDGEPGGSAGKPILSHIQGFEVTNVLVVVVRYFG
                     GTKLGVGGLIRAYGQAAKEGLTLAKITCVEVQNEISLEYDYSETVNVENLANRYGIQI
                     IKENYSDNISKIIKIVASDKDMFLEEIKNITKGKIKITVH"
     gene            complement(571321..572544)
                     /locus_tag="FTM_0524"
     CDS             complement(571321..572544)
                     /locus_tag="FTM_0524"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily"
                     /protein_id="ACD30539.1"
                     /translation="MKKYYYNTLIILLLFFLALLNYVDRSTLSIANTEIANAFNITPT
                     EMGILLSAFMWSYAIASLPAGYMVDRLGVNKVMLISMIAWSVACILGSFVIGFYSILL
                     TRILLGLAEAPFFIVATRIIQHRFPSSQRGLMSSIIALGPRLANILAPLILVGLMLLI
                     DWRGMFIILGVVGLIAAIGWKLLHTKETLEHTTTIIKKSQKISISETLRNKNVVYLCI
                     GNLCSSYAYWLFLTWLPFYFIKVKHLTLSQMSIATSASFISGVASVMLGGIISDFMIK
                     KGYTAVFARLTPIIAGCLVASIAILALPFIDNIFVIVCVIGVTIFCLGLRISPTWALV
                     ADISPYSLVGTIGGLQNFANFVGAGLAPLITGIILQSTNDNFMIIFIFSGIICLFGSI
                     IYMLIRDKRAQNETI"
     gene            complement(572561..574615)
                     /gene="metG"
                     /locus_tag="FTM_0525"
                     /note="methionyl-tRNA synthetase; stop codon"
                     /pseudo
     gene            574764..574855
                     /locus_tag="FTM_0526"
     tRNA            574764..574855
                     /locus_tag="FTM_0526"
                     /product="tRNA-Ser"
     gene            574883..574958
                     /locus_tag="FTM_0527"
     tRNA            574883..574958
                     /locus_tag="FTM_0527"
                     /product="tRNA-Val"
     gene            complement(575155..575603)
                     /locus_tag="FTM_0528"
                     /note="NADPH-dependent FMN reductase; frameshift"
                     /pseudo
     gene            complement(575575..575832)
                     /locus_tag="FTM_0529"
     CDS             complement(575575..575832)
                     /locus_tag="FTM_0529"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30540.1"
                     /translation="MIAVKDITDLNIQDIISQLTSEVINGDTTSSSAKFACEINSYII
                     NYKLLNINLINTQLKNTKILYRKGLISKLDYEKYKNNITRY"
     gene            576207..577730
                     /locus_tag="FTM_0530"
     rRNA            576207..577730
                     /locus_tag="FTM_0530"
                     /product="16S ribosomal RNA"
     gene            577826..577902
                     /locus_tag="FTM_0531"
     tRNA            577826..577902
                     /locus_tag="FTM_0531"
                     /product="tRNA-Ile"
     gene            577917..577992
                     /locus_tag="FTM_0532"
     tRNA            577917..577992
                     /locus_tag="FTM_0532"
                     /product="tRNA-Ala"
     gene            578066..580927
                     /locus_tag="FTM_0533"
     rRNA            578066..580927
                     /locus_tag="FTM_0533"
                     /product="23S ribosomal RNA"
     gene            580978..581092
                     /locus_tag="FTM_0534"
     rRNA            580978..581092
                     /locus_tag="FTM_0534"
                     /product="5S ribosomal RNA"
     gene            581307..582194
                     /locus_tag="FTM_0535"
                     /note="conserved protein of unknown function; frameshifts"
                     /pseudo
     gene            complement(582489..583544)
                     /locus_tag="FTM_0536"
     CDS             complement(582489..583544)
                     /locus_tag="FTM_0536"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical membrane protein"
                     /protein_id="ACD30541.1"
                     /translation="MRNIYKIILVLSIVAIFYSDIFGYGDIPPQKPTLVKTSAFITDI
                     QILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYDEVFEGWKPQISI
                     INEIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQTLKAYIIPFGYN
                     SKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGKPQRISMLE
                     FSISLERKPTNILLKVLIPLTLLVLAMWAIFWMDTKALSDRLNIAFIGILSVIAYQFL
                     IEGEMPDIDYLTFTDGFLLLSFSILFSTVLESLAVYWLIKLNKDKLARKMDIFSRFVF
                     PISYLVLITSLYFIYLH"
     gene            complement(583677..584333)
                     /locus_tag="FTM_0537"
     CDS             complement(583677..584333)
                     /locus_tag="FTM_0537"
                     /codon_start=1
                     /transl_table=11
                     /product="metallopeptidase, M50B family"
                     /protein_id="ACD30542.1"
                     /translation="MDFNHILMIALMAAIPLIFAITIHEAAHAFVAKIRGDDSAYRLG
                     RVTLNPVSHIDPIGTIVFPGLMLISSISFGFPFIFGWAKPVPIDYTKLKRPKIDTILV
                     AIAGPLANLAMAFIWAIVAKYITLHSYIQGMAFYGIMINVVLMILNLLPIPPLDGSRI
                     ISSLLPINLAYKYNSIEKYGFLIILALVIIPFNGSNLLFFIMQPFITTIINLIQFIIF
                     "
     mobile_element  584534..585276
                     /mobile_element_type="insertion sequence:isftu2"
     gene            586480..586815
                     /locus_tag="FTM_0538"
     CDS             586480..586815
                     /locus_tag="FTM_0538"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30543.1"
                     /translation="MANQYSGNFEQIVKNRFKCSAREILLKCQREGLSYQDAEKVLGF
                     KHVTIRKWAKRFDIKLPPRFRSHDEHLEQRREIAYVNQCKLNKINKRNVFSRCWINMN
                     LYSVIKAKS"
     gene            complement(586788..587639)
                     /gene="psd"
                     /locus_tag="FTM_0539"
     CDS             complement(586788..587639)
                     /gene="psd"
                     /locus_tag="FTM_0539"
                     /EC_number="4.1.1.65"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine decarboxylase, proenzyme"
                     /protein_id="ACD30544.1"
                     /translation="MRDNLFIYLQYLLPHTLTSRLVSKLADSENKIIKNHLIRLAIKK
                     FNINLVEAKETDISKYKSFNDFFIRELKDDLRPISNDKNVISSPADGVLSQFGTITDN
                     SLIQAKGKLFSLESLIASSSTTSFTKFATIYLSPKDYHRVHMPIDGKLTKMVYIPGKL
                     FSVNKITTSKVDNLFAKNERLICYFDTIIGEIAVIFVGALLVAGIETVWHGKIAPNYY
                     KDIQTWDYNSAKFNIKFNKGDILGWFNFGSTVIILTSGNNVSFKFEENKNNIKIQVNQ
                     DLALITE"
     gene            587739..588719
                     /locus_tag="FTM_0540"
     CDS             587739..588719
                     /locus_tag="FTM_0540"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30545.1"
                     /translation="MRNTIKIVILLSLGMLLQNCATSDVENDFSYENLTDTISGSPFR
                     NRKYDYARVKVSEEPALKIPTGLNGEKIKPALKLPDGDNNYARSQVNEAQKQMLPPNY
                     ADKFDMEKIISDQISKVSISVVYDDTGSLKLVFREPLSITINLLDNYFKEHPDSYVIT
                     TEKDEILSGHLITVKDTKKDLIFVILARKVDELSSLVKVNVVFTSDGKTLAPNHIDEG
                     VRILSDIRKDLNNTELKNDNNIEIAKQAEANLAASEANPKNGKSSLGGLLGSKKSSFG
                     FGSYDRKIDNSLEQQKTNTNQEQQQDYTQMTAPADDKVYDSQAQPQVLNT"
     gene            588728..589771
                     /locus_tag="FTM_0541"
     CDS             588728..589771
                     /locus_tag="FTM_0541"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional NMN adenylyltransferase/Nudix
                     hydrolase"
                     /protein_id="ACD30546.1"
                     /translation="MYDISVFIGRFQPFHKGHLHNIIIALQNSKKVIINIGSCFNAPN
                     IKNPFSFEQRKQMIESDLQVAGIDLDTVVIEPLADYFYQEQKWQDELRKNVYKHAKNN
                     NSIAIVGHIKDSSSYYIRSFPEWDYIGVDNYKNFNATEFRQKFYNGIISKQYMCSNDP
                     KLGTYNFLTKFMDTQVYQDLVAENNYVIEYKRLWLKAPFKPNFVTVDALVIVNDHILM
                     VQRKAHPGKDLWALPGGFLECDETIAQAIIRELFEETNINLTHEQLAIAKRCEKVFDY
                     PDRSVRGRTISHVGLFVFDQWPSLPEINAADDANDVKWISLGSNIKNICDRMLEDHYQ
                     IITILLEECGKKL"
     gene            589785..591152
                     /gene="glmU"
                     /locus_tag="FTM_0542"
     CDS             589785..591152
                     /gene="glmU"
                     /locus_tag="FTM_0542"
                     /EC_number="2.7.7.23"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     pyrophosphorylase/glucosamine-1-phosphate
                     N-acetyltransferase"
                     /protein_id="ACD30547.1"
                     /translation="MGLSVVILAAGKGSRMNSNKPKVLQTLAAKTLIEHVVSSVEKLN
                     PDNIVVVTGHLKEQVEDALQGRNITFVYQQQQLGTGHAVLQALPYLKEQKVLILYGDV
                     PLISTEVLENLVDTTNDDDLGVLTAFVENPQGLGRIVRDKFGAVTEIVEEKDANDIQR
                     QIKEINTGIYCVHKNLLQKWLPEIKANNVQKEYYLTDIITFAKADHVSINVTHPINEF
                     EILGVNDRTQLASLERVWQRNVAEKIMAKGVSIADPNRFDVRGNLDVGKDCWIDINVI
                     IKGNVKLGNNVVIGANCILKNCIIEDNVRIKSNSMVDGSIIREGAIVGPFARVRPECD
                     VKEGAVIGNFVEAKKTILGKGSKASHLTYLGDSEIGANCNIGAGVITCNYDGVNKHKT
                     VIGDYAFIGSDSQLIAPVNIGQGATVGAGSTIVKDVPADNLAISRARQRHIDTWQRSV
                     KKTDK"
     gene            591173..593011
                     /gene="glmS"
                     /locus_tag="FTM_0543"
     CDS             591173..593011
                     /gene="glmS"
                     /locus_tag="FTM_0543"
                     /EC_number="2.6.1.16"
                     /codon_start=1
                     /transl_table=11
                     /product="Glucosamine-fructose-6-phosphate
                     aminotransferase"
                     /protein_id="ACD30548.1"
                     /translation="MCGIVGANSTRNVTNILIEGLKKLEYRGYDSAGLAIIDDKNNID
