LOCUS       CP000352             3928089 bp    DNA     circular BCT 28-JAN-2014
DEFINITION  Cupriavidus metallidurans CH34, complete genome.
ACCESSION   CP000352 AAAI03000000 AAAI03000001-AAAI03000029
VERSION     CP000352.1
DBLINK      BioProject: PRJNA250
            BioSample: SAMN02598450
KEYWORDS    .
SOURCE      Cupriavidus metallidurans CH34
  ORGANISM  Cupriavidus metallidurans CH34
            Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
            Burkholderiaceae; Cupriavidus.
REFERENCE   1  (bases 1 to 3928089)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Martinez,M.,
            Goltsman,E., Pitluck,S., Schmutz,J., Larimer,F., Land,M.,
            Hauser,L., Kyrpides,N., Kim,E., Mergeay,M., Benotmane,M.A.,
            Vallaeys,T., Michaux,A., Monchy,S., Dunn,J., McCorkle,S.,
            Taghavi,S., van der Lelie,D. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of the chromosome of Ralstonia metallidurans CH34
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3928089)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Martinez,M.,
            Goltsman,E., Pitluck,S., Schmutz,J., Larimer,F., Land,M.,
            Hauser,L., Kyrpides,N., Kim,E., Mergeay,M., Benotmane,M.A.,
            Vallaeys,T., Michaux,A., Monchy,S., Dunn,J., McCorkle,S.,
            Taghavi,S., van der Lelie,D. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (18-APR-2006) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
REFERENCE   3  (bases 1 to 3928089)
  AUTHORS   Janssen,P.J., Van Houdt,R., Moors,H., Monsieurs,P., Morin,N.,
            Benotmane,R., Lapidus,A., McCorkle,S., Monchy,S., Taghavi,S., van
            der Lelie,N., Dunn,J., Leys,N. and Mergeay,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-FEB-2010) Instute of Environment, Health and Safety,
            SCK-CEN, Boeretang 200, Mol 2400, Belgium
  REMARK    Sequence update by submitter
COMMENT     URL -- http://www.jgi.doe.gov
            JGI Project ID: 2351356
            Source DNA and bacteria available from John J. Dunn (jdunn@bnl.gov)
            Contacts: John J. Dunn (jdunn@bnl.gov)
                      Paul Richardson (microbes@cuba.jgi-psf.org)
            Quality assurance done by JGI-Stanford
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-PGF
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
FEATURES             Location/Qualifiers
     source          1..3928089
                     /organism="Cupriavidus metallidurans CH34"
                     /mol_type="genomic DNA"
                     /strain="CH34"
                     /db_xref="taxon:266264"
     gene            104..1843
                     /gene="dnaA"
                     /locus_tag="Rmet_0001"
     CDS             104..1843
                     /gene="dnaA"
                     /locus_tag="Rmet_0001"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="ABF06887.1"
                     /translation="MQDFWQAAAAQLERELTPQQFKTWIKPLAPVAFDEEAHALRIAA
                     PNRFKLDWVKSQFSGRITALACEYWETQVSVHFVLDPAASGRAAAYTQQAMQQGQDAP
                     AAMGTAMGAGHAPYPGMAGMAGGQSYGPAGAQVPGAHPNQMAGYPDYPSQSNGAPAGY
                     GGAAGGQTPYSQSQQSAQGRGAAPTGHPLQGNSAAHLPDMGEIDVAQMDPAEASARSY
                     RVPSPQPAAPAGAQQQSDTVHERSRLNPILTFDNFVTGKANQLARAAAIQVANNPGKS
                     YNPLYLYGGVGLGKTHLIHAIGNFMLMENPRARIRYIHAEQYVSDVVKAYQRKAFDEF
                     KRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEITGIDD
                     RLISRFDSGLTVAIEPPELEMRVAILMKKAAAENVSVPEEVAFFVAKHLRSNVRELEG
                     ALRKILAFSNFHGKDITIDVTREALKDLLTVQNRQISVENIQKTCADFYNIKVADMYS
                     KKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIAEERSKDAQL
                     NHELHVLEQTLKG"
     gene            2220..3335
                     /gene="dnaN"
                     /locus_tag="Rmet_0002"
     CDS             2220..3335
                     /gene="dnaN"
                     /locus_tag="Rmet_0002"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, beta subunit"
                     /protein_id="ABF06888.1"
                     /translation="MQLVKTSRDNLLRPLQIVSGIVERRHTLPILANLLIRKSGSNVS
                     FLSTDIEIQITTHAECGVGSDSVATTVAARKLLDILRAMPDGDVALSLNDKRMTVQSG
                     KSRFALQTLAAEEFPTVAEAAEFNASVSLPQKTFKHLLAMVHFAMAQQDIRYYLNGML
                     LVVDGKKVMAVATDGHRLAYCGVELENEATGVGSRQEVIIPRKTILELQRLLEDTDDP
                     VQVQLAANQVKFTFANIELISKLVEGKFPDFQRVIPKGYKNAFAIDRVQLQQALQRTA
                     ILTTDKFKGVRCILDTHVLKISSTNADQEEAQEELELDYSGDALDIGFNVTYLLDVLA
                     NLKSEQVQVSLGDSNSSALITVPEDDNFKYVVMPMRI"
     gene            3521..6046
                     /gene="gyrB"
                     /locus_tag="Rmet_0003"
     CDS             3521..6046
                     /gene="gyrB"
                     /locus_tag="Rmet_0003"
                     /EC_number="5.99.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase, subunit B"
                     /protein_id="ABF06889.1"
                     /translation="MTDQQKPQQENSYGASSIQILEGLEAVRKRPGMYIGDTSDGTGL
                     HHLVFEVLDNSIDEALAGYCTEIQVTIHSDNSISIVDNGRGIPPAVKFDDKHEPKRSA
                     AEIAMTELHAGGKFNQNSYKVSGGLHGVGVSCVNALSKWLRLTVRRDGQVNLIEFAKG
                     EVQNRVIETVTGPDGQPVEVSPMKVIGATDKRGTEVHFLADEEIFTNVEFHYEVLSKR
                     IRELSFLNNGVHIKLVDQRTGKEEDFAFSGGVKGFVEYINRSKTTLHPNIFYANAEKD
                     GISVEVAMQWNDGYNEQVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIEENEVAKKA
                     KVETSGDDMREGLACVLSVKVPEPKFSSQTKDKLVSSEVRLPVEELVGKALTDFLLET
                     PNDAKIICGKIVDAARAREAARKAREMTRRKGVMDGMGLPGKLADCQEKDPAMSELFL
                     VEGDSAGGSAKQGRDRKFQAILPLKGKILNVERARFDKMLSSQEVLTLITALGTGIGK
                     EDYNLEKLRYHRIIIMTDADVDGSHIRTLLLTFFYRQMPDIIERGYVYIAQPPLYKIK
                     HGKEERYIKDDNELNAYMLKLAMEKASLSRPDGSEINGEALTELARQYQLAEGVIGRL
                     SRIVDVDALRAIADGVALDLDNAAAAEASAVALKAKLAEMHAKTLLGAAVNDDGTADV
                     YAQFDEKTDKHRLMIARRHHGNVRLSHVDADFVHGADYAALARAATTFQGLIPDGTKV
                     RRGEGEKMREQTVADFHQAMQWLLSEAERGVSRQRYKGLGEMNPEQLFETTLDVTQRR
                     LLRVQIEDAIAADQIFTTLMGDEVEPRRNFIESNALVARNIDV"
     gene            6990..8099
                     /locus_tag="Rmet_0004"
     CDS             6990..8099
                     /locus_tag="Rmet_0004"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06890.1"
                     /translation="MGGFRVTGRGEQKSWVVLFTTGEDKDWPDTLDLSTGKFVYFGDN
                     KTPGHELHETRGGNKVLRYSFERLHAAVNPRADVAPFLVFKKYPLAHGARSVQFKGLA
                     VPGFPSLSSTEDLVAVWKSSEGQRFQNYRAVFTILNAPVLSRAWINDLKAGDLNSSNA
                     PRAWRQWRESGKYSPLAAAPTTNIRSANAQSPDTALKRELLECIWQHYKGAPIAFEAF
                     AARVFQMTDERVVIDEITRGVVDGGRDAIGRYRLGSMADPVYAEFSLEAKCYRPPLNG
                     DTPITVSVSDVARLISRIRHRQFGVLVTTSVIASQAYKEVREDRHPIVFISGGDMVNI
                     LIDKGYNTRGRVQELLSSDFALVAAASSEPVDKPR"
     gene            complement(8367..10121)
                     /locus_tag="Rmet_0005"
     CDS             complement(8367..10121)
                     /locus_tag="Rmet_0005"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative metal-dependent amidohydrolase (TAT
                     secreted)"
                     /protein_id="ABF06891.1"
                     /translation="MCFYCSPGGAAVLLARASRRDFLTGALALGAMSTFGFPSAYAEN
                     PPATSPSTSPYAQFIFTNGPIYTMASGSPTAKALAVRDGRIVAVGSMDAVAQFRGPDT
                     QTIDLGGRTLLPGFVEPHMHSALAVLDAWLDVGPFTTTSIDQALEKIRAEAAKSKPGE
                     WVRAQALDPSLMPGAPVTRQRLDAVAPNNPVFILESNGHIAYVNSAALKLANVTRDTP
                     NPAQGRFVRDDKGELTGRLEEGPAYGPFLKVAPMPNAAQMVASIRKLFDRASAVGCTS
                     LHDAGIGTSGVHDLDIVNAAMRDDPPVRYSGFLTSDRMDGWVERGIKPGAGTDRFRLH
                     GIKFWSDGSNQARTGYQREPYLNSTSRGALNYTAEQLIEGVQRAHDLGWQVAIHANGD
                     AAIDTTLDVYEHVLKRSPRTDHRHRIEHCSVLHPEQIQRMAKLGVSPSFLIGHVHYWG
                     KAFRDNILGPQRAQFYAPCASALRGGLRISLHSDYNVTPIEPIRYMDNAVNRTMRDGG
                     GVLNPAERITVAQALRAVTIDAAWQCQMDQIVGSLETGKYADLVIVDKDPLQMAQEEI
                     GKLKVMETWSEGRRRFAA"
     gene            complement(10260..11189)
                     /locus_tag="Rmet_0006"
     CDS             complement(10260..11189)
                     /locus_tag="Rmet_0006"
                     /codon_start=1
                     /transl_table=11
                     /product="Transmembrane transport protein"
                     /protein_id="ABF06892.1"
                     /translation="MSRRMHGYLYLTLAMITVGSTVVASKIVAAGLPPFTATALRFAI
                     ALPLFLVLMRVTRITWPILAPREWGLLLVQAGAGSVGYTTLLILGLRHASATDAGVII
                     GTLPVVSAAIAIMVLGERPRRAVLLAIALAAAGVLTIVFRNDAGSAHSLLGSLLIFGA
                     VGCEGVFILLNKRIQTPIAPLALSTIMAVFGLAVAVIPAGFEMPWMHALSGNAVAAVA
                     YYALIPTVGGFLLWYAGAARVSGAEAALFTAVAPVSAVVLAAALLGEQIGQSQIIGIG
                     CVLVAVFSLGMSQSADMTDSAMADAEGDATSHR"
     gene            complement(11295..12113)
                     /locus_tag="Rmet_0007"
     CDS             complement(11295..12113)
                     /locus_tag="Rmet_0007"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, araC family"
                     /protein_id="ABF06893.1"
                     /translation="MAGGQFQIFRCHVAGTQAVQADSRHAFGRHTHDQFGIGVIGKGA
                     QRSASGQGIVEAGPGDTITVNPGEVHDGMPIGDAGRAWQMLYFDPPVVADAILDVTEG
                     RTRSFEFAHPVMRDVRLAQRFLTLFTAMTAAHAEHASVLREELLLTLLADTMHGQTRS
                     DTRGPGFAEIALARRRIDDDSAAPLTLGELANECRLSRFQFIRAFSRATGMTPHAYMI
                     QRRIIAARHLIARRMSLADAAAASGFADQSHMTRIFVRTYGISPSMYARACGAS"
     gene            complement(12151..13038)
                     /locus_tag="Rmet_0008"
     CDS             complement(12151..13038)
                     /locus_tag="Rmet_0008"
                     /codon_start=1
                     /transl_table=11
                     /product="Binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ABF06894.1"
                     /translation="MEAISTSGGWKLAWLGSRWPARCAWVAVFATLATFAVFCAFPFY
                     WMLITTFKDVHDLINTANNPFVFNLPPTTENLRVLFQETAFLRWLLNTLLVGVFVVII
                     TLVLAVPAGYSLARLSGPRGRQLAIAIFLTYLIPPTILFIPFSRIVGALGLQDSLWSL
                     VLVYPSFTVPFCTWLMMGFFKAVPRDIEEAAMMDGMSRFGAFLKVIVPLSSAGILTVI
                     IFTLTLVMQEFVYALTFITSSSQYTVSVGVPTFLVRGDVYFWGSLMGACLIVSVPVAL
                     LYNVFLDRFVTAFTVGAIK"
     gene            complement(13040..13972)
                     /locus_tag="Rmet_0009"
     CDS             complement(13040..13972)
                     /locus_tag="Rmet_0009"
                     /codon_start=1
                     /transl_table=11
                     /product="Binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ABF06895.1"
                     /translation="MSALSATLGRPDHETSDTPDDDRRLGAMMLAPALIYIALLLGFP
                     FLLSIWYSLTDVTVGSPMPHFIGLENFRSVVANPTFWQSLRNALVFTLVSQALVVVLA
                     KALALALVRDFPGKWLVRLLILLPWVAPISLGSIGWLWIFDPVYSIINWTLRAIGLFG
                     PNTWPIWLGQPDLAMASVILVDVWRLLPLATVIILAGMQGIPQDLHDAAAMDGAGFWR
                     RLFRIDVPLLMPVMLVALLFGIVFTLTDMVIIYVLTRGGPYDTTQVLASLAFFTGIQG
                     GDLAEGAAISLFLFPLLVAVVTLLLTVAHRSEVT"
     gene            complement(13969..15006)
                     /gene="ugpC"
                     /locus_tag="Rmet_0010"
     CDS             complement(13969..15006)
                     /gene="ugpC"
                     /locus_tag="Rmet_0010"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate transporter subunit;
                     ATP-binding component of ABC superfamily"
                     /protein_id="ABF06896.1"
                     /translation="MATVETRSLTKRYDSTTAVDAIDLAVREHEFLVLLGPSGSGKTT
                     LLRMIAGLETPTSGDVLVSGRIVTGLPPRAHNMAMVFQSYALYPHLTVAGNIAFPLQA
                     QHMARDKIDSKVEWAASLFGIGHLLARKPRQLSGGERQRVALARAVVRDPVAFLLDEP
                     LSNLDAKLRASAREELQQLQRRLGTTTIYVTHDQVEALALGDRVAVLDHGGIRQLDTP
                     QRVYAHPVDRFVATFIGSPPMNLVASDGMEIGFRPEHFLPDDVFTADASLERFPLDIT
                     RIENLGADRLVYGVLAPPQPPVKVISRIPCTVNVSPQPGTRHMFAVRRADLHHFDTSS
                     GTSLSVAEGVT"
     gene            complement(15026..16420)
                     /locus_tag="Rmet_0011"
     CDS             complement(15026..16420)
                     /locus_tag="Rmet_0011"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sugar uptake ABC transporter"
                     /protein_id="ABF06897.1"
                     /translation="MKNTTPVAGLRTRPSGGNASVTSLQRRHVMQAAAAAALATGLAP
                     LARPGAAHAAARHTLRILQWNHFVPGYDKWFDNTYVKEWGQRHDTEVIVDHVGIPALA
                     TRAAAEVSAQKGHDLFMFLSPPPVYEDQVIDHRDIYEECQRKHGKPVDLAVRSTYNPK
                     TRKYFAFSDSFVPDPVNYRKDLWDAIGAKPPDSWDDVLTAGRKIKQAKGVPVGIGLSA
                     ELDTAMAMRTILYAFGGAVQDMRGNVVLNSPGTLEAVKYVRALYRDTMTPEVLAWDPS
                     SNNRAMLAGKISLCLNAISITREGENKQIPVTPDIWLTQALRGPAQRICLEHVMDCYV
                     IWKFAENIAGAKQFLVDYIDNFRDGFVGSEFYNFPCFPSTVPDLKTMIEADAKATPHD
                     KYKVLGVLMEQATNVGYPGYANAAIDEIFNTWVLNTMFARAATGDASPEDAIRDAENA
                     CKRIFAKWKARGLV"
     gene            complement(16618..17277)
                     /locus_tag="Rmet_0012"
     CDS             complement(16618..17277)
                     /locus_tag="Rmet_0012"
                     /EC_number="2.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenylcysteine carboxyl methyltransferase
                     (ICMTase)"
                     /protein_id="ABF06898.1"
                     /translation="MRPTPKMAIITIAGALAYLALPVFGWGGITAYFADTARTLAVVA
                     TLVMAVIAIFSGGNISAGEREDRDNRWVLVAFSVLSLLAGFLPAYTDRLDVWSIDGNT
                     IRWIGLFLFVAGGALRLWPVFVLGRRFSGLVAIQPGHTLVTTGIYSVIRNPSYVGFVI
                     SSLGWGLVFRSWVGVLLALLMLPPLVARIRAEEALLQSQFGVEYEQYCARTWRMLPGL
                     Y"
     gene            17396..17752
                     /gene="mazG"
                     /locus_tag="Rmet_0013"
     CDS             17396..17752
                     /gene="mazG"
                     /locus_tag="Rmet_0013"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide pyrophosphatase"
                     /protein_id="ABF06899.1"
                     /translation="MPVSDIHIAFTMALIDISNLQQAAAAFGEARGWGKYHSPKNLAM
                     ALSVEVAELVEIFQWQTEEESRGIMSTDERAHVEQELADITIYLTQLVTALGVDLDAA
                     VQAKMEMNARKYPAPK"
     gene            17884..18834
                     /locus_tag="Rmet_0014"
     CDS             17884..18834
                     /locus_tag="Rmet_0014"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06900.1"
                     /translation="MAVTRQGKSASNIHIGIGGWNYAPWRDNFYPAGLAQARELEYAS
                     RHLTAIEINSTYHGTQKRTSFANWRDATPDGFVFSVKASRFATNRRVLAEGSDSISRF
                     IDSGIAELREKLGPVVWQFAPTKQFVADDFEAFLNLLPTSVEGVKLRHVMEVRHESFM
                     CDAYLKLARKFKAATVFTDSPKFPSFADLTSDFVYARLMNADEKVATGYAPKVLDQWA
                     QRASAWAGGKSPDDLPRVEDEPAGKLKPKEAFLFFINGAKERAPAAAGALLERLGWVP
                     TEAVPMKASTPKPPAAKKIAVVKTVTRKPAATKTVARKTA"
     gene            18848..19531
                     /gene="dbpA"
                     /locus_tag="Rmet_0015"
     CDS             18848..19531
                     /gene="dbpA"
                     /locus_tag="Rmet_0015"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent RNA helicase, specific for 23S
                     rRNA (fragment)"
                     /protein_id="ABF06901.1"
                     /translation="MRVTKFSASIPLSTGTLFSALPLAPALQVTLTELGWHAINPLQA
                     AMLPEALAGRDLIVQASPGSGRTVAFTVALLHHLDPRRFDVQALVLCPTRERVQHVAQ
                     CIRDCVRAARHVKVVALMHGAAMRPQIDSLIHGAHVVVGTPGRVVDHLDAGSLDLRAI
                     GILVIDDAESMLDLGLVDDVGFAASRCPKSRQTLLFSTSFNSDLDPEVERFSRLWLRK
                     PRRIAHLPD"
     gene            19721..20161
                     /locus_tag="Rmet_0016"
     CDS             19721..20161
                     /locus_tag="Rmet_0016"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06902.1"
                     /translation="MKTARQVLESKANQAIFSIPPTATVYAALQLMAEKGIGALLVME
                     QQKIVGIISERDYARKVILMQRTSRETLVREIMTTAVIYVRADQTTDECMALMTRHRL
                     RHLPVMNSDQLLGMISIGDLVNDIISEQRFTIEQLEHYIHGGSR"
     gene            20369..21955
                     /locus_tag="Rmet_0017"
     CDS             20369..21955
                     /locus_tag="Rmet_0017"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter, DHA2 family"
                     /protein_id="ABF06903.1"
                     /translation="MSSTAPASQSTAEALEATASLPQAAVHDHASIMRVIGGIVLCIL
                     LAALDQTVVIPAVPAIANDLNGFGHLSWIVTAYLIVSTVTTPLYGKLSDSFGRRRLLM
                     VAISLFILASVACALAQTLPQLILFRALQGLGGGGLMSLAQAAIADVVAPRERGRYQG
                     YLATVWAISSIAGPLVGGWVSDHMSWRWLFWINVPLGLLAMTMCYRGLAHLKPRGGRP
                     QVDWLGALLLAVAIVAFLLAMSWGGEAFAWISPEMAALLAISLVAVLLLAWQERRAAD
                     PMLPPRLFRNRAYVMGVGASALAALNIFLCIFALPLHFQLVRDADASMSGLLVVPFLL
                     ATVAGNFVVAWLAPRLGRMRVILTIGFVAAAVGLVSLAAVTVAVPTFFVLLAMTIGGI
                     GLGMAMVGTLISVQNALERRDMGAGTGALLVLRSLGSSIGGALAGTLLAMEFRDALAR
                     AGVTQALDLGALRHGSEALAHLSPAVRHVLAGGVESGFHLIFAAGAVATIIALLIVRR
                     MPDLELRSSVTEHAAKIHME"
     gene            22066..22692
                     /locus_tag="Rmet_0018"
     CDS             22066..22692
                     /locus_tag="Rmet_0018"
                     /EC_number="1.11.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione peroxidase"
                     /protein_id="ABF06904.1"
                     /translation="MSRQRTLESVQRTALAGALTLAAAVAVMLPPPAHAAEKAVPAAA
                     QPAGNCPASLNFRFPRLQDESPQNLCQYAGKVVLVVNTASYCGFTPQYEGLEALYAKY
                     RERGLVVLGFPSNDFSQEPGSSKDIADFCYNTYGVKFPMLGKSHVRGSDANPMYALLA
                     QETGTAPKWNFYKYLIDRKGQVIGSYNSMVKPDDKQFVSKIEELLNAR"
     gene            22853..23626
                     /locus_tag="Rmet_0019"
     CDS             22853..23626
                     /locus_tag="Rmet_0019"
                     /codon_start=1
                     /transl_table=11
                     /product="putative beta-lactamase-like protein"
                     /protein_id="ABF06905.1"
                     /translation="MLYEAGGHVCLAFTDLVDEGQGEVVQSNQFLVVDNGHAALIDPG
                     GNMTYSELYLTISRYFPPKQLDYVLASHADPDIVASVGRWLTSSDSRVLISQVWARFL
                     PHFCQAGKTAGRIVTIPDGGMVIPLGNCQLIAVPAHFLHSEGNFQFYDPVSKILFSGD
                     LGATMTSGTEAGTVVTDFDAHARRMLAFHRRYMSGNRACRLWAAMARTMDIEWIVPQH
                     GPSFRGREMVNRFIDWIDQLQCGLDLLEPAHYRVPSMLG"
     gene            23692..24558
                     /locus_tag="Rmet_0020"
     CDS             23692..24558
                     /locus_tag="Rmet_0020"
                     /codon_start=1
                     /transl_table=11
                     /product="Fumarylacetoacetate hydrolase family protein"
                     /protein_id="ABF06906.1"
                     /translation="MKLVRIGEPGAERPGMLDSDGRVRDLSGVIDNIGPQELAPGVLA
                     RLANIDPATLPVVEGGRFGVPWSGVGKIVAIGLNYADHAAEAGMPLPTEPIVFLKANT
                     SLNGPNDNVMLPLDSQKSDWEVELGVVIGTRARNVWKEQALDYVAGYCVVNDVSEREF
                     QLERGGTWDKGKGCDTFCPAGPWLVTRDEVPDAQKLGMWLDVNGERMQKGSTATMVFD
                     VATIVSYVSRFMTLEPGDLIATGTPPGVGMGFKPPRYLRAGDVMRLGVEGLGEQSQNV
                     VAYVGRGGAIRI"
     gene            24791..26068
                     /locus_tag="Rmet_0021"
     CDS             24791..26068
                     /locus_tag="Rmet_0021"
                     /EC_number="3.5.1.32"
                     /codon_start=1
                     /transl_table=11
                     /product="putative peptidase, M20D subfamily"
                     /protein_id="ABF06907.1"
                     /translation="MSEHAPEIEDPDIDAPEVASILKSVSVRLAKDSPTRSFCTLHDT
                     LDSRDELQDIRRHIHQHPELAFNEVHTAELVASKLENWGYTVTRGVGGTGVVASLRVG
                     AGQRSVGIRADMDALPIHERSGLPYASVHDGKMHACGHDGHTAVLLGAARQLARTRQF
                     DGTVHLIFQPAEEIGAGGGAERMLADGLFERFPCDAIFGLHNHPGAEAGTFMFRSGPF
                     MAACDTVAITIRGKGGHAARPHQSIDPILVAGSLVMALQSIVARNVDPNETAVVTIGT
                     LHAGHAPNVIPDSARMELSVRSFSADVRASMETRIKQLATSHAEGYGATADIEYVRGY
                     PVLVNSEAETEFARQVAEELVGPERAIANFHRIAGSEDFAYFLQQRPGCFVRMGNGVN
                     QPLLHNAGYDFNDDNLTVGAAYWTRLVERYLAG"
     gene            complement(26084..26902)
                     /locus_tag="Rmet_0022"
     CDS             complement(26084..26902)
                     /locus_tag="Rmet_0022"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AraC-family"
                     /protein_id="ABF06908.1"
                     /translation="MPAEAPNAAHADGRPDTYSEQPAYLQYDRGPMPVAAMAADYLPT
                     HVTKPHQHPHAQLIHAVHGVMVVSTSEGQWIVPPTRGMWMPGGTVHWIRMVGHVQMRT
                     AYIRPDAAPNLPTRCTVLGISPLLRELILAAIDIPLPYSPDSRESRLMQLLLDEVTLV
                     PTLPLHLPRPKDKDLRVICERITDSPDSGLTLADWGDRLGVDPKTIQRRFARETGMTF
                     GQWRQQARLLAALERLAAGDKVVDVALDMGYGSPSAFATMFRRQFGVPPSAFFK"
     gene            27028..28257
                     /gene="fsr"
                     /locus_tag="Rmet_0023"
     CDS             27028..28257
                     /gene="fsr"
                     /locus_tag="Rmet_0023"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily MFS_1"
                     /protein_id="ABF06909.1"
                     /translation="MRPRTMSTTINPAHPADREEGTRFRVLYAISFAHFLNDMIQSLI
                     LAIYPMLKGGFNLSFTQIGLLTLTYQVTASLLQPVVGLYTDKHPKPHSLAIGMGFTLC
                     GLLLLSVAPTYGVLLVAAALVGTGSSIFHPESSRVARLASGGQHGLAQSIFQVGGNGG
                     SAMGPLLAAWIVHSQGSVAWFSLAALLAITVLWQIGGWYGRHLAERAAKKKGAGVVVN
                     KLPKSTVVRAIVVLLLLIFSKYFYMASLNTYYTFYLMEKFGLARQTSQIYLFLFLFAV
                     AAGTIMGGPIGDRIGRKRVIWASILGVAPFTLMLPHANLFWTAVLSVVIGFILASAFS
                     AILVFAQELIPGKVGMVSGLFFGFAFGMGGIGAAVLGRLADAHGIETVYQLCAFLPLL
                     GLLAVFLPDLRERAKAA"
     gene            complement(28320..29636)
                     /locus_tag="Rmet_0024"
     CDS             complement(28320..29636)
                     /locus_tag="Rmet_0024"
                     /EC_number="3.4.17.11"
                     /codon_start=1
                     /transl_table=11
                     /product="Carboxypeptidase G2 precursor (CPDG2)"
                     /protein_id="ABF06910.1"
                     /translation="MHAAPHPALRTRLARLALLPAALALAGAICALPAQAEPVQPAFQ
                     LAQQEKPALIDTLKDLVSIESGSKDIEGLDRIANLLRDRLAALGGDAKLVEPTEIYRM
                     EDTPAKVGKMVMAQFKGTGQRKIMLIAHMDTVYLRGMLAQQPFRVDGDRAYGLGIADD
                     KNGVAVILHTVAILQKMKFKDYGTLTVLINGDEEISSPGARATLTKLGAEQDAVFSCE
                     ASRVTGDRLSLATSGIGAISLKVDGKSSHAGSSPELGRNALYELSHQILQMRDLSNPD
                     TGLKVNWTLSHAGTNRNVIPAVATAQADVRVLRTADYDSLERTLQERIQKKLIPDTKV
                     EVKFERRRPPLEATPASRALAVHAQGIYAEIGEKLAVYDTAEGGGTDAAFAAAATKAP
                     VIERFGLRGFGAHSNDAEYVDLNSVTPRLYLLTRMIMDVSQDKTGK"
     gene            29809..30120
                     /locus_tag="Rmet_0025"
     CDS             29809..30120
                     /locus_tag="Rmet_0025"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06911.1"
                     /translation="MVVMKSAVLQPPGTPAMPAAVPSRAPAHPACAHCLALADDPRRR
                     EPHPCLALHNTAPLVSQSAAGVPFSMLSFRCRECGTAWRLYDRANELFVSWVPEHPLV
                     R"
     gene            30161..31252
                     /gene="bug"
                     /locus_tag="Rmet_0026"
     CDS             30161..31252
                     /gene="bug"
                     /locus_tag="Rmet_0026"
                     /codon_start=1
                     /transl_table=11
                     /product="Extra-cytoplasmic Solute Receptor"
                     /protein_id="ABF06912.1"
                     /translation="MAAIRTRPCISRHVPPNPQIPANFPPISRSSPIMVAFRSLPLHA
                     AFIAAAALTASISVPAFAADNYPSRPIRMIVAYPTGGISDAVARALGEKLSVQMGTSV
                     VVENKAGAGGSIGIDAVAKAAPDGYTVGFSSTSPLTLNPHVGHVNYDPQHDVAPVMSV
                     MYSPVLVVATPSFSGKSFQDLIAQAKAKPGSVRWATSGLGTVGHVMLEQIKAKSKTEL
                     TMIPYKGAGQQMNDALGGQFEVMSTNASPMLTQHMQAGRLRAIAVGAPKRIDSLPNVP
                     TMDELGYPKANLTSTFGIFAPGKTPPAIINKLNAELNKALAEPDVRDRLLRGGEVPTG
                     GSAAQFGAAIRAESAENARIVKEAGIKID"
     gene            complement(31311..32078)
                     /locus_tag="Rmet_0027"
     CDS             complement(31311..32078)
                     /locus_tag="Rmet_0027"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator, OmpR-family"
                     /protein_id="ABF06913.1"
                     /translation="MRIAALEDDPARAIVLERALHPGGHTLARFRSSQPMIEAMRREP
                     FDLLLLDRDVAGTNADDLLDWVRRTLGHGMPVMMLGQSDAEEVVVGCLAAGADAYVPQ
                     PARCDELRARIEALTRRAAVPGMTVATVPPGALGDTSDQLVCGVFRFAVAEHRVWVNS
                     MTVALSPKEYALALLLFRNLGALVTRRAMIEHVWPATGIKEQARTIDSHLSRVRTKLA
                     LWPFNGIMLRSVYRLGSRLDPIETAVATRGRPSLAAL"
     gene            32264..33070
                     /locus_tag="Rmet_0028"
     CDS             32264..33070
                     /locus_tag="Rmet_0028"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator, OmpR-family"
                     /protein_id="ABF06914.1"
                     /translation="MTRMGLRVASLEDDAAEAARIREIVTAEGHECVTFADGRRMLVT
                     LRKVTFDLLLLDWHVPHVSGREVLDWVRAHLDPRIPVMFLTGRDTEADIVATLSAGAD
                     DYMVKPIRPRELGARIAALLRRAYPDSRQPDDGRLTWGCFRFDAVTREATCHGQEVRL
                     TPKEFEVALLLFRNEGRAVPREYMLAAIWGKELPPLSRTIDTHVSRVRTKLGLWEHNG
                     VRLQPLYTHGYRLELLTTPGMAPPSTPPPTPPSTPPSQKKKGTRRCLSAN"
     gene            complement(33083..33916)
                     /locus_tag="Rmet_0029"
                     /pseudo
     CDS             complement(33083..33916)
                     /locus_tag="Rmet_0029"
                     /note="outer membrane protein (porin) (fragment)"
                     /pseudo
                     /codon_start=1
                     /transl_table=11
     gene            33980..34276
                     /gene="tnpA"
                     /locus_tag="Rmet_0030"
     CDS             33980..34276
                     /gene="tnpA"
                     /locus_tag="Rmet_0030"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase DNA binding site ISRme3"
                     /protein_id="ABF06916.2"
                     /translation="MTSKTKRAQYTLEFKLEAVRLVKSGQSMAVVSATLGIRAQTLHN
                     WVKAEREGKLTGAGMKPVSPEQMELARLRAEVARLKMERDILKKAAAYFAKESV"
     gene            34273..35166
                     /gene="tnpB"
                     /locus_tag="Rmet_0031"
     CDS             34273..35166
                     /gene="tnpB"
                     /locus_tag="Rmet_0031"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase catalytic site ISRme3"
                     /protein_id="ABF06917.1"
                     /translation="MRYAFIERNRRYWPVSVLCELLGVSPSGYHQRKQRTVSTDRPDR
                     GRLSDDALLAHIKAIHAGVKGEYGWPRMWKELLARGVRVGKERVRKLMALHGIRARHK
                     RKYIATTNSNHDLPVAPNLLQRDFSPAAPNQVWTSDITYVATAEGWLYLVVIIDLFSR
                     QVVGWSMQPHMKAELVTDALRMAWFRRRPEAGVIVHTDRGSQYCSHLFQDALKAYGMR
                     SSMSRRGDCWDNAPTESLWGSLKVARLHGRQFATRRAAMDEVIDWLGFYNASRLHSTL
                     GYVSPMTFEKNWSAAQQHRAA"
     gene            complement(35208..35498)
                     /locus_tag="Rmet_0032"
                     /pseudo
     CDS             complement(35208..35498)
                     /locus_tag="Rmet_0032"
                     /note="outer membrane protein (porin) (fragment)"
                     /pseudo
                     /codon_start=1
                     /transl_table=11
     gene            complement(35585..35794)
                     /locus_tag="Rmet_6403"
     CDS             complement(35585..35794)
                     /locus_tag="Rmet_6403"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADC45021.1"
                     /translation="MSSALPFIPLFFVALSLPVRALAPERRVLLRTIFRVRRHCVAAN
                     QRNCTKSPPEALLLLGFMSERSAFC"
     gene            complement(35919..36173)
                     /gene="minE"
                     /locus_tag="Rmet_0033"
     CDS             complement(35919..36173)
                     /gene="minE"
                     /locus_tag="Rmet_0033"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division topological specificity factor
                     MinE down with RPM proteomics BL (0.5)"
                     /protein_id="ABF06919.1"
                     /translation="MSILSFLLGEKKKSASVAKERLQIILAHERSGHSAPADYLPALQ
                     RELVAVISKYVKISDQDLRVSLERQDNLEVLEVKIEIPQA"
     gene            complement(36189..37001)
                     /gene="minD"
                     /locus_tag="Rmet_0034"
     CDS             complement(36189..37001)
                     /gene="minD"
                     /locus_tag="Rmet_0034"
                     /codon_start=1
                     /transl_table=11
                     /product="septum site-determining protein minD"
                     /protein_id="ABF06920.1"
                     /translation="MAKIIVVTSGKGGVGKTTTSASFAAGLALRGHKTAVIDFDVGLR
                     NLDLIMGCERRVVYDLINVVQGEANLHQALIKDKKCENLFILPASQTRDKEALTREGV
                     EKVINDLKEMGFEYIICDSPAGIETGALMAMYFADEALIVTNPEVSSVRDSDRILGIL
                     SSKTKRASEGEPIKEHLLITRYNPKRVHGGEMLSLTDIQEILRIKLIGVVPESEAVLH
                     ASNQGTPAIHLEGTDVADAYGDIVDRFLGKDKPLRFTDYQKPGLFSRIFGNK"
     gene            complement(37050..37898)
                     /gene="minC"
                     /locus_tag="Rmet_0035"
     CDS             complement(37050..37898)
                     /gene="minC"
                     /locus_tag="Rmet_0035"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division inhibitor MinC"
                     /protein_id="ABF06921.1"
                     /translation="MSQKKSPRFELRSGNVDALLLALNTADLDAVRDDLLSRFESTPD
                     FFSDDVVALDLRRLEGTGALALDRVIDTLATLKARAIGVVARADQRDWAGGFGLPLLD
                     SQSRRGGKDEAPKEKAGKPEATAASGQTDAEAAGNTGKGKDSEGAAVNGKASEIAEIM
                     AAANAASAPRAIPTLLIDKPLRSGQQIYAQGDVVILDLVSYGAEVIAEGNIHIYAPLR
                     GRALAGVKGNPDARIFCTCLEPELISIAGIYRTAEQTLPADVLGKSAQVRLADEKLIL
                     EPLRMK"
     gene            37986..39068
                     /gene="corA1"
                     /locus_tag="Rmet_0036"
     CDS             37986..39068
                     /gene="corA1"
                     /locus_tag="Rmet_0036"
                     /codon_start=1
                     /transl_table=11
                     /product="Mg2+ and Co2+ transporter, CorA-like protein"
                     /protein_id="ABF06922.1"
                     /translation="MRTTGAPAARQKVVMAGMVHIKCLGLLRLHVLKYGASMGAIVNC
                     AAYRDGRKVGDVEFDGIARALAEPGTFVWLGLHEPDLPLLRKVQQAFGLHDLAVEDAL
                     EPHQRPKIEAYGDSVFVVLGTARLVDDEVVVGETHLYVGPNYVVSVRHGASSTYTPVR
                     ERCEEDPRGMAHGTGFVLYALMDYIVDHYLPIVNRLEEAFEALEQDIFHDEFDRAAIE
                     RLYKVKHQVLRLRNVVYPVEDICSQLIRLHEDLVPKDLRAYFRDIQDHSSRVVRTLDV
                     VREMLTTAVQVNLALVTVTQNEVVKRLAGWGAILAVPTVVFSLYGMNFNFMPELKFHY
                     AYPVVIGFTAAACSFLWRKLHRAGWI"
     gene            39292..39453
                     /locus_tag="Rmet_0037"
     CDS             39292..39453
                     /locus_tag="Rmet_0037"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06923.2"
                     /translation="MDGIYFLVLLAFGALTGALLALCAALGANPPASRGNGEAAAADS
                     RPAADNRGQ"
     gene            39542..41374
                     /gene="kdpA"
                     /locus_tag="Rmet_0038"
     CDS             39542..41374
                     /gene="kdpA"
                     /locus_tag="Rmet_0038"
                     /EC_number="3.6.3.12"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium translocating ATPase, subunit A"
                     /protein_id="ABF06924.1"
                     /translation="MSTPHFTQFLGLLVLFLAILFVVGPFLGRYMRRAVEEGNFSLTA
                     WGRPIERVLYRVAGVRADAEMGWKQYAIAVLVFNVIGVIAVYALQRVQGLLPLNPQAF
                     GAVSPDSSFNTAISFVTNTNWQGYSGESTMSYLTQMLALTVQNFVSAATGIAVVFVLI
                     RGFARHTSATIGNFWVDITRTTLYVLLPLSVITALLLVSQGVIQNFDGYKDANLVTAV
                     EYTQPKVDAAGQPVLDPQGKPVTEAMKTTTQTLAMGPVASQEAIKMLGTNGGGFFNAN
                     SAHPYENPTPLSNFIEMLAIFLIPAALCFTFGEMVRDRRQGVAVLASMTVIFVVMAVA
                     AMASEQHITAALSSLSIDHAASALQAGGNMEGKEVRFGISATSLFATITTAASCGAVN
                     AMHDSFTAIGGLVPMLLMQLGEVVFGGVGSGLYGMLVYAVLAVFIAGLMIGRTPEYLG
                     KKIEAYEMKMTAVAILVTPLLVLVGTAIAVMLEPGRAGVFNPGTHGFSEILYALSSAS
                     NNNGSAFAGLSANTPFYNTLLAAAMWFGRFWIIVPVLAMAGSLAAKRRTPVTAGTMPT
                     HGPLFIVLLVGSVLLVGALTYVPALALGPVAEQLQPAAVTAAAK"
     gene            41393..43624
                     /gene="kdpB"
                     /locus_tag="Rmet_0039"
     CDS             41393..43624
                     /gene="kdpB"
                     /locus_tag="Rmet_0039"
                     /EC_number="3.6.3.12"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium translocating ATPase, subunit B"
                     /protein_id="ABF06925.1"
                     /translation="MQQQSTATRSSAAGTASRNPAPGSTVMTGGGLPGHPRPSRGMMS
                     PELVKPAIIDAFRKLNPRDQLRNPVMFVVYAGSILTSILCVRAWLHPTPGGESAGFIL
                     AVTVWLWFTVLFANFAEALAEGRSKQQAAALRGLKTTTMARVVRAGHRDARAQGATEQ
                     RAATELRKGDVVLVEAGDMIPGDGEVIEGVASDDESAITGESAPVIRESGGDFSSVTG
                     GTRVLSDWIIVRITANPGESFIDRMISMVEGAKRQKTPNELALTILLVGLTLVLLLAT
                     ATLQPYSLYAVLVTKAGVPVSVTVLVALLVCLIPTTIGGLLSAIGVAGMSRMMEANVI
                     ATSGRAVEAAGDVDVLLLDKTGTITHGNRQASRFICAPGVTERQLAEAAWLSSLADET
                     PEGRSIVVLARQQSDVSAPEMGERGLAAPVFVPFTAQTRMSGVDVANGQIVRSVRKGA
                     ADAVRRYVTERAGKFPDVVMQAVDDVARAGSTPLVVAESIAQGTEESVRVLGVIELKD
                     IVKAGIRERFVELRKMGIRTVMITGDNRLTAASIAAEAGVDDFLAEATPEAKLALIRE
                     YQSEGRLVAMTGDGTNDAPALAQADVAVAMNSGTQAAREAGNMVDLDSNPTKLIEIVE
                     IGKQMLMTRGSLTTFSVANDVAKYFAIIPAAFATTYPQLNLLNVMGLSTPGSAIMSAV
                     IFNALIIVALIPLALRGVVYRPLGAAVLLRRNLLIYGLGGIVVPFVGIKLIDMLLTMF
                     GWV"
     gene            43646..44257
                     /gene="kdpC"
                     /locus_tag="Rmet_0040"
     CDS             43646..44257
                     /gene="kdpC"
                     /locus_tag="Rmet_0040"
                     /EC_number="3.6.3.12"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium translocating ATPase, subunit C"
                     /protein_id="ABF06926.1"
                     /translation="MTTQSNTVAQVPRQTGLLRPALTVFIVLSVVTGLLYPGVVTGIA
                     RAVFPHQAAGSLIVKDGKTVGSELIGQPFSDPKYFWGRLSATAPMSYNATASGGSNLG
                     PTNPALTDAAKARIDGLREADPDNKAPVPVDLVTASGSGLDPHISPAAAQYQAARVAR
                     LRGVSLEKVEALIAANTKDPGLAVLGEPAVNVLALNLALDGLK"
     gene            44406..47309
                     /gene="kdpD"
                     /locus_tag="Rmet_0041"
     CDS             44406..47309
                     /gene="kdpD"
                     /locus_tag="Rmet_0041"
                     /codon_start=1
                     /transl_table=11
                     /product="osmosensitive K+ channel signal transduction
                     histidine kinase"
                     /protein_id="ABF06927.1"
                     /translation="MYAWQSPAWHNHRHQPPLPMTDPDARPDPDALLQRMQAERARAA
                     RGKLRVYFGASAGVGKTFAMLGAARALREQGVDVVVGVVETHGRAETEALLDGLERLP
                     LREVPYRDRVLAEFDLDGALARRPALILVDELAHSNAAGSRHPKRWQDIQELQATGID
                     VWTTVNVQHLDSLNQAVGGITGVRVWETVPDAVFDGADEVVLVDLPADELLRRLREGK
                     VYLPDQARHAARNFFRKGNLIALRELALRRTADRVDDDVRAYRHAESIDLVWRTREAL
                     VACIGAGDDAEQVVRSAQRLAGQLDCDWHVVTIATPQLMPPSNEVRARMRAAMQLAEE
                     LGARTETLAGNDMVKAVAGYVRRHNLTKVLLGRAPADWYARGNWIDKGRALLARALSP
                     LLGVGNRLFGRQMFADALAAGCPEIDVIRVAADSTRADLRPRVQEGLSTEAHDAEAEA
                     ELARVRRHNYGWAVVWCMAATFLSTLTRPWFDLVNIAMLFLVAVVGVALRHGRGPAAL
                     ASVISVAAFDFFFVPPRMSFAVSDVQYLLTFFVLLTVGLVIGQLTAGLREQAQVSVRR
                     ETDARTLYELARELSAALTAQQIVEIGGRFLRAAFDADGTFFLVAENGRLMPMAGGEK
                     TPEPRTGKGDAIDKVLAQWVFDHGQPAGTGTHTLPGSTVLYLPLKAPMQTRGVLAVEP
                     RAWRALADPALRRQADVFATLIAIAIERIHYVDVAQRALVSIESERLRSSLLAAVSHD
                     LRTPLTGLIGMAETLQRAEMPLPASVAETVEAMRVQAQRMRTMVVNLLDMARLQHHDL
                     ALKRGWQSLEELIGAALASMRDVLGRHHVEVMNLVELPLVECDDVLMERVLCNLLENA
                     AKYTPAGTAIRIRGAVVGDEVQLSVEDEGPGVQSGQERYIFEKFTRGERESATSGVGL
                     GLAVCEAIMQAHGGRIWVEAAHPHGSRFTLALPRGNPPAIEPESLDEPIPDHH"
     gene            47311..48006
                     /gene="kdpE"
                     /locus_tag="Rmet_0042"
     CDS             47311..48006
                     /gene="kdpE"
                     /locus_tag="Rmet_0042"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator, winged
                     helix family"
                     /protein_id="ABF06928.1"
                     /translation="MPFDYSPTVLLVEDEPHIRRFVRESLQSEGCTVHEADTLKRGLI
                     DAGTRQPDVVILDLGLPDGDGMTLIREMRTWTEVPVLVLSARTGEADKIAALDAGADD
                     YLTKPFGVGELVARVRVLLRRHAKANPQGTPQITFGDVRVDLANRLVTRGEDQVHLTP
                     IEYRLLAVLIANRGKVMTHRELLREVWGPSHSESSHYLRVYMGHLRHKLEVDPAQPAH
                     LLTEVGVGYRFAG"
     gene            48145..48855
                     /locus_tag="Rmet_0043"
     CDS             48145..48855
                     /locus_tag="Rmet_0043"
                     /codon_start=1
                     /transl_table=11
                     /product="TPR repeat protein, SEL1 subfamily"
                     /protein_id="ABF06929.1"
                     /translation="MSQLAAPTIRQSVVALALACALSGLSAYAATERPQPAQEQTQAA
                     VAAYEAGNFEVAIQGFAAAAQKGNRLAQFDYAMMLLRGEGTPAKPQEALVWLRRAADN
                     QMTHAQFTFGDLYERGDVVPKSLPEANRWYELAAQGGHVQAQVALATNYFTGRGVPLD
                     YGRAFHWYSKAAAAGDEGAQYIVASYYERGYPGVVDRDIEQAKLWYARAAAHGDPGAL
                     AKLRSLQDEGAQPAKGPM"
     gene            48933..51581
                     /locus_tag="Rmet_0044"
     CDS             48933..51581
                     /locus_tag="Rmet_0044"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06930.1"
                     /translation="MPSQSSLPLEGPDAPALMAGQLALPVPDGHLDELRLPDGALREC
                     WARFFSVLGDPPPDVLNAHASAVARQIRQNGVTYNIRADQGDGARAWQLEVFPLLVPE
                     QDWATIEAGVAQRATLANAIMADIYGPQLLLKRGLLPPGLVYGHPGYMRPLKGYRPPG
                     GSYLQTVAVDLVHTASGWTVIAHRTETPSGMGYALENRLIVSGQFAEAFREMRVRRLP
                     QAFAQLISTLALAPLTPLTPLGGEPGSPRPLQAGRQIVLLSPGPYNETFFEHTFLARY
                     LGITLVEGKDLTVRNDVVYLKTFGGLERVDVILRRLDDVFCDPLELRGDSMIGVPGLL
                     EAMRAGNVMVSNVPGSGFLESPAIHGFLPGVAQALLGEPLVLPAVSSWWCGEAPAWQE
                     ALGLLDEAFVMPTYPRTPADAPLGMEQGLQTLADWRARIDASPDRYTVQAPLPLSHMP
                     CWEPDGHGGGRIGSRPAMLRVYAIADGNGGWQVMPGGFTRLAPPHREAVSMQIGGTSA
                     DTWVLSSQPTHAVPLTSARAGLAAMSATAGSALARQLTVSSRAAENLYWAGRYAERAE
                     NLVRLCRQILGSIESNDETDDGTLTMIGDLATWFGLVPPQTPSPRASLRAFEHALVST
                     LANPDADSGLGPTLASHAGAANEIRNRLSNDHWRTILAARNDFRDAMQAACPDGPSAG
                     EGTYDRSKVLAALEHLSMQLGAISGAQGDRMARDVAWRLVFIGRHIERLGTLALFLEV
                     AERSGALYSRSGVDLLLHLFDSTLSFRSLFPGRADVPALVDLLVLDPTNPRGIYGVLD
                     RLRAKLVQLPTGATGQTRVPLAEMLPPASALPSRTLLCASNRQGRQTTLGALCDQLGA
                     RMAKLSEEIGGRYFSHAGVTIETELP"
     gene            51578..52480
                     /locus_tag="Rmet_0045"
     CDS             51578..52480
                     /locus_tag="Rmet_0045"
                     /codon_start=1
                     /transl_table=11
                     /product="transglutaminase-like protein"
                     /protein_id="ABF06931.1"
                     /translation="MSDIGTTTLSVHHTTTYHYAWPVELAQQRAVVTPPSCAWQTVGA
                     HSIEVDPAPSHQHMRTDGFGNNVLHFMLDVPHETMWLTATSTVTLKPRWQALDIARSP
                     RWEDAAERLRYRAGQPFHPETEFVYASPNVALHDSLRNYALLSFAPGVTVAAGAIDLM
                     HRIHADFDYHSEITEVHTPALEAFALRSGVCQDFAQVMIGCLRSIGLPARYVSGYLCT
                     DPPPGEPRLLGADASHAWAGVWCPENGWIDLDPTNAMLADTRHVTLAIARDYSDVPLL
                     HGVIVGGGEHTVGVEVSVVPVMSA"
     gene            complement(52552..54006)
                     /gene="gatB"
                     /locus_tag="Rmet_0046"
     CDS             complement(52552..54006)
                     /gene="gatB"
                     /locus_tag="Rmet_0046"
                     /EC_number="6.3.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutamyl-tRNA(Gln) amidotransferase subunit B"
                     /protein_id="ABF06932.1"
                     /translation="MQWEVVIGLETHTQLSTASKIFSGTSTAFGAEPNTQASPVDLAL
                     PGVLPVLNRGAVERAIQFGLSIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQG
                     GQITIQVEGKQGVYEKTVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTE
                     PDMRSSAEAVAYAKALHSLVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRREIK
                     NLNSFRFLQQAIDYEVQWQIAEIEDGREIVQATVLFDPDTGETRAMRTKEDAHDYRYF
                     PDPDLMPLEIDAAWVERVKSELPELPATMQARFVSQYGLSAYDASTITATKALAAYYE
                     AVVTNVGAASAKPAANWVMGEIASQLNREGISIDEAPVRPAQLAKLLARITDGTVSNN
                     TAKKDVFPAMWAGESDGDADAIIAAKGLKQMSDTGELEKIIDDVLAANAKSVEEFRAG
                     KEKAFNALVGQAMKATKGKANPAQVNELLKKKLG"
     gene            complement(54086..55156)
                     /locus_tag="Rmet_0047"
     CDS             complement(54086..55156)
                     /locus_tag="Rmet_0047"
                     /EC_number="3.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="dienelactone hydrolase or related enzyme"
                     /protein_id="ABF06933.1"
                     /translation="MRRRPHLSTLTPTPLVPTMAGHWLRASVAAVAIGMALLQAAPAQ
                     PAVSSAVPSAAPAASASAPMTPAAAAMEPAAQRVRIPGDGGSPELTGYWFTPRDGGLP
                     RSQPLPVVVALHGCNGLIDMRVAAKRAGTIEEVIDPAGALQSRYREYAHWLAERGYAV
                     LMPDSYSVRGRAQGTCGDALESRAIDDRTRRSDALAAMRWVSRQPGIDARRIVLLGWS
                     NGAQAVLATIDASRPWPGGTPTVDRAVAFYPGCKRAVQQHNFRLRSPLLLLIGGADDW
                     TPATRCAMLQNAVQSRQPGARFRLEIYPGAYHGFDGTSELHVRRDVIAARRNGGVTVG
                     GDAVARVAALGQLDSWLASPDP"
     gene            complement(55190..55663)
                     /locus_tag="Rmet_0048"
     CDS             complement(55190..55663)
                     /locus_tag="Rmet_0048"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein"
                     /protein_id="ABF06934.1"
                     /translation="MQTRPLPIVSMRAAAAMALLATLAGCIPLPFGGRSTPIAARDID
                     LVGDCRRTEEDGFREDAQLRVANNTVQQLQWKLWVGKRGSCSFNLADFRQVKKTPHIE
                     LRANDGSACELMVWQDPRRITLAHANCQAHCTPGIYEQAWPVMFEPGSGDCARTR"
     gene            complement(55671..57170)
                     /gene="gatA1"
                     /locus_tag="Rmet_0049"
     CDS             complement(55671..57170)
                     /gene="gatA1"
                     /locus_tag="Rmet_0049"
                     /EC_number="6.3.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutamyl/Aspartyl-tRNA(Gln/Asp) amidotransferase
                     subunit A"
                     /protein_id="ABF06935.1"
                     /translation="MPFSADSVTSLRQIADALAARSVSAEELAREYLARIEAGRALNA
                     FVAVDPELTLAQARAADERRAQGQATPLTGVPIAHKDVFVTRGWKSTAGSKMLANYES
                     PFDATVVERLAAAGMVTLGKTNMDEFAMGSSNENSFFGPVSNPWDTSRVPGGSSGGSA
                     AAVAAGLAPAATGTDTGGSIRQPASFSGITGIKPTYGRVSRYGMIAFASSLDQGGPMA
                     HSAEDCALLLNGMAGFDPKDSTSLTPELGGVTEDFTRLLGQPRAGATASQPLAGLRIG
                     LPREYFGKGLSADVEQALRAALAEYEKLGATLVDVTLPKTELSIPVYYIIAPAEASSN
                     LSRFDGVRYGHRAAQYGDLLDMYKKSRAEGFGPEVKRRIMVGTYVLSHGYYDAYYLQA
                     QKIRRIIADDFQRAFTQCDVIMGPVAPTVAWKLGEKTADPVQMYLADIFTLSTSLAGL
                     PGMSVPCGFGEGNMPVGLQLIGNYFDEAQLLQTAHAFQQATDWHLRRPA"
     gene            complement(57222..57521)
                     /gene="gatC"
                     /locus_tag="Rmet_0050"
     CDS             complement(57222..57521)
                     /gene="gatC"
                     /locus_tag="Rmet_0050"
                     /EC_number="6.3.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutamyl-tRNA(Gln) amidotransferase subunit C"
                     /protein_id="ABF06936.1"
                     /translation="MALALSDVKRIAHLARIETSDAEAEQTLAQLNNFFSLVEQMQAV
                     DTTGIEPLAHPLSAVRDIAQRLREDAVTESDRRADYQRPAPATENGLYLVPKVIE"
     gene            complement(57750..58019)
                     /locus_tag="Rmet_6404"
     CDS             complement(57750..58019)
                     /locus_tag="Rmet_6404"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADC45022.1"
                     /translation="MVTAQPRVQYAPDFHAVPDSASPFCMAPTAIMRRQCCTAATADA
                     RNWSVPGPGAVLVDRENRPDCADGVTIGHPCPSEVERALRGICNA"
     gene            58487..59530
                     /gene="mreB"
                     /locus_tag="Rmet_0051"
     CDS             58487..59530
                     /gene="mreB"
                     /locus_tag="Rmet_0051"
                     /codon_start=1
                     /transl_table=11
                     /product="cell shape determining protein, MreB/MreI
                     family"
                     /protein_id="ABF06937.1"
                     /translation="MFGFLRSYFSNDLAIDLGTANTLIYMRDKGIVLDEPSVVAIRQE
                     GGPNAKKTITAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMLKQFIKMVHDS
                     KLLRPSPRIIICVPCGSTQVERRAIRESALGAGASQVYLIEEPMSAAIGAGLPVSEPS
                     GSMVVDIGGGTTEVGIISLGGMVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEA
                     IKKEIGSAFPGSEVREMEVKGRNLSEGIPRAFTVSSNEILEALTDPLNQIVSAVKIAL
                     EQTPPELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMAL
                     ERMDKLGSIFSYE"
     gene            59673..60683
                     /gene="mreC"
                     /locus_tag="Rmet_0052"
     CDS             59673..60683
                     /gene="mreC"
                     /locus_tag="Rmet_0052"
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreC"
                     /protein_id="ABF06938.1"
                     /translation="MDYSPPPLFKQGTSAVARLVIFVTIALVLLIVDARFDAMRNVRQ
                     VAATVLMPVERLVLVPRDAIRGVFDYAQSSVELANENRELRRAALEQANASVRQAQLE
                     SENNQLRKLLNLTQQSTTPVTPAEILYDARDPYSQRIVIDRGSMQGLRAGYPVIDERG
                     VIGQVTRVSPFQSEVTLLTDKDQAIPVQVVRNGLRSVAFGGSRAGLLDLRFMAASADL
                     QQGDLLVTSGLDGTYPPGLPVAKIVQIERKADTAFSRVYCEPVAGVRSHRQLLVVRYE
                     SGLAPRPPEAATSQKAERGSRSAAARAGAEQKADKAATSADKPADTPTAAPAQKPSEP
                     AR"
     gene            60680..61192
                     /gene="mreD"
                     /locus_tag="Rmet_0053"
     CDS             60680..61192
                     /gene="mreD"
                     /locus_tag="Rmet_0053"
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreD"
                     /protein_id="ABF06939.1"
                     /translation="MTTSQYLLRPVNPAFIALTFVLAFLINLMPWGETLWIPDVVALV
                     LVFWNIHQPRKVGMGVAFLLGLLMDVHDARLLGEHALAYTLLAYFAITIHRRVLWFSV
                     YAQALHVLPLLFIAHAVPVVIRLAMGAPLPGWQLLLAPVIEAVLWPMATSLLLAPQRR
                     SNEVDETRPI"
     gene            61236..63617
                     /gene="mrdA"
                     /locus_tag="Rmet_0054"
     CDS             61236..63617
                     /gene="mrdA"
                     /locus_tag="Rmet_0054"
                     /codon_start=1
                     /transl_table=11
                     /product="transpeptidase involved in peptidoglycan
                     synthesis (penicillin-binding protein 2)"
                     /protein_id="ABF06940.1"
                     /translation="MTEIRNVELEIGRFRIRVAAAALFTVVCFGLLFSRFLWLQWYKH
                     DQYSAKAEDNRISVAPIEPNRGIIMDRNGVVLARNYSAYTLEITPSKLTDTLDNTIEE
                     LATLVDIQPRDRRRFKRLLEESRSFESLPIRSQLTDEEVARFSAQRFRFPGVDVRARL
                     FRQYPLGEAASHVVGYLGRISQRDQERIEAMDEANDAADGDKYDPRKDADNYKGSNYI
                     GKIGLEQSYETELHGLTGFEEVEVSAGGRPIRTLSTSPATPGNNLILSLDIRLQQLAE
                     QLFGDRRGALVAIEPETGDILAFVSKPTFDPNLFVEGIDSKTWDELNNSPDKPLLNRP
                     LRGTYPPGSTYKPFMALAALTTGKRTAAWGMHDPGFFTLGNHTFRDDKPGGHGWVDMQ
                     ASIVQSCDTYYYMLARDMGVNAIHDFMKPLGFGQITGIDIEGENRGILPSTDWKRKAY
                     RRPEQQKWYDGETISLGIGQGYNSFTILQLANAVSILVNNGVAMKPHLVKAVEDSVSR
                     KRTLTVPKESYRIPLKQGDIDVIKRSMVAVTHSGTAARVFAGAAYESAGKTGTAQTYT
                     LGKNEKYNHHALDERKRDHSLYTAFAPADHPKIALALIVENAGFGAAVAAPIARKVMD
                     YYLLGKWPEELAATAPPPAERERAGGKPPVDTPSVFTTGQTANAASATVMQTAPAAAS
                     DATTGAANAAGASAAGASASVPAARSASDTIAGQLDPDAIAPASAEVTLDARMLQALG
                     HSKPAPTPPATPSRATPASAPAPAKPKTQPARPKPANVAGPASGSSARNNVSE"
     gene            63631..64773
                     /gene="mrdB"
                     /locus_tag="Rmet_0055"
     CDS             63631..64773
                     /gene="mrdB"
                     /locus_tag="Rmet_0055"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall shape-determining protein MrdB"
                     /protein_id="ABF06941.1"
                     /translation="MDRRRVVSIIKSALTGFDKPLALIVFLLFATGIVALYSAAIDMP
                     GRVEDQLRNILLSYVVMLVIAYMPTQLLMRIAVPLYTVGVALLIAVAMFGLIRKGARR
                     WLNVGMVIQPSEIMKIAMPLMLAWYFQKREGVIKWFDFVVALIMLGIPVGLIAKQPDL
                     GTALLVLAAGIYVIYFAGLTWKIILPILGAGVVVITLIVTYQNQICAPGVNWPILHDY
                     QQHRVCTLLDPTTDPLGKGFHTIQSIIAIGSGGVTGKGWLKGTQTHLEFIPEKHTDFI
                     FAVFSEEFGLIGNAVLLVLYLLLIFRGLYIAANAPTLFSRLLAGSITLIFFTYAFVNM
                     GMVSGILPVVGVPLPLMSYGGTALVTLGMGIGILMSISRQKRLIQT"
     gene            64826..65497
                     /locus_tag="Rmet_0056"
     CDS             64826..65497
                     /locus_tag="Rmet_0056"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06942.1"
                     /translation="MNAQDVAAYLQSHPQFFEDHAELLATVQLTSPHSHRAVSLQERQ
                     MEILREKNKGLELKLADLVRHGHENDRTQQRMHDWQMRLLAEADSHALPYAVRDGLQQ
                     VFDVPAVGLRLWSVGETYAHMEVAQGASDDLRLFAEGLRAPFCGANAGFEAAQLLERD
                     DVASLAMVALRVPAKPDEDGPGAAFGLLVLGSPDARRFHEGMGTAYLAQIGEVAGAAL
                     NRLRD"
     gene            65517..66626
                     /gene="xerC"
                     /locus_tag="Rmet_0057"
     CDS             65517..66626
                     /gene="xerC"
                     /locus_tag="Rmet_0057"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-based site-specific tyrosine
                     recombinase XerC"
                     /protein_id="ABF06943.1"
                     /translation="MRTRQPARNRAHAVDEADEASAEKPAPDPLVVRYLDWLATSRKL
                     AAHTLTSYGHDLSVLQSQAIRLAPGVALLALETRHIRSFAARLHGNGLSARTIARTLS
                     AWRGFYLWAARHGHGVQSNPVDGVRAPKRGRPLPKALSVEHAVALVAHRQDDTNESLR
                     DQAVFELFYSSGLRLSELIQLDVRYTEDGDYRSSGWLDLDGAEVTVLGKGSRRRTVPV
                     GSKAIQALKAWIHVREMMLRPGALPEDAHALFLGTRGRRLPISTVQQRIKRQALAAGV
                     PSDVHPHMLRHSFATHMLQSSGDLRAVQEMLGHASISTTQIYTSLDFQHLAKVYDQAH
                     PRAGRASKSPKASSVKPSKPDESDELAEPDDSGED"
     gene            complement(66623..67516)
                     /gene="gcvA"
                     /locus_tag="Rmet_0058"
     CDS             complement(66623..67516)
                     /gene="gcvA"
                     /locus_tag="Rmet_0058"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional dual regulator, LysR
                     family"
                     /protein_id="ABF06944.1"
                     /translation="MPALAALRTFEAAARHESFSRAATELFVTHGAVSHQIRALEEEL
                     GQQLFERRGKRVMLTTNGRLYAERVRDALLQIADATRVLQAGNRDKRLTISTMPSFAA
                     RWLTPRIGSFIEQHPELDVELLSSNSLVDFASEEVDIALRMGTGHYPGLYVERLLDDV
                     FFPVCSPNYNGGRLPEQPAHMAGMPLLRGEGDPWKPWFEAAGLDWPEPTKGLLLQDSS
                     LLLQAAAEGQGVALIRSSLAYNDLLSGRVVRLFDVSIPCPWLLHFVCTHASLETPKVQ
                     AFRHWLLPEMERFRNILSQWN"
     gene            67773..68141
                     /locus_tag="Rmet_0059"
     CDS             67773..68141
                     /locus_tag="Rmet_0059"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein"
                     /protein_id="ABF06945.1"
                     /translation="MKALLTTTVFTLAPGEVTALSLHAAQRLFVEDAKGMDVWVTREN
                     DSEDYWLRCGSSLMLRRGDEIVLSVDPRAAGTVRLALIAEARRPALTLADVPHIAYRA
                     VRRLVRGTEWTPAEDKITAS"
     gene            68214..69008
                     /gene="lipB"
                     /locus_tag="Rmet_0060"
     CDS             68214..69008
                     /gene="lipB"
                     /locus_tag="Rmet_0060"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Lipoate-protein ligase B"
                     /protein_id="ABF06946.1"
                     /translation="MTKQIGPARALRRPALFVTLLPMHPIHVIDRGRQPYQPCFDAMR
                     DFTATRTPETPDQIWLVEHPPVYTLGQAGDPAHLLAPDDTIPVVQIDRGGQITYHGPG
                     QVVAYLLLDLRRRHLMVRELVHDIEQAVLDTLAAYNLAAERKAGAPGIYLSDGKHQGA
                     KIAALGLKIRNGCSYHGVSLNVQMDLSPFLRINPCGYAGLETVDMATAGAAFTAADDA
                     GGAVHRPVTATQQPEIAQRLAAALCEVLAAREARAPVPGQAAAEAA"
     gene            69085..70077
                     /gene="lipA"
                     /locus_tag="Rmet_0061"
     CDS             69085..70077
                     /gene="lipA"
                     /locus_tag="Rmet_0061"
                     /EC_number="2.8.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoate synthase"
                     /protein_id="ABF06947.1"
                     /translation="MSDAPIATSSEVTQSPADYDPTKKQKSAEKTARIPIKIVPAEKL
                     KKPDWIRVKAATGNSRFYEIKDILRANNLVTVCEEASCPNIGECFGKGTATFMIMGDK
                     CTRRCPFCDVGHGRPDPLDVNEPGNLARTIAQLKLNYVVITSVDRDDLRDGGAQHYVD
                     CISQTRELSPNTRIEVLVPDFRGRLDRALDILQACPPDVMNHNMETVPRLYKQARPGA
                     DYAHSLKLLQDFKRRNPNVPTKSGLMVGLGETDEEILDVMRDMRAHDIDMLTIGQYLA
                     PSNHHLPVTRYVHPDTFKMFEEEAYKMGFTHAAVGAMVRSSYHADQQAHQAGFA"
     gene            70418..71068
                     /locus_tag="Rmet_0062"
     CDS             70418..71068
                     /locus_tag="Rmet_0062"
                     /codon_start=1
                     /transl_table=11
                     /product="putative allophanate hydrolase subunit 1"
                     /protein_id="ABF06948.1"
                     /translation="MPQCTVHRLAEQALLYSVEPPASLDVQRRIWAMAARAADWRGVV
                     DVVPGMNNLTVTFDGTADVAALERNLKLAWASGEARNATGRLVEVPVRYGGEFGPDLA
                     DVAAHTGLTPAEVVHRHAAGEYVVYFLGFQPGFTYMGGLAPELATPRRREPRLAVPAG
                     AVGIGGEQTGIYPAVLPGGWQLIGRTDAQLFVADRDPPSLFAPGDTVRFVAEEILL"
     gene            71065..72084
                     /locus_tag="Rmet_0063"
     CDS             71065..72084
                     /locus_tag="Rmet_0063"
                     /codon_start=1
                     /transl_table=11
                     /product="putative allophanate hydrolase subunit 2"
                     /protein_id="ABF06949.1"
                     /translation="MIEIIRPGAQASVQDLGRVGFRRFGVGRSGAADDLALRVGNRLL
                     GNDPGAAAIEFTLGRAAVRFEADMRVALTGAECSANLDGVPVWSWHAFDVRRGETLTL
                     PSPRGGTRTYLCVAGGIDVPLVMNSRSTDLKSGFGGFEGRVLREGDRLPVGRPGIEQG
                     QDWVGVAAPGWALPGQDGGNAIAIRLLPGPEYADFEPASQAALWQSEWTITPQSNRMG
                     LRLQGPALARRAERSADLLSHGVVPGVMQVPPSGQPIALMSDAQTTGGYPKIGTVIGA
                     DLWRLAQVPLGATVRFRQVTLEEAAAAQAEVDRYLRQIDQALAWQRDGMQIAARRRAT
                     TRFVA"
     gene            72161..72901
                     /gene="lamB"
                     /locus_tag="Rmet_0064"
     CDS             72161..72901
                     /gene="lamB"
                     /locus_tag="Rmet_0064"
                     /codon_start=1
                     /transl_table=11
                     /product="lactam utilization protein LamB"
                     /protein_id="ABF06950.1"
                     /translation="MQIDLNADLGEGCGNDEALLALISSANIACGWHAGDAATMLQTV
                     KWALANKVSIGAHPSFPDRENFGRTEMQRDPEAVYADVLYQIGALDAMVRAQGGELAH
                     VKPHGALYNMAVRDAKLCEAIVRAVRDYDSDLVFFGLANSQMIDIARAAGLRVKEEVF
                     ADRGYNPDGTLVKRGTPGALHEDEDVALNQTLSMVRDKQVRAIDGTWVPIRAETVCLH
                     GDGAHALAFARRIRERLGAEGIAIRAGN"
     gene            72969..73703
                     /locus_tag="Rmet_0065"
     CDS             72969..73703
                     /locus_tag="Rmet_0065"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06951.1"
                     /translation="METALNLWPLLGVGVIILGFVLRFNPMMVVAAAAIVTGLAASMP
                     VMQIFTAIGTAFVKARNLPLIILLPLAVIGLLERHGLREHAQAWISRIASATVGRLLI
                     VYLGVRELTAAVGLTSLGGHPQMVRPLLAPMAEGAAENRFGHLPEPVRQRILAFCAAT
                     DNVGLFFGEDIFVAFGAIALMHTFLLSSNIDVEPLHIAVWGIPTAICAFLIHAVRLKR
                     LDGWLERELGGKQAAGTPATAVAKGE"
     gene            73707..74657
                     /locus_tag="Rmet_0066"
     CDS             73707..74657
                     /locus_tag="Rmet_0066"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06952.1"
                     /translation="MIVSIDYLYWLAGFVLLITALMTFTDKTHPRRLSTGLFWLLYAV