                     ICKEVGKVIELEKSVHNLANFKGDIGIAHTRWATHGKPSKNNSHPHASESFCIVHNGV
                     IENFAELKKVLINDGYKFKSDTDTEVIAHLLQKEWRDNFSIVDNIKYIMAMLKGAYAV
                     AIISQKFSDKIVAVRSGSPLVIGVGIDENFISSDALSLLPVTNKFSYLDEGDIAIISK
                     DNVEVFDNNGAAKNLEVEEYNYSSSSASKDGYKHYMLKEIYEQPEAVSNTILASLADG
                     EISLDSFDKRAKELFEKTKHICIVACGTSYNAGMTAKYWIEKYAKVPCSVEIASEIRY
                     RDNVVVDGSLFVSISQSGETADTLESLRKSKKQNYVGSMCICNVPNSSLVRESDIAFM
                     TKAGVEIGVASTKAFTTQLVALAIFTLVIAKLKNSLTDQQIAKYTEELKNIRALVMGA
                     LKLDTEIDQISEYFSDKEHTIFLGRGLYYSIAIEGALKLKEISYIHAEAYPSGELKHG
                     PLALVDKNMPIVAVVPNDELLDKTLSNLQEVHARGGKLILFVDKAVKERVNFDNSIVL
                     ELDAGHDFSAPVVFTIPLQLLSYHVAIIKGTDVDQPRNLAKSVTVE"
     gene            593083..593615
                     /locus_tag="FTM_0544"
                     /note="acetyltransferase; frameshift"
                     /pseudo
     gene            complement(593612..593809)
                     /gene="rpsU1"
                     /locus_tag="FTM_0545"
     CDS             complement(593612..593809)
                     /gene="rpsU1"
                     /locus_tag="FTM_0545"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S21"
                     /protein_id="ACD30549.1"
                     /translation="MLSIKVDERKPFDISLRNFKRACEKAGIKQELRDRQHYVKPTEK
                     RKIAKRQAVKRARISQRRAFI"
     gene            complement(593809..594012)
                     /gene="cspC"
                     /locus_tag="FTM_0546"
     CDS             complement(593809..594012)
                     /gene="cspC"
                     /locus_tag="FTM_0546"
                     /codon_start=1
                     /transl_table=11
                     /product="cold shock protein, DNA-binding"
                     /protein_id="ACD30550.1"
                     /translation="MNNKSQGTVKFFNEQKGFGFITPENGGKDVFVHISKLNGETLAE
                     GQQVTFETQEGRKGPEAINIEVL"
     gene            complement(594261..594590)
                     /locus_tag="FTM_0547"
     CDS             complement(594261..594590)
                     /locus_tag="FTM_0547"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30551.1"
                     /translation="MQIKQAQQTIAELFKDIIHPRLASFIALSEEVGELANEIMKKEI
                     YEETNDNQKIKAELTDVFVSLLELANVYNIDLETEFIEKIQTLEPRVQQWNKAKALLK
                     AKRTKLD"
     gene            594717..595487
                     /gene="map"
                     /locus_tag="FTM_0548"
     CDS             594717..595487
                     /gene="map"
                     /locus_tag="FTM_0548"
                     /EC_number="3.4.11.18"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase, type I"
                     /protein_id="ACD30552.1"
                     /translation="MSQIIIKTPQEIEKMRVAGRLAAEVLEMITPFVKEGVTTAELDK
                     ICHEYIVKEQDAYPAPLNYHGFPKSICTSINHVVCHGIPADKKLKNGDILNIDITVKK
                     DGYHGDTSKMFMIGEPSVMAKKLVEVTHECLWKGIEVVKPGNHFGDIGAAIEKHAKKF
                     GYSIVDAFCGHGIGANFHEPPHVMHHGKAGTGAMFEEGMIFTIEPMINIGKRAVSVLK
                     DGWTAVTKDRSLSAQWEHTILVTKDGYEVLTLREEEKN"
     gene            595489..596337
                     /locus_tag="FTM_0549"
     CDS             595489..596337
                     /locus_tag="FTM_0549"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30553.1"
                     /translation="MPKQVTQKLVNQKCDLLRSQNEEITVSKVRKLIGEGVSIIDLVE
                     KVTLYKEDKKQALEVAEQEILEPNQPVRDELLEIIRASLKQFDVDRDDIAFSLRSDIM
                     QYIQQQISNNISKLKHKQAELSNKNDSLEISNISLDRRYKELLEKYNQIKEEAYSLKQ
                     NYNSKSMKFLEKETTEKMLLAWEDFKGIKEQLVSLKMYSKVAAYDKSGVIVIKFPATD
                     FLTQECRAGVSRYLKAKTVFDYSIQAWVLSGFKDILKTLDFLQRNKFVFSKELETIAY
                     LRRQKS"
     gene            596382..597091
                     /locus_tag="FTM_0550"
                     /note="conserved hypothetical protein; stop codon,
                     frameshift"
                     /pseudo
     gene            597224..599449
                     /gene="parC"
                     /locus_tag="FTM_0551"
     CDS             597224..599449
                     /gene="parC"
                     /locus_tag="FTM_0551"
                     /EC_number="5.99.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV, A subunit"
                     /protein_id="ACD30554.1"
                     /translation="MDLFSSLESTRSVAEFSEQAYLNYSMYVILDRALPHISDGLKPV
                     QRRIIYAMSEIGLSHLSKYKKSARTVGDVLGKYHPHGDSACYEAMVLMAQDFSYRYPF
                     IDGQGNWGSIDDPKSFAAMRYTESRLSKYAVLLLDELKKGTVDWAKNFDGTMDEPKLL
                     PAQVPNILLNGAMGIAVGMSTYIPPHNITEIINACLQLLSKPNSTIEEILEIVEAPDY
                     PGGANIISSKEEIADVYKSGNGSIRQQAVYEYDNHGNVVITKLPHQVSSAAVMEQIAN
                     ELKQQKITWIKNIQDESDDKEPVKIVLYSATIKKNIKKIMGHLLATTDLEKSFRVNMN
                     MIGLDNRPQVKNLLDILNEWLEYRKHTLRRRLQTSLDKVLDRLHILEGLLIAFLNIDE
                     VIDIIRNYDDPSGELQTRFTLSEIQAEAILNIRLRKLAKIEEIEIKKEQKELQKEREL
                     LEGYLNSEVKFRNLMKKEFKQILTDFGDSRRSKIIVAEKAQVLEEKDLMPSEKVTIIL
                     SKAGWIRCAKGENIDPAGLSYKPEDKPFLVTTGNGNIKLVFFSKLGKAYSMYIDKLPS
                     ARGYGEHITTYIPLDKQDQIISMAFVNAAGYFLIASESGKAFVIPAEDLITNKVTGKN
                     IFDADDVFKFIPYDKDLKMLAVSSQGRAIIRDFASFALLKKGKGKSIIRLDKKDKLKF
                     IELFRANQELTLNAGKRFIRIDSKNIETYYSDKPSGGGVLLPQGFRKITKIDIENIES
                     E"
     gene            599449..600135
                     /gene="mtn"
                     /locus_tag="FTM_0552"
     CDS             599449..600135
                     /gene="mtn"
                     /locus_tag="FTM_0552"
                     /EC_number="3.2.2.16"
                     /EC_number="3.2.2.9"
                     /codon_start=1
                     /transl_table=11
                     /product="5'-methylthioadenosine/S-adenosylhomocysteine
                     nucleosidase"
                     /protein_id="ACD30555.1"
                     /translation="MRKIAILGAMEIEILPILAKLDNYETIKYANNKYYLANYQDKEL
                     VIAYSKIGKVFSSLTTTIMIERFGVEALLFSGVAGGLQDLKVGDMIAATATVQHDVDI
                     TAFGYPYGKIPISEVEIKTSAKLLKQAQNVANELGLNLHTGVIATGDQFVHCAERKDF
                     VIKEFDAKAIEMEGASVNLICNEMGVPSLILRSISDTADGDAPENFDEFAKMAAKRSA
                     NFIMQILSNI"
     gene            complement(600122..600721)
                     /locus_tag="FTM_0553"
     CDS             complement(600122..600721)
                     /locus_tag="FTM_0553"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30556.1"
                     /translation="MFNNYNLLTTNLFVVYLILRIFTFLPKRLLLLAILILLCFNFIS
                     ITSDNQTIFYFVTGFINYFSFSSFILLIFIIATTFASKRITIFPYTSIAFLLIIFIFY
                     GSFFIVSYSLYDIGYSAYLVLACVFAYGLILLVISNRFILFNIIIVIATVAYFSGILH
                     GNIWDYLLDPILLVICIIEISRALITTKNKQHKDKIIYY"
     gene            complement(600714..601832)
                     /locus_tag="FTM_0554"
     CDS             complement(600714..601832)
                     /locus_tag="FTM_0554"
                     /codon_start=1
                     /transl_table=11
                     /product="BNR/Asp-box repeat protein"
                     /protein_id="ACD30557.1"
                     /translation="MKHKLKLVLLFAFIYLILLLVFYYYRIQHNYSFSISTPRNDSIT
                     KNLDIKTIANLKYFKYNHASSMTTIDNKLFITWYSSDQETAPNTKIVVAVAEKVAGKW
                     HFNEIKPVMNRQEFQSIFKKHIHHLGNPIIYSQAKRLWLVFTSSSGGWVTSSLNIMYS
                     DDLGKTWSQPKTILSSNILNFSTLTRGAAIELDNNRFAIPVYKEFNNLNGRWFVFNKD
                     GELIFVSEMTNDGVNLQPTVVPLSKTHALALYRQMLSPIKRIYTNETSDSGLSWSKVK
                     PTQLDNPDSGIAAIKIQNGILLAYNNATDSRADLSLAFKADNSQQWRNIYTFPNKIKG
                     ELSYPTFTPYQDNIILAFSDKTKGTIRIVEIKGENSNV"
     gene            602031..604007
                     /gene="slt"
                     /locus_tag="FTM_0555"
     CDS             602031..604007
                     /gene="slt"
                     /locus_tag="FTM_0555"
                     /codon_start=1
                     /transl_table=11
                     /product="soluble lytic murein transglycosylase"
                     /protein_id="ACD30558.1"
                     /translation="MINKKFITSCLLILSSTIGYSLTTQQVEYSQKAIDALAKKDYKS
                     YYYYKSKLKDTSIYPYLQYKEISTDPDIFQQTTIDEYFKQDNNSYWQNRLSDDLAQYY
                     AQKQEWKLFDKYYKGDLSISGKCWSMQAEYESGDKNKALNEYGQLWQNRVYMPAACNP
                     MQKYWDKSDYKPSSYLTTKAYTLAFANKFDDSLWLLNTYVKDNKDYLNYITAWKQATK
                     DPRKLDSFINRFHNYNHFDKVFVDISRDLIRKDVESYAKVWNNLKNKRYLSTKVKQQT
                     ISAIAVSFARSQSPQAKQWLSKVDKNYLDTTAWEWLLRVDLYNENFKDYIQTYNQLPK
                     NSQQDQAWRYWLAYSYQQTGQKAKAEDIFESLTKTPLDYYSFLAADKLGKPYNFGNDV
                     ATALTNSETKKLLTEDTTVQAIDLYQIGQYKDSTSIWQWAIRNKLRDKQIDEIKQLAR
                     LAEDKQMYYAAIFNMSVIGSCNSIDMLFPKAFINIVNQNAQKFAIDKDLVLSIMRKES
                     LFDISAGSSAGAKGLMQVTEPTAKFIAQKYKLSLVGDNSQGMTSQIFIPENNIKLGTA
                     NLYFLEKLFDKNPVLGIAAYNAGPGNVAKWLNENEVPAAIWIENIPFGETRHYVRKVL
                     MYMIVYNNFVFKDKKDHISNFLGYKISDKQSFRK"
     gene            complement(604021..604656)
                     /locus_tag="FTM_0556"
     CDS             complement(604021..604656)
                     /locus_tag="FTM_0556"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30559.1"
                     /translation="MATKNFSFIIALLFSFVFVNANTISNLEIDSSNLYKLPKNYYNI
                     NDLDNITKKTFKPPLYIAINGGWGQQTNMSKGGGTVVANLGYRFSESYAVEFVYQNFL