                     IFLVGDKIPPAIVGVGAVVMALIAGFGGVGQGKHGSLPEEERRASARRLGNKLFIPAL
                     LIPLVTVLGTVLFKDVKIAGLALLDPKNVTFVSLGIGCIVSLIVVCWLTRDTVTQSMR
                     ESRRLIESLGWALVLPQMLAMLGLVFADAGVGKAVAHLTTAYINMDYKLVAVAVYCVG
                     MALFTIIMGNGFAAFPVMTGGVGVPILVGMFNANPAVMAAIGMFSGYCGTLMTPMAAN
                     FNIVPAALLELEDKNAVIRAQVPTALCILVANIILLYFLM"
     gene            74671..75339
                     /gene="pcp1"
                     /locus_tag="Rmet_0067"
     CDS             74671..75339
                     /gene="pcp1"
                     /locus_tag="Rmet_0067"
                     /EC_number="3.4.19.3"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrrolidone-carboxylate peptidase"
                     /protein_id="ABF06953.1"
                     /translation="MTTRTVLLTGFEPFENEPVNPSWEAVRALDGERVGDALIVARQL
                     PCVFGKAIEAMDALVDTLRPDVVIAVGQAGGRTELSIERVAINVDDARIADNAGAQPI
                     DAPIAKDGPVAYFSTLPIKAIVRDMRAAGVPAMVSQTAGTFVCNHVFYGLMHVLAHRK
                     AGSAAAPTRGGFIHIPYLPEQAARHPGAPSLALDTLIAGLRVAVATSLSTDADIREGG
                     GQLH"
     gene            complement(75351..76673)
                     /locus_tag="Rmet_0068"
     CDS             complement(75351..76673)
                     /locus_tag="Rmet_0068"
                     /codon_start=1
                     /transl_table=11
                     /product="predicted integral membrane protein"
                     /protein_id="ABF06954.1"
                     /translation="MAQATPPPSPHSPAPPEPQRSQPEDTRQSELEVALLPRHSPVAR
                     VGLLCFTLLVVYASLYPFTGWVNNGVSAFAFLTAPKPRYITEFDLLTNVLGYCPFGAL
                     VVLSLHPRVSGARATLIALVAGALLSGSMEALQTWLPTRISSNIDLITNALGSLLGAA
                     VVAPFTSALVDRGTLTRLRYAWFEPYASFAIILILLWPFAQIFPQEHLFGMGGIVREW
                     LTDPDSWPMELVQAYFPSLIAWQDNIGLRPDDMQGQLMLETMVTASSWIGTGLFASIA
                     MRRTAPMLRILAGLLTAALIIKAAVAELQFPDDNAFNWLSEGGRFALLTSSLVLVLLL
                     RLPRWLRAILATLALATLIVLTNVLPSNPYAWISEQGWRMGRFIHFNSLAQWLGWLWP
                     LLAFFYIIWRFEQASVRRRLVRRARRRATERAVAAATEAQQESKRPQS"
     gene            complement(76725..77372)
                     /locus_tag="Rmet_0069"
     CDS             complement(76725..77372)
                     /locus_tag="Rmet_0069"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="ABF06955.1"
                     /translation="MTIASALRFTALGLLIALSGCSVLSSQPPSTTYDFGPLAAAPSQ
                     PPAPLPKLRITQTDGPVWMDGSGIYYRLQYTQAQRLQAYSTQRWVDSPQHLFNDRLRD
                     AVAARGPLSWSGDTTIPALKVDLLAFEQVFDSPTSSRGVVRARATVYHKGLIGQKTFV
                     AEQPAPSADGQGGVKALSAGVDAVIAAILDWTATLPLDGAQASSAPPAPPAPQRR"
     gene            complement(77417..78358)
                     /locus_tag="Rmet_0070"
     CDS             complement(77417..78358)
                     /locus_tag="Rmet_0070"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transporter, periplasmic component"
                     /protein_id="ABF06956.1"
                     /translation="MENKSNAFLAGVFTIGLAILVSVSLFWFSSDHTVRVPYDLITRS
                     TVNGLGPQADVKYRGLEVGKVLSIKFDPQVPGQIIVRISINHDTPITRTTYATLGFQG
                     VTGIAYVQLDDSERTEGDTSSSPRLTTSAREPARIVMRPGFFEELEKRGDSLLTQAET
                     LMASLDSMFQPANRDELMAAIRAVHKTADDYSHLKSTLQPAAEKLPKAVDNLNAALVS
                     TKRLTDEIGNPDGTVMRTVNRVGNDLQVAADSVQSTTTIVNQETLPQINGLARESRQA
                     VRSIDRAASQFNDKPSSVLFGGPSPTPGPGEPGFQAP"
     gene            complement(78358..79197)
                     /locus_tag="Rmet_0071"
     CDS             complement(78358..79197)
                     /locus_tag="Rmet_0071"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transporter, ATPase component"
                     /protein_id="ABF06957.1"
                     /translation="MSPTIERGTPRETIIEVRNLEKRFGDNVVHKDLNLEVYRGEVLS
                     IVGGSGSGKTVLLRQIVGLDRPTSGTIRVFGENPAELSADQLQALRSRWGLQFQRGAL
                     FSALSVIDNVALPLREMRALPDDLICRASLLKLQLVGLSAKDADKMPSDLSGGMIKRV
                     GLARALALEPELVFLDEPTAGLDPMASDDYVALIRELRRELGLTVVMITHDLDTLVAL
                     SDRVAVLADHRVLAAAPIPEVIKVDHPFIREYFLGERAQRALQALPAPKGPGAPDAHP
                     GEV"
     gene            complement(79194..80324)
                     /locus_tag="Rmet_0072"
     CDS             complement(79194..80324)
                     /locus_tag="Rmet_0072"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, inner membrane subunit"
                     /protein_id="ABF06958.1"
                     /translation="MERQPTPVIEISRQDTDFRVQLQGEWTAVALAGCHEARGLRAQL
                     HELSEAPRHAEWSLDGITRLDHIGAQLIWQAWNGHMPDNVSLNDGQKRVFARIAGLRT
                     EGWKKHMVERFNPVTIVGASVLSFLAQLGVGVTMLGQLVFDLLRFLRAPQRGPWREIS
                     ANIYNVGYKALGITALVAFLIGIVLSYLSANQLRIFGASTFIVNILGMAVIRELGPVL
                     AAILIAGRSGSAITAQIGVMRVTEELDAMSVMGISHGFRLVMPRVIALAISMPLLVAW
                     TDLLALFGGMVAARLQLDISYVYFLRQLPDAVPVANLWFGLCKGVVFGMLIALTACHF
                     GLRVKPNTQSLGQGTTASVVTSITVVIIADAVFAILFKDIGI"
     gene            80485..81342
                     /gene="birA"
                     /locus_tag="Rmet_0073"
     CDS             80485..81342
                     /gene="birA"
                     /locus_tag="Rmet_0073"
                     /EC_number="6.3.4.15"
                     /codon_start=1
                     /transl_table=11
                     /product="Biotin-(acetyl-CoA carboxylase) ligase"
                     /protein_id="ABF06959.1"
                     /translation="MSEAPDRSPSAPDWRIDADFLHLELGAGAAHAWAVEVVEETGST
                     NADLTQACRAAPWSDDACSVRVAYRQTAGRGRHGRPWRGQAGLTFSVAMPLALSPARL
                     SGLSLAVGLALAEALEDVDPALGARVGLKWPNDLQIDGRKLSGILIESVPAGPERVWV
                     VIGIGLNLVRDPAMEAALGRDLAGVAEAMTTFDPQRDPTRILAAIANRLARMREAFLV
                     DGFAPMAARWSARDAFRDEPVRLLHDGVVQAEGLARGVDGEGYLLLHTPEGLQRIASG
                     EVSLRGASA"
     gene            81339..82172
                     /locus_tag="Rmet_0074"
     CDS             81339..82172
                     /locus_tag="Rmet_0074"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, BAF-family"
                     /protein_id="ABF06960.1"
                     /translation="MSRLLIDIGNTRLKWAWCDDAPVAAEHVVEGGAVLPSPWRHGGA
                     AAHAVPAERSALVGTWRQLAAGTTPEIWIANVAGPTIAAAMEAVMEDAFGAVSPHWVR
                     TTAAHGDLVNGYREPTQLGVDRWVGSIGAHRWLPGETLLIVTAGTATTLDIVTATADG
                     ARFEGGLILPGLELMLGTLARNTAQLPELDVLDTGAGAERAVRALGADNTHDAIAAGC
                     LAAQAGAIERSWRALAGRGPVRCLLSGGARHAVAGALAMPFEMHDNLVLLGLHAMALP
                     A"
     gene            82215..83009
                     /locus_tag="Rmet_0075"
     CDS             82215..83009
                     /locus_tag="Rmet_0075"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein"
                     /protein_id="ABF06961.1"
                     /translation="MLRKGFNALLLILLLVNLWLAAAVAGKFGPEPLAGWAESPREPQ
                     RLGQQARVERMQIQPPRAAEAADAAVAPASSPAAPRAAHPAAISSTARTSADSCMEVG
                     GFTAQNVQRAIEDLKAIAVTAPLPMEQFERSEQVRWWVHLPAQPTRENADRKLAELRR
                     RKVTDVSVVAGENPESYTVSLGLFRDRERADKFLEVLRGQGVRTAQISDAPRAIARQW
                     LRVAHADDAVRARMDEVRLRYGGDVLQDCRPVTQARGEPVATRAEG"
     gene            complement(83133..83624)
                     /gene="hldC"
                     /locus_tag="Rmet_0076"
     CDS             complement(83133..83624)
                     /gene="hldC"
                     /locus_tag="Rmet_0076"
                     /EC_number="2.7.7.-"
                     /codon_start=1
                     /transl_table=11
                     /product="D-beta-D-heptose 1-phosphate
                     adenylyltransferase"
                     /protein_id="ABF06962.1"
                     /translation="MNAPAFESKLVPADDVAALHAAVAKLPRPLVFTNGVFDILHRGH
                     ATYLAQARAMGASLVVGVNSDASVKMLGKGNDRPLNHDADRMALLAALASVDLVAMFR
                     EKTPVELIRLVRPDVYVKGGDYDIDTLEETRLVRSWGGQAYAIQFLHDRSTTKLLTKV
                     RGG"
     gene            complement(83702..84562)
                     /locus_tag="Rmet_0077"
     CDS             complement(83702..84562)
                     /locus_tag="Rmet_0077"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06963.1"
                     /translation="MLYPELFKSLEAVRWHMDKDIPWDTFDASLLTDDQAKTIRMNAI
                     TEWSALPATEMFLRDNRHDSDFSAFMSIWFFEEQKHSLVLMEYLRRFRPDLVPTEEEL
                     HAVRFEFDPAPPLETLMLHFCGEIRLNHWYRRAAEWHSEPVIKHIYRTLSQDEARHGG
                     AYLRYMKKYLNQFGDNARAAFAKIGVLMASARRTEKPLHPTNLHVNKALFPNDTVQSR
                     LPDPDWLEHWLDEQIRFDEIWEKKVIERILHNMSLLFERTFDTVQDLNRYRKELNISL
                     QSGGAQPAQA"
     gene            complement(84692..85948)
                     /gene="rssA"
                     /locus_tag="Rmet_0078"
     CDS             complement(84692..85948)
                     /gene="rssA"
                     /locus_tag="Rmet_0078"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="predicted esterase of the alpha-beta hydrolase
                     superfamily"
                     /protein_id="ABF06964.1"
                     /translation="MSALSAHSAEASARARQRQSTALVMMGGGARAAYQAGVLSGIAK
                     IAARLGLAHCPLPFGIIAGTSAGAINGAGLAVGAADFRAATDKLSALWHSLHADDVYR
                     TDVLRVGVSGARWLSSLAFGWVTRRSSPRALFDNAPLGSFLTELFEPERVQASLDAGV
                     LQAFAVTALSYSTGRHVTFYQSHRRIHGWQRSQRMAVESAIGVDHLLASASIPFLFPA
                     IPLELEGHHEWFGDGTMRQMSPLSPAIHLGASRILAIGAASRQRAGWFDTVPSGGYPS
                     LAQVGGQALASIFLDGLQADIERLMHINRLLSRMPEMANDTEGWRPVQVMTISPSEPI
                     EAIAAEHLNRLPRTVRAFLSPLGGTEARGAAFASYLLFEPEFTQALLALGERDAAAQG
                     DQIAAFLYGVVPETTPAKKEVTEVSQ"
     gene            complement(85945..86844)
                     /locus_tag="Rmet_0079"
     CDS             complement(85945..86844)
                     /locus_tag="Rmet_0079"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06965.1"
                     /translation="MFGQLPDFTNSYEFLRKLWASGSGMPSGLMPGLSAMTPPMDLEG
                     IDKRIHDLKAVESWLQLNSSLLRTTIQGLEVQRATLVALQTFGSALSPDAMQSAMENV
                     ARAASAPSAAPHHQYGAAETVSEAQADAENDEPADDDIDAPPESGAEASATSTGPAQV
                     PPNASLWWDLMQQQFNQIASSAAAAANVTPFSNLGGFGASPAGSESATSTTSTTSTTS
                     TTSAGDNKSGPAPKGAKTSGTKKAGTKTVARKSAKSATKPAAKTSGKPAAKKPAARKA
                     SAGKSTAKPETPPAPGTPEDTFE"
     gene            complement(86899..87726)
                     /locus_tag="Rmet_0080"
     CDS             complement(86899..87726)
                     /locus_tag="Rmet_0080"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="Enoyl-CoA hydratase (ECH)"
                     /protein_id="ABF06966.1"
                     /translation="MTTSDANTLPPRLARYRALTLRRHGPILEVIMGAAQSANQKLAT
                     ADASMHRELAEIWRDISAEPEIRVALIRGEGKGFSAGGDLGLVEEMANDFETRTRVWH
                     EARDLVYNVINCDKPIVSAMHGPAVGAGLVAGLLADISIAAKTARIVDGHTRLGVAAG
                     DHAAIVWPLLCGMAKAKYYLMLCESVSGEEAERIGLVSLAVEEDELVAKAFEVANRLA
                     AGSQTAIRWTKYALNNWLRMAGPAFDTSLALEFMGFAGPDVHEGMASLRQKRPPEFK"
     gene            complement(88108..89148)
                     /gene="mhpD2"
                     /locus_tag="Rmet_0081"
     CDS             complement(88108..89148)
                     /gene="mhpD2"
                     /locus_tag="Rmet_0081"
                     /EC_number="4.2.1.80"
                     /codon_start=1
                     /transl_table=11
                     /product="2-Oxopent-4-enoate hydratase"
                     /protein_id="ABF06967.1"
                     /translation="MRPRRSGRLWPIRFAYVRLRMKLATLKDGSRDGQLVVVSRDLKT
                     AHFATDIAGKLQTVLDDWAFYAPQLQDLYDALNAGRSRHPFPFQTKDCMAPLPRAYQW
                     ADGSAYVNHVELVRKARGAEMPPEFWTDPLMYQGGSDDFIGPQDDIVCASEAFGIDFE
                     AEVAVITGDVRMGATPDQAGEAIRLVMLANDVSLRNLIPAELGKGFGFFQSKPATAFS
                     PVAVTPDELGDAWRERRVHRPMVVHWNSKKVGSPDCGTDMVFDFGQLIAHICRTRNVR
                     AGSIVGSGTISNVDRSKGYCCIAEKRMIETIDGGKPETEFMKYGDAVRIEMFDAEHKS
                     IFGAIDQVVAAP"
     gene            89192..90049
                     /locus_tag="Rmet_0082"
     CDS             89192..90049
                     /locus_tag="Rmet_0082"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, IclR-family"
                     /protein_id="ABF06968.1"
                     /translation="MTAAEDDDTRDDIADDTRRAGIQSIEVGFRLLQALAASPRAMML
                     RDLAAAADMSPAKAHRYLVSFQRLGAVTQDAVSQRYDLGPFALQLGLAGLNRLDPVRK
                     ARPILSQLRDEIDQTAGIAVWGNHGPTIVHWEESSHPVSASLRLGDVMPMLNSATGRL
                     YGAYLSRRQTLPLIERELATRGTVPLPDMPVSLDEYDAICADVREHGAARTRGGVLPG
                     INAISTPVFDANGHLAMALIVLGAQSVFDAEWGGTVDRRVRDIARQISSELGYLDGNQ
                     RAGQTGQTS"
     gene            90102..91106
                     /locus_tag="Rmet_0083"
     CDS             90102..91106
                     /locus_tag="Rmet_0083"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06969.1"
                     /translation="MVILLVVAAHLLALLRLVHAPAPSLPDIEPTPTLDAILLPPPKP
                     PAPPAPPPPVPAPRPVPQPPAPSPPPKPAPPEPAPALATAESGQTTTTTGSGGEGSAA
                     AAPPAATPAAPAAPPSPPAPRYDAPPSVVLRYASFVNGVQNPDGRITWQQDGQHYRLA
                     VETRVLWFRFAFQSSGDMNDGGLNPTRYEEARRSKVEVARFDRTAGTVVFETRGGQVP
                     MPSAFQDRFSVFLQLVGWARGDPQRYATPGVTETFNVSDTREVEVMQVQYVGEQDIDI
                     GIDRVRTKHFVRLPRHPNDKRKVEIWLAPSLNWMPARLRQTEPDGTQIDLVYRSSETH
                     "
     gene            91161..92009
                     /locus_tag="Rmet_0084"
     CDS             91161..92009
                     /locus_tag="Rmet_0084"
                     /codon_start=1
                     /transl_table=11
                     /product="predicted hydrolase or acyltransferase
                     (alpha/beta hydrolase superfamily)"
                     /protein_id="ABF06970.1"
                     /translation="MSDTSASTASQTNRLRVGDVHLQVRVDGTEGPWVILAHALGANL
                     TLWDDTARHLAARYRVLRFDMRGHGGSDAPVGAYTMTRLADDVVALMDELDIAQAHFC
                     GVSVGGMVAQTLGVRHPERLLSLTLVDTIHHTPLEARAMWADRIGQVEAHGMGGTVES
                     TLNRWLTAPFRERHPEIVERIRKMLLETPVRGYVGVAQAIEAFDLARAISRIHCPTLV
                     VVGDKDEGSPVSIAEAIAREIHGSRLEVLPDAAHLSFIEQPERFHAMFDAFLGHAACG
                     GQCDIP"
     gene            92245..92502
                     /locus_tag="Rmet_0085"
     CDS             92245..92502
                     /locus_tag="Rmet_0085"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06971.1"
                     /translation="MQMIYNSDNYCIVEFGADVEHATLASGGYEIVDKNLKREIFLGG
                     LMAETFRADVTRLIESEPSVEEVDEFLGKFDTVMNNPLVMH"
     gene            complement(92621..93013)
                     /locus_tag="Rmet_0086"
     CDS             complement(92621..93013)
                     /locus_tag="Rmet_0086"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sulfurtransferase (rhodanese-like
                     protein)"
                     /protein_id="ABF06972.1"
                     /translation="MQTLSPNDARTLLEGEPDALFIDCRSEMEYLFVGHPRGAHNVPW
                     NDGPDWEVNPHFVQAVKKLAGQASARPVVLICRSGNRSSAAARALEGAGFATIYCVLH
                     GFEGDLDAQRHRNTVNGWRHDGLPWEQY"
     gene            93237..94304
                     /gene="bhmT"
                     /locus_tag="Rmet_0087"
     CDS             93237..94304
                     /gene="bhmT"
                     /locus_tag="Rmet_0087"
                     /EC_number="2.1.1.5"
                     /codon_start=1
                     /transl_table=11
                     /product="homocysteine S-methyltransferase"
                     /protein_id="ABF06973.1"
                     /translation="MSAAQSQPRPYTRAASLPKLLRDRILILDGAMGTMIQRYKLTEA
                     DYRGTRFADHRIDVKGNNELLLLTRPQVITEIHEQYLAAGADLIETNTFGATRVAQED
                     YKMADLAYEMNVEAARLARAACDKYSTPDKPRFVAGAFGPTPKTASISPDVNDPGARN
                     VTFEELRDSYYEQGKALLEGGADVFLVETIFDTLNAKAALFAIDQLFEDTGERVPVMI
                     SGTVTDASGRILSGQTVEAFWNSLRHAKPVTFGLNCALGATLMRPYIAELAKVCDAAV
                     SCYPNAGLPNPMSDTGFDETPEVTSALVEEFAASGLVNLVGGCCGTTPDHIAAIAKSV
                     ANKTPRTWPGQYREDTAQSAA"
     gene            94333..97080
                     /gene="metH"
                     /locus_tag="Rmet_0088"
     CDS             94333..97080
                     /gene="metH"
                     /locus_tag="Rmet_0088"
                     /EC_number="2.1.1.13"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine synthase, cobalamine dependent"
                     /protein_id="ABF06974.1"
                     /translation="MSQQNLPPRPMRLSGLEPFTIDDDTLFVNVGERTNVTGSKAFAR
                     MILNGQFDEALAVARQQVENGAQIIDINMDEAMLDSKAAMVRFLNLIASEPDIARVPI
                     MIDSSKWDVIEAGLRCVQGKAVVNSISLKEGEEQFRHHATQIRRYGAASVVMAFDEKG
                     QADTFERKTEICKRSYDFLVNEVGFPPEDIIFDPNIFAVATGIEEHNNYAVDFIEATR
                     WIKQNLPYAKVSGGVSNVSFSFRGNDVVREAIHTVFLYHAIAAGMDMGIVNAGQLGVY
                     DQLDPELRERVEDVVLNRRDDATDRLLEIADRFKGGGTKREENLAWRGTPEQPVPVGD
                     RLAHALVHGITTFIVEDTEEVRQQIAARGGRPIEVIEGPLMDGMNIVGDLFGAGKMFL
                     PQVVKSARVMKQAVAHLLPFIEEEKRLVAEAGGDVRARGKIVIATVKGDVHDIGKNIV
                     SVVLQCNNFEVVNMGVMVPCNEILARAKVEGADIVGLSGLITPSLEEMAYVASEMQRD
                     DYFRVKKIPLLIGGATTSRVHTAVKIAPNYEGPVVYVPDASRSVSVASNLLSDEGAAK
                     YLDELKSDYDRIRTQHANKKATPMVSLAQARANKTPIDWSAYVPPKPKFIGRRVFRNY
                     DLSELANYIDWGPFFQTWDLAGKFPDILNDEIVGESARRVFSDGKSMLARLIQGRWLT
                     ANGVMALLPANTVNDDDVEIYTDESRSKVALTWNNLRQQSERPVVDGVRRPNRCLADF
                     IAPKSSGVADYIGLFAVTAGIGVDKKEAQFEADHDDYSAIMLKALADRLAEAFAECLH
                     ERVRKDLWGYDAAESLNNDQLVAEAYRGIRPAPGYPACPEHTVKAPMFAFLDAADIGM
                     GITEGLAMTPAASVSGFYLSHPDSTYFSIGKIGQDQLDDMVARRGEDRLTLERALAPN
                     L"
     gene            97386..97724
                     /locus_tag="Rmet_0089"
     CDS             97386..97724
                     /locus_tag="Rmet_0089"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABF06975.1"
                     /translation="MNKLLISLSALSIAAASSLAMAQGTGATAGTAGTQAGVGAAVNA
                     PSLQTGTGASVNASGGAVTPGASADGGTGAQMDAPKGHQGKQAKGKSKKGETSESSAS
                     AGGQAGTKMQ"
     gene            97974..98606
                     /locus_tag="Rmet_0090"
     CDS             97974..98606
                     /locus_tag="Rmet_0090"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator, NarL-family"
                     /protein_id="ABF06976.1"
                     /translation="MIRVLIADDHEIVRAGLRQFIAEEPDIEVTGEAGSGDEVMAQLR
                     DSEFDVLVLDISMPDRNGIDVLKLIRQRLPALPVLILSTYPEDQYAINLIRAGASGYL
                     TKESAPDDLVKAIRTVAQGRRYVSPTVADLLIGGLDKPTDQPVHRTLSEREFQIFCKL
                     SRGQSVSVIADELFLSVKTVSTYRSRILEKMGMKTNADLTYYAIKNGLVE"
     gene            98767..99174
                     /locus_tag="Rmet_0091"
     CDS             98767..99174
                     /locus_tag="Rmet_0091"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator without effector domain"
                     /protein_id="ABF06977.1"
                     /translation="MPEQPTASIPRPLRVLLIEDSAVIRSMLMEYLTAFPFVEAVDWA
                     DTESKAVGLAAAGAYHVAIVDLQLRQGNGINVLREMQKARFPGIRIVYTNHAQVSMYR
                     RQCAEAGADYFFDKSLEMEQVFRVIEDYAMSTP"
     gene            complement(99240..100625)
                     /locus_tag="Rmet_0092"
     CDS             complement(99240..100625)
                     /locus_tag="Rmet_0092"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase containing
                     a CHASE3 sensory domain"
                     /protein_id="ABF06978.1"
                     /translation="MAKHSLLVRNTLLLVSGIMLTLAVLIASETGNQRLREGYIEAIR
                     SQQLQNDLGDLIAELVNAEGGQRGFLLTGKDSYLDPYYKALPRINELMSRIRQHYAND
                     PEGLRQFGEASQFVTRKLNEMALTLVYGKRDFDVALDMVRTDFGKQTMENARRSLEHL
                     QVRESGTVTHNLEAAEHDLQLSRYGIGLLTAINIVLMVTLGMGHARRMAMADATRAEL
                     EEESARLDRKVRARTRQLSALAAHLQRVTEDEKTRLARELHDELGAILTAIKLDLHWV
                     RMRVQDTHPEARDKLTRVMQHADQAIQIKRQLIEDLRPTVLLNLGLREAIVQLVEDVG
                     TRNQWDTALDLPETLPRLNDPAAIALYRIVQESLTNASKYAEAKQVSVTLACTTEHLV
                     LTVRDDGRGLPPDFDAGSIAGHHGLLGMEQRVLALGGTMEVDSSPGHGVTIGIEVPLT
                     AAVLAQEEPAE"
     gene            100777..101070
                     /locus_tag="Rmet_0093"
     CDS             100777..101070
                     /locus_tag="Rmet_0093"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein (membrane)"
                     /protein_id="ABF06979.1"
                     /translation="MGIGLDSVPALASEPYDEAMSLRAVVQAGRATFGSPIIRGRLDM
                     LYYALVFFIVALIAAIFGFGGIAAGAVEIAKILFLIFLVVAIVTFVMGLVRRR"
     gene            101101..101535
                     /locus_tag="Rmet_0094"
     CDS             101101..101535
                     /locus_tag="Rmet_0094"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06980.1"
                     /translation="MLTQNPKVRKEINHLHDSADAAVRQIRHAARDTRDAARDAAGPV
                     SEDVKALIGQLQQTIDVLAREGSAESLAAGRRLRDRAQELAERLRERGRDGMDWARVH
                     VDDAVDHSRQRVVESPLMAVGIAALVGAFVGLLLAGGRRSDD"
     gene            complement(101947..102267)
                     /locus_tag="Rmet_0095"
     CDS             complement(101947..102267)
                     /locus_tag="Rmet_0095"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06981.1"
                     /translation="MLITFKSHAAQDLIMMKDLAITLLGIIGKHLGERGVIKADEMPA
                     AIRKLEAAVQDAKKVHPAEATVHPGKDDEREEEPLHLGQRAYPFLDMLRESAKEGADV
                     MWGV"
     gene            102445..104253
                     /gene="argS"
                     /locus_tag="Rmet_0096"
     CDS             102445..104253
                     /gene="argS"
                     /locus_tag="Rmet_0096"
                     /EC_number="6.1.1.19"
                     /codon_start=1
                     /transl_table=11
                     /product="Arginyl-tRNA synthetase"
                     /protein_id="ABF06982.1"
                     /translation="MLPVQTSQLAAAFTDAVRALAPADANLPAVTFERPKAAAHGDLA
                     CNIAMQVAKSLKTNPRELAQKVVDAVKADSRATALVAALEIAGPGFINLRLSPEARAE
                     VLRAVLADGDRYGARPVGEHGQVLVEFVSANPTGPLHVGHGRQAALGDALANLLAWQG
                     WSVHREFYYNDAGVQIHTLAISVQARARGLKPGDAGWPESAYNGDYIADIAADFLAGK
                     TVSASDGEPVTASGNIEDLESIRKFAVTYLRNEQDIDLQAFGVKFDRYYLESSLYSDG
                     RVEAAVQSLIAKGKTYESEGALWLRTTDDGDDKDRVMKKGDGTYTYFVPDVAYHTTKW
                     ERGFSKVINVQGSDHHGTIARVRAGLQGLDIGIPQGYPDYVLHKMVTVMKNGEEVKIS
                     KRAGSYVTVRDLIEWSNGGEETIRGCLEAGVADWPAHFTRGRDAVRFFLLSRKADTEF
                     VFDVDLALKQNDENPVYYVQYAHARICSIFEAWGGADWEARLGELASVDLAAVTAADV
                     SPQAIALGRRLAEFPDMLAAASSELAPHAVAFYLRDLAGDFHAFYNADRVLVDDETVK
                     RARLALLAATRQVLKNGLAVIGVSAPQRMDREAAPA"
     gene            104393..105133
                     /locus_tag="Rmet_0097"
     CDS             104393..105133
                     /locus_tag="Rmet_0097"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06983.1"
                     /translation="MQQIAKRAPRTVRHTKTQRGGTFLGLVLGLIVGLAIAVVVALYI
                     TKSPAPFQQKGGSSAPAPRPSEPGNVVSTLPSPTQQAQQPEEPSDPNRPLWSKTPAKP
                     VGQPEQAQPGQPAPQAPVATTRPADAGTNSASSTVAGKTPEKPAARPAEKPVADPIAE
                     IAQADANKVGYLLQVGAFRSQDDADRQKANLAMQGFEAKVTDRDVNGVKMYRVRLGPF
                     NRIDDMNRARDRLQSAGFEASVIRFTKQ"
     gene            105279..105917
                     /gene="dsbA"
                     /locus_tag="Rmet_0098"
     CDS             105279..105917
                     /gene="dsbA"
                     /locus_tag="Rmet_0098"
                     /codon_start=1
                     /transl_table=11
                     /product="thiol-disulfide interchange protein DsbA"
                     /protein_id="ABF06984.1"
                     /translation="MKKIAALLATVAAVSGLLMTAPAAMAAPTEGKDYTVLKSPQPVP
                     AGKIEVTEFFWYGCPHCYDFEPELEAWVKKQGKDVVFKRVPVAFRDDLLPHTKIFYAL
                     EAMGKLDAMHTKVFDAIHKQRKRLLTTDEIADFMAQNGIDKKQWLDTYNSFSVTTNSQ
                     RANKIADAYKIDGVPTVVVQGKYETSPSIAGTKPGAIQAMDFLVTGVRDKKL"
     gene            106009..106806
                     /locus_tag="Rmet_0099"
     CDS             106009..106806
                     /locus_tag="Rmet_0099"
                     /codon_start=1
                     /transl_table=11
                     /product="Dehydrogenase/reductase oxidoreductase protein"
                     /protein_id="ABF06985.1"
                     /translation="MRPQKIFITGASSGIGQALARAYAEQGAILGLVGRREDALRAFA
                     GTLPNPGAVRVYAVDVRDVDAMGVAAADFLANVGCPDVVIANAGVSVGTVASEREDLE
                     VFRTVMDTNWFGTLTTFQPFLGPMREQPPGADGWRGTLVGIASVAGVRGLPGGGAYSA
                     SKSAVIKLLESLRLEQAREKIRVVTIAPGYIRTPMTSHNPYRMPFLMDAEVFAQKAVR
                     RIAAGSRFAVIPWQMGVVASLLHLMPRWLYDALFARAPRKPRRPRDA"
     gene            106806..107648
                     /locus_tag="Rmet_0100"
     CDS             106806..107648
                     /locus_tag="Rmet_0100"
                     /codon_start=1
                     /transl_table=11
                     /product="putative periplasmic metal ion binding protein"
                     /protein_id="ABF06986.1"
                     /translation="MWTDAGGQVHEAASGDVRIASLVPSITELLFDLGLADQLVARTG
                     FCIHPEPAVRAVAKVGGTKDVKLDRLRALAPTHVVVNIDENRRETVDEIRTFVPHVIV
                     THPCAPEDNLALYRLLGGIFGRRPQAEALVGQLRGELDAIQAQTWPARRVLYAIWQDP
                     WMTVSRATYISRMLALVNWATWPDDADTSDTPAACVDGDCSRPNAPGERYPTFRWSDA
                     LVRELDAVLLSTEPYRFTEDHADALERQIGKPVLLVDGEMLSWYGSRAVAGARYLRSL
                     AQGF"
     gene            complement(107649..108728)
                     /locus_tag="Rmet_0101"
     CDS             complement(107649..108728)
                     /locus_tag="Rmet_0101"
                     /codon_start=1
                     /transl_table=11
                     /product="putative metallo-beta-lactamase superfamily
                     protein"
                     /protein_id="ABF06987.1"
                     /translation="MNALEHQLQYPFGETMPEPGTRQEVAPGVYWLRMPLPFALDHIN
                     LWLLRDRIDGRDGWTIVDCGITNDTIKAHWETIFANELEGLPVLRVLVTHCHPDHVGL
                     AHWLCKHWDVRLWMSLGDYMSARVMAGGSGVGSNAGGDFAASHFARHGMVDPDNLEKL
                     RARKSYYPSLVPDLPTQYRRLMDGDTVKIGADPATASWRVITGYGHAPEHVALFNPAT
                     NVLISGDMVLPRISTNVSVFDMEPEANPLQLYLDSLGKYEGLPKDVLILPSHGRPFRN
                     LHTRINQLREHHVDRLAETLAACAEKPCNAHDIVSVIFRRQFDIHQLTFAIGEALAHL
                     HALWHRGELVRVVGDDGVIRFKKAG"
     gene            108861..109295
                     /locus_tag="Rmet_0102"
     CDS             108861..109295
                     /locus_tag="Rmet_0102"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, MerR-family"
                     /protein_id="ABF06988.1"
                     /translation="MSAQPSTVTYTITDLAREFDITPRAIRFYEDQGLLAPDREGPSG
                     RRRVYNSRERTRLKLTLRGKRLGLTLNEIREILDLYESPRDTAPQLERFLHLLAGHRG
                     TLERQLEDLQAQLAEIDQHERQCQALLAAQHAKNAGNKTPTA"
     gene            109418..110599
                     /gene="ivd1"
                     /locus_tag="Rmet_0103"
     CDS             109418..110599
                     /gene="ivd1"
                     /locus_tag="Rmet_0103"
                     /EC_number="1.3.8.4"
                     /codon_start=1
                     /transl_table=11
                     /product="isovaleryl-CoA dehydrogenase"
                     /protein_id="ABF06989.1"
                     /translation="MTELPGLKFDLGEDIEMLRESVRNWAQAELAPRAAEIDRTDQFP
                     MDAWRKMGDLGVLGITVAEEYGGANMGYLAHMIAMEEISRASASVGLSYGAHSNLCVN
                     QIHRNGTAAQKAKYLPKLVSGEWIGALAMSEPNAGSDVVSMKLRADFKGDRYVLNGTK
                     MWITNGPDCDVLVVYAKTEPDLGARGMTAFIVEKGMKGFSVAQKLDKLGMRGSHTGEL
                     VFQDVEVPVENILGAENGGAKVLMSGLDYERAVLSGGPVGIMQACMDVITPYIHDRKQ
                     FGQSIGEFQLIQGKVADMYTTLQAARSYLYTVGKNLDSLGTDHVRQVRKDCAAVILYT
                     AEKATWMAGESVQILGGNGYINEYPVGRLWRDAKLYEIGAGTSEIRRMLIGRELFSET
                     M"
     gene            110726..112549
                     /gene="aceK"
                     /locus_tag="Rmet_0104"
     CDS             110726..112549
                     /gene="aceK"
                     /locus_tag="Rmet_0104"
                     /EC_number="2.7.11.5"
                     /EC_number="3.1.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate dehydrogenase kinase/phosphatase"
                     /protein_id="ABF06990.1"
                     /translation="MSHFPKLLSSQIAYDVARTMLDGFDKHYRLFREVSIEAKARFEV