                     VSQYNTTQVNNYFAGAAKYYYKINNYITAYAAGLGIGYTNINGIANQRNSPASYLATN
                     NTWGRFTVFPVGVMFPIKYVDNLSLKVTYTYSISFSGNSQNFVTSGLQYSF"
     gene            605009..606163
                     /locus_tag="FTM_0557"
     CDS             605009..606163
                     /locus_tag="FTM_0557"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30560.1"
                     /translation="MAKIFFLLKHQLSIIRGKLWFQPITYSILAVISIYSCYLLQNYE
                     FSFYPYKVNLETVNHLLSIITTTMLTITVFAVSSIVSAYNSASSVGTPRILNLLLRDS
                     SSQNAHSKFIGAFIYGVIATIGIKSEIFNQNGIFFIFIITILVFIIVISTFIIWIDDI
                     VKLGQVRTSLARSEKYAYENIKKYVKDPYMGCNKFTVVKKLKSVPIYAGKYSFLTGIS
                     LENLNILCEKINAKVYIIRRNGEHLISSDVVAYVSSSKPLSQERFDEVVKNFIFSQER
                     SYSEDSLFGLTILSEISAKAFFNNDLGTVIKVIDSLTDILDCLFEIKPSQNVIYKNLY
                     VKEIAIEEIIKSSFENIRSYGSSNILVAKRLQKSLAHIAKQLQNDEKNLF"
     gene            606520..609999
                     /locus_tag="FTM_0558"
     CDS             606520..609999
                     /locus_tag="FTM_0558"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit alpha"
                     /protein_id="ACD30561.1"
                     /translation="MISHLRVHTGYSVVDSTVRLGDLFARAKDKNIVAVALTDVCNLF
                     AAVKFYKQALASGIKPIFGVELKVDTEFGICDLVLLAENNQGYQNIVNLVSKAYQEAD
                     RFGSIPLIPKSWLSEVKLESVICLNGGQQGELGKAILAKDYIKADEIIKQNIEIFGTN
                     NYIIEIHKLEYENEGLYNEKALEYASKYNLIAVATNLTVFMEADDYDIHEIRACINEK
                     TTILDESRKSKFTKEQYLKSADEMYETFSALPVLVDNTLAIAKRCNVTFELGKPCLPT
                     VNIPAGLTEKEYFSKLCYQGLDKRLEKILENRSADKHEHIIKVYKDRLQREIDIICDM
                     GFPGYFLIVEDFIRWSKENDISVGPGRGSGAGSLVAYSLLITDIDPLPYGLLFERFLN
                     PERVSMPDFDIDFCIQSRDRVIKYVEQKYGKESVAQIITYGTMAAKGVVRDVVRVMGQ
                     SFGFGDRIAKLIPETPGTTFKKILHEGEPLYEEVQADEDVAEIIEKAQKLEGLPRSLG
                     KHAAGIVISPTKISDFAPVYCEDKGGDIVTQFDKGDVEDVGLVKFDFLGLKNLTIINN
                     TVKSINAKRPADQKPLDIADIPLDDQKTFKLLQAGNTTGIFQLESQGMRQIVKDLGTS
                     NFEEIIALVALYRPGPMENIPTFIDRKHGRKQITYLHPLLEGVLKETYGIPVYQEQVM
                     QMAQKLAGYTLGGADLLRRAMGKKKPEEMEKQRKIFKEGAAKHHNIDTKLADEIFDQM
                     EAFAGYGFNKSHAAAYALIAYQTAWLKAHYPDEYMAALMSGDMGNTDQLVKFILDCKN
                     MGITVLAPNVNKSVYDCIAVSKGTILLGLGAIKGLGGEAIKSILTERDIAGEFSSIFD
                     LCRRVDLRKVNKKALEALCYAGAIKDISKNRATAFNSIEKAIKNAGYVNEMNAAGQDD
                     LFGFTEQESDTDAELERECIVEEWNLKELLINEKKALGMYFSGHIIDEESHWRNHVSF
                     SDLEKIQQPNMDGNSVRIIASMITPPARRKTKTGRVLYIINIDDEFDRADCLISEEVF
                     ASVKDSIEVDDIVVVEGKVSRDVQRECNKLSVDKVQPISQYIDENFSKVELTLRSQNI
                     NPTNLKKVLSNLKENIASTNIQKQNILEITVSLGDVDGKFDYLQKPFSIYKFVNDVSK
                     LIAEGSTVSLSGV"
     gene            610075..610683
                     /locus_tag="FTM_0559"
                     /note="peptide deformylase; frameshifts"
                     /pseudo
     gene            611388..612650
                     /locus_tag="FTM_0560"
     CDS             611388..612650
                     /locus_tag="FTM_0560"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, involved in lipoprotein
                     release, permease component"
                     /protein_id="ACD30562.1"
                     /translation="MFKSLPLFIGLRYIRAKKRNRFISIISAISFLGISLGVAVLITV
                     MSVMNGFDQQIKSKILMMVPPLKVYQLGGEVTDWPNLAKEVEKSTPSVTAVAPIVESQ
                     GLLSANSGSSTTAFVQIQGIEPKYQTKVLPIAEHIVDGKLSSLDDNQGYNIVLGSVLA
                     DNLGVKVGDKVTLIVPKISLTPAGMIPRIKQFRVSGIFSVSYQYDVYYAMINIKDAQK
                     VFETGNSVSSLQLSVKNIYDAPLVKDKLNDGAIPPYYFTRDWTDENKSFFDALKMEKT
                     MMFFILLLIITVAVFNLLSSLVMVVTDKRSDIAILRTMGMSSRQIITVFIYQGFIIGL
                     IGTVIGVLLGILLSTYATEIVNFIQNLTGKQFLSASVYLINYIPSELMWSDVIKVTLV
                     SMFLSFLATLYPAWSASKVQPVEALRYE"
     gene            612643..613338
                     /locus_tag="FTM_0561"
     CDS             612643..613338
                     /locus_tag="FTM_0561"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, ATPase component"
                     /protein_id="ACD30563.1"
                     /translation="MNDVVLSCKNVSKKYTEFKTDIAILKDVNLEIKKGEKVAILGLS
                     GSGKTTLLNVLGGLDKCSAGEVYLMGERFDNQSVNKRAKMRNKHLGFIYQLHHLLPEF
                     TAIENVMIPLAITKKYTKKESIKLANEILKKVGLDHRADHKPAELSGGERQRVAIARA
                     LVTNPNCILADEPTGNLDSQRSESIFALMQQLSDDFGTSFVIVTHDEKLASRMNKIYR
                     LVDGELELVINSN"
     gene            613455..615596
                     /locus_tag="FTM_0562"
                     /note="lysine decarboxylase; stop codon"
                     /pseudo
     gene            615688..616764
                     /gene="gcvT"
                     /locus_tag="FTM_0563"
     CDS             615688..616764
                     /gene="gcvT"
                     /locus_tag="FTM_0563"
                     /EC_number="2.1.2.10"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage complex protein T
                     (aminomethyltransferase)"
                     /protein_id="ACD30564.1"
                     /translation="MLKTPLYESHIAANAKMVDFSGWSMPINYGSQIQEHNNVREDCG
                     IFDVSHMLAVDIQGSEAEKFLRYLLANDIAKLQENKAQYGCMLNHDAGIVDDLITYKV
                     TDEHFRIVVNAGNRESDVAWFNQNAQNFDVAITPQTDLAIVAVQGPKAVAVIKRVVTK
                     EIAAEIEALLPFSFKFFSKWMVARTGYTGEDGFEVILPATQVKKFWDSLLENGAQPAG
                     LGARDTLRLEAGMHLYGADMDTSTTPLERGLGWSVDLSDEHRDFIGKKAYLAKKAQGV
                     DTKWVGVVLKTKGVLRAGQEIDFDNGEKGYITSGSFSPTLKVAIGLAYVPKQADNPVV
                     NIRGKELEVELVKPKFVKNGKSLI"
     gene            616821..617204
                     /gene="gcvH"
                     /locus_tag="FTM_0564"
     CDS             616821..617204
                     /gene="gcvH"
                     /locus_tag="FTM_0564"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system H protein
                     (lipoate-binding)"
                     /protein_id="ACD30565.1"
                     /translation="MSNIPKELKYTKSHEWVKIDGDEVTVGITAHAQSLLGDLVYVEL
                     PEIGEEFAAGDDSCVVESVKAASDVYAPVDGEVIEINEALVDDPSRVNHTPYKDGWLF
                     KLKISDESQLADLLTADAYAKTLED"
     gene            617269..618636
                     /gene="gcvP1"
                     /locus_tag="FTM_0565"
     CDS             617269..618636
                     /gene="gcvP1"
                     /locus_tag="FTM_0565"
                     /EC_number="1.4.4.2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system P protein, subunit 1"
                     /protein_id="ACD30566.1"
                     /translation="MSFIPHKLEQIKKMLDTIGASSVDQLFDEIPRHLRADTLKIKDG
                     INEIQLANLMRKRANKNHHNINYIGAGAYSHHIPAAIWDIVARGEFYTAYTPYQAEAS
                     QGGLQVIYEFQTMMAGLTGMDASNASMYDGATALAESVLMAIRSNKKAKSQKVLIAEA
                     LHPTYLRVLETITKHQGIEFDIVNLDSKNGKTDVTKLEDFANTNYAAVVIQSPNFLGQ
                     LADVDGITNWAHKHGALVVAVTNPMSLAILKSPAEWGDNGADIVCGEGQPMGVPLASG
                     GPYFGFMTCKMAHVRQMPGRIVGRTVDLDGNEGFCLTLQAREQHIRRAKATSNICTNQ
                     GLMVTAATIYMSLLGAEGLERVASISHENTQTLATELAKINGVSIRFNSAFFNEVVID
                     LPVNAETFVTEMEKEAIDAGYFLGEYHSDLANSIMVCATEIHTSEDIKEYIEATKKVL
                     ARIGG"
     gene            618642..620087
                     /gene="gcvP2"
                     /locus_tag="FTM_0566"
     CDS             618642..620087
                     /gene="gcvP2"
                     /locus_tag="FTM_0566"
                     /EC_number="1.4.4.2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system P-protein, subunit 2"
                     /protein_id="ACD30567.1"
                     /translation="MVIFEKTRGKNSPSVMPSKKGDVSNIPTDMLRTKKPILPEQAEL
                     DVVRHYTQLSRKNFCIDTNFYPLGSCTMKYNPRAAHKYASLAGFLERHPYASAQSVQG
                     TLECLYDLQNLIKELTGMTGVSLAPMAGAQGEFAGVAMIKAYHHKRSDFERDEIIVPD
                     AAHGTNPATAKVCGLKVIEIPTKKDGDIDIEALDKVLGPKTAGIMLTNPSTVGVFERN
                     IAVIAKKVHEAGGLLYYDGANLNAIMGKARPGDMGFDVLHMNLHKTFATPHGGGGPGA
                     GPVAVNDKLKEFLPVPMVGKKDDKFVWLEEKDVSNTIGRLSAFNGNIGVLIRAYIYGA
                     MLGGNGLTEASEIATLNANYMMARLKEEGFTIAYPDRRASHEFIVTLKPEFLNYGVTA
                     TDFAKCLIDKGVHAPTMYFPLLVPECLLIEPTETENVDSMEKFIQAMVEIRDIAKKDP
                     QYLKGAPYNLPARRLDDVKAAKELDIVWQPK"
     gene            complement(620207..621052)
                     /locus_tag="FTM_0567"
     CDS             complement(620207..621052)
                     /locus_tag="FTM_0567"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate 5-dehydrogenase"
                     /protein_id="ACD30568.1"
                     /translation="MSDLFKIPLNTKTKLLFSTSGSNSSIQRHNTAIQKLGFNLCYFT
                     FSGQISAQIYTDAIRAPFVNGGTVTAHNGLKSKVIPFLDYVEPLAKQTLAVNTIINKD
                     GKLYGYNTDCYGLHTALTKGIKESKQDIKTAIIYDNGGVSGVAFKVLQDLGIKVTIVG
                     RNADKVAQKRKELGIENIPHFEAPYDLVIDATPISSSPELEQNTQFIDLVKHAKIVFC
                     HAMPEKDNKKNYLLEYCNQNGIFYISGEDMYIAQLIKQYKLYFENLDSQRKITEENII
                     EAWGL"
     gene            complement(621078..624290)
                     /gene="glgX"
                     /locus_tag="FTM_0568"
     CDS             complement(621078..624290)
                     /gene="glgX"
                     /locus_tag="FTM_0568"
                     /codon_start=1
                     /transl_table=11
                     /product="pullulanase"
                     /protein_id="ACD30569.1"
                     /translation="MQATNQNIWIQDKFGNFTHLNATHQVYLDFETNSIRFRIQADGF