                     GDWHGLQQLQRDRIAFYNQRVHETIVTLQDEYDAEDIEDEIWQQIKLHYIGLLTNHHQ
                     PELAETFFNSVFTRIQHRSYFNNDFIFVRPAISTEYIENEESPIKPTYRAYYPGSREG
                     MAACFERIVNNFQLERPFEDLKRDAGYVARAITEHFGEFRIAPNFQVHTLSSLFFRNK
                     TAFVIGRVINGDHTYPLVVPIIHAASGKLVLDTVLLHREQILILFSFAHAYFMVDMEI
                     PSAYVTFLRDLLPRKSRAEIYTSLGLQKQGKNLFYRDFLHHLQHSSDKFISAPGIKGL
                     VMLVFTLPSFPYVFKVIRDFFPAPKETTRELVKSKYQLVKQHDRVGRMADTLEYSDVA
                     FPLSRFDDALVRELEQHAPSMIEYQRSKQGEDEIVVRHVYIERRMTPLNIWLQEGTDE
                     QVDHGILEYGNAVKELIAANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNVRRV
                     PAPRNEEEEMSGEVWYTVRPHDIFPETYGTFLLGDPRVRAAFMRHHPDFFDAAMWQHH
                     KDRLLAGHVHDFFAYHSQERFIHRYGSGATGPATEEPRRAA"
     gene            112546..113217
                     /gene="can"
                     /locus_tag="Rmet_0105"
     CDS             112546..113217
                     /gene="can"
                     /locus_tag="Rmet_0105"
                     /EC_number="4.2.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="ABF06991.1"
                     /translation="MSDAIAQLFRNNREWVDRVNAEDPTFFTRLANQQAPEYLWIGCS
                     DSRVPANQILGLAPGEVFVHRNIANVISHSDLNALSVLQFAVDVLKVRHVTVVGHYGC
                     GGVKVALKRERVGLADNWLRHVQDVADKHAGYLGTVLREDDAHTRLCELNVIEQVNNV
                     CQTTVLQDAWARGQAVTVHGWVYGVSDGLLRDLGMAASNNDELHAQIAAALRQYGDPP
                     QASIR"
     gene            113259..114443
                     /gene="atoB"
                     /locus_tag="Rmet_0106"
     CDS             113259..114443
                     /gene="atoB"
                     /locus_tag="Rmet_0106"
                     /EC_number="2.3.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="ABF06992.1"
                     /translation="MQKDPVVIVSAVRTPMGAFQSELSSLMAPQLGAAAIRAAVERAG
                     IKPEQVQEVVFGCVLPAGQGQAPARQAALGAGLPLDVACTTVNKMCGSGMRAAMSVYD
                     GLLAGSFDIAVAGGMESMTNAPYLVPKARGGYRIGHGMIYDHMMLDGLEDAYDKGRAM
                     GTFGEDCAAKYHFTREQQDAFAMESVRRAQRATEQGDFRWEIVPVTVSGKGGDTVIDT
                     DEGPRRIKVDKIPSLKPAFAKDGTITAASSSSINDGASALVMMRESTAKSLGLQPIAR
                     MLGHTSHAQAPGWFTTAPVEAIAKLYRKLDWNTGSVDLFEINEAFAVVPMAAMHDLDI
                     PRDKVNIHGGACALGHPIGASGARIMTTLIGALRKTGGKRGVASLCIGGGEATAVGIE
                     LY"
     gene            114493..115173
                     /locus_tag="Rmet_0107"
     CDS             114493..115173
                     /locus_tag="Rmet_0107"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="ABF06993.1"
                     /translation="MPTALVLGASRGLGLEFVRQYRADGWRVIAAARSDEGVAALTAL
                     GAEAHKLDLTDAAAVAGLAWKLDGETLDVAIYNAGVIGPRSETAEPVTREEFDAVMHT
                     NVLGPMMALPVLLPFVESGNHGRGGVLAVLSSRMGSIGAMDSNRSWLYRVSKASVNAA
                     LKSVSLDARHAICVALHPGWVQTDMGGPKADLTPQQSVAGMRRVLAGVARHDNGSFHN
                     YDGTSIPW"
     gene            115189..116319
                     /locus_tag="Rmet_0108"
     CDS             115189..116319
                     /locus_tag="Rmet_0108"
                     /EC_number="1.3.8.1"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase, short-chain specific"
                     /protein_id="ABF06994.1"
                     /translation="MLLTPEQEMIRDAVRQFAQDVIAPQAARWDRDKTFPKDVHKELA
                     RLGAYGVAVPEALGGAGLDYLSLALILEEIAAGDGGTSTVISVNNCPVCSMLMAFASD
                     AQKQQWLVPLAQGDMLGAFCLTEPHVGSDASALRTTATRDGDHYVLNGVKQFITSGKH
                     ADVAIVMAVTDKAAGKRGISAFLVPTSTPGYIVARLEEKLGQHSSDTAQIVFENCRIP
                     AANMLGEEGAGYKMALSGLEGGRIGIASQSIGMARAAFEAALAYAKERESFGQPLFQH
                     QAVQFRLADMATQIDVARQMVWHAASLKDAGRPCLKEAAMAKLFASEMAERVCSDAIQ
                     VFGGYGYVTDFPVERIYRDVRVCQIYEGTSDIQKILIARALG"
     gene            116409..117068
                     /locus_tag="Rmet_0109"
     CDS             116409..117068
                     /locus_tag="Rmet_0109"
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxychromene-2-carboxylate isomerase"
                     /protein_id="ABF06995.1"
                     /translation="MTAPIDFYFDFSSPYGYFASTRIDDIAQKYGRYVIWHPILLGVV
                     FKTTGSSPLPSIPLKGDYCWRDFERTSEFNHIDYKRPTHFPLPTRHAARAMLWLQNNH
                     GADVATAFAKAVYRALFVDDINIAEPAELAKLAEPLGVDPIAMNEGANNYQIKDQLKA
                     EIDVAMAKGVFGSPFVIVDGEPFWGFDRFDQVEAYLKSRRQTELRAVGGNELNKEKKP
                     A"
     gene            117065..117748
                     /locus_tag="Rmet_0110"
     CDS             117065..117748
                     /locus_tag="Rmet_0110"
                     /EC_number="3.1.3.18"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-superfamily hydrolase, subfamily IA"
                     /protein_id="ABF06996.1"
                     /translation="MTAANQAARFDCVIFDCDGVLVDSEPIVHRVLNRVLNEIGIEIT
                     LEESMKWFLGRAVRDELGNIEARLGKPLPRNFLSEWFVRRDAALIEELEAVPHVRQAI
                     EAVKARGLPVCVASGADRIKVKLQLNHTQLVELFTDDAAREHIFSATEVEHSKPAPDV
                     YLLAARTMGVDPSRCAVIEDSPTGATAGVAAGMTVFGYAASTNADALRAVGVTTIFTD
                     MRELPGLIG"
     gene            117745..118170
                     /locus_tag="Rmet_0111"
     CDS             117745..118170
                     /locus_tag="Rmet_0111"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF06997.1"
                     /translation="MTNKGRAGTGPAPCPCGNGAYDTCCGRFHRGEASPPTAEALMRS
                     RYSAYVLGDVSWLRQTWHASTCPPDLSADPGTNWLGLTVKSHAQQDATHATVEFVARY
                     KVGGRAHRLHELSRFVFESREPGEASRWLYVDGDLREPA"
     gene            118231..119160
                     /locus_tag="Rmet_0112"
     CDS             118231..119160
                     /locus_tag="Rmet_0112"
                     /EC_number="3.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical signal peptide protein"
                     /protein_id="ABF06998.1"
                     /translation="MKSRVVSSICGIAAALAGLVWCATAIAQVALPAHTIEQVVMVPK
                     VGAEDTVDLETTIFRPPGEGRRPLVVINHGKTPGKPAFQRRARFAAQTAEFVRRGFVV
                     ALPMRQGFSKSGGKYVGGSCDVGANGMAQAEDVIAALDYLVQQPYVDPTRIVVIGQSF
                     GGLSTMALSTIGYPGVVGVINFAGGLRNESCSGWENNLVDVFGDYGRGARYPSLWIYG
                     DNDRFWPWPLPERMFNSYKANVSGAAKDTHFVDVGEFDGDSHQLFSDSAGIAVWLPEV
                     ETFFRDHGLPFDVEPPEAEPVTRGVTSNRRQKS"
     gene            119221..120009
                     /locus_tag="Rmet_0113"
     CDS             119221..120009
                     /locus_tag="Rmet_0113"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="Enoyl-CoA hydratase/carnithine racemase"
                     /protein_id="ABF06999.1"
                     /translation="MQFTTLTVTAERHVATVTLNRPDVRNAFNETVIAELTGAFRALG
                     DTPDVRAIVLAGNGPAFCAGADLNWMKKMAGYSNDENRADALTLAQMLHTIWSCPKPV
                     IARVHGDTYAGGVGLVAACDVAVAAEGVNFCLSEARLGLLPATISPYVIRAMGEQAAR
                     RYFITAERFDAAEALRIGFVHATVPAAGLDAKVAELAATLVGNSPNAVRESKRLVQDV
                     AGRAIDKDLLTDTADRIAVIRASEEGREGVRSFLEKRAPAWKPQ"
     gene            120229..121695
                     /gene="bioA"
                     /locus_tag="Rmet_0114"
     CDS             120229..121695
                     /gene="bioA"
                     /locus_tag="Rmet_0114"
                     /EC_number="2.6.1.62"
                     /codon_start=1
                     /transl_table=11
                     /product="7,8-diaminopelargonic acid synthase,
                     PLP-dependent"
                     /protein_id="ABF07000.1"
                     /translation="MSFPHPAARDARADTHRRVPLTHPVLDSGGGDTSLAARSQRAVW
                     HPCTRLRPDASANEPPLAIVRGEGPWLIDAGDKRYFDAISSWWVNLFGHANPAINAAI
                     GEQLQTLEHVMLAGCTHAPAVELAERLTALTGGALGNAFYASDGASAVEIALKMSFHY
                     WRNTGLTAKREFICLRHGYHGETVGALAVTDVEIFRDAYDPLTRRAHVVMSPDARQAA
                     RSESAADVATRALAELEALLRERAGQIAALIVEPLVQGAAGMAMYDPSYLEGARALCD
                     RYRVHLIADEIAVGCGRTGTFFAWEQARGGDAVPAHAWPDFLCLSKGITGGYLPLSLV
                     LSRPEIQRAFVADDIARSFLHSHSYTGNPLACRAALATLDLFESEDVLARNRERAQWL
                     GTAMAGIAADPRVSHVRQRGMIWAADIDPQAAGANFAGRFHLAARERGVLARPIGHTL
                     YVMPPYVFDAELANWLGEQLLDTLQAVLDPAEEARHAA"
     gene            121685..122905
                     /gene="bioF"
                     /locus_tag="Rmet_0115"
     CDS             121685..122905
                     /gene="bioF"
                     /locus_tag="Rmet_0115"
                     /EC_number="2.3.1.47"
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="ABF07001.1"
                     /translation="MLLDHLKRAAAERDAQSLTRRRRIAHTACAPHQSVGGIDATPTP
                     LLTFCSNDYLGLANHGSIAHALAEGAHRYGAGSGASHLVSGHSLAHAQLERELARWLA
                     PYIPQAQALYFCTGYMANLAVLTSLGATGATLFCESLNHASLIDGARLARADVQRYPH
                     GDAGALDALLAASTTALKLIVTDSVFSMDGDIAPLAALLEVAERHDAWIIVDDAHGFG
                     VLGENGHGVLEHLGLRSERLIYIGTLGKAAGVAGAFVAAHETIVEHLINTARPYIYTT
                     AAPPAVAHALLTSLEIIAGEEGRSRRAHLTGLIAQLRAGLAVLAAQAGWSLGESETAI
                     QPLIVGDNAAALALSAALEAEGIRVGAIRPPTVPAGTARLRITLSASHSAADVARLLE
                     TIARAAPQLHKEAA"
     gene            122902..123666
                     /gene="bioD"
                     /locus_tag="Rmet_0116"
     CDS             122902..123666
                     /gene="bioD"
                     /locus_tag="Rmet_0116"
                     /EC_number="6.3.3.3"
                     /codon_start=1
                     /transl_table=11
                     /product="dethiobiotin synthetase"
                     /protein_id="ABF07002.1"
                     /translation="MTGIADRPERFACFITGTDTGVGKTHATATLLHALHGAGYSTVG
                     MKPIAAGGEWLDDQWQNDDVDQLRAAGSVIVPQEKMCPFFFRTPVSPHLAAALEGARI
                     TPEPIRDAFESLRQRAEAVVVEGVGGFIVPLDMGAARWNTADLAVMLDLPVIMVVGIR
                     LGCLSHAMLTAEAIRARGLRLAGWIANRIDPDMLLPSENIVTLQDALGALDAPLLGEL
                     PWQVAPAVAAQYLDLAPLLSAAPSVVPHHSAATHRA"
     gene            123668..124744
                     /gene="bioB"
                     /locus_tag="Rmet_0117"
     CDS             123668..124744
                     /gene="bioB"
                     /locus_tag="Rmet_0117"
                     /EC_number="2.8.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase slightly down RPM proteomics BL
                     (0,72)down also RWV BL (0.68)"
                     /protein_id="ABF07003.1"
                     /translation="MAKPNPLPNPIPIMTQQANQTVATISAEALRQSARNIAAAAPKE
                     GDAWRVDDVAALFALPFNDLLFRAQQVHREHFDANTVQLSTLLSIKTGGCEEDCGYCP
                     QSAHHDAGVKAEKLMDLEAVLDAAKAAKANGATRFCMGAAWREPKERHLEPVIDMVRE
                     VKAMGLETCVTLGMLKAEQAQRLKDAGLDYYNHNLDTSPEFYGKIITTRTYQDRLDTI
                     GHVREAGINVCCGGIVGMGEAREARAGLIAQLANMDPYPESVPINNLVQVEGTPLAGT
                     EALDPFEFVRTIAVARITMPRAMVRLSAGREAMDEALQALCFMAGANSIFYGEKLLTT
                     GNPQADRDRALLARLDIRAEGYAG"
     gene            124894..125835
                     /gene="ycdW"
                     /locus_tag="Rmet_0118"
     CDS             124894..125835
                     /gene="ycdW"
                     /locus_tag="Rmet_0118"
                     /EC_number="1.1.1.79"
                     /codon_start=1
                     /transl_table=11
                     /product="2-ketoacid reductase"
                     /protein_id="ABF07004.1"
                     /translation="MKLQLYVPDGRYAPWIDGFAEVLPEAQCVTWEDSQGQSVDYAVV
                     WRPPVEMLRGRTDLKAIFNLGAGVDGILKLNAQHPDALPAGVPIIRLDDAGMAAQMAE
                     YVTAAVLRYFRRLDVYDAQERAGTWKFQKPHRRADFTIGVMGVGTLGAHIARTLAGFG
                     FPVRGWSRSPKTVDGVQSFHGEDGQAAFLDGLRVLVNVLPLTPETQDIIDTGLLHRLA
                     HGAYLINVARGQHLVEEDLLAAVREGQIAGATLDVFRTEPLPADHPYWQEPRITITPH
                     ISALTLREDSIAQIAGKIRLLESGKPIAGVVDLQRGY"
     gene            125870..126367
                     /locus_tag="Rmet_0119"
     CDS             125870..126367
                     /locus_tag="Rmet_0119"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07005.1"
                     /translation="MSESPTLPDAAQRVADLLVGIGHDRPVVMLPATGKTSAEAAAGL
                     GCTVAEIAKSIIFRRVEDDVPVLVIASGSNRVDEAKVAARVGALGKADAKFVREKTGY
                     AIGGVCPIGHAVAPVMLLDQDLFQYDSVWAAAGHPHAVFNLTPQQLQAMTGAEVADVA
                     QVTSA"
     gene            126364..126618
                     /locus_tag="Rmet_0120"
     CDS             126364..126618
                     /locus_tag="Rmet_0120"
                     /codon_start=1
                     /transl_table=11
                     /product="Predicted Fe-S protein"
                     /protein_id="ABF07006.1"
                     /translation="MTAAQRRLLADLVRGAAAAQIVAPVPSPCRNVCKMDAASGYCEG
                     CLRTIPEIAGWSKADDEERRRIWALLPARVPRLCAAGSEA"
     gene            126615..127544
                     /locus_tag="Rmet_0121"
     CDS             126615..127544
                     /locus_tag="Rmet_0121"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase-like protein"
                     /protein_id="ABF07007.1"
                     /translation="MSTPPLLPSTMRVFERGWLSANNILFIDDATGESALVDTGYVTH
                     AAQTEALVAAALDGRPLTHIINTHLHSDHCGGNAALQARWQPRTAIPAAEAAAVASWD
                     HVALSFDATGQQCARFGFDALLHDGDRLRLGGIDWDVVAAPGHDPHAVMLFAPSHGIL
                     ISGDALWESGFGVIFPELDGESGFVEQAAVLERIAALDARIVIPGHGRPFDDVTGAIS
                     HARSRLDYLQGDGVRNATHAVRVLVKFKLLELQAVSREALFAWMRDTPLMQRIHARFM
                     AGQSIEDVFDQTLRALAKAGALTTEGDQVRNQD"
     gene            127547..128098
                     /locus_tag="Rmet_0122"
     CDS             127547..128098
                     /locus_tag="Rmet_0122"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acetyltransferase"
                     /protein_id="ABF07008.1"
                     /translation="MQPLRGKDFLLRPFRASDVDPFVAAVRESMGTVGAWMPWAHPDY
                     NTLDAQEWFARCETCMEEGSAYDVGVFSADGRTLYGGVAINQIRREDNLGNLGYWIRQ
                     SHQRQGLASGAATMMACHGFHALGLTRIEIVAAETNLASRGVAEKIGAAFECIARNRL
                     ILGGRPVAAAVYSLVPESFDFSR"
     gene            complement(128153..130312)
                     /locus_tag="Rmet_0123"
     CDS             complement(128153..130312)
                     /locus_tag="Rmet_0123"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane receptor, TonB dependent"
                     /protein_id="ABF07009.1"
                     /translation="MFSNNTRIPAVRRTPLAALAALIVTSGVASHAMAQDNAAAAPAA
                     PQTQPQPQPQTLKEVVVTANPLGSDLNEMVAPVSTLGGDALTVRQTSTLGETLNGMPG
                     VTSTYFGPNASRPSIRGLDGDRIKLLQSGGSTLDASSLSYDHAVPIDPLVAEKVEVVR
                     GPAALMYGGNALGGVVNVIDNRIPRDPVTGVSGAADVSGTIGGDKGRNASGLLEAGNG
                     TFAVHADAFVRQTSDLRIPGFARSANLRATQPLPAGESEAYGTLPNTSSHQEGGSMGG
                     SYTWADGFLGANYSTYRNDYGTPAEADARIKMRQDRIGLAGEARNLAGNTNGIIESVK
                     GSFNYTDYEHREIEDGVTGTTFKNRGWDTRIEATHGKIGNMSGVIGTQFGHSDFSALG
                     EEAFVPSTTTDNAALFVFEELPLISSGDLKLNLGGRIDHSSVKASANGNDRFTDDNRS
                     FNAGSASAGLLYKLNPIWTVTSNLSYTERAPTFYELYANGPHLATNAYEIGDPNANKE
                     RATSIDLGMRFKQGDHSGSVSGYYSRFQNYLALLNTGTFRDAEGNVVTAGSDGALPVL
                     QYAGVPATLYGFEAEGKTRLLQKMLTTGDTLDFEARADYVHGENRNNGEPLPRLAPLR
                     LGGSLVYAAGPWGARINVDWNARQTRVPTGDTPTDAYTMLGVSLTYKLKVSGTQTLLY
                     LRGDNLTNTEARSATSILRDIAPLPGRSVKIGMRTMF"
     gene            complement(130427..130825)
                     /locus_tag="Rmet_0124"
     CDS             complement(130427..130825)
                     /locus_tag="Rmet_0124"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07010.1"
                     /translation="MHTESCTLSRLRARGPSLWAVLWLVACLLLAQHAGLVHRVLHGG
                     LPNASQPALTVASDDATHTEPFSLKLGLHSCVLFDGATVADIHVGSFQLPLLAFGKPV
                     KPANLAWRWPDLPSAQPFRSRAPPAAFAFA"
     gene            complement(130815..131990)
                     /gene="cobW"
                     /locus_tag="Rmet_0125"
     CDS             complement(130815..131990)
                     /gene="cobW"
                     /locus_tag="Rmet_0125"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin (vitamin B12) synthesis"
                     /protein_id="ABF07011.1"
                     /translation="MAVRLPVTVLSGFTGAGKTTVLRHLEAQAGARVAVVDSHGDLLA
                     EVERLAQTGQYDHVVIEAGATDEPLGLAEGFAFEDEHGETTSVGHLDTLVTVIDASRF
                     LQDYHDADFLSARALAAHDDDDRTVVDVLIDQVEVCDVLVVNKIDLVDAGQLGRLHVM
                     LHALNPRADIVDASHGQVPAARVLDTGRFDIDATPNAAGWQAALQGDTVPDAAGVSTL
                     VYRRRRPFHPQRFADLIHTEWMREHGDVLRSKGLFWLASRMDIAGDWSQAGGVCRPGA
                     AGAWWAAIDAEEWPPEGPARAAIEADLIEDGLPAEYGDRRQELVLIGLDLDAHALEAQ
                     LDACLLTDDEMAAGPEAWAAYPDPFPDWGNAFDDDHDHDHGHDHDHGDGPCDCGHAH"
     gene            complement(132183..132872)
                     /gene="dksA"
                     /locus_tag="Rmet_0126"
     CDS             complement(132183..132872)
                     /gene="dksA"
                     /locus_tag="Rmet_0126"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaK suppressor protein"
                     /protein_id="ABF07012.1"
                     /translation="MTAATKTKESRSKTGSAAVETRKAAPAKATPAPRGSTAAHADAG
                     EAKGGTRSSKTAASQSETAAPRKRTATAPERTTTPPVASTRESAGTMSSNKLLTEAEI
                     LKMSDKDYMNEAQLAFFKNRLEQLRDEILKNADQTTEHLRETVIVPDPADRATIEEEH
                     ALELRTRDRERKLLKKVEQSLQRIESGDYGWCEETGEPIGVPRLLARPTATLSLEAQQ
                     RRELRQKLFGD"
     gene            complement(133191..134282)
                     /gene="yjiA"
                     /locus_tag="Rmet_0127"
     CDS             complement(133191..134282)
                     /gene="yjiA"
                     /locus_tag="Rmet_0127"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin synthesis protein, P47K (putative
                     GTPase)"
                     /protein_id="ABF07013.1"
                     /translation="MSKLIPVTILTGFLGSGKTTLLKRILNEQHGMKIAVIENEFGEE
                     NIDNEILVQDGREQIVQMSNGCICCTIRGDLVQALSDLVTQRDEGKIAFDRVVIETTG
                     VANPGPVAQTFFMDEEIASRYLLDAVITLVDAKHANLQLDKQEEAQRQVGFADAIFIT
                     KADLVSEAEVADLRHRLLHMNPRAPINAAHFGEAPIDLIFDLRGFNLNEKLEIDPDFL
                     RADEHDHEHDHEHGEHCGTDCGHDHGHEHGHDHGHGHAHDHHHHHHHTDRIASFVFRS
                     DKPFHYGKLEEFLSGILSVYGEKLLRYKGVLYMEGVDRKVVFQGVHQLMGSDIGAKWE
                     DEQPGTKMVFIGVDLPRDAILKGLAACLA"
     gene            complement(134333..134842)
                     /locus_tag="Rmet_0128"
     CDS             complement(134333..134842)
                     /locus_tag="Rmet_0128"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ferric uptake regulator, Fur-family"
                     /protein_id="ABF07014.1"
                     /translation="MTRTTPHAAASDDAVMPGDPLATAQLRLRQLGARVTQPRLAILA
                     CLIEAPEPLTHQAVIDHLPAEGDVDRVTVYRVLDWLVDQGLAQKRAGNDRVFRFSLVE
                     HEAARAEVHRQHSHFHCTRCDRTFCLESAGKSVAPRVPNGFAVEHVELTVNGICAECG
                     RSHGDASAH"
     gene            134975..135874
                     /gene="dehH2"
                     /locus_tag="Rmet_0129"
     CDS             134975..135874
                     /gene="dehH2"
                     /locus_tag="Rmet_0129"
                     /EC_number="3.8.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="haloacetate dehalogenase"
                     /protein_id="ABF07015.1"
                     /translation="MQNDASALLFPNFEWFRLKVDEVEIAGVRGGSGPPLLLLHGFPQ
                     SHLIWHKVAPALADRFTVIATDLRGYGSSGAPPASPGHEAYSKREMARDQVEVMRQLG
                     FSRFALCAHDRGARVAHRLCIDHPEAVSRAMLLDIAPTLAMYEATSMAFAAAYWHWFF
                     LIQPAPFPETLINAEPAFFIDKLLGLRHAGPSPFAPDAMAAYVAAMQEPARVHAMCED
                     YRAAATIDLDHDRADREAGRKLAMPVRVLWGEHGVVARCFEPLALWQALGDAVSGATL
                     PCGHYVPEEVPEPLLEEMLEFFR"
     gene            136126..137112
                     /gene="bug"
                     /locus_tag="Rmet_0130"
     CDS             136126..137112
                     /gene="bug"
                     /locus_tag="Rmet_0130"
                     /codon_start=1
                     /transl_table=11
                     /product="Extra-cytoplasmic Solute Receptor"
                     /protein_id="ABF07016.1"
                     /translation="MKRVALKFAAVLAVAGVGVFSGAQAQEYPAGKPVQAVVPFAAGG
                     PTDKVARELTMVMSKHLGTTIVIENLGGAGGTIGAKKVAQSKGDGYTILIHHIGMSTA
                     PALYRNLGFDPLKDFEMVGEIADVPMVLVGNKQLPPASFKELVPYIKANSSKLSLANA
                     GIGSASHLCGLLFQSAIQTELTTVPYKGTAPALTDILGGQVNLMCDQTTNIAGQLKAG
                     ALKPYAAMQPRRVEAFKDIPTAAEQGLPGVEVKIWHAMYAPKGTPKPVIDKLSAALQK
                     SVADPNFRAKMAELGAEAVPAQRATPDSLRVFLASEINKWTPVIKKAGVYAD"
     gene            137308..137844
                     /gene="hslV"
                     /locus_tag="Rmet_0131"
     CDS             137308..137844
                     /gene="hslV"
                     /locus_tag="Rmet_0131"
                     /EC_number="3.4.25.-"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase component of the HslUV protease"
                     /protein_id="ABF07017.1"
                     /translation="MEQYHGTTIVSVRRGNQVALGGDGQVTLGNIVMKGTARKVRRIY
                     NGKVLVGFAGSTADAFSLLDRFEAKLEKYQGNLTRAAVDLAKDWRSDRALRRLEAMLI
                     TADKDTTLVITGNGDVLDPEGGIAAIGSGGAYAQSAAKALVENTELPPKDVVEKALTI
                     AGELCIYTNTNFVIETLD"
     gene            137875..139194
                     /gene="hslU"
                     /locus_tag="Rmet_0132"
     CDS             137875..139194
                     /gene="hslU"
                     /locus_tag="Rmet_0132"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone and ATPase component of
                     HslUV protease"
                     /protein_id="ABF07018.1"
                     /translation="MTPSEIVSELDKHIIGQNKAKKAVAVALRNRWRRQQVAEPLRQE
                     ITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDTIVRDLAE
                     MAVKQTRESEMKKVRTKAEDAAEDRLLDVLLPPPRDIGFAQHEEKDSNTRQVFRKKLR
                     EGELDEKDIELEVSAGMPNMDIMGPPGMEDMTEQIRSMFAGLGQGKKARRKMKVKDAF
                     KLLIDEEAAKLVNEEELKHKAIANVEQNGIVFLDEIDKIASRSEVGGGEVSRQGVQRD
                     LLPLVEGTTVNTKYGMIKTDHILFIASGAFHLSKPSDLIPELQGRFPIRVELESLSVQ
                     DFEAILTQTDASLTKQYQALLKTEEVELQFSPDGIRRLAEIAFSVNEKVENIGARRLY
                     TVMERLLEDLSFHATKSSGETVTVDAAYVDARLGDLAGNEDLSRYVL"
     gene            complement(139272..139799)
                     /locus_tag="Rmet_0133"
     CDS             complement(139272..139799)
                     /locus_tag="Rmet_0133"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein precursor"
                     /protein_id="ABF07019.1"
                     /translation="MNIRTLLASLLIVAAPMASAHIVFEQKQAPAGSYYKGTLLVGHG
                     CNGSATRAVTVTIPDGVQGVHPQPKPGWQLEIKRAKLAKPYTSHGKTIDEDVHTIRWF
                     GNTLADEHFDEFRMLMKLPEQGGKLYFPVLQECESGKSEWTQIPADGQTTRDLKTPAA
                     ELEVLPPAGGHVHSH"
     gene            139939..140412
                     /locus_tag="Rmet_0134"
     CDS             139939..140412
                     /locus_tag="Rmet_0134"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07020.1"
                     /translation="MPLLTPVRLVSIGKHTGAVLSGNETLAHLDGPGSLPMSQNISRT
                     PFFHRNQVRKRRVAMATVGVMAGITAATLFLCVRPTMAQQGVAALPVTDSAHADQPER
                     RAMHEGQAAVAALAMASGAMVTLADRHATDAVRIADASASADADDLGWDYVQLRL"
     gene            complement(140454..141017)
                     /gene="regA"
                     /locus_tag="Rmet_0135"
     CDS             complement(140454..141017)
                     /gene="regA"
                     /locus_tag="Rmet_0135"
                     /codon_start=1
                     /transl_table=11
                     /product="RegA, response regulator containing a Fis-type
                     DNA-binding domain"
                     /protein_id="ABF07021.1"
                     /translation="MPFLVIDDDEVFSGTLARALTRRGYAVQVAHNGAEALALAGRTP
                     FAYVTLDLHLGPPPESGGTSASESGLHLVAPLRAALPDARILVLTGYASIATAVAAVK
                     QGADEYLAKPANVDSILTALMAGVSEDAAEAALEEPVPLSVARLEWEHIQRVLTEHGG
                     NISATARALNMHRRTLQRKLGKRPVSR"
     gene            complement(141047..142426)
                     /gene="regB"
                     /locus_tag="Rmet_0136"
     CDS             complement(141047..142426)
                     /gene="regB"
                     /locus_tag="Rmet_0136"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="ABF07022.1"
                     /translation="MHPPIVMSTLPPSVAPPIGTAPQRHSLVSLRRLSWLRWALLAGQ
                     ALLLVSCESLAGIALPYKPLLFLFAVQTVFNVFTVARLHWHTRHGTAPSDAELMVQMM
                     VDLTALSAILFYTGGATNPFVSFYLPGLAIASAILPWRLVVTLAAYALACYSMLLLEY
                     IPLDLHNPDNAVNYHLAGMWLNFVASAVMIAFFVARLSNALRQRDAQLNEARELLLRE
                     ARVEALNDQAAAVAHEIGTPLATLAVIAGELRADAENTNRSDTPVADYQADLRTMEQQ
                     LELCRSILARLRADHETLAPQRIDAWLAPFVERWQLRHPQASLQAGAAPDAAAQAVDT
                     ARISQILTIALDNAARSQQAAGHDHRQGPPLRLDIAREADALVYRVTDHGHGLPPGLR
                     ARLGESPVASAHGGQGIGLYLAQSAARQLGGQISWHDNPAGGTVLELRLPLTAASERA
                     IAAQPDFQP"
     gene            142608..143096
                     /locus_tag="Rmet_0137"
     CDS             142608..143096
                     /locus_tag="Rmet_0137"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein"
                     /protein_id="ABF07023.1"
                     /translation="MQAKFRAARAASIATLALAGLLASAQAMAQVDVSDAWVRGTVPA
                     QTASGAFMTLHAHQDAKLVGVSSPVGTAELHEMKMENNVMRMRQIPSLDLPKMQDVQL
                     KPGGYHVMLMGLKQQLKAGDTVPITLKFEQNGKVVEQQVSAQVRDMTASAQGGGHGDH
                     KH"
     gene            complement(143182..144117)
                     /locus_tag="Rmet_0138"
     CDS             complement(143182..144117)
                     /locus_tag="Rmet_0138"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR-family"
                     /protein_id="ABF07024.1"
                     /translation="MNSLRGIDLNLLVVLEALLAERHISRAALRLQLSQPAVSHSLAR
                     LRQLLDDPLLVRGQGGLVLTARAHELAAPLAEALAQVRILLGPGGFQPATARRTFKLA
                     MSDYGSLVVLPRLLRTVRKAAPNIDLTVTQGSLETMTAQVADGQIDLAFGAFAFEPEG
                     VRTAVLFDDDFACAVDAATVRDTGRLDHVAYLARSHVLVTAATERGDAIDAAVTRLGG
                     RRKIACTVPHWSVAPGLILGTNMVLTTARRSLEALADDRLAIFEAPFTIPGFAFCMIW
                     PAKADADPGLTWLRERVLQAVAPEAESSDAISLRG"
     gene            complement(144172..144480)
                     /locus_tag="Rmet_0139"
     CDS             complement(144172..144480)
                     /locus_tag="Rmet_0139"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07025.1"
                     /translation="MRHPATAGADFTRNPRPHCNPDEWHTMTDPSTIQTGQLRPVEHC
                     SRCGAAFVCGYVAGLPECWCASLPLLPSRKIVAGQHCLCPTCLRQRQDDVPQDAVAPD
                     "
     gene            144495..145529
                     /gene="argB"
                     /locus_tag="Rmet_0140"
     CDS             144495..145529
                     /gene="argB"
                     /locus_tag="Rmet_0140"
                     /EC_number="2.7.2.8"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglutamate kinase"
                     /protein_id="ABF07026.1"
                     /translation="MTRCFPDGYCRNAGLARPLPVRRTISHDTCSTSHGMSKAMNADN
                     PEPATKSVAAIAPSLKAEILAEALPYIRKFHGKTIVVKYGGNAMTEEKLKHGFARDVI
                     LLKLVGMNPVVVHGGGPQIDEALKKVGKVGTFIQGMRVTDEETMEVVEWVLGGEVQQD
                     IVMLINQYGGQAVGLTGKDGGLIRAKRLQMPDRENPGTFIDIGYVGDIEAINPAVVKA
                     LQDDAFIPVISPIGFSDDGQAYNINADVVAGKMAEILKAEKLVMMTNIPGVMDKKGNL
                     LTDLSAREIEELFADGTISGGMLPKISSALDAAKSGVHSVHIIDGRIEHSLLLEILTE
                     QAFGTMIRSH"
     gene            145594..146598
                     /locus_tag="Rmet_0141"
     CDS             145594..146598
                     /locus_tag="Rmet_0141"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrimidine 5-nucleotidase"
                     /protein_id="ABF07027.1"
                     /translation="MFIRQPTQRRGVERARLHSSHRPRRHLVRGVAGNTSGDTVWLFD
                     LDNTLHDASHAIFPAINRLMTAYVARVLGCDDATASRVRVDYWQRYGATLLGMVRHHQ
                     VDPADFLRAAHDFPELADMVRVRRGLVAALRQLPGRKILVTNAPRNYARSVMAIAGID
                     RCFERVVAIEDMWVHGHLRPKPDRRMMLRLLAQIGVAPHRAVLVEDTLSHLKHYAGSG
                     IRRAWVTGYLRTIAPSRPHVVVPAQDASVPGAARDAVTRSTLAAEDRQRVAHLAQERS
                     VTLVAAESQDPTRAATTPQSQPDHLPRMRARVTNRPGYVDIKVQSMHQLLRRMWRTGS
                     "
     gene            146595..147245
                     /gene="ttk"
                     /locus_tag="Rmet_0142"
     CDS             146595..147245
                     /gene="ttk"
                     /locus_tag="Rmet_0142"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, TetR family"
                     /protein_id="ABF07028.1"
                     /translation="MTQTISSQAEADTPAGHSPEAAPARKRPRPGERRIQILQTLAGM
                     LEHPRGEKITTAALAAKLSVSEAALYRHFASKAQMFEGLIGFIEQTVFGLINQITTQE
                     EHGLRQAQAIVRMLLSFAEKNPGMTRVLTGEALVGEHERLQERINQMIDRIEASLRQC
                     LKVAVSQAAFPPDADIPLRVALITAAVQGHWHRFVKSGFRKAPTENIDAQLRILLG"
     gene            147516..148688
                     /gene="metX"
                     /locus_tag="Rmet_0143"
     CDS             147516..148688
                     /gene="metX"
                     /locus_tag="Rmet_0143"
                     /EC_number="2.3.1.31"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine O-acetyltransferase"
                     /protein_id="ABF07029.1"
                     /translation="MTDVAPPAGVLDVPTDSVGVVTPQRMHFSEPLQLRNGSQIADYD
                     LMVETYGTLNAARTNAVLVCHALNASHHVAGIAADNPRDIGWWDNMVGPGKPLDTNRF
                     FVIGVNNLGSCFGSTGPMSTNPSTGAPYGALFPVVTVEDWVNAQARVADIFGIQQFAA
                     VMGGSLGGMQALAWSLMYPERLRHCIVVASTPKLSAQNIAFNEVARSSILSDPDFHGG
                     NYYAHNVKPKRGLRVARMIGHITYLSDEDMAEKFGRSLKAEDIRFSFDVEFQVESYLR
                     YQGDKFAEYFDANTYLLITRALDYFDPALAHGGDLTRAMAQTQAGFLVVSFTTDWRFA
                     PNRSREIVKALLDNKRPVSYAEIDAPHGHDAFLLDDARYHNLMRAYYDRIAEEIGA"
     gene            148685..149296
                     /gene="metW"
                     /locus_tag="Rmet_0144"
     CDS             148685..149296
                     /gene="metW"
                     /locus_tag="Rmet_0144"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine biosynthesis protein MetW"
                     /protein_id="ABF07030.1"
                     /translation="MNAASNPNILALRPDFRAIARWIEPNSTVLDAGCGDGSLLRVLQ
                     DELDVQAYGIEIRDEEVLACAQKGVHVIQQNLEGGLALFEDQSFDTVILSQTLQTIHN
                     TAQVLRDTLRVGRECIVSFPNFGYWPHRLSVFRGRMPVSESLPYQWYNTPNVRVLTIS
                     DFEALAPKVGLRVLDRVVMHEGVTVNWGVNWRGSLAVYRVCAV"
     gene            149389..150207
                     /locus_tag="Rmet_0145"
     CDS             149389..150207
                     /locus_tag="Rmet_0145"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07031.1"
                     /translation="MTQAPLHPLDQALKLEPAGEHRYVGHTSQAYWNMIGPFGGATAA
                     VMLQAALVHPERLGDPIALTVNFAGPIGEGDFEVEARPSRTNRSTQHWHLELRQNGEV
                     TTTGSAVFAVRRQTWNSGEAVMPQVPAAESLPVMSGFAPVKWLGSYDIRAVRGAKPTT
                     APGTENPDSLSQFWIRDEPARTPDYASMAAWCDAFYPRIFLKRAGFVPAGTVSLTTYF
                     HADAATLAAVGDSHVLGCAQARVFRQGFFDQSAEIWSASGELLATSHQIVYYKE"
     gene            complement(150209..151489)
                     /gene="ampG"
                     /locus_tag="Rmet_0146"
     CDS             complement(150209..151489)
                     /gene="ampG"
                     /locus_tag="Rmet_0146"
                     /codon_start=1
                     /transl_table=11
                     /product="muropeptide transporter"
                     /protein_id="ABF07032.1"
                     /translation="MTFQDYLDIFRNRRIGAMLTLGFASGLPLALTSGTLQAWMTVEG
                     LDIKTIGFFSLVGQAYIFKFLWAPLMDRFTPPLLGRRRGWLLVTQLGLVGSIAAMAFC
                     PPHEALWALAALATLVAFLSASQDIVFDAYSTDVLRPSERGAGAAVKVLGYRLAMLVS
                     GGLALYLADRVLGWPHMYLLMAALMSVGLVTLIWAPEPDVPARAPRSLEEAVVGPLRD
                     FFGRQGAWWLLLLIVLYKLGDAFAGSLSTTFLIRGLGFDPGEVGIVNKTLGLAATIIG
                     ALFGGSLMVRLGLYRSLMLFGILQGVSNLGYWILSVTPPHLWTMGATIAVENLCGGMG
                     TAAFVALLMTLCNRSFSATQYALLSALASIGRVYVGPTSGYMVEAWGWAPFYLGTVIA
                     AVPGVALLWAMRNTVHRYEAQAREPAEPAVPRPA"
     gene            151708..152562
                     /locus_tag="Rmet_0147"
     CDS             151708..152562
                     /locus_tag="Rmet_0147"
                     /EC_number="3.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase family M48"
                     /protein_id="ABF07033.1"
                     /translation="MVSAPDDGVRVDRRYSKVRDIVPMEVIDQQAAREYEQVKQEAIA
                     KHTLVDEDDPQVKRLREIGIRLLPQTVLWNPRAGRWAWEINLIRSKQVNAFCMPGGKM
                     AVYSGLLDELNLTDDEVAMVMGHEISHALEEHARQRAAQAEISNLGANVVSQLTGFGN
                     LGNMDIGSNAKMLSLRFSRQEETEADLIGMDIAARAGYDPRAAITLWQKMGAVLKAGD
                     EFTSTHPSGRSRIAVLQAHMNEVLPLYAKAMNMPMEKLPPYKANMADLHDAPVDAGDE
                     DLQHPLKK"
     gene            complement(152636..153643)
                     /gene="argC1"
                     /locus_tag="Rmet_0148"
     CDS             complement(152636..153643)
                     /gene="argC1"
                     /locus_tag="Rmet_0148"
                     /EC_number="1.2.1.38"
                     /codon_start=1
                     /transl_table=11
                     /product="N-Acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="ABF07034.1"
                     /translation="MLVLRPQGRETFRIFQSESAMVFKVFVDGQEGTTGLRLLDYLSG
                     RTDVELLRIADDKRKDPQERARFLNASDVSFLCLPDVASREAVSLVTNPDTCVIDAST
                     AFRTADNWAYGLPELTRGQREKVRSSKRIAVPGCHASAFVLAVRPLVEAGLMPADYPA
                     SAFSLTGYSGGGKSMIAEFEAGGNPKLMSPRPYALGLAHKHLPEMRVQTGLSQAPIFN
                     PIVGNFLKGLAVTVPVYPGLLSRKADAEAILDIYRKHYEGEQFVRVHPFNSDANLDNG
                     FFDVQANNDTNRVDLFVFGNEERLNLVARLDNLGKGAAGAAVQCMNVHIGADEATGLV
                     A"
     gene            complement(153809..154585)
                     /gene="xthA1"
                     /locus_tag="Rmet_0149"
     CDS             complement(153809..154585)
                     /gene="xthA1"
                     /locus_tag="Rmet_0149"
                     /EC_number="3.1.11.2"
                     /codon_start=1
                     /transl_table=11
                     /product="Exodeoxyribonuclease III"
                     /protein_id="ABF07035.1"
                     /translation="MLRIISANLNGIRSASKKGFFEWMGKQEADMVCVQELKAQEADM
                     TEAFLAPHGYHGYFHYAEKKGYSGVGLYTRHKPERVIIGFGNTEFDAEGRYVEVQYPH
                     LAVISVYVPSGSSSEERQQAKFRFMEAFLPHLLELKASGREIVLCGDVNIAHKEIDIK
                     NWKGNLKNSGFLPEERAWIGELFDNHGYVDVFRQLDPRPEQYTWWSNRGQAYAKNVGW
                     RIDYHLTTAKIAATAKATSIYKDEKFSDHAPLSIDYDFPL"
     gene            154616..155293
                     /gene="pyrE"
                     /locus_tag="Rmet_0150"
     CDS             154616..155293
                     /gene="pyrE"
                     /locus_tag="Rmet_0150"
                     /EC_number="2.4.2.10"
                     /codon_start=1
                     /transl_table=11
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="ABF07036.1"
                     /translation="MTQQTTPDDLSQSFIRFALDAGVLSFGEFVTKAGRKSPYFFNAG
                     LFNQGAMLGQVAQFYAKTLLESGVQFDVLFGPAYKGITLASATAVALAGMGRDVGFSY
                     NRKEAKDHGEGGTLVGAKLQGKVVIIDDVISAGTSVRESMQLIRAAGAEPAAVLIALD
                     RMEKSGTADNIGTHSAVQDVQREYGIPVIAIATLKDLLAYLDASKDPSLGNSREAVAA
                     YRQKYGV"
     gene            155341..156669
                     /locus_tag="Rmet_0151"
     CDS             155341..156669
                     /locus_tag="Rmet_0151"
                     /codon_start=1
                     /transl_table=11
                     /product="predicted esterase of the alpha-beta hydrolase
                     superfamily"
                     /protein_id="ABF07037.1"
                     /translation="MAVKRRNKEAIQREIGEQGGPPQDSSSPATPERAKRGASARGSV
                     LSEHCGQPVEPGDGPPHEAYAIRALVLQGGGALGSYQAGVYQGLAEGGIHPNWIAGIS
                     IGALNAAVIAGNPPETRVAQLRAFWEYICAQPWLPGLPLEMLSDSAPTWPEPMRIWFD
                     SFNAARAIVEGQRGFFSPRAVTDLWAHFEDPTRVSYYDTAPLKSTLERFADFDRINHP
                     KGMRVSVGAVNVHTGNFAYFDNTRTTLRPEHFMASGALPPGFPAIEIDGEYYWDGGLV
                     SNTPLQEVLTAQPRRDALIFQVDLWSARGGLPHNLQDVVERQKDIQYSSRTRAITDYM
                     REQQNYRRMLGEVLALVPQSKRNDPWYQRAADHACDARRNVIQLIYRDKSFEGSAKDY
                     QFGVLTMHEHWASGLEDIRETLKHPKWLAMPGPDHPFVTHDVHRGNGGND"
     gene            complement(156694..157503)
                     /locus_tag="Rmet_0152"
     CDS             complement(156694..157503)
                     /locus_tag="Rmet_0152"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07038.1"
                     /translation="MKLDDFCITSGKGFKLAAFDPESKPFSLGEKDADVAHVADLSAR
                     LDAEQDIFYAEHRRKLLFILQGMDTSGKDGTVRSVFRNFDPLGVRVASFKAPTAEELA
                     RDYLWRVHLQVPRQGEIAIFNRSHYEDVLITRVHGWIDDEECERRFRQIRAFEEMLTE
                     TGTTIIKCFLHISKAEQKRRLEDRIADPQKHWKFDMQDLAERKYWKEYQQSYEAAIAA
                     TATPACPWYIVPADSKSHRNLMVAEILADVFHKLKPSYPPPKPELAKVAVE"
     gene            complement(157559..158425)
                     /gene="dapF"
                     /locus_tag="Rmet_0153"
     CDS             complement(157559..158425)
                     /gene="dapF"
                     /locus_tag="Rmet_0153"
                     /EC_number="5.1.1.7"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate epimerase"
                     /protein_id="ABF07039.1"
                     /translation="MKLQFTKMHGAGNDFIVLDGIHQKLDLTDAQWRALANRHFGIGA
                     DQILIVEKSSRDDVDFRYRIVNADGGEVEHCGNGARCFVRFVTDRGMTDKQSVRVEVM
                     NGVITLKLQDDGQVTVDMGEPELTPARVPFIADGLPTRAEAQDTLYGLEVNGRTEWIS
                     PVSMGNPHAVQIVDDVEQFPVLQDGPVIEHHKSFPNRVNAGFMQIVDRNTVRLRVFER
                     GAGETLACGTGACAAVVAGIRRGLLDSPVKVHTHGGDLTIAWQGAGQPVQMTGPATTV
                     FEGTIDLSTLPA"
     gene            complement(158440..159333)
                     /gene="lpxL"
                     /locus_tag="Rmet_0154"
     CDS             complement(158440..159333)
                     /gene="lpxL"
                     /locus_tag="Rmet_0154"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="lauroyl/myristoyl acyltransferase"
                     /protein_id="ABF07040.1"
                     /translation="MSRIFTWLGIGLLTVLGKLPYPFVARFGEALGSILFMIPNPRRE
                     VVRANLRLCFPDKTDAEIEAMSRETYRKVFRSFAEGGIFWTCNEKKMRQLVQINDQGN
                     LPSLDGSPHILVTLHLSGLEAGAIRLTMHLRDTVGRSGASLYTVQKNALFDDFLKVAR
                     GRFGANMISRNDSVRNILRVLKKGEALQLISDMDFGERDSEFVPFFGVEALTLTSVSR
                     LARLAGAKVVPIYTEQLPDYKGYVLHILPPWDDYPGESVTDDTRRMNAFFEDAIRPRV
                     PDYYWVHKRFKHRPPGEPDIY"
     gene            complement(159330..160250)
                     /locus_tag="Rmet_0155"
     CDS             complement(159330..160250)
                     /locus_tag="Rmet_0155"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="lauroyl/myristoyl acyltransferase"
                     /protein_id="ABF07041.1"
                     /translation="MTFIFWLISRLPLRALHAIGGALGLLAARLPGRYGRRLEENFRH
                     AYPDVSDAMLAEAARHSGRLIMEMPYFWSRKSITVRTDNFDDHLWPELARLEAAGNGV
                     IVLTPHLGCFEVLPQSYARLRRVTAMFKPPHQAWLREFVERMRSRPNMAMAPANPRGV
                     RMLVKALKRGEAVGILPDQVPSGGEGTWAPFFGKPAYSMTLVHRLQQLTKAPVVMVYA
                     ERLPKGAGYRGHLRILNDGGMLPEDPAAASAVINAAIEDLITIDPTQYLWGYNRYKCP
                     TGTELPPDTFATTQATTRATTQATTNNNIQ"
     gene            160510..161673
                     /gene="metK"
                     /locus_tag="Rmet_0156"
     CDS             160510..161673
                     /gene="metK"
                     /locus_tag="Rmet_0156"
                     /EC_number="2.5.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine adenosyltransferase 1"
                     /protein_id="ABF07042.1"
                     /translation="MSNDFLFTSESVSEGHPDKVADQISDAVLDAILAQDKYARVAAE
                     TLCNTGLVVLAGEITTTANVDYIQVARETIKRIGYDNTEYGIDYKGCAVLVAYDKQSP
                     DIAQGVDRASDDYLNQGAGDQGLMFGYACDETPELMPFPIYYSHRLVERQSLLRRDGR
                     LPWLRPDAKSQVTVRYVDGRPHSVDTVVLSTQHAPDISQAQIREAVIEEIIKPVLPAE
                     MLKETKYLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGASPHGGGAFSGKDPSKVDRS
                     AAYAARYVAKNVVAAGLARQCQVQVSYAIGVARPINVTVYTEGTGKISDEKIAALVQE
                     HFDLRPKGIVQMLDLLRPIYEKTAAYGHFGREEPEFSWEATDKAAILRAAAGL"
     gene            161816..162709
                     /locus_tag="Rmet_0157"
     CDS             161816..162709
                     /locus_tag="Rmet_0157"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07043.1"
                     /translation="MAMSLDLIRTQPYTDWSPEVSPETQATLRRELEQGAVLYFPNLH
                     FRFAPGEERFLDSRYSDGKSKNINLRANEGAVRGAAGTQQDLTDLYNLIRRYAESTES
                     LIHALFPEYGPHMTRAGTSLRPSEIAGRPVSWRKDDTRLHVDAFPSNPLLGKRLLRVF
                     HNIDPEAPRVWRVGEPFADFAGRFVPKTHGMWPGQSWLMKTLHITKRARSEYDHRMLQ
                     LHDLAKADLDYQKSVPQQEFQFPPGSTWIVFSDQLLHAAMRGKAMMEQTIYLDPAAIG
                     DRTHSPEAVLSKMLGKPMLAA"
     gene            complement(162755..164158)
                     /locus_tag="Rmet_0158"
     CDS             complement(162755..164158)
                     /locus_tag="Rmet_0158"
                     /EC_number="1.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent aldehyde dehydrogenase"
                     /protein_id="ABF07044.1"
                     /translation="MREVPAMSSLFDAMRAASRHDQTPPWDVRADRLRRLRRLVQANH
                     DAIAAAISADFTNRPHQETALLEVFPSVAGIDDALRHGKRWMRVRRASTGLWFKPGRS
                     RLMPQPLGVVGIVVPWNYPLYLTIGPLTGALAAGNRAMVKLSEYTPRFSALFAQLVQA
                     AFAPDEVAVINGDAEVAAAFSTLPFDHLLFTGSTNVGHHVMRAAAANLTPVTLELGGK
                     SPAIIGPHADFERAVERILVGKLLNAGQTCIAPDYVLVQADQRDRFAEAARRCASRLY
                     PDIARNPDYTSIISPRHFDRLVSMIAAATAAGAHAVPLTDATPDAAARRLPPVLLTDV
                     PDNVMAMQEEIFGPVLPVVTYRSIEDAIGFVNARPRPLALYVFDKSGDVVDRVMRQTV
                     AGGVTVNDTLFHIAQDDLPFGGVGPSGMGVYHGKAGFETFSKLKPIFHQAGLNGAGLL
                     KPPYGKRFESMLKLLLR"
     gene            164406..166088
                     /gene="betA1"
                     /locus_tag="Rmet_0159"
     CDS             164406..166088
                     /gene="betA1"
                     /locus_tag="Rmet_0159"
                     /EC_number="1.1.99.1"
                     /codon_start=1
                     /transl_table=11
                     /product="choline dehydrogenase, a flavoprotein"
                     /protein_id="ABF07045.1"
                     /translation="MEATFDYLVVGAGSAGCALAGRLADSGNDSIALLEAGGHDHHVL
                     VRTPAAGAAFLPRAGSRNVGYRTVPQEGLDGRRVSQPAGRGLGGSSLISAMIYTRGRP
                     ADYDAWADAGCDGWSWDDVLPYFRRAECNERLAGEDDDPLHGGTGPLHVSDLRSPNPF
                     AHHFIDAAQRAGIVRNGDFNGDEQEGVGWYQVTQHNGERWNAARAYLHGGNARNRTSN
                     GGRSHLHVLTGVQVLRVLFERRRAVGVVAWRDGKELEIRARREVILAAGAFGSPQLLM
                     ASGVGPMMHLREFGVPVVHDLPGVGANLQDHVDVAVQRRVRASELFGISLGSAFRLIG
                     ESLRYRRGRSGMLTSNLAEAGAFVRSRPGLAEPDLQLSFVVGLVDDETRRLRLGHGYA
                     CHASVLRPRSRGVVRLASPDSRKAPLIDPHYLSDPQDMDGLLDGLRIARRILAQAPLA
                     AFGGQDLRLGQLRDDGGNDEAARAWIRAHAQSACQPVGTCRMGMDPLAVVDPQLRVRG
                     IEGLRVVDASIMPTLIGGDANAPAIMIGERAHDLIRYAPHVTLRILETVAAD"
     gene            complement(166140..167681)
                     /locus_tag="Rmet_0160"
     CDS             complement(166140..167681)
                     /locus_tag="Rmet_0160"
                     /codon_start=1
                     /transl_table=11
                     /product="Methyl-accepting chemotaxis protein"
                     /protein_id="ABF07046.1"
                     /translation="MTISKRLLLTLSIALLALLFVGIGGIWQMGESEKRLEYFNDNTL
                     GSVHDLNTVAESVAAMRIELYRHGLSEDAKGLAEIEQQFDEASKRFDRMIDKYERDDI
                     SDETDRAMLAADRAAVKHYRDQIPAFFERSRTGDYAGAKQMLTAGELFKASLALRKTV
                     AEHLEYNTKQGGIAVENNKAQHARSVSISLSVIVITVALTAIMALMLFRRIRGSLAQI
                     QGSLEYVSRTLDLDHRAAVDRLDEIGLTAQSFNTLLERVAGTLRDVRRSTDSVGVAAA
                     QIAAGNTDLSSRTEQQAASLEETASSMEQLSTTVRQNADNAQQASSLASNAAQVADQG
                     NQAVNQMVETMGAISTSSGRIAEITNMIEGIAFQTNILALNAAVEAARAGEQGRGFAV
                     VAGEVRSLAQRSSSAAKEIKDLIEASAETVRAGSEQAHGVGSTMTEIQQAVRRVSDII
                     TEISAASREQSTGIEQVGHAVGQMDQVTQQNAALVEEAAAAAQSLDEQASKLREMVGQ
                     FRMSV"
     gene            complement(167867..169552)
                     /gene="aidB"
                     /locus_tag="Rmet_0161"
     CDS             complement(167867..169552)
                     /gene="aidB"
                     /locus_tag="Rmet_0161"
                     /codon_start=1
                     /transl_table=11
                     /product="isovaleryl CoA dehydrogenase"
                     /protein_id="ABF07047.1"
                     /translation="MDATSFPDAGSAQTHTVFNQVPDLAHYNLFESDPGLRAALDRLG
                     GAWHADTLAAFGARLGDPEVQAWAADANRFTPELHTHSRTGERIDQVEFHPSWHNLLA
                     LLRSQQLQAMPFAQPRPGVWAARTVGYFLQAQVESGSLCPTTMTLASIPVLRKEPALF
                     CDLEPRLYATEHDARDLPWRGKTAVMIGMGMTEKQGGSDVRANTTVALPVRGDGRGAE
                     YALTGHKWFFSAPMCDAHLVVARMGAADGPLSCFFVPRFRDDGSKNPILIQRLKDKLG
                     NRSNSSSEVEFRGTTGILIGEEGRGIPTIIEMATNTRLDCVIGSAALLRAGLVQALHH
                     ARHRMAFGRLLADQPLMRNVLADLTLESEAATLMMMALAHAFEHADDDPLAAAWKRVM
                     TPAAKFWICKRALEATGETMEVWGGNGYVEDGPMARLYREAPVNSIWEGSGNIMCLDV
                     LRALQRDPGDGARILQDLARLSNGDAAVRAELASLQAMLRGPAEQLETSARRFAQGLV
                     LTAQAALMIAHGNAESAALFVASRLGRQHGRVFGTLDADASTLARIAARAWPA"
     gene            complement(169601..169945)
                     /locus_tag="Rmet_6405"
     CDS             complement(169601..169945)
                     /locus_tag="Rmet_6405"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADC45023.1"
                     /translation="MAGGGVPFVRINVEIRGTRAIRFYLKLPTPVLAGSGSKGLSQPP
                     GPSERHPCFIQRGEFKHKPLPDASQRSVASVMHHSIGIDMLRCTITADASRLAGLVAG
                     FGSVARAVVAVP"
     misc_feature    169782..169883
                     /product="TPP riboswitch (THI element) as predicted by
                     Rfam (RF00059), score 75.31"
     gene            170011..171888
                     /gene="thiC"
                     /locus_tag="Rmet_0162"
     CDS             170011..171888
                     /gene="thiC"
                     /locus_tag="Rmet_0162"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamin (pyrimidine moiety) biosynthesis
                     protein"
                     /protein_id="ABF07048.1"
                     /translation="MARTAPAASFESLESDLDQKFAYPASSKTYITGSRPDIRVPLRT
                     ILQTATRTEKGEMANPPIPVYDTSGPYSDPDVHIDLKAGLPPVRAKWIEERNDTEVLT
                     GLSSEYGLARANDPATAHLRFAQLTNPRRAKAGANVSQMHYARKGIITPEMEYVALRE
                     SLNLQALYDKPEYKALLRQHPGNALGAALPLRPEDMTPEFVRREVAAGRAIIPANINH
                     TELEPMAIGRNFRVKINGNLGNSAVTSSLAEEVEKMVWSIRWGADTIMDLSTGKHIHE
                     TREWILRNSPVPIGTVPIYQALDKTGGIAEDLTWEMFRDTLIEQAEQGVDYFTIHAGV
                     LLRYVPMTADRVTGIVSRGGSIMAKWCLAHHKENFLYTHFDEICEIMKAYDVSFSLGD
                     GLRPGCIADSNDDAQFGELRTLGELTAKAWEHDVQVMIEGPGHVPLQRIQANMDEELK
                     HCYEAPFYTLGPLVTDIAPGYDHITSGIGAANIGWMGTAMLCYVTPKEHLGLPDKEDV
                     REGIITYKIAAHAADLAKGWPGAQLRDNALSKARFEFRWEDQFNLGLDPERARSFHDA
                     TLPAEGAKIAHFCSMCGPKFCSMKITQEVRDYAASLPEAERGMQEKSIEFVKTGSKIY
                     S"
     gene            172044..173276
                     /gene="thiO"
                     /locus_tag="Rmet_0163"
     CDS             172044..173276
                     /gene="thiO"
                     /locus_tag="Rmet_0163"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis oxidoreductase"
                     /protein_id="ABF07049.1"
                     /translation="MPPANNLMTAVQSFDVAILGAGLAGRLSAWQLVRAGARVALIER
                     GGPDGSGSAAHVAAAMLAPLAESAIAERRIVDLGMTSVDLWRTWIGELPEPVFFQEDG
                     TLVVWHARDRSEVSLFTGRMRAVAPPDLVQQRLRALDGEGVGQIEPALAGRFPQGLLL
                     QGEGQLDNRGAMHALLNCAVTEGLHCVWEAGDIDADALPALGIRAGVVLDCRGLGARA
                     AWTNASAGGETALPGLRGLRGEVVRVHAPDVKLHRPVRLLHPRYPIYIAPKPNDLYVI
                     GATELESEDESPMSVRSALELLSAAHSLHPAFGEARVLELNVQRRPTRPDHLPAIRVD
                     QQARVVRVNGLYRHGWLIAPAVTEAACAVVRAMLGGDPAAHAVPAALRWPGMIEAVQE
                     RGTAMLSARAGAGSGLLH"
     gene            173290..173487
                     /gene="thiS"
                     /locus_tag="Rmet_0164"
     CDS             173290..173487
                     /gene="thiS"
                     /locus_tag="Rmet_0164"
                     /codon_start=1
                     /transl_table=11
                     /product="sulphur carrier protein"
                     /protein_id="ABF07050.1"
                     /translation="MEILLNGRPTELPEAATLADAVTAAAIAPPFAAAVNGQFVPRTR
                     HAATLLAAGDQIDLVQPVTGG"
     gene            173495..174343
                     /gene="thiG"
                     /locus_tag="Rmet_0165"
     CDS             173495..174343
                     /gene="thiG"
                     /locus_tag="Rmet_0165"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamin biosynthesis ThiGH complex subunit"
                     /protein_id="ABF07051.1"
                     /translation="MTFEPTETLRDPFVLYGESFASRLLLGTARYPSPATLQAAVEAS
                     RPAMITVALRRQTAVGSGDGQTLGGETFWQMLRTLGVPVLPNTAGCFTAQEVITTAMM
                     AREVFETDWIKLELIGDDYTLQPDTLNMPAVAETLVKEGFKVLPYCTEDLVLCRRLLD
                     VGCQALMPWAAPIGTGRGAVNPHAMRTLRDRLPDTPLIVDAGLGLPSHAAQVLEWGYD
                     GVLLNTAVAQSAYPVNMARAFALAVEAGRTAYLAGPMPEREVAQASTPVVGMPFWHAE
                     GAEDRA"
     gene            174340..175470
                     /gene="thiE"
                     /locus_tag="Rmet_0166"
     CDS             174340..175470
                     /gene="thiE"
                     /locus_tag="Rmet_0166"
                     /EC_number="2.5.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine monophosphate synthase"
                     /protein_id="ABF07052.1"
                     /translation="MTRQGVAAAIDAALFDDLMARYAAMFGRDETPWRIWSAANAPAA
                     LDRHDVVLSDGEATGDLIDRVVAADAVLIESEREGGRWIDTVRSPMGTWVLDVRADDD
                     TPHSAAFVAVLRAALSLHFPAHDALCIARAWLPGATAWPNDFARFPQVRHAALVPPGQ
                     TAQPFAPCPPDLGLYAVMPSAAWIETLVPLAVPTVQLRFKSGDADAVKHEVARAAKAA
                     KGSQSRLFINDHWRVAIDHHAACGGDSGIYGIHLGQEDLDDADLDAIRASGLRLGVST
                     HGYAEMLRVAAISPSYLALGAIFPTTTKVMPTQPQGMGRFQSYVALMQPVIPSLVGIG
                     GVNAGNMGEVLAVGVGSAAVVRAITEASDVPAAVAGLNALFA"
     gene            175607..176041
                     /locus_tag="Rmet_0167"
     CDS             175607..176041
                     /locus_tag="Rmet_0167"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABF07053.1"
                     /translation="MNEIIPAAPGTPDKPYFGIDIPLMRLLGLQPVHMEEGLCRTRLP
                     ANPNVVNSRGDVHGGTLMAVLDFTLSGAARSHAPLETGVITIDMSTHFLSAARGELTF
                     EARIMRRGAKIAFCEGEARDATGTLCCVARASFKLVKLVGGD"
     gene            complement(176038..176481)
                     /locus_tag="Rmet_0168"
     CDS             complement(176038..176481)
                     /locus_tag="Rmet_0168"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07054.1"
                     /translation="MQTLTNIDLREDRAANWYVKDETVQVAFATEPGELISREGPNRY
                     QPGDAIVTGATGDRWVVSRGRFDPRYVAVGPNAHGESGPYRNKPVPVLAKEMTHAFAI
                     ARSTGGDVLTGKPGDWLMQYAPGDYGITERARFEAVYRPADGPKD"
     gene            complement(176502..177332)
                     /gene="thiD"
                     /locus_tag="Rmet_0169"
     CDS             complement(176502..177332)
                     /gene="thiD"
                     /locus_tag="Rmet_0169"
                     /EC_number="2.7.4.7"
                     /EC_number="2.7.1.49"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional hydroxy-methylpyrimidine kinase and
                     hydroxy-phosphomethylpyrimidine kinase"
                     /protein_id="ABF07055.1"
                     /translation="MLPTPPRTLTIAGSDSGGGAGIQADLKTFAALGCFGMSAITAIT
                     AQNTLGVTGVHAIPAEMVAAQIDAVASDIGVDAAKTGMLGTAAIVEAVAGAVDRHGIR
                     KLVVDPVMISTSGATLSDDATSQAMVKLLFPRAMLVTPNLPEASYLLGRRITRRAEME
                     AAAADLLALGCKAVLLKGGHLEDDGPGSLGLDDLLMLADGTVRVYTHPRVDTPNLHGT
                     GCTLAAAIAAQLARGDALPDAVAAALDFVAQAIRSGARLRLGDGNGPLNHSFAPRALG
                     "
     gene            177630..179048
                     /gene="ahcY"
                     /locus_tag="Rmet_0170"
     CDS             177630..179048
                     /gene="ahcY"
                     /locus_tag="Rmet_0170"
                     /EC_number="3.3.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Adenosylhomocysteinase"
                     /protein_id="ABF07056.1"
                     /translation="MNAVTDLKQDYIVADIGLAGWGRKEIAIAETEMPGLMAIRDEFA
                     AAQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAASGTP
                     VFAFKGESLKEYWDFTHRIFDWADGGTPNMILDDGGDATLLLHLGARAEKDASLIAKP
                     TSEEETFLFAAIKEKLAKDSTWYSRNLAAIRGVTEETTTGVHRLYQMAQKGELKFPAI
                     NVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKIAVVAGYGDVGKGSAQALRALS
                     AQVWVTEIDPICALQAAMEGYRVVTMDYAAEHGDIFVTCTGNYHVITHDHMAKMKDQA
                     IVCNIGHFDNEIDIASVEKYEWDEIKPQVDHVKFPDGKKIIILAKGRLVNLGCATGHP
                     SYVMSSSFANQTIAQIELWAERDSGKYPVGVYVLPKHLDEKVARLQLRKLNAQLTELT
                     EQQAAYIGVKKEGPYKADHYRY"
     gene            179182..179529
                     /locus_tag="Rmet_0171"
     CDS             179182..179529
                     /locus_tag="Rmet_0171"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07057.1"
                     /translation="MRLLAVWIINAAALFLVGYLISGVHLGSFGSAMIAALVLGLVNA
                     LIRPILVILTLPVTLLTLGLFIFVINALLFLFVGNLLQGFVVDGFGPALLGSILYSVI
                     AWILASVLLGERN"
     gene            179577..180407
                     /gene="metF"
                     /locus_tag="Rmet_0172"
     CDS             179577..180407
                     /gene="metF"
                     /locus_tag="Rmet_0172"
                     /EC_number="1.5.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="ABF07058.1"
                     /translation="MTDRYFSFEFFPPKTAEGAEKLRNTRAQLAPLQPKYISVTFGAG
                     GTTQQGTLDAVLEIQREGIEAAPHLSCVGSTRDSIRQILQTYRDGGIRHIVALRGDMP
                     SGMGEIGEFRYANELVEFIRAETGDWFNIEVAAYPEYHPQARSPRHDLENFVRKVKAG
                     ADSAITQYFFNADAYFRFVDDVRAMGVEVPIVPGIMPITNYSQLMRFSEMCGAEVPRW
                     VAKRLESFGDDKEAIRAFGLDVVTDLCTRLLEAGVPGLHFYTLNAAGATKAIWQRLKL
                     "
     gene            180414..180776
                     /locus_tag="Rmet_0173"
     CDS             180414..180776
                     /locus_tag="Rmet_0173"
                     /codon_start=1
                     /transl_table=11
                     /product="putative regulator of competence-specific genes,
                     TfoX-like protein"
                     /protein_id="ABF07059.1"
                     /translation="MPAARRPDPFVEHLLELMTPLAANIGAIAAKRMFGGHGLFYDGL
                     MFALISDGQCFLKADDVTLARFEAEGSEPFRYQSARREVTMRHYLSLPAACLESPAAM
                     TPWARMAVEAALRLGNAR"
     gene            180828..181628
                     /locus_tag="Rmet_0174"
     CDS             180828..181628
                     /locus_tag="Rmet_0174"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07060.1"
                     /translation="MVTATFRFYEELNDFLAPAQRRRDLSCPCARAATVKHMIEALGV
                     PHTEVELILVNGESSPFERIVCDGDRIAVYPKFESFDIAPLLRVREQPLREIRFVADA
                     HLGGLAHLLRMTGFDTLYDNHFEDCEIARIASDEKRIVLTRDRELLKRRGITHGCYVR
                     AIRSSLQVREIFSRLDLARSARPFSLCLDCNVPLRRIGKTDVDGRVPEGVFERHEHFV
                     TCPHCHRVFWEGSHWRKMRTLVEELMSAQADQVAPDGSGSSGSSGGPG"
     gene            complement(181634..182368)
                     /locus_tag="Rmet_0175"
     CDS             complement(181634..182368)
                     /locus_tag="Rmet_0175"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="ABF07061.1"
                     /translation="MLGARLSRDRHAGFVIRTTGAHLHLRVQHCFQMSVRWPLLHAMP
                     PNQAPDNGPDSLYFTAPEDRRALRRRLLALRAALPDRETADAQIAAALAPLLERLGVQ
                     RLGFYWPIQQEFDARDTVARWLAAMPGRVAALPVVSRAAAPLDFHAWTPDTTMRVGQY
                     GIPVPDGTGAVTPDALLIPCVGFSANKFRLGYGGGFYDRTLAAMAAANATPIAIGIGF
                     AACEAPLQAASHDLPMDWLVTELGAR"
     gene            182381..184348
                     /locus_tag="Rmet_0176"
     CDS             182381..184348
                     /locus_tag="Rmet_0176"
                     /EC_number="3.2.1.147"
                     /codon_start=1
                     /transl_table=11
                     /product="soluble lytic murein transglycosylase"
                     /protein_id="ABF07062.1"
                     /translation="MPKGVYLRRAGRFAWLAFAGALLATPVYAQKRTATPQKAVQQQP