                     LHGYVIANFNNWQKLEEYKLTWTTDNDDGSLWLTKDVFNISTLNAGTNQYSFILVSLA
                     GEEFKVSINDHDLIPLSFNWQVAKGTLEIKASENYVVSGFNLELIAITKSITGYQNIV
                     DVEWQVSPQNSKITLTNGKLLIDPSVSNLTEVKVSCFAKNNPDLKAERIFTVIKEKRK
                     GSLVHFIKKDQQYKGENFDWDLWNFNKNKPAYSVSLSHRSDFGLYGLCQKKNVIARKR
                     IWDINWHNDWVEQTSCFKISKKHQNYYIVHGDATIYRSLEDVINKTNPRIIHAVMNEA
                     SRIIAYLSDILRIGTSFELWVNSKKVENVGLIVKHRSKQLIFTGLPPINPHDLVEIRA
                     NNTFSAAKVLMGEYLNNFYYPNNIGVSFSDELISLRIWSPTAIKVEVLIYNEDLDNNK
                     KQPDVVHELTAERSYGTHHIEICRKNYENKYYIYRLYFEDLDNKGQRCIKTTYAVDPY
                     AYGVGLNGRKGFLVDLNNPKVTPEQWQQSHNPNCLNREDAIIYEAHLRDFTISPESGV
                     SEELRGKYLGAVENNTYYIDSATNQKVSTGIDSLVELGVTHIHLLPIFDFSSVNEEKN
                     NEKDNRNWGYDPQNYNAPDGSYSINPYDPLQRIRGARNMILGFHQKGIGVIMDMVYNH
                     MTETSNLDKIVPKYYFRTDALGNFTNGSGCGNELASEKPMVSKFIQDSVIHWVKNYKI
                     DGIRFDLMELIDINTIKNIVSKVKQINPNVIIYGEPWKGGDSPLINGTHRGTQRNQQF
                     SIFNDYFRDAIRGNNNPGNGFINGDPHNPSNISNVIEGLRGSIYSLTAMPGESVNYID
                     AHDNYTLWDQVEKSQSHDIPQGYYRKNLPENIFEHRFIRQNALALGIILTAQGIPFIH
                     GGSEFLRTKQGDHNSYKSGDNINAFHWSDKLRYKAFFDYIAGLIRIRKEHPAFRMRDR
                     ETIEKHLNMTTAHHDSKSGVIISHFKNNANGDSWQDIIVIYNATSIDGYDVNALMPIP
                     AGKIWHIVANHEKAGVDTIQTVNSSELPGLKSYSLMIIHS"
     gene            complement(624324..626246)
                     /gene="glgB"
                     /locus_tag="FTM_0569"
     CDS             complement(624324..626246)
                     /gene="glgB"
                     /locus_tag="FTM_0569"
                     /EC_number="2.4.1.18"
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-alpha-glucan branching enzyme"
                     /protein_id="ACD30570.1"
                     /translation="MKNKNSEQNTHSTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGI
                     EGIRFTTWAPNAKSICVIGDFNYWQVEDKNYMEPITDAGLWSVFIPNAKNGDKYKFVV
                     TNKDTNNYVYKSDPYAFFSELRPNTASIITTETQYTWSDDKWLEKRAKTNYYDNPMNV
                     YELHLASWKTKNGKFLTYDELNETLPQYIKEMGYTHVEFMPLHEHPLDASWGYQPTGF
                     YSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPT
                     KAINKGWGTHNFDLGRNEVKCFLISNAMYWINEFHIDGLRVDAVSNILYLNYDREDGQ
                     WIPNIYGGHENLEGIAFLKELNGVLKHTCKGVITIAEESSSWPDISTPVEKGGLGFDF
                     KWNMGWMNDTLRYISLDPVYRKYHHNLITFSMVYHYSEKFILSISHDEVVHGKKSLIN
                     KMWGDLWNKYAGLRLYMSYMIGHPGKKLIFMGSEFVQFVEWREYEQLQWQVVDQYESH
                     KQTLHFFKKLNDLYHNETALWQCDYDHHGFRWIDADNSQQSILSFIRSSKDNKQKLIF
                     ICNFTPVTYYDYHLGVPDAGSYKEVFNSDNLEFGGSGQVMATEIFSSPQSSHGFEQRI
                     TIKIPPMATLVLKLIK"
     gene            626548..628182
                     /gene="pgm"
                     /locus_tag="FTM_0570"
     CDS             626548..628182
                     /gene="pgm"
                     /locus_tag="FTM_0570"
                     /EC_number="5.4.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucomutase"
                     /protein_id="ACD30571.1"
                     /translation="MAIQTVSTKPFANQKPGTSGLRNKVIAFQQPRYLENFVQSIFNS
                     LDDIEGKTLVVGGDGRYYNDVAIQIIVRMAAANGFAKIIVGQNGIFSTPAVSCVIRKY
                     EAFGGIVLSASHNPGGPKGDFGIKYNVSNGGPAPEKITDRIFSETKKINQYFISDAAK
                     ESVDLDKLGTYKIENTTVEVINSVIDYAELMQQIFDFDKVRELFAKGFKVRFDSMCAV
                     SGPYAKYIFETLLKAPAGTVVNAQPLEDFGGFHPDPNPVNAEDLVKHMRSGKYDFGAA
                     SDGDADRNMIVGKQIDVSPSDSLAIMAANAHLIPVYSKGIKGVARSMPTSTAVDRVAE
                     SLRLPCFETPTGWKFFGNLLDAEKITLCGEESYGTGSNHIREKDGVWAVLFWLNLVAV
                     TGKQVDQLVEEHWQKFGRNFYSRHDYEAIDTAIANSIIDSLRERLSSLVGAQLNDEKV
                     AKADDFSYIDPIDGLVSNHQGIRIIFEDGSRIVFRLSGTGTQGATLRIYLEKYESDSS
                     KFSIPTQQALASLIEIAEDLTNIKSLTGMTEPTVVT"
     gene            628216..629487
                     /gene="glgC"
                     /locus_tag="FTM_0571"
     CDS             628216..629487
                     /gene="glgC"
                     /locus_tag="FTM_0571"
                     /EC_number="2.7.7.27"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate adenylyltransferase"
                     /protein_id="ACD30572.1"
                     /translation="MDNHNSSHQLYKKAMALVLAGGRGSRLYNLTDTRAKPAVYFGGK
                     FRIIDFALSNCLNSGIRRIGVVTQYKSHSLLRHLQRGWGFLRGELNEFIDLLPAQQRV
                     DEEHWYRGTADAVYQNIDILRSYGPEYVIVLAGDHIYKMDYSIMLRDHAQSGYKCTVG
                     CVEIAKGEAYAFGIMGIDENRKITSFIEKPKKNAPTIPGTTDRCYASMGIYIFNSDYL
                     YDLLEEDITNKESSHDFGKDIIPRVVSENQALAHPFSMSCVPRGEGIEPYWRDVGTID
                     AFWEANLDLAANMPELNIYDKDWPVWTAQEQLPPAKFVPDRNGNHGVITNTLASGGCI
                     VLGSEISKSLMFSKVRVLAGCKIDQCVIMPEVVVGENCRLKKVVIDKGCDIPAGMVIG
                     EDPIEDAKNFYRTDKGVVLVTKKMIDELKEK"
     gene            629497..630966
                     /gene="glgA"
                     /locus_tag="FTM_0572"
     CDS             629497..630966
                     /gene="glgA"
                     /locus_tag="FTM_0572"
                     /EC_number="2.4.1.21"
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen synthase"
                     /protein_id="ACD30573.1"
                     /translation="MRVLHVCSELYPILKTGGLADVTAALPPALAGFGVDSRVLVPGF
                     PAFINAIKDKQLLINIPSRFGAEEINIFLAKISNTKIDIYVIDAPSLFARPGNPYADS
                     SNQAYADNYLRFALLGWVAARISEGLDAKWKPEIVHSHDWHAGLVPAYIKASELASGK
                     KAVKTVFTVHNLAYQGLFPMSVFAELDLPGIFLSMNGLEFYGQVSFMKAGLYFADKIT
                     TVSPTYAKEIQIYEQGCGLEGLLADRHNDLYGVLNGVDPQIWNPKKDSLIATNYSSTT
                     VATGKAKCKLALQQMMGLAEKEDALLFGIVTRLTEQKGLNLLIEAIGEITSRGGQIVL
                     LGSGDKALEEVFLAAAKKYSKSIAVQIGYDEEQAHRIIAGSDVIMVPSRFEPCGLTQL
                     YGLTYGTLPLVHKVGGLADTVIDSSLENLADGTATGFVFDEFSVESLTLVIRRAFALY
                     NRKTDWKKVRKTAMQQQVTWDSSAEKIYQIYKNLVRENN"
     gene            631071..633344
                     /gene="glgP"
                     /locus_tag="FTM_0573"
     CDS             631071..633344
                     /gene="glgP"
                     /locus_tag="FTM_0573"
                     /EC_number="2.4.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen phosphorylase"
                     /protein_id="ACD30574.1"
                     /translation="MNEKNQIKLHLEKILNCDVSAANDQDLYYALLTYAKDQTAKLPE
                     QDYKKKIYYISSEFLIGKMLISNLINLGVYNEVCQILKESGKDIVQIEEFEPEPSLGN
                     GGLGRLAACFLDSIASLGIPGIGISLNYHYGLFKQKFKNHCQNEKPNPWIEKLGWLNK
                     KDTSYKVDFNDFSVESQLYEIDVVGYQNNFVNKLCLFDITSVDASVIEDNITFDKTAI
                     EKNLTLFLYPDDSDEAGHLLRIFQQYFMVSNAVSLIFSDITKKGYSLANLPEHAVVQI
                     NDTHPTLVIPELIRQLVANGIDIDKAIELVSKTAAYTNHTILAEALEKWPLRYLEKVL
                     SKEIIDIIKYLDKKVKQQYKQADLAIIDANNCVHMAHICIHYSFSVNGVAALHTDILK
                     KAELKHFNEIYPNKFNNKTNGITFRRWLLQANPELTNYLKSLIGDSFVQDSKQLEKLL
                     AYHNDKNVLAKLDEIKKTKKAQFIEFASYYSGVELLENGIFDVQIKRIHEYKRQQMNA
                     LYIIHKYLEIKSGLYPKPERPINFIFGGKAAPAYIIAKDVIHLILCLQELINNDADVN
                     QYIRVLFVENYNVSIAEKLIPAADISEQISLASKEASGTGNMKFMLNGAITLGTMDGA
                     NVEITDLVGSANIYTFGKDSNTIIDLYKTSGYKAIEYYNNPVIKNAVDFITSPTMLAI
                     GDKNKLTRLFNELINKDWFMTLIDFVEYIKVKDKMLRDYENREDWLRMSLVNTAKSGF
                     FSSDRTIGQYNKYIWKI"
     gene            633388..634851
                     /gene="malQ"
                     /locus_tag="FTM_0574"
     CDS             633388..634851
                     /gene="malQ"
                     /locus_tag="FTM_0574"
                     /EC_number="2.4.1.25"
                     /codon_start=1
                     /transl_table=11
                     /product="4-alpha-glucanotransferase"
                     /protein_id="ACD30575.1"
                     /translation="MRKAGLLLAISSLPSWFGIGDLGKSAYEFVDILKQASIRIWQVL
                     PLTTLGFGNSPYQSSSSFAGDEIYISLEKLADYGLLEESSLKKLNANSKKVEYELVRN
                     FKDNYLEEAFSNFQSSKDKFEQEYNDFITQNSWVKNYAIFKAFRKVNNNQAWNFWPAE
                     YKNWVKEKAIELDQFQQEIDYQIFLQFIFYKQWFELREYANKNNIEIMGDLPIYLGFD
                     SADVWEHQEVFLLDEDQNPSFVAGVPPDFFSETGQLWGNPLYDWDKLKETNFDFWIDR
                     LNGNFKLFDIVRIDHFRAFDTYWKILASEKTAINGEWVEAPGYDFFDTVYKRIPDANI
                     IAEDLGDLRDEVFELRDHYNLKGMKVFPFHFDLKTARFIDDANIIAYSGTHDNNTLKG
                     WYFDELNRYQRKLLKRYFKANDKNIFSKIIKYLLSCEAEYVILPVQDVLELDGTARLN
                     TPGTVGAPNWEWKLVDFNLLKSKTNRLAKQVSKSINH"
     gene            634943..635833
                     /gene="glyQ"
                     /locus_tag="FTM_0575"
     CDS             634943..635833
                     /gene="glyQ"
                     /locus_tag="FTM_0575"
                     /EC_number="6.1.1.14"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase, alpha subunit"
                     /protein_id="ACD30576.1"
                     /translation="MLTFQEIILKLHHYWASKGCAIVQPLDMEVGAGTFHPATTLRAI
                     GPEPWTAAYVQPSRRPTDGRYGENPNRTQHYYQYQVVMKPSPDDIQELYLGSLRELGI
                     DPLENDIRFVEDNWESPTLGAWGLGWEVWSNGMEITQFTYFQQVGGLECKPVMGEITY
                     GLERLAMYIQNVDSMYDILWANTQNGPLYYRDVFLQNEVEMSTYNFEEANVEELFKQF
                     DLLEKEGYRLVEKNLPIPAYEFVLKASHTFNLLDARHAISVTERQGYILRVRKLALEV
                     AKEYYSAREKSGFPAFKKDN"
     gene            636044..637483
                     /gene="murE"
                     /locus_tag="FTM_0576"