                     AALTIPSDPDDAFVALREAARKNDADRAAAISATLVDYPIPSYVEYFRIKSQMFDSSG
                     QPLIDTPDAEISAFLQRYQGEAIADRMRNDWLLVLGKKRDWANFDVQYPQFVLKDDTQ
                     VECYALLSRALKGQNVAADARAMLVDPRYYGDGCVDLISYMAQSQQIQRGDVAFQARQ
                     ALEQNYTTLAGKIAAALPDARVDGDSLATVVKMARNDPSQAAAYMGTISGNLSRDEQG
                     AAWGVIGQFAAKKLMPEAAGYYRRQMDLGGNQWLSDESQEWRVRAALRQGDWKQVRQS
                     IESMRPELRAKDPAWTYWYARALKADGRGSDAQQQFQSIAGQFNFYGQLASEELGNRI
                     TIPTRTTVSDAEAMAMRSRAGFTRAKKFYDLNLRFEGNREWNWELRGMNDRDLLAAAE
                     YARKIELLDRTVNTSDRTKAEHDFTQRFPMPYRDIMQRATDDVGLDMAWAYGLIRQES
                     RFIMNARSSAGAHGLMQVMPATAKYVARKIGMTDFSPSMMGDPNINIMLGTNYMSMVL
                     TDLDSSWTLASAGYNAGPGRPKAWRTSLSRPVEGAIFAETIPFTETRNYVKNVLSNAT
                     YYAALMSGRPQSLKDRLGMVAPSAVTTTSLP"
     gene            184449..185471
                     /locus_tag="Rmet_0177"
     CDS             184449..185471
                     /locus_tag="Rmet_0177"
                     /codon_start=1
                     /transl_table=11
                     /product="putative NAD-dependent epimerase/dehydratase
                     precursor"
                     /protein_id="ABF07063.1"
                     /translation="MQTSNVLVIGGAGFIGSHLISRLAGAATASGAPLDPASHPDSPI
                     APERIIVGTRNVEHAQHLLLLPRVEVIELGLADDAVLDDAIGSLGVDGIVVNLVGVLH
                     GERGDPYGPQFAAAHVDLPRQVVESCKRTGVRRLLHMSALGADPQGPSMYLRSKGDGG
                     RIVRESGLDWTIFRPSVVFGPDDHFLNLFAQLQQMAPVVPLACAHARFQPVFVLDVVQ
                     AFVNAMVHPETIGQVYELGGPQVYTLEELVRFAGRASGHPRPVIALPDALARMQAAVL
                     EHVPGGTVLSRDNLDSMRLDNVLAHPMAAELGVRPVSLEVVMTDVLSGRNRDSALQFM
                     RGSVHR"
     gene            185640..186329
                     /gene="gst"
                     /locus_tag="Rmet_0178"
     CDS             185640..186329
                     /gene="gst"
                     /locus_tag="Rmet_0178"
                     /EC_number="2.5.1.18"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutathione S-transferase"
                     /protein_id="ABF07064.1"
                     /translation="MKLVIGNKNYSSWSLRPWLLLRHAGIAFEEIAVRLFTKEFAAEI
                     ARYSPAGKVPALIDGDVTVWDSLSISEYVAERFPEKALWPKDAAARALARSICAEMHS
                     GFGNLRSQMPMNVTAMLPGLGWNVAVQRDIDRIASIWTDLRTRYASEGPFLFGSFTIA
                     DAFYAPIVSRFATYGVHLPESAKAYADFVLALPAMQEWAAAAREERDFVPADEPYRTE
                     PDRPDAIIVSG"
     gene            186333..187577
                     /gene="cca"
                     /locus_tag="Rmet_0179"
     CDS             186333..187577
                     /gene="cca"
                     /locus_tag="Rmet_0179"
                     /EC_number="2.7.7.72"
                     /EC_number="3.1.4.17"
                     /codon_start=1
                     /transl_table=11
                     /product="fused tRNA nucleotidyl transferase; 2'3'-cyclic
                     phosphodiesterase and 2'nucleotidase and phosphatase"
                     /protein_id="ABF07065.1"
                     /translation="MQVYAVGGAVRDQLLGKPSQDRDYVVVGATPADMEAAGFKPVGK
                     DFPVFLHPHTKAEYALARTERKTAVGYKGFAFYTGADVTLEEDLVRRDLTINAMAQAV
                     DEHDNLVGPVIDPYGGQKDLAARKFRHVSDAFAEDPVRILRVARFAARFHEFTVAPET
                     VALMRKIVDAGEVDALVPERVWQELSRGLMEAKPSRMFDVLRECGALAHLLPELDRLW
                     GVPQRPEYHPEVDTGVHVMMVIDYAASVGASLPVRFAAMAHDLGKGTTPEDMLPRHIG
                     HEQRGVKLLEAICQRLRVPNDCRELALVVAREHGNIHRSTEFGAAALTRLVERCDALR
                     KPERFAEALLACEADARGRLGFADKDYPQADRLLAARDAAASVDAGAIAKACGDKVDQ
                     IKDRVHKARVAAVAQRLGMAEE"
     gene            complement(187618..187812)
                     /locus_tag="Rmet_0180"
     CDS             complement(187618..187812)
                     /locus_tag="Rmet_0180"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein"
                     /protein_id="ABF07066.1"
                     /translation="MLRWTFTIFLCVIVLSASLPWLQKIGLGRLPGDVRFRLFGREYV
                     LPFASTILLSLAALVIGKLL"
     gene            complement(187838..189034)
                     /locus_tag="Rmet_0181"
     CDS             complement(187838..189034)
                     /locus_tag="Rmet_0181"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein"
                     /protein_id="ABF07067.1"
                     /translation="MQKVASLPLPSADALDASAALSICIAGAIDAAGGWIGFDRFMSL
                     ALYAPRLGYYSGGAAKFGRDVNDGSDFITAPELTPFFARTLARQFAPLVRMNLPRVME
                     FGAGTGRLAADLLLALETEDALPDTYQIVELSGELRARQQATLDQRAPHLAGRVTWLD
                     ALPDRFEGVVVGNEVLDAMPVRLYARTGGRWHERGVVCAKDGKAGAEAFAFEDRPLED
                     GAIPAVLLGIPGDHDIVTETHTEAEGFTRAVGALLARGAAFFIDYGFPASEYYHPHRT
                     GGTLMCHYRHHAHPDPFLYPGLQDITAHVNFSGIAQAGVEAGLQVSGYASQARFLMNA
                     GITELMMSLDPSDARAFLPQANAVQKLLSEAEMGELFKVIALTRGIDDAMPLDGFARG
                     DRSFAL"
     gene            189069..189869
                     /locus_tag="Rmet_0182"
     CDS             189069..189869
                     /locus_tag="Rmet_0182"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative short chain dehydrogenase/reductase
                     SDR, oxidoreductase protein"
                     /protein_id="ABF07068.1"
                     /translation="MGTSQASSDKSRGVALVTGAARRLGRAIALELAAQGWDVAVHCN
                     RSRDEADALATQIRGLGRRAAVLQADLSDEAATARLIPACIDALGVPACLVNNASLFQ
                     YDVATSFSYGSLDTHMRTNVAAPLLLAREMHKALGADGNETGQLGVVINLLDQKLNNL
                     NPDFLSYTLSKAALQTATVQLAQALAPRLRVVGVAPGITLVSGDQSDPGFVRAHGMTP
                     LGKSSTPEDIAQAVAYLAVARAVTGTTLYVDGGQHLMPLARDVMFLTE"
     gene            189891..190289
                     /gene="folB"
                     /locus_tag="Rmet_0183"
     CDS             189891..190289
                     /gene="folB"
                     /locus_tag="Rmet_0183"
                     /EC_number="4.1.2.25"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin aldolase"
                     /protein_id="ABF07069.1"
                     /translation="MTFAALSHPSLQNCRRMFLRNYEVQINIGVHEFEKKGEQRVLVN
                     IDLFVSLAETTPQADKLEEVVDYDFMRNTVAERMARGHIHLQETLCDDVARAMLQHPK
                     VRAVRVSTEKPDVYPDCDAVGVEVFHVKPA"
     gene            190405..191349
                     /locus_tag="Rmet_0184"
     CDS             190405..191349
                     /locus_tag="Rmet_0184"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ydaO, C32 tRNA thiolase"
                     /protein_id="ABF07070.1"
                     /translation="MSHSANFYRLETRLQSLTGKAIGDFGMIEDGDTVLVCMSGGKDS
                     YTMLSVLTALQKRAPIQFKLIAMNLDQKQPGFPEHVLPAYLKSLGVEYVIVEADTYSI
                     VKEKVPEGKTTCSLCSRLRRGVIYRTAKELGANKIALGHHRDDIVNTFFLNMFFGGKM
                     KAMPPKLATDDGQHIVIRPLAYCAEKDIASYARAMAFPIIPCNLCGSQENLQRKKVSE
                     MLQAWERENPGRIDNIFAALRNVVPSHLADTDLFPFTGLATGLAKIDEASLFGETTFT
                     QQALTFTGNVEANRMEFVRFDKIQKVQEAPERASEPSA"
     gene            complement(191379..192458)
                     /locus_tag="Rmet_0185"
     CDS             complement(191379..192458)
                     /locus_tag="Rmet_0185"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07071.1"
                     /translation="MSVSENKLENPCLGAPRPAVHRTGWPRPNPCHAWAGGRSATPGN
                     MRADSSMPPRTDLARSRRVTVVHNWSRRVFVVITTLTFVAILGGCNAMKLGYEQGDRL
                     AYWWVDRYVDVSDAQEVPTRDAIARFFAWHRRSQLPEVAKVLARVKGEVAGPVDIAMI
                     RQAQQDSQRLGRQAYENTIPDLADLMLTLSPDQIKRMETKFAESNTKYRKQFLGSDAD
                     ARTDARFDKIMDYTKLVYGSFSRDQEKAIRDAMGPYMLNADARYSERVRRQQEWVALA
                     REISTTRPPKAQAEEMLRHYADDWQRPATGQQRSTDAGINLTVTIANLTTPEQKAHAV
                     KRFQGWIEDVQALMREPGRSTRASQ"
     gene            192473..193837
                     /gene="glmU"
                     /locus_tag="Rmet_0186"
     CDS             192473..193837
                     /gene="glmU"
                     /locus_tag="Rmet_0186"
                     /EC_number="2.7.7.23"
                     /codon_start=1
                     /transl_table=11
                     /product="fused N-acetyl glucosamine-1-phosphate
                     uridyltransferase; glucosamine-1-phosphate acetyl
                     transferase"
                     /protein_id="ABF07072.1"
                     /translation="MNIVILAAGMGKRMNSALPKVLHPVAGQPMLSHVLDTARTLSPS
                     RLVVVVGHGAELVRKAVGADDVAFAEQAQQLGTGHAVMQALPLLDDSQPTLVLYGDVP
                     LTSVDTLKGLVQAAGAERLGVLTVEMPDPTGYGRIVRDAAGNIVRIVEQKDASEDVRA
                     IREINTGIIVCPTAHLRQWLATLRNDNSQGEYYLTDTIERAVNDGVEVVSAQPAALWE
                     TLGVNSKVQLAEIERIHQRNIAQRLLEAGVTLLDPARIDVRGELTCGRDVTIDVGCVF
                     EGRVHLEDGVSVGAHCVVRNTTIGAGARIQPFCHFEDAKVGPDGRIGPYARLRPGTEL
                     GQDVHIGNFVEIKNSQIADHSKANHLAYVGDATVGQRVNIGAGTITCNYDGVNKHRTV
                     LEDDVFIGSDTQLVAPVTVRRGATIGAGTTLTKEAPADKLTLSRAKQMTLDAWQRPVK
                     QPKK"
     gene            193852..195690
                     /gene="glmS"
                     /locus_tag="Rmet_0187"
     CDS             193852..195690
                     /gene="glmS"
                     /locus_tag="Rmet_0187"
                     /EC_number="2.6.1.16"
                     /codon_start=1
                     /transl_table=11
                     /product="L-glutamine:D-fructose-6-phosphate
                     aminotransferase"
                     /protein_id="ABF07073.1"
                     /translation="MCGIVGAVSHRNIVPVLIEGLRRLEYRGYDSCGVAVVRDGILER
                     ARTVSRVAELDAQTQSSGLAGHIGIAHTRWATHGKPDTVNAHPHFSDETIALVHNGII
                     ENYEPLRDELRAVGYGFESQTDTEVVAHLIHQAYTYPSSATRGDLFGAVRAVTKRLHG
                     AYAIAVVAKDQPDVVVGARAGSPLVVALGEDESFLASDALAVAGTANRIIYLEEGDVV
                     EISRGGARIRDVHDHEVEREARVVEAHAAAVELGPYRHFMQKEIFEQPRALGDTLEGI
                     SAITPELFGENAAQVFSEIDSVLILACGTSYYSGCTAKYWLESIAKIPTQVEVASEYR
                     YRDTVPNPRALVVVISQSGETADTMAALRHARSLGHTHTLAVCNVATSAMVRETELSF
                     LTRAGTEIGVASTKAFTTQLAALYMLTLALAKVRGYLTDAQEAEALTNLRHLPAALHG
                     VLALEPQIIAWSEDFARRENALFLGRGLHYPIALEGALKLKEISYIHAEAYPAGELKH
                     GPLALVTEAMPVVTVAPNDALLEKLKSNIQEVRARGGRLYVFADSDTHIQSSDGIQVI
                     RLPEHYGALSPILHVVPLQLLAYHTACARGTDVDKPRNLAKSVTVE"
     gene            196166..196834
                     /locus_tag="Rmet_0188"
     CDS             196166..196834
                     /locus_tag="Rmet_0188"
                     /codon_start=1
                     /transl_table=11
                     /product="putative type-4 fimbrial pilin related signal
                     peptide protein"
                     /protein_id="ABF07074.1"
                     /translation="MARLPHARLTGRGGRALAVRIEDADVDGVRASRANRKPSLRTVS
                     GSAGLTLIEMAVTVAIVAIVAAISTPSFLSFIQSNRVQSEVNSMVNSLQLARSEAIKR
                     GQSVSICPSSNGSSCLGANTWNVGWLVFVDRNADGVVDTPANAADLLQYRAPWAGTDT
                     FVATPTATFVTYNRDGFGVNLPGGAVTLAAQTRPVSAQATRCIALNMVGRQTVQQSGV
                     GACN"
     gene            196825..197367
                     /locus_tag="Rmet_0189"
     CDS             196825..197367
                     /locus_tag="Rmet_0189"
                     /codon_start=1
                     /transl_table=11
                     /product="putative type-4 fimbrial biogenesis pilV
                     transmembrane protein"
                     /protein_id="ABF07075.1"
                     /translation="MQLKTTGNRHAAGFSLLEVLIALVITVIGLFGIAKMQAAAIANT
                     QVARGQSLIALQLESLAGAMHGNKGFWAAGLVPATFSMTGATVTDTTGKLSTTAPDCK
                     ATTCTPTQLAAYDVQGWAAEMNAHFPTYSAAVNCVVLINKPVTCTVSANWNESNLAYN
                     QTTATLAGQTAQSLTLYVQP"
     gene            197379..198107
                     /locus_tag="Rmet_0190"
     CDS             197379..198107
                     /locus_tag="Rmet_0190"
                     /codon_start=1
                     /transl_table=11
                     /product="putative type 4 fimbrial biogenesis
                     transmembrane protein, pilW"
                     /protein_id="ABF07076.1"
                     /translation="MRHLRRTRSRQAGVSLVEIMVAMIIGLFMLLALSTLFLNFRGTF
                     RDQDQLAQLQDNERLALTMFSTTIQSAGYFPDPVNNVVTGALPLSTGNAYGDFAAGQA
                     VVGTSGANGASDTLTARFMTANGDGILNCQGQSNTSGANVVYVNSFAVNVNNELTCAI
                     NGGAAVPLVSGVTGFSVLYGTDTANGGNVDQYLSAAAVTAAGYWPQVRTARVTVTFVN
                     PYATQPSQPATLSWTQTISLMNRS"
     gene            198104..198700
                     /locus_tag="Rmet_0191"
     CDS             198104..198700
                     /locus_tag="Rmet_0191"
                     /codon_start=1
                     /transl_table=11
                     /product="putative type-4 fimbrial biogenesis
                     transmembrane protein, pilX"
                     /protein_id="ABF07077.1"
                     /translation="MKHPTRHRPPGRGTSQGYVLIVGLLFLLVLSLLAVSMMKSFGMQ
                     EKIAGNTREKQRAFEAAQSALRYGEWWLGQGNGSSGALCKSIVSVTANDWSSMQVCSN
                     ALTNPTALPWTPARADYSPPSMAVALNGNLGGKAASGDINYAAPPSLYINYLGLSQDG
                     LSMLYSVTGAGYGGSAATAAVVQSTYQVGASTKDLGKE"
     gene            198697..202080
                     /locus_tag="Rmet_0192"
     CDS             198697..202080
                     /locus_tag="Rmet_0192"
                     /codon_start=1
                     /transl_table=11
                     /product="putative type-4 fimbrial biogenesis
                     pilY1-related protein"
                     /protein_id="ABF07078.1"
                     /translation="MMRNPPRLALVASAVAALLAAQARAVVIQDNLNGASSSYPWTAI
                     NGACLTAGDGSGTIPGCTASSFTYYSSKSSKLVGGVTGTLPDTAGSGALRLTNGDTGK
                     GSNGNSQNGAVVSNFTFPMQEGLQVTFSTVTYGGNAFGNTGADGISFFLADGNQAASV
                     GALGGSLGYSCSNVNAVYDGVVAGYIGIGIDEYGNFSNGSSGGSKNDNTSTGPGFKAN
                     RISIRGSGNTNWANLLATYNSYYKKVPTSKIPTAVQNTCAAGYVQDWSSGKDNGSVTS
                     KPLAYNYNFIASSDLPNAIANQQATATPTRGKAIPIVYSLKLTQNGLLSMSYSYNGGA
                     ATPIITNQDITKSNGPVPTQFRFGFAAGTGSGSNVHEITCFKAEPVGQSSSSAGTNVQ
                     QSARVEAGSQVYLAYYHPTNWWGELSAQNLLYDASSDTVSMSTTANWNASCVLTGGSC
                     PSTGGTNTAQSPTARKILTWSGSTGIPFRWDSTYTPPAAVQTLMTAGDASATNKRLNY
                     LRGDRTNEITTSGTGLYRARTGVLGDIMDSSPTWVGAPSSPYSGPWTDALYKTATAAE
                     PKGSYDTFKQNNALRQNIVYVGANDGLLHGFRSGYYDAGGNFVGSDASKPNDGSEAIA
                     YMPGAVLKTIHSSTSALDLASAQYVHNYFVDATPGTGDLYYQNAWHTWLVGGLGPGAN
                     ATGPIGDKTTTGTGGAIYALDVTNPAGFADDAATASSLVIGEWDNTLKCTGNTGCGTN
                     LGNTYGTPVIRRLHNGNWAVLFGNGLNSASGSAGLYVMLVNPADGSKSFLYLDTGYGP
                     AKDPAGKNSKNGIAYVTPADLDGDHITDYVYAGDMFGNVWRFDLTSNTPANWSASAKP
                     LLATGLPITSKVAVAAVPGSGTGANAIPRVMVSFGTGRRLEQTQSSEAVFESATQSLF
                     GVWDWNMTAWNGVAPASAKYAALATAPQPLAIANLTAQSITNEGRASSNTAMLRTVSA
                     TAVCWQGSTVCSSGNTKYGWQLPLSTNPGEQVIYNPVIAYGMFIVNTTIPPSSAAAQA
                     LSCNTEVPTGFTMGVSMATGGAASQSFFSTANSNTFPLLNGGIVSGIGLSGTGSPSIV
                     TAQKRPYIVQQTVGGTGVVTQINPGANATGSRINWIKLR"
     gene            202083..202526
                     /locus_tag="Rmet_0193"
     CDS             202083..202526
                     /locus_tag="Rmet_0193"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Type-4 pilus assembly protein PilE
                     (pilE1)"
                     /protein_id="ABF07079.1"
                     /translation="MNRRPKHSAGFSLVELMIVAIIVAILAAIAFPSYMQHVRKSRRT
                     DAKTALLDAAARQEKVFSTQNLYGGAPGDLGYAGAAYPVQIQSSGQTFYQLTVATANS
                     GTTYTATAAPVGAQAGDDCGSYVINNLGVQSNTGTSNGATSATCW"
     gene            202545..202721
                     /locus_tag="Rmet_6406"
     CDS             202545..202721
                     /locus_tag="Rmet_6406"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADC45024.1"
                     /translation="MRAREVPHVMAGRSLQGRRSKRHHQNDLASLRGLAVLLVLSAAV
                     RLARTASLHFDSAS"
     gene            202936..203532
                     /gene="ribA"
                     /locus_tag="Rmet_0194"
     CDS             202936..203532
                     /gene="ribA"
                     /locus_tag="Rmet_0194"
                     /EC_number="3.5.4.25"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase II"
                     /protein_id="ABF07080.1"
                     /translation="MKDLESELIGSARLPTRYGEFTAHAFQGVDTGTEHLALSMGEIS
                     GENLLVRLHSECLTGDVFGSCRCDCGEQLDLAMQRIAEEGRGILLYLRGHEGRGIGLS
                     NKIRAYALQDGGLDTVDANLALGQAIDSRTYAFAADFLRQWGVSSVRLMSNNPIKIKA
                     LEDAGIKVTEQVRHVVPANAENEKYLATKRSRMGHLLD"
     gene            203746..204222
                     /gene="bfr"
                     /locus_tag="Rmet_0195"
     CDS             203746..204222
                     /gene="bfr"
                     /locus_tag="Rmet_0195"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin, iron storage and
                     detoxification protein"
                     /protein_id="ABF07081.1"
                     /translation="MKADKKVIQLLNGQLKHELTAINQYFLHARMYRHWGLKELGKHE
                     YEESIEEMKHADKLIERILMLDGLPNLQDLDKLLLGENTEEMLGCDLKLELASQVTSK
                     DAIKYCESVGDYVSREILSEILSDTEDHIDWLQTQLELIGKIGLQNYQQSAMGGVE"
     gene            204307..204381
                     /locus_tag="Rmet_R0002"
     tRNA            204307..204381
                     /locus_tag="Rmet_R0002"
                     /product="tRNA-Cys"
     gene            204744..205187
                     /locus_tag="Rmet_0196"
     CDS             204744..205187
                     /locus_tag="Rmet_0196"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5-related N-acetyltransferase"
                     /protein_id="ABF07082.1"
                     /translation="MIRDLRIRAAQPADAAAIGAVLERCGLPVDDLARLVGEFHVAVL
                     ESQIVGCACAELFGDSAIVRSVAVLREWRDQGIASHLVNAVMMRARANGSRRAVLLTS
                     TCPSYFARYGFTLIHASKLPPEILESKEFQRMRNTSALCMCCELA"
     gene            205268..206251
                     /gene="qor"
                     /locus_tag="Rmet_0197"
     CDS             205268..206251
                     /gene="qor"
                     /locus_tag="Rmet_0197"
                     /EC_number="1.6.5.5"
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase, NADPH-dependent"
                     /protein_id="ABF07083.1"
                     /translation="MPTTVRAVRLHEFGLPQVMRLESVELPPPAAGEARVRHTAIGFN
                     FIDVYQRRGTYPLPVGTGLGHEAAGVVEAIGDGVTDVAVGDRVAYMNAGLGAYAEGRN
                     IPVDKLVKLPDAISDEQAAAVIFKGMTAQYLVRHTYAVKPGDTVLVHAAAGGVGQILS
                     GWAKALGARVIGTAGSAAKCEIARAVGCDVAIDYSHGDWVKQVRDATDGRGVNVVYDA
                     VGKDTFLGSLDCAQTFGMVVLYGGASGPAPAIEPELLNKKGCLYLTRPSVFPHNADAT
                     RFRANAKDLFDAIAAGHVKVQIGARFPLADVARAHEAAEGRATTGAILLLP"
     gene            complement(206274..207422)
                     /gene="dmeF"
                     /locus_tag="Rmet_0198"
     CDS             complement(206274..207422)
                     /gene="dmeF"
                     /locus_tag="Rmet_0198"
                     /codon_start=1
                     /transl_table=11
                     /product="Co/Zn/Cd efflux system component"
                     /protein_id="ABF07084.1"
                     /translation="MKALSTAHAATLRAYFKPDPTHPDCTAMHTQNLSAWTHSHVFDA
                     GNQAAERGTRLVMWITLAMMIVEIAAGLVFNSMALLADGWHMSSHALAIGLSAFAYAA
                     ARRLSQDGRFSFGTWKIEVLAAFASAIFLLGVAGLMVFGSVERLFTPQPIHYQEAMAI
                     TAIGLIVNLACALILGGAHHGHDHGHGHDHGHQAHGHDHHDHGHGHGHGHGGHDDHGH
                     RHHDINLRSAYLHVVADAATSVLAIVALAGGWWLGWSWLDPVMGLVGAVLVGRWAIGL
                     MRQSGTVLLDREMDHPVVEEVREVLAQFSHGEDGTRVADLHVWRVGREKFACIASLVT
                     HDASLTPQRVRHALSIHDELVHVSVEINQCDDGRDGHDGHAAHRGHRH"
     gene            complement(207472..208398)
                     /locus_tag="Rmet_0199"
     CDS             complement(207472..208398)
                     /locus_tag="Rmet_0199"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding transcriptional regulator"
                     /protein_id="ABF07085.1"
                     /translation="MDAFSDLAFFVLLVKRGSLAGAAQQLGVTPSATSKRLAALEARL
                     GVRLLNRTTRRLSVTPEGEAYLAQGGRILAELDELEQGLRGSRVAPRGLLRVNGTLGF
                     GRRHLAPAIGDFLVACPDIEVQLQLTDRALNLAEEGYDVGILVGDLPDARLNARRLAL
                     NSRLLCASPAYLARHGEPASPRALTQHRCIVIRESEAAYGTWHLQHQQSAARQETVKV
                     RGMAATNDGEVAVNWALQGHGIVLRSEWEVAPLLRSGRLRQVLPEWSAQAADIHAVYL
                     SRDKLSARVRAFVDFLAERFGHYDPAAPYHGW"
     gene            208470..209951
                     /gene="leuC"
                     /locus_tag="Rmet_0200"
     CDS             208470..209951
                     /gene="leuC"
                     /locus_tag="Rmet_0200"
                     /EC_number="4.2.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate isomerase subunit, dehydratase
                     component"
                     /protein_id="ABF07086.1"
                     /translation="MDSAIRLRAFIHSNCIHPANAMTGRTLYQKLVDSHTVVTLDADN
                     VLLYADLHIMNEYTSPQAFAGLAEQGRKVAAPGQNLAVVDHIIPTHAESPRVIQDPAS
                     ALQARNLKRNCDLHGIPLFDTNDPLQGIEHVIAPEHGMIRPGMVVLCGDSHTTTYGAF
                     GALGFGIGTSEVEHVLATQTLVYRLARDMRIRVDGPLPSGTTSKDLILHIIARISAQG
                     ARGYAVEFTGSTIRALSMEARMTLCNMTVEAGARGALIAPDATSIDYVLRRAPDIDAD
                     MAETARRAWAGLRSDADAGFDLELAFDAAAVEPFVTWGTSPDQAIPVSATVPQPADAG
                     DSNARVSAERALEYIGVTPGVSLQGLPVQRVFIGSCTNGRIEDLRQVAAVVRGRRVAP
                     GVRAMVVPGSGAVRDQAEAEGIAALLIDAGFEWRKPGCSMCLAMNDDVLAPGERCAST
                     TNRNFEGRQGRAGRTHLMSPAMAAAAAVTGCITDVRELEIQHG"
     gene            209944..210597
                     /gene="leuD"
                     /locus_tag="Rmet_0201"
     CDS             209944..210597
                     /gene="leuD"
                     /locus_tag="Rmet_0201"
                     /EC_number="4.2.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate isomerase subunit"
                     /protein_id="ABF07087.1"
                     /translation="MDDITTIEGVGAPLPLPNLDTDQIMPKQFLRGIDKAGLDRGLLH
                     DMRFDANGAPRADFVLNQPAWRDTRVLVAGPNFGCGSSREHAVWGLQQYGIRAVIAPS
                     FGEIFYSNAMNNRLLLVALPQADVDQIMAAVSDPVAPASIRIDLSTMTVNAGDFAKSF
                     SLSPRHLDMFRLGLDVIGMSLTHADAIAAFTSRHHADNPWLRDVAATTMARLGRMAG"
     gene            210611..211489
                     /gene="dehH1"
                     /locus_tag="Rmet_0202"
     CDS             210611..211489
                     /gene="dehH1"
                     /locus_tag="Rmet_0202"
                     /EC_number="3.8.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Haloacetate dehalogenase H-1"
                     /protein_id="ABF07088.1"
                     /translation="MFEGFTTQRIDHDGVAIHAVVGGEGPPLLLLHGHPQTHVIWHKV
                     AGELARHFTVVATDLRGYGDSDKPAGLPDHSNYSKRTMAADQMAVMRALGFERFRVLA
                     HDRGARVAHRLAVDHPQAVEKLVTLDIAPTLAMYAQTNEAFARAYYHWFFLIRPAPFP
                     ETLIEADPELYLRQTMGSRSAGLAPFTDEALAEYLRGLRQPGAAHGLCEDYRASAGID
                     LDHDRADIEAGRMIECEMLALWGADGAVGKCFQPLEEWRKVARRVTGHALPCGHYIAE
                     EIPEQLLAEVLPFLRA"
     gene            211952..212632
                     /locus_tag="Rmet_0203"
     CDS             211952..212632
                     /locus_tag="Rmet_0203"
                     /codon_start=1
                     /transl_table=11
                     /product="Probable signal peptide protein"
                     /protein_id="ABF07089.1"
                     /translation="MAAYAVPFDVRCRANLSSMSMNKKTEQQEHHMPPANLSRKLPSA
                     RLLAIAALVAGASSAASAEELVGWAHPAVQAAFARDTDHGINKYEIAVNFNTPIQYGN
                     PDGWLFRLQAEANMGYWDARSGTNRQNLMEFGLTPILRVEKRGGYFVPFLEAGVGLRL
                     LTHTSTSDQHNFSTAFQFGDMVGLGVGFGKNAATEVGMRFQHISNAGIKEPNPGTNLY
                     TGYVRYRF"
     gene            complement(212650..214095)
                     /locus_tag="Rmet_0204"
     CDS             complement(212650..214095)
                     /locus_tag="Rmet_0204"
                     /EC_number="2.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family,
                     HTH:Aminotransferase, class I and II"
                     /protein_id="ABF07090.1"
                     /translation="MLNLNLVRSRRGGETLTEQIVAGIAALVDSRALRAGALLPSVRR
                     FAQQHDVSTFTVAEAYGRLTALGYLAARPGSGYTVAHRHAPAGHARVPHWEAPGLNAA
                     WLLSDVFADHSVPIKAGAGWLPGDWLNEEGLHQAMRSAARVPAAQVSGYGHPYGFGAL
                     REHIAAHLSQYGIPAQSQQVVLTQGATQALDLVVRTLLRPGDTVLVESPCYCNLLQIL
                     RLAGLRAIGVPRTAAGLDTDALEDAIRQHSPRALFINTVLQNPTGASLTSMNAFRVLQ
                     IAEQHRLLVVEDDIYRELAPAGSPMLAAMDGLSQVVYVNGFSKTIAPSLRVGYLAASP
                     DLAKAFARTKMAVGLTSSEVTERLVYSVLTSGHYGRHVAALAERLRAQQDLVTEKMDA
                     HGLEVLLRPEGGMFAWARMRETDGPAPSGNRLATLALEHGIWLAPGAYFEPGEADSPW
                     IRFNVATSDAPQLWDFFDAVRTDQGALARAA"
     gene            214386..215717
                     /gene="aptA"
                     /locus_tag="Rmet_0205"
     CDS             214386..215717
                     /gene="aptA"
                     /locus_tag="Rmet_0205"
                     /EC_number="2.6.1.18"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-alanine-pyruvate aminotransferase"
                     /protein_id="ABF07091.1"
                     /translation="MDAAKTVIPDLESLWMPFTANRQYKSAPRLLVSASGMYYTTHDG
                     RQILDGCAGLWCVAAGHARKEIVEAIAQQAATLDYAPPFQMGHPLEFEAATKVASLMP
                     QGLDRIFFTNSGSESVDTALKIALAYHRARGEGQRTRIIGRERGYHGVGFGGMGVGGI
                     GPNRKMWSANVMPGTDHLPATLNIAEAAYSKGQPQWGAHLADELERLVALHDASNIAA
                     VIVEPMAGSAGVLIPPVGYLEKLREITSKHGILLIFDEVITAFGRLGAATGAERLKVT
                     PDLITMAKAINNAAVPMGAVAVRREVHDAVINATPQGGIELPHGYTYSGHPLAMAACI
                     ATLDIYKRDKLFERAAEMSPKFESAVHGLRGAPYVKDIRNLGLVAGVELESRPGAPGA
                     RAYEAFLKCLELGLLVRYTGDILAFSPPLIISEAEIDQMFDTVRQALHSIK"
     gene            215758..217275
                     /gene="mmsA"
                     /locus_tag="Rmet_0206"
     CDS             215758..217275
                     /gene="mmsA"
                     /locus_tag="Rmet_0206"
                     /EC_number="1.2.1.27"
                     /codon_start=1
                     /transl_table=11
                     /product="Methylmalonate-semialdehyde dehydrogenase"
                     /protein_id="ABF07092.1"
                     /translation="MNIAENRQIAEIHHYVGGTVRRAGTDRFADVFNPATGEVAARVA
                     MGSADDVAAAVAAAKAAAPAWAEMPPLRRARILFKFKELLDRHHDDLAALITREHGKV
                     FSDAKGEVTRGIEVVEFACGIPNLLKTDFTDNIGGGIDNWNLRQPLGVVAGITPFNFP
                     VMVPMWMFPVALACGNTFVLKPSERDPSPSLLIADLLKQAGLPDGVFNVVQGDKVAVD
                     ALLAHPDVQALSFVGSTPIAEYIYTEGTKHGKRVQALGGAKNHLVVMPDADLDQAVDA
                     LVGAAYGSAGERCMAISVAVAVGDVADRLVPRLAERAATLKIRNGMEDDAEMGPLVTA
                     AHKAKVEGYIAKGVAEGAKLVTDGRGHKVDGHENGFFVGGTLFDNVKPDMTIYKEEIF
                     GPVLSVVRVHDFAEAVDLINRHEFGNGVSCYTSDGGIARAFARQIQVGMVGINVPIPV
                     PMAWHSFGGWKRSLFGDHHAYGEEGVRFYTRYKSVMQRWPDSIAKGAEFTMPVAK"
     gene            217473..218882
                     /locus_tag="Rmet_0207"
     CDS             217473..218882
                     /locus_tag="Rmet_0207"
                     /codon_start=1
                     /transl_table=11
                     /product="Probable amino-acid transporter transmembrane
                     protein"
                     /protein_id="ABF07093.1"
                     /translation="MSLFRTKNIDAMLEVSEHDGLRKVLGAVDLVLMGIGAIIGTGIF
                     VLTGTGALTAGPALTVSFVIAAMACGFAALCYAEFASAIPVSGSIYTYSYATLGEIVA
                     WMIGWDLLLEYGLATSAVSVGWSGYFQSLIAGFGIHLPTVLTAAPGAVPGEHTLFNLP
                     ACLIMLAITWIVSYGVKESARLNNVMVAIKIGVVLLFIAVGVWHVKPANWQPFAPFGM
                     TGVFNAAALVFFAFIGFDAVTSAAEEVRNPRRDLPIGIIGSLAVCTILYVTVAAIMTG
                     IVPFMKFEGVDHPVSLALQYAGQNWVAGFVDLGAILGMTTVILVMTYGQTRIIFAMSR
                     DGLLPEALSTVHPVHATPYTATWTVGIVFAAIAAFVPLNVLAELINIGTLAAFTLISI
                     AILVLRRTRPDLRRGFRCPGVPVVPLLAVGFCLFLMAHLQALTWIAFLCWIGLGLIIY
                     FAYSRRNAVLHNHGGDAEG"
     gene            complement(218883..220283)
                     /locus_tag="Rmet_0208"
     CDS             complement(218883..220283)
                     /locus_tag="Rmet_0208"
                     /EC_number="2.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family,
                     HTH:Aminotransferase, class I and II"
                     /protein_id="ABF07094.1"
                     /translation="MRLLLDPSTGVPLTEQIVLGVKAWISSREALPGARLPSIRQMAA
                     EHGISRFPVIEAYDRLVSQGLVDSRQGSGFYVADSTLAGRSGRGWSDPSLAEDLSLHI
                     IDQFHHPSGTLKLAGGFVPEEWRDVEGLTQAIRHITRHDIDSVIHYATPLGHPELRKQ
                     VLTRVRQVGIQAELSQILITTGASQALDLVARHLLKPGDTVFVEDPGYYNLFGLLRMQ
                     GVQLVGVPHTPNGPDPEACEHLLRDHKPKLFFTNSVLQNPTGSTLAPPVAFRLLELAR
                     KHNFRFVEDDIFSDFQLNFTDRLATLDQLEHVIYVGGFSKTVSAALRVGYIVADKALV
                     KDLIDVKVLTSVAGSHFAEAVTATMLERGNYRKYVERLRVRTREVTADVVKLLGQYNW
                     DVFCEPAGGNFLWARPRGIEDSRELVALAENHGVALAPGHFFRPGGETTAWVRINSAY
                     ASDPRARAFLEDAGSR"
     gene            220444..220782
                     /locus_tag="Rmet_0209"
     CDS             220444..220782
                     /locus_tag="Rmet_0209"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07095.1"
                     /translation="MRELRTFELEEPDQPVTWRARHGHSVTALEGRLWLTVEGHLADI
                     WLRPGDVMTLPEGTRVWLSGDAPGSRFLLTESPAPWSLRRAVFITRQFARRWGEHKTA
                     AFGDCPRISA"
     gene            221032..224313
                     /gene="sbm"
                     /locus_tag="Rmet_0210"
     CDS             221032..224313
                     /gene="sbm"
                     /locus_tag="Rmet_0210"
                     /EC_number="5.4.99.2"
                     /codon_start=1
                     /transl_table=11
                     /product="Methylmalonyl-CoA mutase"
                     /protein_id="ABF07096.1"
                     /translation="MTDLSDVSRTAAAKPPAVPGRGPANKVRFVTAASLFDGHDASIN
                     IMRRILQSQGCEVIHLGHNRSVQEVVTAALQEDVQGIAISSYQGGHVEYFKYMIDLLR
                     EHGGEHIQVFGGGGGVIVPDEIRELQAYGVARIYSPEDGQRMGLAGMITDMAQRCDID
                     LTRYAPTTLDTVVAGDRRALAQLITALENGKADPELVSALHAQAKAAAVPVLGITGTG
                     GAGKSSLTDELIRRFRLDQDDALSIAVISIDPSRRKSGGALLGDRIRMNAINHPNIFM
                     RSLATREAGSEISQALPDVIAACKAARFDLVIVETSGIGQGDAAIVPHVDLSLYVMTP
                     EFGAASQLEKIDMLDFADFVAINKFDRKGAQDAWRDVAKQVQRNREQWHSRAEDMPVY
                     GTQASRFNDDGVTMLYQGLVGALGARGMSLKPGTLPNLEGRISTGQNVIVPPARSRYL
                     AELADTVRAYHRRVVAQSKLARERQQLRAAHDMLQGAGHESAALETLASERDVSLGAV
                     ERKLLAMWPQMQQAYSGDEYVVKIRDKEIRTGLISTTLSGTKIRKVVLPRFEDEGEIL
                     KWLMRENVPGSFPYTAGVFAFKREGEDPTRMFAGEGDAFRTNRRFKLVSEGMEAKRLS
                     TAFDSVTLYGEDPHERPDIYGKVGNSGVSIATLEDMKVLYDGFDLTNPSTSVSMTING
                     PAPTILAMFMNTAIDQQIDRFRADNGRDPTADEEAKIRAWVLQNVRGTVQADILKEDQ
                     GQNTCIFSTEFSLKVMGDIQEYFVHHQVRNFYSVSISGYHIAEAGANPISQLAFTLAN
                     GFTYVEAYLARGMHIDDFAPNLSFFFSNGMDPEYSVLGRVARRIWAVTMRDKYGANDR
                     SQKLKYHIQTSGRSLHAQEIDFNDIRTTLQALIAIYDNCNSLHTNAYDEAITTPTAES
                     VRRALAIQLIINREWGVAKCENPNQGSFLIEELTDLVEEAVLQEFERIAERGGVLGAM
                     ETGYQRGKIQEESLYYEQLKHDGTLPIIGVNTFRNPNGDPTPQTLELARSSEDEKQSQ
                     LHRLTEFHGAHQADAEAMLARLRQAVIDNRNVFAVLMDAVRVCSLGQITHALFEVGGQ
                     YRRNM"
     gene            224403..224840
                     /locus_tag="Rmet_0211"
     CDS             224403..224840
                     /locus_tag="Rmet_0211"
                     /EC_number="3.6.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="diadenosine tetraphosphate (Ap4A) hydrolase and
                     other HIT family hydrolases"
                     /protein_id="ABF07097.1"
                     /translation="MQAEYDSNNIFARILRGELPCFKVYEDADTIAFMDIMPQSDGHT
                     LVVPKEQAVDVFGLSEAGAAAAIRATQIVARGVREAFQPDGVVISQFNGAAAGQTVPH
                     IHFHIVPRYVDQPLRGHARQQQDMGVLKQHAERVIAALAKLKG"
     gene            224897..225751
                     /gene="hbdA"
                     /locus_tag="Rmet_0212"
     CDS             224897..225751
                     /gene="hbdA"
                     /locus_tag="Rmet_0212"
                     /EC_number="1.1.1.157"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxybutyryl-CoA dehydrogenase"
                     /protein_id="ABF07098.1"
                     /translation="MAIKTVGIVGAGTMGNGIAQACAVVGIDVVMIDISDAAVQKGIA
                     TVAGSLDRLIKKEKATEADKAAALARIHGSTSYDDLKRADIVIEAATENFDLKVKILK
                     QIDGIVGPDVIVASNTSSISITKLAAVTSRADRFIGMHFFNPVPMMALVELIRGLQTS
                     DAAHADVEDLAKRLGKYPITVKNSPGFVVNRILCPMINEAFCVLGEGLASPEEIDEGM
                     KLGCNHPIGPLALADMIGLDTMLAVMEVLYTEFADPKYRPAMLMREMVAAGYLGRKTG
                     RGVYVYSK"
     gene            complement(225859..226638)
                     /gene="crp1"
                     /locus_tag="Rmet_0213"
     CDS             complement(225859..226638)
                     /gene="crp1"
                     /locus_tag="Rmet_0213"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, CRP-family"
                     /protein_id="ABF07099.1"
                     /translation="MCWQRPVPRDRKIADAIPRGCHADDNSGLIPTIEMTATNNDFID
                     RCAWATNLSPEQRARVKRVTTVREYTQGEYVCHKGEMAEHWLGVVEGVVKITTVSPSG
                     KSVTFTGVPTGGWFGEGAVLKHEIRKYDVMALRRSRIAFIPIETFQWLLDTSLPFTRF
                     LLMQLNDRLGQFIAAVEYERLLDIDSRVARAVSSLFNESLYPGIGTTLEISQEEIGLL
                     AGISRQRANQALKVLEQQGLVRVDYGVIEALDLEGLRQYGE"
     gene            226793..228757
                     /locus_tag="Rmet_0214"
     CDS             226793..228757
                     /locus_tag="Rmet_0214"
                     /EC_number="6.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain-fatty-acid--CoA ligase (Long-chain
                     acyl-CoA synthetase)"
                     /protein_id="ABF07100.1"
                     /translation="MQESSATTFPRCLLAHATQRPDHPAYREKDLGIWQTYGWSQTAN
                     EVRALACGLAALGFRRGMNLAVVGDNRPRLYWAMTAAQALGGIPVPLYQDAIANEMIY
                     VLDDAEIEFAIVEDQEQVDKLLEVESQLAARGRAVRHLIYEDPRGLRDYDHPSLLSYE
                     RVQEIGREFDRANPGFFDAAVQAGAPEDTAIILYTSGTTGKPKGVCHSHAGLIGSARN
                     GCKFDGLGADDDVLSYLPMAWVGDNLFSYAQALVAGFTVNCPESRETVMTDLREIGPT
                     YYFAPPRIYEGLLTQVMIRMEDAGWIKRRLFQWAMNVARRCGADILDKRPVATLDRLR
                     YALGEALIYGPLRNVLGMSRIRVGYTAGEAIGPDLFRFYRSIGINLKQFYGQTETCAY
                     VCLQPDGQVKFDTVGPAAPGMEIRIAENGEVLVRGVGLLKNYYKRDDATREAINDEGY
                     FLTGDAGVIDADGHLKIIDRAKDVGKLADGSMFAPKYIENKLKFFPYIKEAVAFGTDR
                     DRVCAFINIDFDAVGNWAERRHLPYAGYVDLAAQPDVIAMIAECVEQVNADLAADAML
                     AGSQIARFLILHKELDPDDDELTRTRKVRRGFIAEKYGVLVEALYAGKPEQFIETRVK
                     FEDGREGSVSATLKLVDVKRFPPVGGARAA"
     gene            228774..229715
                     /gene="livG8"
                     /locus_tag="Rmet_0215"
     CDS             228774..229715
                     /gene="livG8"
                     /locus_tag="Rmet_0215"
                     /codon_start=1
                     /transl_table=11
                     /product="leucine/isoleucine/valine transporter subunit,
                     ATP-binding component of ABC superfamily"
                     /protein_id="ABF07101.1"
                     /translation="MTVTQTAWQGGMARVDATGTLVPPGAIAPAGHVEGTHGDSPRPG
                     SAREPESTSHVRTRGDVILDLQNISLSFGGVKALTDISFDVCEHEIRAIIGPNGAGKS
                     SMLNVINGVYHPQQGRIVFRGQERRQMHPTAAARQGIARTFQNIALFKGMTVLDNIMT
                     GRNTQFRTGVFAHALWWGPARAEEMRHRRKVEEVIDFLEIQAIRKTPVGRLPYGLQKR
                     VELARALAAEPSMLLLDEPMAGMNVEEKQDMCRFILDVNHQFGTTIVLIEHDMGVVMD
                     ISDRVVVLDYGKKIGDGTPDEVKSNPDVIRAYLGTAH"
     gene            229756..230670
                     /locus_tag="Rmet_0216"
     CDS             229756..230670
                     /locus_tag="Rmet_0216"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transporter, livH-like permease
                     component"
                     /protein_id="ABF07102.1"
                     /translation="MSFFFEILIGGLLSGLMYSLVALGFVLIYKASGVFNFAQGAMVY
                     FAALAVVGLMDKGLPMWAAVIGAFIVMIIVGMSTERFVLRKLVNQPPITLFMATIGLS
                     FFLEGLGPLLFGNEVRPIQLGIVDEPIESILTRFNIVVSKFDLAAALIAAVLVAGLAL
                     FFQYTKVGRALRAVADDHQAALSLGIPLQNIWAIVWGVAGFVALVAGMLWGSRNGVQF
                     ALTLTALKALPVLILGGFTSVPGAIVGGLIIGASEKLAEIYIPPVFQSVFGGNFGGIE
                     GWFPYVFALLFLLVRPEGLFGEKHIDRV"
     gene            230683..231759
                     /locus_tag="Rmet_0217"
     CDS             230683..231759
                     /locus_tag="Rmet_0217"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transporter, livM-like permease
                     component"
                     /protein_id="ABF07103.1"
                     /translation="MLYRESGQFKTSYVADSQIFPIRQDRIFFALLMAVAFVAIPFVG
                     TEYWLSAILTPFLIFSLAALGLNILTGYAGQLSLGTAAFMAVGAYAAYNFQLRIEGIP
                     VLLTFILAGASAAVVGVAFGLPSLRIKGFYLAVATLAAQFFVVWALTKFPWLSNNSSS
                     GVITAQRLDLFGVAIDTPVKKYLFVLGIVTVLALIAKNLVRSATGRAWMAVRDMDVAA
                     EVIGIPLMRTKLLAFAVSSFYCGVAGALYAFCYLGSVEPDGFSLDLSFRILFMIIIGG
                     VGSILGSFLGAAFILLLPIFLDNVLPALASSLHLPFTNATVSHIQLMVFGGLIIFFLI
                     VEPHGLARLWQIAKEKLRLWPFPH"
     gene            231824..233161
                     /locus_tag="Rmet_0218"
     CDS             231824..233161
                     /locus_tag="Rmet_0218"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transporter, periplasmic component:
                     HAAT family"
                     /protein_id="ABF07104.1"
                     /translation="MTTVFRNVQRAALVVSVAAAMLVPALPALAQTNDQFVALPSYRV
                     GPYGANGQSFYGGFVDYLNYVNLKEGGVNGVKLGWEECETEYNNAKGVECYERLKAKS
                     SASKGTAYHTMSTGISYALVDKTAADKVPLVMMGYGRTDAVDGSVFPYAFPLVTTYQM
                     QVSAIVKFLASKNGGSLAGKKIVYLYHDSAYGKEPIVALEAEAKLGKFNLVEIPVAHP
                     GNEQGAQWLKIRQENPDYVIFWGWGVMNQTALKAAQKVGYSRDKMIGSWWAGSEEDTV
                     PAGEAAKGYMSATWNVAGKNVPLIADIEKVVYGAGKGNMQDRNKVGSVLYNRGVSAAV
                     VTVEAIRGAQAKFGKGKVMSGDEMRWAFENLNLTSARLQQVGATGLLPEIKTSCDNHE
                     GSGKVKIQQWDGAKWVVVSDWIEGNKSLIHPLFKATAAQYAKEKGITPACMKS"
     gene            233224..234039
                     /gene="livF8"
                     /locus_tag="Rmet_0219"
     CDS             233224..234039
                     /gene="livF8"
                     /locus_tag="Rmet_0219"
                     /codon_start=1
                     /transl_table=11
                     /product="leucine/isoleucine/valine transporter subunit,
                     ATP-binding component of ABC superfamily"
                     /protein_id="ABF07105.1"
                     /translation="MTLLSVNNIEVIYDHVILVLKGVSLEVPEGRIVALLGANGAGKT
                     TTLKAISNLLHAERGDVTKGSIEYRGQRVDQLTPNDLVKRGVIQVMEGRHCFAHLTIE
                     ENLLTGAYTRGLSRGQTRDELEKIYAYFPRLKTRRKSQAGYTSGGEQQMCAIGRAMMA
                     KPAMILLDEPSMGLAPQIVEEIFEIVRDLNTRERVSFLLAEQNTMVALRHADYGYILE
                     NGRVVMDGDAESLRTNEDVKEFYLGVAANDADGAARKSFRDVKSYRRRKRWLA"
     gene            234054..235316
                     /gene="paaK"
                     /locus_tag="Rmet_0220"
     CDS             234054..235316
                     /gene="paaK"
                     /locus_tag="Rmet_0220"
                     /EC_number="6.2.1.30"
                     /codon_start=1
                     /transl_table=11
                     /product="Phenylacetate--CoA ligase"
                     /protein_id="ABF07106.1"
                     /translation="MAADPVEYFDALETRNPAEREAALFAALVRQIAHAQSHAAYFAE
                     ILCDIDARDITSRAALATLPVTRKSEMTMQQRIAPPLGGLNATPLRDLRHVFQSPGPI
                     HEPDGHGPDWWRTARAMFAAGFREGDLVYNTFSYHFTPAGMMMESGAHRLGCCVFPAG
                     VGQTESQVQALANLQPSAYAGTPSFLKLLIERGEEMGMACSSISKALVSGEACPPALR
                     AWLQDHGITARQMYGTADLGLIAYETAGGDGWVVDEGVLVEIVEPGGTEPMPEGEVGE
                     VVVTVLGNSDYPLIRFGTGDLSAIVADSSHRASPCGRTNIRLKGWLGRADQATKVKGM
                     FVHPGQVGDVVRRHAEIRAARLIVTGTVGADVMTLHCDVTREDEALAAAIRESMREVL
                     RLRGEVRFVPAGSLPQDGKVIEDARSYD"
     gene            complement(235367..235819)
                     /locus_tag="Rmet_0221"
     CDS             complement(235367..235819)
                     /locus_tag="Rmet_0221"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07107.1"
                     /translation="MQPDDPERQTTLTHRERAIRAFWVTCGTLSLALGVIGIFLPVLP
                     TTPFVLLAAACFARGSERFHRWLLAHHRFGPLVHDWQTHRSIPFRAKCLALSMMWPSM
                     IITAWLMRERPVASITLIAIALGTTVWMVRLPTRPRGGHVRSSNAQPE"
     gene            complement(235860..236837)
                     /gene="nppD"
                     /locus_tag="Rmet_0222"
     CDS             complement(235860..236837)
                     /gene="nppD"
                     /locus_tag="Rmet_0222"
                     /EC_number="1.13.11.-"
                     /codon_start=1
                     /transl_table=11
                     /product="2-nitropropane dioxygenase"
                     /protein_id="ABF07108.1"
                     /translation="MPAAKLIPPVLQNLALPVIASPMFIVSYPELVLAQCKAGIVGSF
                     PALNARPAELLDEWLTQIQAELANFKAANPGKPVGPIAVNQIVHASNARLEHDVKVCV
                     EHKVPIFITSLRAPPKEMIDAVHSYGGIVLHDVINIRHAEKAIEAGVDGLILVAAGAG
                     GHAGTLSPFALVGEVRKFFDGPIALSGSIATGEAVLAAQAMGADFAYVGTRFIASQEA
                     HAALEYKQSITSSAASDIIYTNLFTGVHGNYIRESIVNSGLDPENLPVADKSKMDFSS
                     GSSKAKAWKDIWGAGQGVGQIEDIPTAGEIVARMKSEYDAARARLGLVA"
     gene            complement(237241..238434)
                     /locus_tag="Rmet_0223"
     CDS             complement(237241..238434)
                     /locus_tag="Rmet_0223"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative SAM-dependent methyltransferase"
                     /protein_id="ABF07109.1"
                     /translation="MNVITLKPGKEKSLLRRHPWVYATGIAATEGRCEPGSTVVIRSA
                     DGRFLARGAYSPESQIRARVWTFDENEPVDHAMFKRRVSAALAHRKQWVRDTNAVRLI
                     FGESDRLPGLIVDYYGQGERGQLVCQFNAAGVEQWKDALVQALIKETGCPNVYERSDA
                     AVRQREGLPLVTGVLAGAEPDPELSVTEHGVRYHVDVRNGHKTGFYVDQRDNRKLVGD
                     LAEGREVLNCFCYTGGFSLAALRGGATSVTSIDSSGEALKIAASNVTLNGFDPARATW
                     LDADVFKTLREFRAEGRQFDLIVLDPPKFAPSAQHIDRAARAYKEINLVGMQLLRPGG
                     LLFTYSCSGAISMELFQKIVAGAATDARSDARILRRLSAGTDHPMSAAFPEGEYLKGL
                     LLEKI"
     gene            complement(238439..238747)
                     /locus_tag="Rmet_0224"
     CDS             complement(238439..238747)
                     /locus_tag="Rmet_0224"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07110.1"
                     /translation="MSTDSNNGPLIPGEIPPEQSLIEYPSDFPIKVMGAMQDGFAEAI
                     VTLIQDFDPNFHAGKMEMRPSRNGNYLGLTVTVWVTSREQLDELYRALTGHPMVKVVL
                     "
     gene            complement(238765..239958)
                     /gene="dac"
                     /locus_tag="Rmet_0225"
     CDS             complement(238765..239958)
                     /gene="dac"
                     /locus_tag="Rmet_0225"
                     /EC_number="3.4.16.4"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine carboxypeptidase"
                     /protein_id="ABF07111.1"
                     /translation="MLNRVTPYVASAIAPVIVAATLAAAPAAVMAQGVPVPQVAAKSW
                     MLYDVTSGQALASQNADMRIEPASLTKLMTAYLAFEALKEKRLTLDQTVTPTDIVRKV
                     KSDESRMFIEAGKPVSVQDLLLGLIVQSGNDASLALAEAVGGSEEGFVVMMNREAQRM
                     GMKNTHFTNTDGVPDPNHYTTAVDLAILTTRLIKDFPEYYSMYSQKEFTYNKIRQPNR
                     NRLLYIDPTVDGVKTGHTKSAGYCLISSAKRPLANVPNGSRRLVSIVIGTATEQIRTQ
                     ESLKILNYGFQFFDTLRLYDKGQVLATPDIYKGKTGTIKIGVANETFVTVPKGTGSRL
                     KPVLERQELLIAPITAGQQVGTVKLMDGANKVAEFPVVALEEVPEAGFFGRLWDTIRL
                     WFKRK"
     gene            complement(240002..240646)
                     /locus_tag="Rmet_0226"
     CDS             complement(240002..240646)
                     /locus_tag="Rmet_0226"
                     /EC_number="3.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative hydrolase of the alpha/beta
                     superfamily"
                     /protein_id="ABF07112.1"
                     /translation="MNAHTQVTTFAGPVGAIDISIDLPQNAPVRGLALVAHPHPLFAG
                     TKDNKVAQTLARTFVALGYATVRPNFRGVGGTAGEHDKGIGEQDDLLAVIDWMRTQTA
                     WSPDVATLPLALGGFSFGSFVQTHVARRLAEAGTPAQRLVVVGTATSRWDVANVPADT
                     IVIHGEQDDTVPLASVFDWARPQDLPVIVIPGADHFFHRKLHLIKQLVVNAWDR"
     gene            complement(240781..241185)
                     /locus_tag="Rmet_0227"
     CDS             complement(240781..241185)
                     /locus_tag="Rmet_0227"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ferredoxin (modular protein)"
                     /protein_id="ABF07113.1"
                     /translation="MNTYNSELPITGDGRPRRLATPRPTSAVMSSYYQHHVFFCLNQR
                     DDGSACCADHNAKAMQEYAKKRCKELGIAGGEGRVRINKAGCLNRCELGPVLVVYPEA
                     VWYTFVDEQDIDEIIESHLINGKPVQRLMVDR"
     gene            241551..242840
                     /gene="dctA"
                     /locus_tag="Rmet_0228"
     CDS             241551..242840
                     /gene="dctA"
                     /locus_tag="Rmet_0228"
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylic acid transport protein"
                     /protein_id="ABF07114.1"
                     /translation="MRKPFYKILYVQVLFAIFVGILLGHYWPDTGVAMKPLGDAFIKL
                     IKMIIGPIIFCTVVSGIAGMRDMKKVGRVGGKALLYFEIVSTFALLLGLIATHALKPG
                     VGFNIDPATLDTKSIAQYVSKAHGQSTVEFFMHIIPDTIFSAFANGDILQILMVSMFF
                     GSALAVVGERARIIHDMVDQVSKVFFHIVHVITKVAPIGAFGAMAFTIGKYGLGSLIP
                     LLKLIGTFYLTAIVFVLVVLGTVARLTGFSIIRFVAYIKEELLIVLGTSSSEAALPHL
                     MEKMEKLGCSKSVVGLVVPTGYSFNLDGTNIYMTMAVIFIAQATNIELTLMQQLTILA
                     VAMVTSKGASGVTGSGFITLAATLAVVPTIPVAGMVLILGIDRFMSECRALTNIVGNG
                     VATVVVSAWEHELDRARLTRVLRGEDEASSLADASAR"
     gene            242959..244965
                     /gene="dctB"
                     /locus_tag="Rmet_0229"
     CDS             242959..244965
                     /gene="dctB"
                     /locus_tag="Rmet_0229"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase regulating
                     C4-dicarboxylate transport system"
                     /protein_id="ABF07115.1"
                     /translation="MPHSDDFLAVHDPAAPGPVHAPESSTRWWGFAAALMVGLLALCS
                     LTWLFSVQRGIAALQQSTAMRADRYAATLESTLDRYEFLPALVSLHPSVRALLANPED
                     PARIAVANNYLAEVNTRARASATYVIAASGLALAASNHGEPGSFVGTDYRFRPYFQMA
                     SRGQIGRFYAIGITSDEPGYYIAQPIESGGKVIGVTVVKLNLEWFQRAGSGSTEPLMV
                     SDDHGVIFLSSVPGWQYRTLRPLPPTLQAELHNTRQYHDVDVTPLPIQPLDSPVSRWL
                     ASTTLNDGERLVRVGAAGSTGATARDGDDGQGAHFGLSSDGADRYLEINRAVGPAGWN
                     MQVMAQLDPVLASARTATIGAALAYACICLLLVNLRQRRQRARDMQYSRRLLEAAYDQ
                     LERRVEARTADLMAINEQLEAEVTERARTEGELRATQDELVQASKLAALGQMAAGITH
                     ELNQPLAALRTFSDNTRVLLERGQLDAATGNLSAIADLTERMGKITGQLKLFAGKARQ
                     RRNAVRVRAAIDHVLQLIAPRLGRVMLRVRGLDGDAADLAVWADELKLEQVLLNLVGN
                     ALDAIAAAGAEDGRVDIAVSATDETVTLVVRDNGPGIAPDALPRLFEPFFTTKEIGQG
                     LGLGLAISSSIVREFGGQLTAGNVEGGGAEFVVTLRRSRQTATA"
     gene            245002..246336
                     /gene="dctD"
                     /locus_tag="Rmet_0230"
     CDS             245002..246336
                     /gene="dctD"
                     /locus_tag="Rmet_0230"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator of C4-dicarboxylate
                     transportsystem"
                     /protein_id="ABF07116.1"
                     /translation="MIAMQDGLRVLFVEDEPLVRQATAQSLELAGFSVLALPSAEAAM
                     PHLGADFPGVLVTDVRLSGASGLDLLQHCRNAAPGVPVILVTGHGDITMAVQAMREGA
                     YDFIEKPFGADRLTETVRRALERRALELENHALRRELAGPAAGTRIIGRSPAIAQVRD
                     LIANVAATDVPVMINGETGTGKELVARSLHALSTRRDQPFIALNCGAVPESIFESEMF
                     GHEAGAFTGAGKRRVGKLEHASGGTLFLDEIESMPLALQVKLLRVLQEGTLERLGSNT
                     SIPIDVRIIAASKGDMEALVAQGTFRQDLLYRLNVVTIPLPPLRERREDIVPLFEHFM
                     LVAAVRYQRPAPILSEMQRQQLMQRPWPGNVRELRNAADRLVLGVPEGGHAGGKADPV
                     DESTPLRERMERYERAVIADTLARTGGAVSQAADLLQVGKATLYDKIKRYGL"
     gene            246473..248074
                     /gene="hutH"
                     /locus_tag="Rmet_0231"
     CDS             246473..248074
                     /gene="hutH"
                     /locus_tag="Rmet_0231"
                     /EC_number="4.3.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Histidine ammonia-lyase (Histidase)"
                     /protein_id="ABF07117.1"
                     /translation="MPHAHPADIDGHHLTPDTVAAIARGQRAAIVPEPVLGKVADARA
                     RFEQVAAANVPIYGVSTGFGELVHNWVDIEHGRALQENLLRSHCAGVGPLFSRDEVRA
                     MMVARANALARGYSAVRPAVIEQLLKYLEAGITPAVPQVGSLGASGDLAPLSHVAITL
                     IGEGKVLTEDGGTAPTAEVLRERGITPLALAYKEGLALINGTSAMTGVSCLLLETLRA
                     QVQQAEIIAALALEGLSASADAFMAHGHDIAKPHPGQIRSAANMRALLADSARLSGHG
                     ELSAEMKTRAGEAKNTGTGVFIQKAYTLRCIPQVLGAVRDTLDHCATVVERELNSSND
                     NPLFFEDGELFHGGNFHGQQVAFAMDFLAIAATQLGVVSERRLNRLLSPHLNNNLPAF
                     LAAANEGLSCGFAGAQYPATALIAENRTICSPASIQSVPSNGDNQDVVSMGLIAARNA
                     RRILDNNQYILALELLASCQAAELAGAVEQLAPAGRAVFAFVRERVPFLSIDRYMTDD
                     IEAMAALLRQGALVEVVRGAGIELA"
     gene            complement(248112..250220)
                     /locus_tag="Rmet_0232"
     CDS             complement(248112..250220)
                     /locus_tag="Rmet_0232"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATP-dependent DNA helicase"
                     /protein_id="ABF07118.1"
                     /translation="MLPELAPEAAAESPDTEVTDAPAYLSRLNPEQRAAVEYDGDAPL
                     LIIAGAGSGKTNTLAHRVAHLVVNGADPRRILLLTFSRRAASEMGRRVERIVDQALGI
                     QTGAGRAALQWSGTFHAIGARLLREYAETLGLAPTFTISDRGDAADLMHVVRHDLGLS
                     EQTSRFPRKETCLAIYSRVVNTQLPLEVVLKTQFPRYAMWADALKGLFAAYVEAKQKQ
                     QVLDYDDLLLYWAQAMTEPALAQDMGARFDHVLVDEYQDTNALQASILLALKPQGRGL
                     TVVGDDAQSIYAFRGATVRNILDFPTQFSPPAEQVTLSQNYRSTQPILGAANAVIGLA
                     AERFTKDLWSLRESAEKPGVVVVNDEAEQARFVVEQVLARREAGLSLTQQAVLFRAAD
                     HSAQVEIELARRNIPFVKFGGLKFLESTHVKDVMAVVRWLENPRDRMAGFRTLQLLPG
                     IGPKTAARVLEGLEAATEPLIALEAFEPPPAAAPAWDELVTLARALMAPTSPWPSEFE
                     QVIAWYMPHLERMHDDAAARQADLQQIERIAATYASRERFLTELTLDPPSASSDESGV
                     PSRDEDYLILSTIHSAKGQEWKAVYVLNAVDGCMPSDLATGTTEEIEEERRLLYVAMT
                     RARDHLDIVVPQRFYVHNQVGFGDRHVYASRTRFLPNRVMPNFYSRSWPPAPMPGEGQ
                     QAKASLPQVDLASRMRGMWK"
     gene            complement(250374..250913)
                     /locus_tag="Rmet_0233"
     CDS             complement(250374..250913)
                     /locus_tag="Rmet_0233"
                     /codon_start=1
                     /transl_table=11
                     /product="Thiol-disulfide isomerase-like and
                     thioredoxin-like protein"
                     /protein_id="ABF07119.1"
                     /translation="MSNSATPATPSSKKRWPIAVAVVIVALLGFFGYRAMTPANTVPD
                     ATFTLLSGEKLSTGDLKGKVYLINFWATSCATCVKEMPQMVSTYKQFKDKGLDFVAVA
                     MNYDPPMYVMNYAKTRELPFKVAMDADGAAAKAFGNVQLTPTTFVVDKNGKILKRYVG
                     EPEWDALHKLLDGALANAA"
     gene            complement(251042..251539)
                     /locus_tag="Rmet_0234"
     CDS             complement(251042..251539)
                     /locus_tag="Rmet_0234"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein"
                     /protein_id="ABF07120.1"
                     /translation="MTPRSPLLRTVLHGLAALLLLVGPAVSMAASHLPPVTDIAAQSA
                     DAAKQGGPLVVLVSLPGCTYCETARRNYLAPQAAAGEITARELDMTADTPLRDADGTM
                     TTAKQWARAHNITVAPTVLFLDRNGRNLASPLRGLQPDFYGAYLEQAVDTARAKLTEG
                     LAASK"
     gene            251570..252259
                     /locus_tag="Rmet_0235"
     CDS             251570..252259
                     /locus_tag="Rmet_0235"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07121.1"
                     /translation="MVKTSPHLISCASGANVRGFPDNTGLRQIAPTSPMRRPSPRPAP
                     RVPLLIAIVLLALAGCSPRYDWRTIVSNEGQYAALYPDKPTSAARDVAIAGRQLPMRM
                     EAARIDNTLFAVGVVSLPADDAGLRREALASMQAGLVGNLGAHPDSPARSRPVTVMSA
                     GQPPVALDGVEVTVAGISPQDKSPRRLTARLVASGSRVYQAVVLEAGDAAKDARQAEQ
                     VEQFLTGFHPF"
     gene            252302..252946
                     /gene="rhtB"
                     /locus_tag="Rmet_0236"
     CDS             252302..252946
                     /gene="rhtB"
                     /locus_tag="Rmet_0236"
                     /codon_start=1
                     /transl_table=11
                     /product="neutral amino-acid efflux system"
                     /protein_id="ABF07122.1"
                     /translation="MRWEVWLAYFAACWVIAVSPGSGAVLSMSHGLSYGLKKTSTTIL
                     GLQTGLVIILLIAGGGLGALLLASEEAFLVVKTIGAMYLIYLGIQQWRAKVETNPQNS
                     EDKTVRVTIMSRRRRFATGLLTNVTNPKGIIFMVAVLPQFIDPTHALGLQLAILAATM
                     CFVDLIVMHGYALLASRMQGLFRNARAVRWQNRFFGSVLVAVGTALFFVRRHHA"
     gene            complement(253220..254758)
                     /locus_tag="Rmet_0237"
     CDS             complement(253220..254758)
                     /locus_tag="Rmet_0237"
                     /codon_start=1
                     /transl_table=11
                     /product="Probable Mg chelatase-related protein"
                     /protein_id="ABF07123.1"
                     /translation="MSLAVLRSRALTGIEAPPVSVEIHLANGLPAFNIVGLADTEVRE
                     SRERVRAALLNSEFEFPNRRITVNLAPADLPKESGRFDLAIALGILAASGQLQADTLD
                     AFEFAGELSLAGDLRPVRGALAMAMGLARDNARRVAEDRPPRAFVVASENGAEAALVE
                     AVIVHAGATLRDVCHHIGLLPERPLPRARPPARVEASADGPDMRDVRGQAQARRAMEI
                     AAAGQHSVLLVGPPGTGKSMLAQRFPALLPPMTEAEALEAAAVQSLTSGGFHPSRWGH
                     RPFRSPHHTASAPALVGGGASPRPGEISLAHHGVLFLDELPEFERRVLEVLREPLETG
                     RITISRAAGQADFPARFQFVAAMNPCPCGYLGHPTRMCRCTPDQVQRYQSRLSGPLLD
                     RVDLQIEVPAQSQQEMFDGQPGEPSQTVRARAVVARERQLTRQGTPNSELAGRAIETH
                     CPLDNEARTLLRDAMQKLGWSARAYFRVLKVARTIADLDGAEVLTAGHVAEAIQYRRV
                     LRTA"
     gene            complement(254841..255098)
                     /locus_tag="Rmet_0238"
     CDS             complement(254841..255098)
                     /locus_tag="Rmet_0238"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07124.1"
                     /translation="MKPTDLFNDLQSKVSEALRNSPAKDIEKNVRSMMTQGFARLDLV
                     TREEFDVQSQVLARTRARLEELEARVAELERRVGGTPTGGA"
     gene            255651..256451
                     /locus_tag="Rmet_0239"
     CDS             255651..256451
                     /locus_tag="Rmet_0239"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein"
                     /protein_id="ABF07125.1"
                     /translation="MKKSSLAVSAAAALFSLATSVAFAQSAPEAAAPAAAPAAEPASP
                     HTITANVSLVSDYRYRGLSQTNRRPAIQGGFDYAHESGFYIGNWNSTISWISDADKSV
                     SAPVEMDFYGGFKNTFKMSDLEFNYDVGVLQYFYPGGYSNPRPYTTELYAGIGYGPVF
                     LKYSQAVTNLFGIANSQYSSYIDLAFNYPLNVWDLTLNAHLGYQNVQHNSAASYLDWK
                     VGLTKDLGKGFALAVAYIGTNAKESFYTNSYNHNVGNNTAWVSLSKTF"
     gene            256504..256842
                     /gene="glnK"
                     /locus_tag="Rmet_0240"
     CDS             256504..256842
                     /gene="glnK"
                     /locus_tag="Rmet_0240"
                     /codon_start=1
                     /transl_table=11
                     /product="Nitrogen regulatory protein PII-2"
                     /protein_id="ABF07126.1"
                     /translation="MKLIIAVIKPFKLDEVREALSDVGVSGITVTEVKGFGRQKGHTE
                     LYRGAEYIVDFLPKVKIEVAVPDEVVERAIEAVEKSARTGKIGDGKIFVAPIEQVIRI
                     RTGETGGDAL"
     gene            256874..258406
                     /gene="amtB"
                     /locus_tag="Rmet_0241"
     CDS             256874..258406
                     /gene="amtB"
                     /locus_tag="Rmet_0241"
                     /codon_start=1
                     /transl_table=11
                     /product="ammonium transporter"
                     /protein_id="ABF07127.1"
                     /translation="MKTWFKRILTAGAMTLALGTAGLGLSTHAVAQDKPAAEASAATA
                     SATPAAAVAAPAAATPAAAPAEAAAAPAAPVPNKGDTAWLLVSTTFVILMTLPGLALF
                     YGGLVRSKNMLSVLMQCLMIFSVISILWAIYGYSFAFTEGNAFFGGTDRLFMKGLTVD
                     AVAATFSKGVVVPELGYFAFQCAFAAITCSLIIGAFAERAKFSAVLVFVVLWFTFAYI
                     PMAHMVWFWPGPDAYTDAAAGTAATAKAGWLFQKGALDFAGGTVVHINAAVAGLVGAF