     CDS             636044..637483
                     /gene="murE"
                     /locus_tag="FTM_0576"
                     /EC_number="6.3.2.13"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
                     6-diaminopimelate ligase"
                     /protein_id="ACD30577.1"
                     /translation="MKRINQILKFLDIKTLSQNNFQIESLYLDSRKCDKKSVFVALKG
                     LSTDGNKYIDSVLAKGVSLVLTDSHEFEDQKRVFYIQNLKEKLSTLAKWFYDYEKPQN
                     IIGITGTNGKTSISSYIAQFLDLSAQKTLLLGTNGNGIYPDLRESTHTTLDILSLYKT
                     ISYYKNYQNLVMEVSSHSLDQKRVEGLDFDVAIFSNLSHDHLDYHKTMDNYFEAKAKL
                     FQFKRLKKAIINIDDEYGQRLCNMTQVPVITVSLKSEYADVYIKPKSIEGIKTKFEMF
                     FNGRFVGEYTTKLIGDFNLMNLGLSFASLDGVLDWDCILDLGNIKPVKGRMEVIELDN
                     DIKIVIDYAHTPDALEKALQTLNSYNPNNLWCIFGCGGNRDTSKRPIMAQIAEEYASK
                     IVITEDNNRFESIENIFSDIRKGFKYPQKHIFITSREQAIRFSIENANQGDIILLASK
                     GHECYLDKNGAKEYFDEREIIKNMPEHSL"
     gene            637563..637922
                     /locus_tag="FTM_0577"
     CDS             637563..637922
                     /locus_tag="FTM_0577"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein"
                     /protein_id="ACD30578.1"
                     /translation="MVMILLASCSSVELKPIANKVEISRAAPAKDCKFVNTITATQGN
                     FFTGAFTSNNNLQEGAYNKVRNEAAEMGGNYIQLISSQAGNTGEGSGFNGDYNSSYQQ
                     TNYTVTGSVYNCPSNNS"
     gene            638274..639632
                     /gene="murF"
                     /locus_tag="FTM_0578"
     CDS             638274..639632
                     /gene="murF"
                     /locus_tag="FTM_0578"
                     /codon_start=1
                     /transl_table=11
                     /product="d-alanyl-d-alanine-adding enzyme"
                     /protein_id="ACD30579.1"
                     /translation="MIKSLKQLAIQAGLEYLGEDVSIQTVAINSNEVRQDCLFVAIVA
                     NRDGHEFIPSAIANGAKAILVSKKQGLDIPQVVCGNTIKGLRALAKEYRKSLTMPIIS
                     LTGSCGKTSVKEMIVTLLGERKVHFTQGTLNNYLGVPMTILETPHDVDFAVIEAGTNV
                     GGEIKAAADIIQPNIAMITNVGACHLENLKTLDGVMIEKGELLKALPRDGFCIVNLDD
                     ERIPNYAKLLECKKISCSMTNPKADILVLDYRATSNSYAFKIRIFSQEYDYQLPNIGK
                     HNLLNSVLAIASVVAVGLEPKDFLQNTQNIKNYKGRFSTEKLSDKLTLIDDTYNASAG
                     AVQAAIEDLAEFDGKKILAISSMRELGDEAENYHRKMGQWLKKANLDKIFLFGEKNLI
                     DYVLAEYSNQNAKYYESKDELNNDLAKILDEYKSQSTKLTVKGARSFKMEEVVKFVKE
                     NL"
     gene            639641..640459
                     /locus_tag="FTM_0579"
     CDS             639641..640459
                     /locus_tag="FTM_0579"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30580.1"
                     /translation="MKRLFAILVFVLLVSVSFGKDIIKYPLIESNVLCDSVRPFCGDN
                     CSNMPFYPTLCKPTEYGSAWSGGGATTATKQLYCAKATYANCHYSGSPKATGINPNNQ
                     VMPCKVSEDGKTANCRCKVFTGPNYVNIDGIMNLGVYYKTVAVCGKDGSKCKNLFTCL
                     PDGSGDCKGVEAPVCKYIANQNTQDDSISFIPGADLISTYGFDMNKDYDIAKPGEGVK
                     CQNIDVAGCMTQPCKYEKGSKEYATCSCPITNMKTMMLSQKGVSCDLPKGYVWE"
     gene            complement(640508..641586)
                     /gene="asd"
                     /locus_tag="FTM_0580"
                     /note="aspartate semialdehyde dehydrogenase; frameshift"
                     /pseudo
     gene            641682..644102
                     /gene="thrA"
                     /locus_tag="FTM_0581"
     CDS             641682..644102
                     /gene="thrA"
                     /locus_tag="FTM_0581"
                     /EC_number="2.7.2.4"
                     /EC_number="1.1.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate kinase I/homoserine dehydrogenase I"
                     /protein_id="ACD30581.1"
                     /translation="MIVHKFGGSSLATAEKIKNVSNIINCKDEAVVVSASAKTTRNLQ
                     KTIDQATIAQDYSKTLEQIYEHHNEIIKQLIPNDETLRTLIVTDLANIKHILSTITIT
                     GFCADSLRFFILGFGEIWSARILTTYLKSKGKKAAFIDASECLIVNDRSYPVTVDWQQ
                     SLEKLEIIKSDTPADVYVITGFIAQNKYGKRTILSLNCSDYSAAIFAKLLQANKLYIW
                     TDVAGVYSANPQVVPEAKPLTQLTYKEALELAYFGASVVHPLTIAPMALDRTPIYIKS
                     SYTPDEVGTKISADKDENQGIIKGLTSVSDVAIVRVQGAGMIGVSGISFKVFGALEKA
                     NVSVMMISQASSEYSICFAIDNLDVDKATEALRQEFANDIKNNLIEEIIVHKHYSLIT
                     AVGEGMKSKTGSLAKLVNSLKLANINIHAIAQGSSERSVTFAVKAEDEVRGVQAMHRH
                     YNSVSDDIAIAVIGAGNIGKAFIRQLKQTYEKWYAKGINLVLISATNSKKMRFSYENL
                     LFENINSLLEKNTEQINLEKLAEFMSHASATKKIVIDATASESVSKNYISFLQKGISV
                     ITPNKYANSGNYEFYQELRKVAKQNGTSFLYETNVCAGLPLIVTLQNMVQSGDHVRTI
                     KGIFSGTLSYLFTQLNNGVVFSDAVKMAYDAGYTEPDPRQDLSGMDVARKTVILAREI
                     GLNIGLNDLVIENLVPEELRECSVEEFFAKLPAFNEQIMQQIADKKKNLAGVHYVGSI
                     VNGTANVGIQAYDESSPFANVKGTDNIVMINTDRYTQPMVIQGAGAGVEVTAAGVYAD
                     VITVIRER"
     gene            644105..645058
                     /gene="thrB"
                     /locus_tag="FTM_0582"
     CDS             644105..645058
                     /gene="thrB"
                     /locus_tag="FTM_0582"
                     /EC_number="2.7.1.39"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine kinase"
                     /protein_id="ACD30582.1"
                     /translation="MKLANIKSAKAFAPATSANFAVGYDLLGFAIDGVGDIVELIKRD
                     DTELVIKQISGATGADKLPFDSDKNVATAVIKKFLADRDIKIGFDVYIQKGITLGSGM
                     GSSAASSVAALVAMNAFFETPYNYDDLIDYAIYGESLISGSFHGDNAVPCMFGGLVLL
                     QSSKPCKKIDLPIVDCNVVIVCPDLSIETKKARELLKDPYDLSTIVEHSAYLAATISA
                     LYTQDIELLGQSLKDILIEPRRSKLITGFYDVQKAAYATGAIACGISGSGPTMFALVR
                     KQHDANIVTKAMQDKFKEFNLNSNSWISAMSDKGAYILEKK"
     gene            645071..646355
                     /gene="thrC"
                     /locus_tag="FTM_0583"
                     /note="threonine synthase; frameshift"
                     /pseudo
     gene            complement(646456..646686)
                     /locus_tag="FTM_0584"
                     /note="Beta-galactosidase I; fragment"
                     /pseudo
     gene            646942..647430
                     /locus_tag="FTM_0585"
     CDS             646942..647430
                     /locus_tag="FTM_0585"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine decarboxylase"
                     /protein_id="ACD30583.1"
                     /translation="MIIQNTTAILDSNLKNKEMGSGKWPEHNNQICDNLHQDHFIQES
                     VRYAGNHLIVDFWGASKLDCLETMEVAMREAVEKAKATLLHIHLHHFTPNGGISGVAV
                     LAESHVSVHTWPEYGFAAFDIFMCGDSKPNKAIEVLESYFKPKTNNVSKFRRGEVVEV
                     VN"
     gene            647430..648299
                     /locus_tag="FTM_0586"
     CDS             647430..648299
                     /locus_tag="FTM_0586"
                     /EC_number="2.5.1.16"
                     /codon_start=1
                     /transl_table=11
                     /product="putative spermidine synthase"
                     /protein_id="ACD30584.1"
                     /translation="MIANINNKKIFHETLYHSYHQSIAISEILYEHKTDYQHLVIFNN
                     PIFGNVMVLDGIVQTTEKDEFIYHEMLVHVPVIAHGNVKNILIIGGGDGGMLREALSH
                     KAVESVTLVEIDQAVIDMCQEYFPGHSKGAFDHPKAKIVIQDGCEFVKNPPRKYDLII
                     CDSTDPIGPGEVLFTSKFYKDCKEALNPGGIMVTQNGVIYFQIDELKKTLERFEPLYK
                     DVSFYTAAVPTYVGGSMAFGWGTDELSYRNHDIQVIAQRFLKSGIKTKYYNPAIHIAA
                     FALPQYVIDTLKK"
     gene            648325..649734
                     /locus_tag="FTM_0587"
     CDS             648325..649734
                     /locus_tag="FTM_0587"
                     /codon_start=1
                     /transl_table=11
                     /product="putative arginine decarboxylase"
                     /protein_id="ACD30585.1"
                     /translation="MNKNLFLTANLSEYFSYNSLGQLCINYADGYRKTIPIVDFLQQA
                     NFQGATYPLVLYFEHILKNQLDKLYTSFGKAIDDFSYTGKYSLAYPIKVNPEQKIIKA
                     IYDYHQHNQVSLDYEVGTKSEFLAVLSTAAKTQKIICNGFKDLSFYKIAQLAAKIGYK
                     IIIVIENISEINIIQDLLDNNVNIKFDFGIRTKPFDNCIHTQKFGLSLSQINKCINFL
                     KTNQLQQKLLLLHSHIGSQLKSTDKVVANIQRLMRIYSELKSDFVNLEYIDFGGGLAV
                     NYDEYDRPSYDFDSYAKNIIKNCKYYAEYYNCDMPSIVTESGRAITAESSLLITKPLI
                     KQHESDIENEILHQQWLDREVSLGELQSYLPQNQKNTQQAWLNFSIFQSLPDHWGIDQ
                     KFPILPLEFFNSYVTSEVKLYDISCDVDGVVKSTSEYIEIATDNIEYIVFMCVGAYQG
                     MLSAKHNMLGNISAVNIYI"
     gene            649957..650942
                     /locus_tag="FTM_0588"
                     /note="conserved hypothetical protein; frameshift"
                     /pseudo
     gene            650944..651804
                     /locus_tag="FTM_0589"
     CDS             650944..651804
                     /locus_tag="FTM_0589"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase, carbon-nitrogen family"
                     /protein_id="ACD30586.1"
                     /translation="MANIKVAVVQLSFNDNEAENLAKLESKIIQAAKNGAKIILTPEL
                     PSYLYFCKKQNSKYFDLAKTIDESPIVKLYKLLAHKYNIVLPASFFERDGNACYNSIA
                     MIDADGSIMGVYRKAHIPDGIGYQEKYYFSPGSAGFKVWDTKYAKAGVGICWDQWFPE
                     AARVMALKGTEILLYPTAIGSEPHLPDYDSKDHWQRVMQGHAAANMLPVLASNRYATE
                     ANDDITATYYGSSFITDHTGDKIAEADRSGDDILYATFDFAELQQQRFYWGLFRDRRP
                     ELYDEIVRKY"
     gene            complement(651821..652537)
                     /gene="lpxH"
                     /locus_tag="FTM_0590"
     CDS             complement(651821..652537)
                     /gene="lpxH"
                     /locus_tag="FTM_0590"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-2,3-diacylglucosamine hydrolase"
                     /protein_id="ACD30587.1"
                     /translation="MAHNKDIYLISDLHLNANHAEMADLFKKFLDSITSTQNQLFILG
                     DFFDYWIGDNHRDDFYHKITNWLKEASDQGLEIFFMYGNRDFLIGRKFAKQSGVTLIK
                     DPYYIDISKQKILFSHGDLFCTDDKSYQIYRKWIAYNPILRFIFRRLPLFIREYTARN
                     VRKASYVKNRKNPNVDVTTKGIEKYRKDCDIIIHGHTHKMAVHIADNYTRYVLGDWFK
                     DGNYIKISKNGEIMQVRTLN"
     gene            complement(652527..653153)
                     /gene="pyrE"
                     /locus_tag="FTM_0591"
     CDS             complement(652527..653153)
                     /gene="pyrE"
                     /locus_tag="FTM_0591"
                     /EC_number="2.4.2.10"
                     /codon_start=1
                     /transl_table=11
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="ACD30588.1"
                     /translation="MFIEFALKNQVLKFGEFTLKSGRISPYFFNAGLFNTGAQLATLA
                     DYYAQLIIKSDVKYDILFGPAYKGIPLVAAISTVLALKYNIDMPYAFDRKEAKDHGEG
                     GVFVGADMTNKKVLLIDDVMTAGTAFYESYNKLKIINAKIAGVVLSIDRQEKAKDSDI
                     SATKKISQDFNIPVLAVTNFESIFEYVKENLDETMIDKFKQYRQKYGS"
     gene            653313..654683
                     /gene="mpl"
                     /locus_tag="FTM_0592"
     CDS             653313..654683
                     /gene="mpl"
                     /locus_tag="FTM_0592"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase"
                     /protein_id="ACD30589.1"
                     /translation="MSKHIHILGICGTFMGSLAVLAKQKGYKVTGSDLNVYPPMSTYL
                     ESQGIEILQGFDCDQLDTNPDEIIIGNIMKRGMPIIEKILAEKLNYFSGPEWLYQNIL
                     KYKKVIAIAGTHGKTTTTTMTIKILEQAGLNPSFLVGGVSSDFGVSSRYTDSEYFVIE
                     ADEYDTAFFDKRSKLIHYDPSIFVINNIEFDHADIFKDIDAIFWQFHQLLRKMPSTAK
                     IIYNAKDDNVQKIISMGCWSELVKVNSDLGISITKHTLDYSKFELCDINGNSVEVSWG
                     LIGEHNALNAMSAYAVAKQLNISDEMVKDALESFRGVKRRLEVLSHQDNVTLYDDFAH
                     HPTSIKLTLEAVRNKAKDAYVVALIDPRSNTMRQGDNKDNLPMSIIEADRVLLYNHSL
                     LKWDAKEVLKNSNNVDFIADVDDFVDCVDKLLTKHQDRNIQLVMMSSGSFDGLREKLV
                     KLLEIK"
     gene            654680..655309
                     /locus_tag="FTM_0593"
                     /note="23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
                     IS insertion, fragment"
                     /pseudo
     mobile_element  complement(655314..656064)
                     /mobile_element_type="insertion sequence:isftu1"
     gene            656238..656537
                     /locus_tag="FTM_0594"
     CDS             656238..656537
                     /locus_tag="FTM_0594"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, ArsR family"
                     /protein_id="ACD30590.1"
                     /translation="MDLMQMKDNASEASSLLKAISHESRLLILCLLLRREMTVGELAE
                     YSSLSQSAFSQHLSVLRNNGLVKCRKEAQNVYYSINDPSVTKILEALYSIYCGDK"
     gene            656603..657122
                     /locus_tag="FTM_0595"
                     /note="rhodanese-related sulfurtransferase; frameshift"
                     /pseudo
     gene            657147..658831
                     /gene="naoX"
                     /locus_tag="FTM_0596"
                     /note="uncharacterized NAD(FAD)-dependent dehydrogenase;
                     frameshift"
                     /pseudo
     gene            658880..659566
                     /locus_tag="FTM_0597"
     CDS             658880..659566
                     /locus_tag="FTM_0597"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent hydrolase"
                     /protein_id="ACD30591.1"
                     /translation="MIFRQLIDRDTYTYTYILACEQTRQAVIIDSVRFNVNQYLKLLK
                     ELDLKLIYAIDTHVHADHVTAAGILRKETGCDIVIGGESKAECATKKVFDGDILEFGN
                     YQLKALYTPGHTDDSYCFITENMLFTGDTLLIRGSGRTDFQNGDSYAAYDSIMNKLMT
                     LPGSTIIYPGHDYNGITSSSVAEERQNNPRLKVKSPDEYAKLMADLKLPPPNYIDIAV
                     PANLKCGIEE"
     gene            659568..660316
                     /locus_tag="FTM_0598"
                     /note="conserved hypothetical membrane protein;
                     frameshift"
                     /pseudo
     gene            complement(660309..660929)
                     /locus_tag="FTM_0599"
     CDS             complement(660309..660929)
                     /locus_tag="FTM_0599"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="ACD30592.1"
                     /translation="MGIIMSDLIAINPFYEKIINDYLNKDFCIIDNWLTTDETDKLRQ
                     QLEELYQANYFKKSAVGNRLNENLERSIRSDFIFWLDETKYAQVFFEKINSFIEYINK
                     TCFAGIVTKEFHYAVYPQGSFYKKHIDTFQNDDRRTISVVCYLNQDWQDCFGGQLKLY
                     LKDQTLEIFPTDGKIVLFDSKSIEHEVLPVLTENKRLSITGWLKAN"
     gene            complement(660969..661418)
                     /locus_tag="FTM_0600"
     CDS             complement(660969..661418)
                     /locus_tag="FTM_0600"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30593.1"
                     /translation="MMSKWWQQIDLKDMSSEQWESICDRCGLCCLNKLQDDETDEVYY
                     TRVSCKLLDIGKCQCSMYQKRKQLVPECVNLTYKQLKNHAHKWLPNSCSYKLLFEGKD
                     LPDWHHLNTSSTEEMHKQKKSAKHFAISEYELDVDEYLEDFIIKIDN"
     gene            complement(661637..662148)
                     /locus_tag="FTM_0601"
                     /note="protein of unknown function; frameshift"
                     /pseudo
     gene            complement(662165..662566)
                     /locus_tag="FTM_0602"
     CDS             complement(662165..662566)
                     /locus_tag="FTM_0602"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30594.1"
                     /translation="MKFNIICMLDLAFILSSCVSNTNPENVSFVKTPYTSGNVSLTLK
                     KGVTTKDQVINAFGSPNIVTQNADGESVWTYQTNATVENNAARDGFLTLLITGENTEE
                     SGFMQSQKTMTIIITFKGNVVSDYKSLSTNF"
     gene            662753..663178
                     /gene="nusB"
                     /locus_tag="FTM_0603"
     CDS             662753..663178
                     /gene="nusB"
                     /locus_tag="FTM_0603"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination factor NusB"
                     /protein_id="ACD30595.1"
                     /translation="MKTTARARNNARLYAVQALYQKKIADNTFSELKIQYYADNADRH
                     YTDWDLFYRLIDAVKTNQDTIDKYIKENSSNGVESINYVDYAVLQVAIAELIECLENP
                     YQVIIKEYVGICYSMGTEEGYKFINAVLQNLAKSIRGEE"
     gene            complement(663162..663932)
                     /locus_tag="FTM_0604"
     CDS             complement(663162..663932)
                     /locus_tag="FTM_0604"
                     /EC_number="3.5.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-nitrogen hydrolase"
                     /protein_id="ACD30596.1"
                     /translation="MSKLKVSVIQSDIIWADKQANYNNLENSIANIDQDTDIIVMCEM
                     FNTGFIMNPTDQASTQQDIVNWMYRQVKGKNYAIVGSAATYSDDKIVNRLYFVTPEKQ
                     VYTYDKNHLFIHAGEDKKYTAGNKRQIINYKGFNILVTVCFDLRFPVFNCNNNDYDIL
                     INVACWPESRRQHWQALLKARAIENQAFVVACNRVGNDPNFNYAGDSMIIDYNGDILA
                     HQEFKQATLSATLDKNKQLQHRSKFNFLASQDKFTLHL"
     gene            664101..664514
                     /locus_tag="FTM_0605"
     CDS             664101..664514
                     /locus_tag="FTM_0605"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein, putative"
                     /protein_id="ACD30597.1"
                     /translation="MKGLKAKIYIIFLAAVLAVISGCATDKGTQYKDGYYITTLNYNF
                     NTVYNATLQAIQNGQTFDYKSNPYDISVNKNNGTDAEIVSASDSDSTDSLQVTMKKLP
                     NNATRISIKYGSQGNSIRSSALIGIIEGNIRYANT"
     gene            complement(664550..665991)
                     /locus_tag="FTM_0606"
                     /note="hypothetical protein; frameshifts"
                     /pseudo
     gene            complement(666059..667192)
                     /locus_tag="FTM_0607"
     CDS             complement(666059..667192)
                     /locus_tag="FTM_0607"
                     /EC_number="2.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate/tyrosine/aromatic aminotransferase"
                     /protein_id="ACD30598.1"
                     /translation="MIQAKSYIDTTPSVYGKFALMANEYKALNFTQGAPDFDTPEWLI
                     ERTNFYIQHGKNQYSPIPGAVALRNAIVQKTKRCYDTDITIDNVAITAGAQEGLFCII
                     SAYVGQGDEVIMFDPIFDTYAGVTKFNQGKCVRLKLLPNGKIDINAIANAITNRTKLI
                     ILNSPHNPMGTVISKDEFKEIAKIVKDKDILVISDEVYEHIYAGESFISAIQIPELHH
                     KLVVLQSLGKTYNVTGWRQGVTIAPPQVIQNMLAIKQFATFSAVHPMQLALAEGILEH
                     PEYYENLHKLYKKQNQLLREHLKDTRFKILDWQGSPFQILDYSNISNQDGDKFASNLI
                     KEHGVGLVPISSLFETPQDGLLRLCFAKKDHDIIKGAKILANI"
     gene            complement(667338..669035)
                     /gene="proS"
                     /locus_tag="FTM_0608"
     CDS             complement(667338..669035)
                     /gene="proS"
                     /locus_tag="FTM_0608"
                     /EC_number="6.1.1.15"
                     /codon_start=1
                     /transl_table=11
                     /product="prolyl-tRNA synthetase"
                     /protein_id="ACD30599.1"
                     /translation="MKATQTLIATTKELPKEAVLISHQYMLKAGLIKKLASGIYTWMP
                     LGLKVLQKIQNIVRDEMNKAGASELLLPSILPSELLQETHRWDKFGPELLKLHDRHNR
                     DFCYGPTHEEPIVDMARDTIKSYKQLPLNLYQIQTKFRDEIRPRFGVMRAREFIMKDA
                     YSFHENSQCLRNTYNTMYATYCNILDKIGLAYRPVKADTGAIGGDNSHEFQVLANAGE
                     DIICYSNGSDYAANIELATYAKPDLSKRVNSQNTIEKIHTPNIKTIEKLYKEMSFDIK
                     KTIKTMVIKDAGGNFFALVIRGDHELNETKINKLDQIIAPYTLATKEEIFSIFNANPG
                     SLGIYNCPISIIADYSAIAITDLVCGANEDDYHFTNVNWDRDVTNYQIADIRNVVTGD
                     ISPDCKGTLELTNGIEVGHIFELEDVYSKPMNANIIGQDGKSKPMLMGCYGFGVSRVM
                     AAAIEQSHDENGIIWPESIAPYQVAILPINYNKSDKVKEVADKLYQDLLGDGIDVLLD
                     DRGARPGVMFADADLIGYSHHVVIGDKLLEQGLIEYKNRKTQEKQEITIAELIKILK"
     mobile_element  complement(669299..670455)
                     /mobile_element_type="insertion sequence:isftu5"
     gene            complement(671064..671291)
                     /locus_tag="FTM_0609"
     CDS             complement(671064..671291)
                     /locus_tag="FTM_0609"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30600.1"
                     /translation="MNFLKTVSQIKIVVVLSKLLISSTGISKSSHLSPVLGCIYLHEL
                     DIAMDKLDIIYKNMLMILSSWKKLKTNCVKL"
     gene            complement(671623..672159)
                     /locus_tag="FTM_0610"
     CDS             complement(671623..672159)
                     /locus_tag="FTM_0610"
                     /codon_start=1
                     /transl_table=11
                     /product="disulfide bond formation protein, DsbB family"
                     /protein_id="ACD30601.1"
                     /translation="MKQDILDFFDSLAIIGISIILAMAFYYQLFLQELPCALCVFQRM
                     ALSLLTFGLLLNLTHGNNYKHYLLIILVALLNAAMAITQILLHIVPGTGNYGEAVFSL
                     HMYTWNFIVSIIFILYAAICGLITPNENKKKKLSILAKLAIILILILTVANTLNVFVE
                     CGPHLCPSDPNSYWLFNR"
     gene            complement(672564..672639)
                     /locus_tag="FTM_0611"
     tRNA            complement(672564..672639)
                     /locus_tag="FTM_0611"
                     /product="tRNA-Asn"
     gene            672866..673282
                     /gene="sufE"
                     /locus_tag="FTM_0612"
     CDS             672866..673282
                     /gene="sufE"
                     /locus_tag="FTM_0612"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur acceptor protein SufE"
                     /protein_id="ACD30602.1"
                     /translation="MENQVVQKQQELVEELSFFEDWEDKYDYVISLAKQLPEFPEEKK
                     TEENLVKGCQSQVWFDSNIDQGKLNFIATSDALIVSGLIGMLLRVYNNATPAEILASN
                     TDFIKQIGFGNNLSTTRANGLKSMLDYIYATAKQNQ"
     gene            673283..674032
                     /locus_tag="FTM_0613"
     CDS             673283..674032
                     /locus_tag="FTM_0613"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen III synthase"
                     /protein_id="ACD30603.1"
                     /translation="MKILVCRPQNDAVNLTEKLCANGLLAVSLPTIKICYQKITESVL
                     DYTSLVFTSKYAVESLFSQYPIDLFKNKKIYSVGASTAAILEKYQLAAIYPVRHGSQE
                     LLDIILNQDISKEKFAIISGVSGNDLLLEELSKLTHCHKFETYLRVFIDLDELLDTYN
                     KLFLHNQPDIIIATSLDVFKSLNRIFEKITTPKAATITIASLKMLKFVNQQGFKNTLK
                     LEKLDNSYICQRILEFTEAKDVSRKKHPATK"
     gene            673998..675083
                     /locus_tag="FTM_0614"
     CDS             673998..675083
                     /locus_tag="FTM_0614"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30604.1"
                     /translation="MSVEKNTQQQSSTQDNPAKKTARVDNKSSIGGVFAKITLVVSIA
                     ALGLSSYALVNSISQTRNSNANFQTYTAFDKQLKAIKSNQDQQKNISNDLSTQNDALT
                     QSVKALQSQLITINNQIAVPAKDLYVQMSIINIQSAINYLILAKDVMVFDGDSQKASE
                     LVDNAFDKIQASRVASVSASERQNIKSALEQYSSRDEIIKEFIAIEQQFAKLQYLTPE
                     NISTTVKSQDSQNKYMKLLSAIVEIQDIPKNQTLVATKQAKEFVADSMYRSLISLQTA
                     MYINNQDAIDKAKNNLIDIVKKYFVQNDDAKKLISAIQGIKAQNLDSFNTSIDKLISQ
                     LSEQQNQLLAQQPNLNKTNISAEGSQK"
     gene            675080..676237
                     /locus_tag="FTM_0615"
     CDS             675080..676237
                     /locus_tag="FTM_0615"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane protein"
                     /protein_id="ACD30605.1"
                     /translation="MIKVFKLIIAVALATLVGIWATKYHCYIMLVLADKTIKMNLVAF
                     VFITFILLFILILGVRIIVSVFRFPYLLFSWVIGLFSVDKQERFADIVADITLENNRL
                     VKKFSIGHILRLTPKHLKEYVLFRKLNLIAVTQDIKELEKALKHIDSKTFTYKFFEVY
                     KLYLVQKFSEAQTKISIMLEKNDPRFMPNIVNLAGNIALADGDDAFALKILEKYDAYL
                     KEDLEENLIILALKSAKDVAKLNDIYNKSDTTKALSTVYLEQLIKFGEMVSAEKFAKK
                     QLANLNISAEMLKLYINAFNMPISRLCDKVLDRANHDYNSILTLLDFAMIKSDNYCFK
                     IIYDYIERHLKDFLSAAELEKYFHILCKFFIKNGEVAGIDLSVTRLVYTNN"
     gene            676251..677009
                     /gene="gloB"
                     /locus_tag="FTM_0616"
     CDS             676251..677009
                     /gene="gloB"
                     /locus_tag="FTM_0616"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyacylglutathione hydrolase"
                     /protein_id="ACD30606.1"
                     /translation="MQIKRWFLNNSLRNYQYLLYDKSHAIVIDPLKSDIFAEFIAKNK
                     LQLEAILITHKHGDHIAGVKKLLAIYLNAKVYAYTGNDLFKPDIYVKDGSFINLGFTS
                     FRVMYIPGHIDDHVCFLFEQERALFCGDTLFNAGVGGVQAESADINQLYDSLVKITKL
                     DGDIKPYPAHDYWLGNLDFALSILADDSYFNYYRNQVAELAAEDKPIVNLAEEAKLNI
                     FIRAMSDKALLKALPDYSLGREMFVKLRQLKNNF"
     gene            complement(677087..677794)
                     /locus_tag="FTM_0617"
     CDS             complement(677087..677794)
                     /locus_tag="FTM_0617"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30607.1"
                     /translation="MKDLSRLDIPKKTAKDNSQEPQQPKNTKKKKILITIVVCLLVVA
                     VASKLVNKHLKKIKAEQEKAKIELQAEKNQKLKTLDNKQSSEATNHQTADLSSKDNPS
                     NDKMVFTFYNNLKHDSVEVDVVPEAQRAQYKYTYIYQIASFRNMDETSWYVKKMKEDG
                     LNPQFERVGNWIRMYIGPYDSKRAMAPDIIKLQRIGLNGGFPREVSRTKIEPKDNNKV
                     SDSKSSDKDLTNNNSKS"
     gene            677903..678127
                     /gene="feoA"
                     /locus_tag="FTM_0618"
     CDS             677903..678127
                     /gene="feoA"
                     /locus_tag="FTM_0618"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe2+ transport system protein A"
                     /protein_id="ACD30608.1"
                     /translation="MTYNKNDKFIVRGFHTNCPAAFKDKIIAMGVIEGQQMTVTNKSI
                     LGGPIAFETNCGAFSLRKKDLEFLKLEKIN"
     gene            678144..679778
                     /locus_tag="FTM_0619"
     CDS             678144..679778
                     /locus_tag="FTM_0619"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30609.1"
                     /translation="MRLRKIFLLTSICTATLATVNLYATPTTTNIQQLSSQQQDRIRS
                     MLKSNLDSLFPYQTQITIGKIDQDNKGTVVASNILIMSNDSENPNLTINKLIFKGLHA
                     NQAINNNFTIKVEGLSIANLAAAVANSNLVSSEVDPKQLADNQGLFSIAMNSLGQTIY
                     NLEINYNYNNSTIDYSLDSTINNKPLLKAAAQLTDIDLSNTNVNTDFLATLLDESMSA
                     KIKTLEFDANFSEVLRDITNKYLGKDYKQTPILNIKAQLGKNPDQLMLNVDGKLGSQN
                     YAKYNIIINGINLASSTINDIVAGSSNALDNAYIQSSTSSSRIELNFARDFFPKGSPI
                     IQVFSALDKNNISFTIVSQHQFEGTSYNTNFYLKADGLASLSANANAVVNGKLNLLPY
                     LGTNAQNQTNLYDCTNQLCLSNVDVKFANYGLLEKVARQTNNDPNTTPQQILGSYGAL
                     LQLFAVQQQDKFLQQTLSAFAIFLQNPKNIAIHAKANKPVNENALLNMLVADAKTLKK
                     YKPVNSNGNVDLRNNPNVKLINNIQNIFKISFDVNK"
     gene            679891..679965
                     /locus_tag="FTM_0620"
     tRNA            679891..679965
                     /locus_tag="FTM_0620"
                     /product="tRNA-Gly"
     gene            679981..680054
                     /locus_tag="FTM_0621"
     tRNA            679981..680054
                     /locus_tag="FTM_0621"
                     /product="tRNA-Cys"
     gene            680060..680148
                     /locus_tag="FTM_0622"
     tRNA            680060..680148
                     /locus_tag="FTM_0622"
                     /product="tRNA-Leu"
     gene            complement(680350..681003)
                     /locus_tag="FTM_0623"
     CDS             complement(680350..681003)
                     /locus_tag="FTM_0623"
                     /codon_start=1
                     /transl_table=11
                     /product="prophage repressor protein"
                     /protein_id="ACD30610.1"
                     /translation="MFNYKTDLKPALKRVGMKQIELAKKLGKSDRTIKGWVAGTNCPS
                     YDGHIEVMRILGLKDNYCPSDTSIITVTNVPVLSYVQAGEFTESQENIDPIDYLQIPD
                     TLVPKNGFSLQVQGESMLYDFSESQLLNPKYSKYTIYEGENILVDPNQVNPQDLIDKV
                     VVARNSDGATVKLLYKDNNRLYLMPLNSKLQNNDEIKSPADAVIIGRVVKSFNIRSF"
     gene            681172..681558
                     /locus_tag="FTM_0624"
     CDS             681172..681558
                     /locus_tag="FTM_0624"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACD30611.1"
                     /translation="MIRKSILVENQEIKDLLSVIKQHYASDNRKTIQEVSLNHVVNNV
                     YKQNIKNYIIEKWYTLETKVGHQITLLENNYNKSIINKLYKKSRDLNFVIKTRPDDSS
                     RELHDSIKSASNIDVVIKEFSFFCEK"
     gene            complement(681572..682441)
                     /locus_tag="FTM_0625"
     CDS             complement(681572..682441)
                     /locus_tag="FTM_0625"
                     /codon_start=1
                     /transl_table=11
                     /product="drug/metabolite exporter"
                     /protein_id="ACD30612.1"
                     /translation="MNRDFFIILFALSNLIVASVLIRYSEVGPIASFGYRLLLPCIFL
                     YSFLAITKDEEKLSKKSLYITALTGFFLALDLAFYSISLIYTSIAEASLLTNLCPFIT
                     TFIAIIFLKEKVSLKYYFVLLLAFLGLLLLMSQAGLSSRHLLGNWLAIVSAVFYALFI
                     ILSKQLRNSCSTFRMMFIASLSGSIVLFILAFIFNEQIIPTTARGIAILLAIALFGHL
                     LGNILYISRIKHISLAMSSLVLLVGPVFALLYGYVLFRETFSIQQFVGMFIIILSVYL
                     GKKVLENPQGKKV"
     gene            682618..684204
                     /gene="gltB"
                     /locus_tag="FTM_0626"
     CDS             682618..684204
                     /gene="gltB"
                     /locus_tag="FTM_0626"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase domain 2"
                     /protein_id="ACD30613.1"
                     /translation="MHISERRKWYIGFAVFVMVILLSLSLLHASIWFSIGFVAVLAVI
                     AIYDVSQTKHSILRNFPIVGHMRYILEFLRPEIQQYFIADNESEKPFGRELRSTIYRR
                     AKGINDTVAFGTEKDIYRVGYEWVTHSLMPKHLDEIETRVKIGGSDCKQPYMASHLNI
                     SAMSFGALSANAVMALNKGAKLGGFYQCTGEGGLTKYHLQGGDLVFQIGTGYFGCRTD
                     DGKFSAEKFVEKANLDSVKMIEIKLSQGAKPSHGGVLPAAKITPEIAEIRGVSMGKDV
                     LSPPAHSAFSTPIEFCYFIKQLRDLSNGKPIGFKLCIGSHVEFLAICKAMLETGIRPD
                     FITVDGADGGTGAAPLEFSNHIGMPLEDSLIFVHNALVGCGLRDEIRIIASSKVATGF
                     DMVRLFAMGADTCNSARAMMLAIGCIQSRQCNNNTCPVGVATQNPRLEKALVVEDKMY
                     RVYNFHKATIQSCLEIIGAMGLISTDDVEPENLKKRISVNEIKSYADLYDFIPERCLV
                     DGNIPASFARSWEKARADSF"
     gene            684281..687520
                     /gene="recC"
                     /locus_tag="FTM_0627"
     CDS             684281..687520
                     /gene="recC"
                     /locus_tag="FTM_0627"
                     /EC_number="3.1.11.5"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V, gamma subunit"
                     /protein_id="ACD30614.1"
                     /translation="MALYTYPSNKLEYLVQVLSKLLDVEKKDLFTPTQLIVGSRGMQH
                     WLSMQLAEYRNIAMNLKYDMINGYILDICYELTVKQEYKKAYTKDILAWRVFRLLSSQ
                     NQEKNTHSHAGGNLIADGLSSKDTSLCGYDNRDGWSSKLKEYYQDSDLKKYQLSVKIA
                     ETFSKYISYRSEWLQKWEKDEYINPSKLENDEDWQMLIWQNLVKDIAETPYKVQLEAL
                     QKLDKQNLEKLNIPSDIYIFGVNTISPKNLKFIFELAKYINVHILYINPCSEYWYDLH
                     KSKISAWLDSDDYEIQPLLANLGQQGKEFFNQLLENEQQQELEVFEKFDKESLAFEKL
                     ADNNQTQLVSLQRNLLELDCQNHAKQKDLSISINSCHSPLREVQILHDKLLDMIKADP
                     NIKPRDILVMCPNIEDYSPYIDSVFSRYPTDKKLPCSIADRTLLDSEPLAASFIELLQ
                     LPESNFEVNKILDYLAVPAIQQKFKITDEQLEAIRYWLKESCIHHSNNDQTFSWSWGL
                     RRLMLGFSYSDSNYIIDDKLMTVPVIEGSEIAELGGLYELLELLERYSQNLLKPRSLA
                     NWQVYLLEMFDDVFDVTNDEQYIAKKIKDIIAKTVTTAKNILLDQEIDLYTIRYCLIS
                     QLSEPIINNHFLNGKVTFCSMTPMRSVPFRVIAMLGLNNGKFPRQESAISFDLIARLG
                     RKKGDRTKRDDDRYLFLEAILSARDYLYISYIGRSVKTNVEQQPSLILKELTSYLNLN
                     YDWGKEDIKEYPLHAFSSKCYSDSYRSYDKAWLKLLQSEPRGFYDSASLSNCANLPKN
                     LSISKLLKVFDDPIKAYANYALELYLEDDFEELEDSEPFDINSLDKHKLKQALLKTFE
                     DEKDKDLTIKTTKLSGKLPESVLTDTEIKEEVENIQKLLDKMSLASYESKYFHQEILG
                     YELEANCYIKNNQIMLSTPSSLNIGKKFELYLIALLVAYSEQRDISAVYYGIEKNQVE
                     EFRVENIEYTTAKGILEHYINQAEQIVVKPQLAHLSLAEAICDSKNNTDKKKQQAWQK
                     VIKSSQHNFKALEDNSYFKLFYNKFPTVDDFEGEKIYKKFFEVIYESQS"
     gene            687462..688034
                     /locus_tag="FTM_0628"
     CDS             687462..688034
                     /locus_tag="FTM_0628"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein, putative"
                     /protein_id="ACD30615.1"
                     /translation="MRVKKFTKSSLRLFMKVNHEHSNIPQLYKNIYISFEIALAACIC
                     FLLGFYMSNLLHRGQSIIGGFWCLITVSTILQLSIRDLYLAAFQILVGSVIGGITAFI
                     FTSVLGYYYYVMILAVAISVFITASIGLENAVKMSSANAGVIVALGLYQPSYSPFLNT
                     GLRLIETFSGIAIALFFIFISRIFRIRTDD"
     gene            688177..689565
                     /locus_tag="FTM_0629"
     CDS             688177..689565
                     /locus_tag="FTM_0629"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase"
                     /protein_id="ACD30616.1"
                     /translation="MNILQRIQNGEDSYTQFKQDINNADSLAQELVAFSNANGGILII
                     GVADDGKIIGLSKDDIHRINQLISNVCSTNIKPLMSVLTKIENIDDKEILIIEINNGV
                     NKPYSTNKGVYLTKVGSDKRKMSQEELGRLFRQAPKLYPDEEVLYKTSLENFDVSKFR
                     KFLKTDNYTTFSKLENGSLDLSTILENKDLAKDGKLTLAGNLIFGEEPQRFCPSFYID
                     CCYFDGNNISVSKFISKKVIKGTFSELYEDTMRFLLSQLKSYQIDLDFNSNPQLEVNE
                     SALTEIVVNALVHRDYYINSSIKVFIFHNRVEIISPGKLPDTLTVDKIKNGIAIQRNP
                     ILASICKTLLPYTGYGSGIKRAIELIPNIEFINDIDSEQFRCIIKRDESSPKEQESSP
                     INISYGVGSSPKTDKQILEMFRENPKITIKEIAERLSITDRAVKKHIEKLKYQGLIAR
                     EGSPRNGYWRVI"
     gene            689637..693290
                     /gene="recB"
                     /locus_tag="FTM_0630"
     CDS             689637..693290
                     /gene="recB"
                     /locus_tag="FTM_0630"
                     /EC_number="3.1.11.5"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V, beta subunit"
                     /protein_id="ACD30617.1"
                     /translation="MDNLNANTITLQGRHIIEASAGTGKTFNITKLYIRLLLEKKLLP
                     SNILVMTFTKDATQEIIGRVEKEIRDVLASYTDEKKESDKENYKHLKRSLLEIDEAAI
                     FTIHGFCKKVLSEQAFASGIEMDVSMDVDTSDILQKVVEDFFRKHINKSETNFGYLQI
                     YKLHTPEKFLDDLENIIRSNYEILTKQAISLDEFKILKKQQLELFINNHDIVDDFLSK
                     LGKGEPQGKRVDEYHRVLEWLKLDNQTLFPENISIITDGRKISAKLIKPIFIGVKELR
                     DLQQEIKQAQAAQFIRKACLQIRQDFAKAKEQKGVLDFDDLITKLCQSVKKSPELVKT
                     LQKQYPVALIDEFQDTDAEQYEILDTIYPLKNSSSHSHEGRNLLTNGLNLKDTRLCEY
                     DSSSDQNDSNLLLLMIGDPKQAIYGFRGGDIFTYLKAKDSCPEENQWSMDTNWRSTGE
                     MIKAYNRLFYKQDYQPEEEGQIGTNIFSDGIGYQLVKASPDADKKTKDFDDNFKPINY
                     FYYEVAEDDNKSDIDTNLSLWTVNEITRLLNTQKVAENDIAILVENGKQAKIIQQALQ
                     AKNLSSVYLSQRDNVYHSQEAKEILALMEGINDLENKSMLKRALSTSLLGGRADKFIS
                     YIDENDVSAWDDEIEKAKSLRQQWHKYGFMAFIMQIIHENFTQRADSKERIITNILHL
                     AELIKVAENKYKHPNQLIKWYRHQLNNTATSEGELRLESDDNLIKIITIHGSKGLEYS
                     VVFIPFACYASTKKFETSNFTKYYDGDLKQTVYKIGKDDSVKQQADKEVIEELMRLFY
                     VAVTRAEHRCYIGVAKYNNSEKSPLARFLGYQKDDDWLEKIQSITANPANQSLLINIA
                     DMREFSLKNLSSKDKNSDYDTLKANYISKLENDSWEMLSFSKISKSKVQNTALEKEID
                     EAEDDKTQASDRKLAFRFTASKGADMGNILHNVLEHTDFSLGEIDGNLLQEQMDRYKV
                     VAAEDFDNLKLWLEECLEAHIPYIDTSFSSSNESIQYGLFDIKDKGFCLKTIPNSKTL
                     KEAEFYFPVKNENLYKTNILEILQEYRELTKLKTYSHSYVGGNLPANYQDLRDTRLRE
                     YGNLTNVSNQKIFGMLHGFIDLIFEYEGKFYVADYKSNYLGDTLEDYNQQAMQEKNQS
                     SFYDLQYLIYSVALDKYLRQNIESYNYEKHFGGVYYFYLRGMKDGYGVYRARPNLEII
                     NKLASLFNGDDNV"
     gene            693256..695124
                     /gene="recD"
                     /locus_tag="FTM_0631"
     CDS             693256..695124
                     /gene="recD"
                     /locus_tag="FTM_0631"
                     /EC_number="3.1.11.5"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V, alpha subunit"
                     /protein_id="ACD30618.1"
                     /translation="MLVYLMEMIMYKTFHKACEQLADIRAIDFFFAKEVFDLVKKTTP
                     SMTTLSSESYPPFHGAKGNDLEQKSNEILFHILMKLMHVYSHGHSCLKIADISNKTIF
                     ASEQSNQSDAKVGFKMPSSDKIASILDNLNYDNLPIYFAKQYDSLYIKRLWNYENEIA
                     NFIKLKTIQNTQKDNRIEEVVDKLFEPAGEINWQKQAVIKSLNYNFSIISGGPGTGKT
                     TTVAKLLLAIQMLNQNQQRIALLAPTGKAAQRMTESLKNTLATVIPSSLTTESTIQKN
                     DIFKQIQDELNSVAQYLNNLEAQTIHRFLGLRPNSTYVKYNQQSKAPFDVIIVDEASM
                     LDMNIFIKLIRAVADNTKLILIGDTNQLPSVEAGSLLANFTHDKYGSITPYTTLLIKN
                     YRSQQYINNLAASVLKGDVNIDSQQNENIKFHSLRNLDIYLREYAKRYSQLEKCRDYK
                     EALTELNKFRILVANKNLEIGTDKLNQKIEKFMSKPIDSNYKGKPIMITQNSYSLGLF
                     NGDVGIMWPDDTGKLRVYFDGKDAKAFSLNMLPKYESVYAMTIHKTQGSEFDEIVIIL
                     PAEDNEALSKQLLYTAITRAKYKLTIISEQSSLRDIAQKDIKRNSNISELVSLSTQ"
     gene            complement(695133..695903)
                     /locus_tag="FTM_0632"
     CDS             complement(695133..695903)
                     /locus_tag="FTM_0632"
                     /EC_number="2.7.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory factor, Bvg accessory factor family"
                     /protein_id="ACD30619.1"
                     /translation="MIVCIDIGNSHIFGGVFVGDQIKHNFRYPSTTPCTSDTLGIFLL
                     SFFERKKLDIEDIEAVVLSSVVLHLEYSVNSACKKYLGITPLELKPGVKTGLKLNIKN
                     PLDLGADRVANSVAAISLFPSRNIIVVDFGTATTICAISENKTYIGGAILPGINLSME
                     SLSQKTAKLSNVTISHPSSALGKTTISQIQSGLIYGQLGAIKEIINRISQENFIDKPP
                     ILIATGGYAHIFEKEQYFDVIISDLLLHGLRIIWQMNK"
     gene            complement(695907..696242)
                     /gene="panD"
                     /locus_tag="FTM_0633"
     CDS             complement(695907..696242)
                     /gene="panD"
                     /locus_tag="FTM_0633"
                     /EC_number="4.1.1.11"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate 1-decarboxylase"
                     /protein_id="ACD30620.1"
                     /translation="MLISVLKSKISYATVTGKDLFYVGSITIDSEIMKQANIIENEKV
                     QVVNLNNGERLETYVIKGEPNSKTIALNGPAARRCEIGDQLFIISYTQVDPTRENIKP