                     MFGKRIGFGREAIRPHSLTFTMVGASLLWFGWFGFNAGSALEANGSAALAFVNTLLAT
                     AAAVVSWTFGEWIGKGKPSMLGGASGAVAGLVAITPAAGFVGPMGSIAMGLIAGLLCL
                     WGVTGLKRLLGMDDSLDVFGVHGVGGILGALLTGVFAAPSLGGTGIYDYVANKVADDY
                     SIAGQVWIQFEGVLTTIVWSGVVALVAYKLIDMLIGLRVPEEEEREGLDITSHGETAY
                     EV"
     gene            complement(258548..258613)
                     /locus_tag="Rmet_6407"
     CDS             complement(258548..258613)
                     /locus_tag="Rmet_6407"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADC45025.1"
                     /translation="MEETASLALYAPQALKTIETF"
     gene            258869..260164
                     /gene="gshA"
                     /locus_tag="Rmet_0242"
     CDS             258869..260164
                     /gene="gshA"
                     /locus_tag="Rmet_0242"
                     /EC_number="6.3.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-cysteine ligase"
                     /protein_id="ABF07128.1"
                     /translation="MVPHLITALNGPLLELEKKILDATPSIERWFRLEWQEHTPPFYC
                     SVDLRNAGFKLAPVDTNLFPGGFNNLAPEMLPLAVQAAMAAIEKICPDAKNLLLIPER
                     HTRNMFYLQNVARLSLIMRQAGLNVRLGSLSEEITEPTPIELPDGQTLVVEPLARLGA
                     KGRRLGLKDFDPCSILLNNDLSAGIPPILENINEQYLLPPLHAGWSTRRKSSHFAAYD
                     EVAKKFAKLIDIDPWMVNPYFARQTGVNFHERIGEEELADAVEGVLKKIAKKYREYGI
                     KETPYVVVKADAGTYGMGIMTVRDPSEVKGLNRKERNKMSVVKEGLEVSDVIIQEGVH
                     TFEKVNDAVAEPVVYMIDRYVVGGFYRVHTGRGIDENLNAPGMHFVPLAFAPNGMPDS
                     HAKPGAAVPNRFYMYGVVARLALLAASLELEKTDPNPIL"
     gene            260189..261142
                     /gene="gshB"
                     /locus_tag="Rmet_0243"
     CDS             260189..261142
                     /gene="gshB"
                     /locus_tag="Rmet_0243"
                     /EC_number="6.3.2.3"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione synthetase"
                     /protein_id="ABF07129.1"
                     /translation="MRILFITDPLETFKTYKDSTFAMMTEAAARGHELFFCLQSQLSL
                     SANVVEAMVRPLELTDDAQAWYRLGDAALMPLSAFDAVLMRKDPPFDMEYVTSTWLLE
                     LAEAQGARVFNKPRAIRDHSEKLAIGQHPQFITPTLVTRDAGRIREFHAEHKDIIVKP
                     LDGMGGMGVFRVGADAMNLGAIVETLGDNGARTLMVQRYIPAIKDGDKRILLIGGKPV
                     PYSLARIPQGTEIRGNLAAGGVGRAQELSARDREIAETLAPGLWKQGLLLVGLDVIGD
                     YLTEVNVTSPTCFQEIAQQTGFNVAGMFIDALEQAVAADRR"
     gene            261267..261722
                     /locus_tag="Rmet_0244"
     CDS             261267..261722
                     /locus_tag="Rmet_0244"
                     /EC_number="2.7.1.69"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase system, fructose-specific
                     component IIA"
                     /protein_id="ABF07130.1"
                     /translation="MAGILIIAHAPLASALRDCAGHVYCGQPQRVEAIDVIADADPAA
                     VLAEARKRLADVCEENGALVLTDIFGATPANIAARLAEPGRVKVLAGVNLPMLVRAIC
                     YRTEKLDQLATKALAGGAQGVLQIGTTAVQNQTANHPDKYAAEGHHHHQ"
     gene            261691..261960
                     /gene="ptsH"
                     /locus_tag="Rmet_0245"
     CDS             261691..261960
                     /gene="ptsH"
                     /locus_tag="Rmet_0245"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphocarrier protein (HPr)"
                     /protein_id="ABF07131.1"
                     /translation="MLQRDTTIINKLGLHARASAKLTQLAGSFNSQVKMSRNGRQVDA
                     KSIMGVMMLAAGIGSTVSIETDGPDEQEAMDALLALIANRFGEGE"
     gene            262011..263768
                     /gene="ptsI"
                     /locus_tag="Rmet_0246"
     CDS             262011..263768
                     /gene="ptsI"
                     /locus_tag="Rmet_0246"
                     /EC_number="2.7.3.9"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoenolpyruvate-protein phosphotransferase
                     of PTS system (enzyme I)"
                     /protein_id="ABF07132.1"
                     /translation="MPFALHGIPVSRGVAIGRAHILAPAALDVSHYLVDEDRLEAEVE
                     RLRSARAAVRAELITLKRDLPRDAPEEMGAFLDVHAMILDDEALSREPETLILQRRYN
                     AEWALTTRLEELMRQFDEIEDEYLRERKADIEQVVERILKVLAGAPVLAPAPVPTLAP
                     DGEATPGVIVVAHDIGPADMLQFKHTVFHGFVTDLGGRTSHTAIVARSLDIPAAVGVK
                     NASELIRQDDWIIIDGDAGLVIVDPSAIILEEYRHRQSERALEKKRLQRLRHMPAVTL
                     DGLEIELLANIEMAEDAGAALSAGAVGVGLFRSEFLFMNRRDELPDEDEQFHAYRNAV
                     EAMHGLPVTIRTIDIGADKPLDGRGDDFETALNPALGLRAIRWSLSEPGMFLTQLRAL
                     LRASAFGPVRILIPMLAHAGEIDQTLDLIEQAKRQLDERGLPYDPGIKVGAMIEIPAA
                     VLLLPLFLKRMDFLSIGTNDLIQYTLAIDRADNAVAHLYDPLHPAVLQLIARTIREAN
                     HAGVPVAVCGEMAGDPAMTRLLLGMGLREFSMHPAQLLRVKQEVIHADCERLSKAVDQ
                     ILNCYEPDELTAALKQLTA"
     gene            264005..264310
                     /gene="bfd"
                     /locus_tag="Rmet_0247"
     CDS             264005..264310
                     /gene="bfd"
                     /locus_tag="Rmet_0247"
                     /codon_start=1
                     /transl_table=11
                     /product="BFD-like (2Fe-2S)-binding region"
                     /protein_id="ABF07133.1"
                     /translation="MYVCICNQVTDHEIHGAAHLGVSTMDELAETLGVGTCCGRCREC
                     AQQVLCEGVAAVKTVRSSSMATIKVVEISSCSTTTSHAIMDARDPAVANDRRTALVA"
     gene            264456..264935
                     /gene="bfr"
                     /locus_tag="Rmet_0248"
     CDS             264456..264935
                     /gene="bfr"
                     /locus_tag="Rmet_0248"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin, iron storage and
                     detoxification protein"
                     /protein_id="ABF07134.1"
                     /translation="MKGDKKVIQHLNAQLKNELTAINQYFLHARMYRHWGLKKLGDVE
                     YKESIGEMKHADRLIERILMLDGLPNLQDLHKLLLGEDTPEMLKCDLKLEQGAHATVK
                     EGIAYCESVGDYVSREILVDILTDTEEHIEYLETQLDLIDKVGLPNYLQSQMEPGEQ"
     gene            complement(265152..265904)
                     /gene="moeB"
                     /locus_tag="Rmet_0249"
     CDS             complement(265152..265904)
                     /gene="moeB"
                     /locus_tag="Rmet_0249"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin synthase sulfurylase"
                     /protein_id="ABF07135.1"
                     /translation="MNDDQLLRYSRHILLDELGIEGQERLLAGHALVIGAGGLGAAAL
                     PYLASAGVGTITIVDDDDVDLTNLQRQILHTTANVGRPKVESAREGMLRINPDIDIRM
                     VPMRVGDAELDGLVAQADVVLDCCDNFATRHAVNRACLRHRKPLVSGAALRFDGQVTV
                     FDLRNPDAPCYACLFPPSEPAPEAACATMGVFAPLVGMIGTVQAAEALKLLTDVGETL
                     AGRLLMVDAMSMEWTTMRLVRTPGCEVCGGDH"
     gene            complement(266028..267635)
                     /gene="ctpA"
                     /locus_tag="Rmet_0250"
     CDS             complement(266028..267635)
                     /gene="ctpA"
                     /locus_tag="Rmet_0250"
                     /EC_number="3.4.21.102"
                     /codon_start=1
                     /transl_table=11
                     /product="C-terminal processing peptidase"
                     /protein_id="ABF07136.1"
                     /translation="MRKTLKNISLVSIGVVAGVLATLQISATAQNTTGPLPLDQLRLM
                     ADIFGQIKREYVEPVDDKKLLTEAIKGMVASLDPHSAYLDEKDFKELQEGTRGRFAGL
                     GIEISQEEGLVKVINPIEDTPAFRAGIQPGDLITRIDDKPVRGLPLEQAVKRMRGEPG
                     TKVTLTIYRKSEERTFPVSITRAEIRVQSVKTKMLDNNTIGWVRLTSFQERTVTDLGR
                     RLKEMADKNPNLRGIVLDLRNNGGGVLQGAVGVAAAFLPEDSVVVSTNGQVPDAKRVY
                     KASFSNYRLSSLEDDPLKDLPAEFKKLPMVVLTNAYSASASEIVAGALQDHKRATLMG
                     KTTFGKGSVQTVRPLTNDTGIKLTIAYYYTPSGKSIQAKGIRPDIPVDQNPDGDPDDA
                     LITREIDTERHLHNKQESEEPEMAEREQRRVEELRRLEEENAKKTPEEREKERKKKPV
                     EFGSADDFMLQQAIAQLDGKPVQRSKSRLEATGTAGKPDSSDNPKPASKAPAKPAAKP
                     AAPAKPSSPPPASAPIGEPLGTPTGKK"
     gene            complement(267833..268579)
                     /gene="gpmA"
                     /locus_tag="Rmet_0251"
     CDS             complement(267833..268579)
                     /gene="gpmA"
                     /locus_tag="Rmet_0251"
                     /EC_number="5.4.2.1"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglyceromutase 1"
                     /protein_id="ABF07137.2"
                     /translation="MYKLVLIRHGESTWNLENRFTGWVDVDLTDTGAAQAKQAGTLLK
                     EAGFAFDVAYTSVLKRAIRTLWHVQDEMDLMWIPVRNEWRLNERHYGALAGLNKAETA
                     KKYGDEQVLVWRRSYDTPPPALEPTDERASFGDPRYANVPRAEIPLTECLKDTVARVM
                     PLWNESIAPDIKSGKRVVIAAHGNSIRALVKYLDQISDDDIVGLNIPNGTPLVYELDA
                     DLRPLRHYYLGDQEAIAASLAAVASQGKAR"
     gene            268724..269137
                     /locus_tag="Rmet_6408"
     CDS             268724..269137
                     /locus_tag="Rmet_6408"
                     /codon_start=1
                     /transl_table=11
                     /product="putative rhodanese-related sulfurtransferase"
                     /protein_id="ADC45026.1"
                     /translation="MNFFADYNNLALIAIAVVSGGLLAWPTIKSGTGGKRVNAAAATQ
                     LINKRNAVVVDIRDAAEFAKGHMPQAKSAPLDDLPNRAGGLAKDKAIPIIVVCQNGQR
                     SSKAQAALKEAGYSEVYALEGGMAAWQQAGLPVIK"
     gene            269216..269473
                     /gene="grxC"
                     /locus_tag="Rmet_0252"
     CDS             269216..269473
                     /gene="grxC"
                     /locus_tag="Rmet_0252"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin 3"
                     /protein_id="ABF07138.1"
                     /translation="MARVVMYSTVVCPYCQMAERLLKQRGVEAIEKILIDREPGKREE
                     MMTRTGRRTVPQIYIDETHVGGFDDLSALDRQGGLVPLLAA"
     gene            270722..272437
                     /locus_tag="Rmet_0253"
     CDS             270722..272437
                     /locus_tag="Rmet_0253"
                     /EC_number="2.7.7.49"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-directed DNA polymerase (reverse
                     transcriptase)"
                     /protein_id="ABF07139.1"
                     /translation="MEALIREDESAPSGIPQRWGDINWRRVEQNVRAMQIRIAKATQE
                     RDWRRVKALQRSLTRSFSAKASAVRRVTENQGKRTAGVDRELWDSPEVRWVAIGRLRR
                     RGYRPMPLRRVFIPKANGKERPLGIPTMLDRAMQALYLLALEPVSEGTSDPNSYGFRS
                     NRSTADAMSQLFVNLSRKVSASWILEADIRGCFDHISHDWLERNVPMDKAILRKWLKA
                     GVVFQGQFQATEAGTPQGGIISPTLANVALNGLEQQLARFLETTLGVNQTRKLKVNVV
                     RYADDFVITGSTPEVLEHEVKPWVEQFLAIRGLSLSTEKTRIVSIDEGFDFLGWNFRK
                     YSGTLLIKPSRKNAQAFYRKVKEVISANKTVKQEVIIRLLNPMLRGWAQYHSPVVAKE
                     AFSKMQSRVFRALLWWTKRRHRGKNAEWVRKKYFASFGDRNWVFGTEFVEDDGERRWQ
                     ELYSLASTPIRRHKKIRGDFNPFDPAQEMYGENLRRDRMLESMSHRKQWIRLYVDQRG
                     LCAVCQCKITKETGWDDHHIVYRTHGGSDALGNRVLLHPNCHVQVHHHGRTVVKPVLE
                     MSSIL"
     gene            272596..273114
                     /gene="secB"
                     /locus_tag="Rmet_0254"
     CDS             272596..273114
                     /gene="secB"
                     /locus_tag="Rmet_0254"
                     /codon_start=1
                     /transl_table=11
                     /product="protein export chaperone"
                     /protein_id="ABF07140.1"
                     /translation="MSDQQQANQQDDQPFFNIQRVYLKDMSLEQPNSPGIFLESEAPS
                     VEVQVNVGASQLQEGIFEVVVTGTVTTKVQDKVAFLVEAHQAGIFDIRNVPVEQLDPL
                     LGIACPTILYPYLRGNIADVITRAGFQAIHLSEINFQALYEQRLQAAMEEAQGQGGDS
                     GIVMPDGSQARH"
     gene            273233..274261
                     /gene="gpsA"
                     /locus_tag="Rmet_0255"
     CDS             273233..274261
                     /gene="gpsA"
                     /locus_tag="Rmet_0255"
                     /EC_number="1.1.1.94"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase (NAD+)"
                     /protein_id="ABF07141.1"
                     /translation="MKLTILGAGAWGTALASHAATAAADHDVVLWGRDPAQLAGIAAT
                     GVNATYLPGVSLSPRLVCEPDFDRAVDHALTDPEGLLIIGTPVSGLREMTRRLAARRK
                     GPLAMLWLCKGFEAETHAMPHQMVHDELNALGVAPGEIEYGVLTGPSFAKEVAQGLPC
                     ALTVAGTAHVLIDRAQAAFHHHAMRIYGSDDLIGVEVGGAVKNVLAIATGASDGLGLG
                     LNARAALITRGLAEMTRLGLALGGRVETFMGLAGMGDLILTATGDLSRNRKVGQQLAG
                     GKTLDQILADLGHVAEGVRCAQAVAALAARVGVEMPITRAVCAVLFEGLPVADAVSQL
                     LQRDARDE"
     gene            274268..275251
                     /gene="bug"
                     /locus_tag="Rmet_0256"
     CDS             274268..275251
                     /gene="bug"
                     /locus_tag="Rmet_0256"
                     /codon_start=1
                     /transl_table=11
                     /product="Extra-cytoplasmic Solute Receptor"
                     /protein_id="ABF07142.1"
                     /translation="MPSRRHTLKALIATFAAGAVPAVAHADTWPAKPIRMIVPFPPGS
                     SPDLIARIVTEKLATVLGQPVVVENRPGAGGNIGTGMVAKAAPDGYTLLFTINGPLVT
                     APSLYRHLSYDPMKQLAPVTLVATSPNVLVIDARLPVHTLREFVALAKSKPGALNYGS
                     VGNGSAAHLAMEQLKAMAGIDLQHVPYPGFPQITTAIVGGQVQAGFMVPAIAMPMVNA
                     GKLRILAVTTTGRTSLLPSVPTVAESGYPGFEAISWQAILAPAGTPAPVVDRLYRELV
                     RIIGSDDIREKMRTQYFVPAGTAPASLRETMVSEKARWDKVIRAAGVQPEG"
     gene            complement(275265..275735)
                     /gene="yibK"
                     /locus_tag="Rmet_0257"
     CDS             complement(275265..275735)
                     /gene="yibK"
                     /locus_tag="Rmet_0257"
                     /codon_start=1
                     /transl_table=11
                     /product="putative rRNA methylase"
                     /protein_id="ABF07143.1"
                     /translation="MFNVVLVEPEIPPNTGNVIRLCANTGAQLHLVKPLGFPLEDARM
                     RRAGLDYHEYATMRVHESWDALMAAEQPDPTRMFALTTHGSTPFGQVSFAPGDWFVFG
                     SETRGLAPERREWFPSAQRIRLPMRPNNRSLNLSNTVAVVVFEAWRQNGFAGGS"
     gene            complement(275788..276627)
                     /gene="gntX"
                     /locus_tag="Rmet_0258"
     CDS             complement(275788..276627)
                     /gene="gntX"
                     /locus_tag="Rmet_0258"
                     /EC_number="2.4.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative amidophosphoribosyltransferase"
                     /protein_id="ABF07144.1"
                     /translation="MQGHGETERNQWNRRAAQQRVAPRHGPDPDGRPTGTGVYAPSSQ
                     LAGRAGGITGLWSALLPSVCLICAKVQRDVVCAGCADTLLRIVPRCPRCAMPGTIPGV
                     KAGRCDACADDDPIDATLTLGNYITPADRLVLRLKFAARLPAAAWIARQMATRMQAAG
                     IAPDVLAPIPLAPQRLAGRGFNQAWEIARPLGRQLGIAVSATLLTRRRDTVSQRVLDQ
                     SARQANLRDAFVLDPPCRLDGLHIGLVDDVMTTGATLREAARVLKAHGAARVTALPAL
                     RTP"
     gene            276652..277554
                     /locus_tag="Rmet_0259"
     CDS             276652..277554
                     /locus_tag="Rmet_0259"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methyltransferase"
                     /protein_id="ABF07145.1"
                     /translation="MPPARLTRLAFDRRSPSFGQLDFLLGEIGQRMHERMDVVKLTPR
                     RAIDIGCGHGQGLAGLRARFPDAQIAGLDISGAMLQQAGQRDPQRRPGWIGRLLGKRP
                     MFDLVQGDLATLPFGAASFDLLWSNLALHWHPEPHRVFPEWHRVTGDEGLVMFSLFGP
                     DTLKELRAAFADVDLDAHTMRFVDMHDIGDMLVHSGWSTPVMDMETLTVTYESPENLL
                     REVQSFGGFRRPGAVGLRGRRWYRAVLAALERQRNADGVIPLTFEIVYGHAWKLAPRG
                     RQATDDQGRAVVPVDSIGRARPRP"
     gene            277818..278333
                     /locus_tag="Rmet_0260"
     CDS             277818..278333
                     /locus_tag="Rmet_0260"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     transmembrane protein"
                     /protein_id="ABF07146.1"
                     /translation="MQDLGIAFQTAVGDSGGNLDGRTPLPSNDWLMKRNCSLTPRQAG
                     WFYFSIVCFSTAIAVFFAVWLGAWLVLPFAGLELLGLGIALLAYARHAADYERVSVTD
                     GMLVVETASASRITREVFNPRWVRVELGESFRAPVVLRSDKRSVQVGLYLDPYRRRKF
                     AQELAVALQRV"
     gene            278395..279663
                     /gene="coxB"
                     /locus_tag="Rmet_0261"
     CDS             278395..279663
                     /gene="coxB"
                     /locus_tag="Rmet_0261"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase, subunit II"
                     /protein_id="ABF07147.1"
                     /translation="MKMWKKASAACLAGASLLVSQAASAVSDMPGGPAVRQLNLAEPV
                     TKIAEQIHWLNWMMLIICTVIFVAVFGVMFYSIFKHRKSKGARPASFHESITVEVVWT
                     IVPFLIVIAMALPATKTVVAMKDTTNSDITIKATGYQWKWGYDYLKGQGEGISFVSTL
                     TTPREQINNQQEKSNTYLMEVDNELVVPVNKKIRIVTTANDVIHAWMIPAFGVKQDAI
                     PGFVRDTWFRAEKTGVYRGQCAELCGKEHAFMPIVVRVVSDAEYTKWVDDKKKAMAAA
                     ADDPNKVWTLDEIKARGEKVYATNCAVCHQPTGKGGGPFPALDGSKVVNGPKAGQMHV
                     LLEGRNAMPSWKQLSDTELAAVMTYTRNSWGNKTGEVIQPADFTGARTGKFPEGGGAQ
                     AGAGDAAPKAAAPSSTPDKQASLAGNRVAG"
     gene            279706..281316
                     /gene="coxA"
                     /locus_tag="Rmet_0262"
     CDS             279706..281316
                     /gene="coxA"
                     /locus_tag="Rmet_0262"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase, subunit I"
                     /protein_id="ABF07148.1"
                     /translation="MSTATPETLGHPHDHAHDHDHAHDHPHGWRRWLFATNHKDIGTL
                     YLLFSFTMLLSGGVLALLIRLELFEPGLQFFRPELFNQFTTMHGLIMVFGAIMPAFVG
                     FANWMIPLQIGASDMAFARMNNFSFWLMPPAALLLVGSFFAPGGATAAGWTLYAPLSV
                     QMGPGMDMAIFAMHIMGASSIMGSINIIVTILNMRAPGMTLMKMPMFCWTWLITAYLL
                     IAVMPVLAGAITMVLTDRHFGTSFFSAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGI
                     ISHVVPAFARKRLFGYSSMVYATASIAILSFIVWAHHMFTTGMPVTGQLFFMYATMLI
                     AVPTAVKIFNWIATMWRGSMTFETPMLFAIGFIFVFTIGGFTGLMPAVAPIDIQLQDT
                     YFIVAHFHYVLVAGSLFALFAGFYYWGPKWSGFMYDEMRGKIHFWGSLIFFNVTFFPM
                     HFLGLAGMPRRYADYPTQFTDFNAIASIGALGFGLMQVYFFFCVVLPSYRGGQAAGDK
                     PWDGAEGLEWTVPSPAPFHTFEEPPVVK"
     gene            281382..281534
                     /locus_tag="Rmet_6409"
     CDS             281382..281534
                     /locus_tag="Rmet_6409"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; hypothetical
                     transmembrane protein"
                     /protein_id="ADC45027.1"
                     /translation="MLMQPSETSPSPQDRKAAQRAANRRLGWILLSIVVVFFLGFFAK
                     MVFLGG"
     gene            281571..282167
                     /gene="ctaG"
                     /locus_tag="Rmet_0263"
     CDS             281571..282167
                     /gene="ctaG"
                     /locus_tag="Rmet_0263"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase assembly protein"
                     /protein_id="ABF07149.1"
                     /translation="MDGQDKAIEKRFNRGMMLRLLVVVTLMFGFGYALVPLYKAICEV
                     TGINVLTTRDLYGGSALKNSQVDTSRTITVEFDSNARGPFAFRPVKHSMEVHPGELTT
                     IVYEVANGQSRDISAQAIPSYAPKQATEYFKKIECFCFKQQTLKSKEAREMPVVFVID
                     PKLPKDVKTITLSYTFFEVGTPVAQAPQDEQASVQKGS"
     gene            282170..282397
                     /locus_tag="Rmet_0264"
     CDS             282170..282397
                     /locus_tag="Rmet_0264"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; hypothetical
                     membrane associated protein"
                     /protein_id="ABF07150.1"
                     /translation="MTNRDDSVDPVHRKASFAQTVRAVLWSFIGLRKGSEHESDMARL
                     NPVHVIIAGLIAAAVFVTVLILVVRTVVSQS"
     gene            282495..283355
                     /gene="coxC"
                     /locus_tag="Rmet_0265"
     CDS             282495..283355
                     /gene="coxC"
                     /locus_tag="Rmet_0265"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase, subunit III"
                     /protein_id="ABF07151.1"
                     /translation="MSANRANAPYYFVPGPSRHPITAAFGLLMTGAGAAGWVNGQPWA
                     PYLCGFGLLWFLFVLKSWFGDAIRESEGGMYGKNIDTSFRWSMGWFIFSEVMFFAAFF
                     GALFYARTIAMPWLGDLNNKIIWPDFAAVWPNMGPAGTVEDFQTMGPWPIPTINTALL
                     LTSGVTLTWAHHALLAGKRSQLIQGLVLTILLGAIFMCLQAYEYMHAYSELNLKLTSG
                     VYGSTFFLLTGFHGFHVTMGAIMLTVVLIRVLKGHFTPEHHFAFEGAAWYWHFVDVVW
                     LGLYVVVYWL"
     gene            complement(283456..283665)
                     /locus_tag="Rmet_0266"
     CDS             complement(283456..283665)
                     /locus_tag="Rmet_0266"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     transmembrane protein"
                     /protein_id="ABF07152.1"
                     /translation="MRFVILVAFILIIGSLASALFFMMRDRGRTPNMMRSLMFRVGFS
                     VALFLFILFSHWMGWIQSTGIHTSP"
     gene            283666..284484
                     /locus_tag="Rmet_0267"
     CDS             283666..284484
                     /locus_tag="Rmet_0267"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative transmembrane cytochrome oxidase"
                     /protein_id="ABF07153.1"
                     /translation="MGARSAKRPLSHCDARREPVTTRTLWRSPGTVPMVAALVVIVVT
                     CALGNWQLRRAHEKIDRAERLATLAKQAPVELRAGQTDAAQLVERRVRARGTFDADKT
                     VLLDNRPHGNGTDSRAGFLVLTPLRLTDGGSVLVMRGWLPRDAQDRTRIAPFPTPTGE
                     VTVEGTALAAVPRVYSLGQDASAEAGRKIRQNIDLAAFSHEIGASLLPVVVEQSGDAG
                     DGLARDWAPADFGADRHYGYATQWFGLAVLTLVLVAVLGWRRARLDRADGNGNL"
     gene            284471..285148
                     /locus_tag="Rmet_0268"
     CDS             284471..285148
                     /locus_tag="Rmet_0268"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     transmembrane protein"
                     /protein_id="ABF07154.1"
                     /translation="METYKRTMNAQTNAMPQPDPTASPDPRIDARTRRGRLQMLMLLL
                     VCASPVLFSYFTYYVIKPTGGSTNYGVLIDPQRPMPPVQVTNERNESVPLASMRGKWL
                     MVMTDPSACDETCAKKLFTVRQIRVGQGEDRERIVPVWLIQDRGDVDDRLAAAYNEPY
                     AGVRFLRMDRATIAQWLPAEDGARVEDAIYLVDPLGNLMMRWPKDPDPKKISSDLKKL
                     LKYSRIG"
     gene            285154..286257
                     /gene="ctaA"
                     /locus_tag="Rmet_0269"
     CDS             285154..286257
                     /gene="ctaA"
                     /locus_tag="Rmet_0269"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase assembly"
                     /protein_id="ABF07155.1"
                     /translation="MLLQLAIIGILIALLPLSYVMVRGDRDKYRRLVWITAFLTLDLI
                     MFGSFTRLTDSGLGCPDWPGCYGHSNPHAAMEPIRAAETALPSGPVTLMKAWIEMIHR
                     YFAMAVGVLIISLMVLAWVKRRELKQSPWFATGVFLLVCLQGAFGMWTVTMKLQPIIV
                     VTHLLLAMALLASLILLGSRNEPPHVVAPQAASLRWAGLLALVLLVVQIFLGGWVSTN
                     YAVLACTDFPLCNGQLVPEMDFRHGFTLWRQLGMTADGDYIPHAALVAIHWVHRGFAF
                     VVLGFLLWFALRARRMEGLARHARWLLVVLTLQLCTGMSNIVFDWPLVAAVAHNGGAA
                     LLLMLLLRLNYNIGLATRSAGAATQPSIAARAT"
     gene            286254..287192
                     /gene="ctaB"
                     /locus_tag="Rmet_0270"
     CDS             286254..287192
                     /gene="ctaB"
                     /locus_tag="Rmet_0270"
                     /EC_number="2.5.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Protoheme IX farnesyltransferase (heme O
                     synthase)"
                     /protein_id="ABF07156.1"
                     /translation="MKDKMPPVVTATHSQSSVGRLRHLARQYAALTKPRVTQLAVFCA
                     IIGMFLATPGMVPWSVLIGGAAGIWLLAGAAFAINCLVEQKIDALMRRTAWRPSATGE
                     ITTTQTLIFSAVLGGAGMWLLHVFANDLTMWLTFATFLGYAVVYTILLKPATPQNIVI
                     GGLSGAMPPALGWSAVSGTVPAEAWFLVLIIFTWTPPHFWALALYRRADYAKSGLPML
                     PITHGERYTLLHILLYTLIMIAATLLPFVYGMSGYIYLVAALGLGLVFLGYAWKLYRN
                     YSDGLAQRTFRYSILYLSLLFAVLLVDHYFKFVPQV"
     gene            287277..287891
                     /gene="sco2"
                     /locus_tag="Rmet_0271"
     CDS             287277..287891
                     /gene="sco2"
                     /locus_tag="Rmet_0271"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome oxidase assembly protein, Sco1/SenC
                     family"
                     /protein_id="ABF07157.1"
                     /translation="MSTSSQGLWAAFRRFWLLALCTALLAACGQPKPSFRNVDISGAT
                     EFGKDFALLDPTGKTRTLADFKGKVVLMFFGYTHCPDVCPTTMVELKQVMEQMGPDAD
                     KVQVLFVTVDPDRDTAALMAQYVPAFDSRFLGLRPADEAALKKVTKDFKVYYAKVPGS
                     SPDNYTMDHSAGSYVFDQNGQLRLFIRHGQGPEPIAHDLKQLMS"
     gene            complement(287945..288880)
                     /gene="rpoH"
                     /locus_tag="Rmet_0272"
     CDS             complement(287945..288880)
                     /gene="rpoH"
                     /locus_tag="Rmet_0272"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma 32 (sigma H) factor"
                     /protein_id="ABF07158.1"
                     /translation="MNAVLSADQTQVTRRLPTAPQNAAANAFALTFPGTLGNLDSYIQ
                     AVHRIPMLTPEEELSLARDLRDNDSVDAARRMVMSHLRLVVSIARQYLGYGLPHADLI
                     QEGNIGLMKAVKRFDPEQGVRLVSYAMHWIKAEIHEYVLKNWRMVKVATTKAQRKLFF
                     NLRSHKQGSHTFTPEQIEAVARELNVKPEEVMEMETRMSGGDMALEGQIEDGEEEFAP
                     IAYLADNHNEPTQVLEAKRHDRLQVEGLEEALTKLDPRSRRIIEARWLDVNDDGSGGA
                     TLHELADEFGVSAERIRQIESAAMKKMKGALAAFA"
     gene            289212..290087
                     /locus_tag="Rmet_0273"
     CDS             289212..290087
                     /locus_tag="Rmet_0273"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; Putative
                     pirin-related protein"
                     /protein_id="ABF07159.1"
                     /translation="MSAIEHLLKPHVRDIGEFTVRRLLPAATTQTVGPFIFFDHMGPV
                     EMEPGAGMDVRPHPHIGLATVTYLFEGEIMHRDSLGSEQVIRPGDVNWMTAGRGITHS
                     ERSPDGARSAGPHLHGIQTWVALPKAHENDPPSFHHHPGATLPKLELPGVRMTVIAGD
                     AFGAESPVRVYSRTLYVAIEMDAGASLVIPAEHVQRGIYPVDGNLEVDGETLPAEHLV
                     VLVPGEPVTIKATMPSRVMLLGGDPTDGRRFIYWNFVASSKEAIEEAAQRWQDDQFPH
                     VPGETERIPLPPRRP"
     gene            complement(290128..291117)
                     /locus_tag="Rmet_0274"
     CDS             complement(290128..291117)
                     /locus_tag="Rmet_0274"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transferase/phosphorylase"
                     /protein_id="ABF07160.1"
                     /translation="MTSASRAPFPAAKYIKEIGRGVNGARALPREDAQALFDAMLAGR
                     VSDLELGAVLLAYRIKGEAPHELAGMLDAAHDHCAPLAAPADKPVVVIPSYNGARKQP
                     NLVPLLAMLLARDGVPTLVHGIREFPGRVTSMALFEALGVPLCATAQSAETQLGAASN
                     PLAALPIDVLSPALSQLLDKRAIIGLRNSAHTVVKMLQPVGGHSPAEALRLYSYTHPE
                     YRETLTEYFSHEPANVMLARGTEGEVVADARRSSRIDWLHDGHQRTMVDPVGGSVADV
                     PELPQGTDIAETAAWIRKVLDGAEPVPAPVATQVAAIKECLAQATRVTWASPL"
     gene            complement(291216..292019)
                     /gene="nasD"
                     /locus_tag="Rmet_0275"
     CDS             complement(291216..292019)
                     /gene="nasD"
                     /locus_tag="Rmet_0275"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate ATP-binding ABC transporter protein"
                     /protein_id="ABF07161.1"
                     /translation="MEKFVSIENVGQTFKTRKGPFVALRDIDLSIAEGEFVTLIGHSG
                     CGKSTLLNLIAGLTAPTTGALICAGREIAGPGPERAVVFQNHSLLPWMTCFENVHLGV
                     ERVFGQSETPAQLKARTHDTLALVGLTHAESKYPHEISGGMKQRVGIARALAMQPKVL
                     LMDEPFGALDALTRAHLQDALLKIVARTRSTVVMVTHDVDEAVLLADRIVMMTNGPAA
                     TIGEILRVDIPRPRDRVTLADDKTFHACRTAVLDFLYRKQRNPALEEAA"
     gene            complement(292036..292947)
                     /gene="nasE"
                     /locus_tag="Rmet_0276"
     CDS             complement(292036..292947)
                     /gene="nasE"
                     /locus_tag="Rmet_0276"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transporter, permease component: NitT
                     family"
                     /protein_id="ABF07162.1"
                     /translation="MNALAQSSPEGATPMNPEAVDPDAKEQSRRRAQEIAALEQRAAR
                     RDALAAFVLKCVPPLIGFALFVLVWHGIATLIPSIPTPGATWNAAVPLFADPFYRNGP
                     NDQGIGWNVLASLARVAAGFGLAAVVGIPAGFLLGRFAFLNAMASPVISLLRPVSPLA
                     WLPIGLLLFKAANPAAIWAIFICSIWPMIINTAVGVTRVPQDYLNVARVLDLSEWKIF
                     RHVLFPAVLPYMLTGVRLSIGTAWLVIVAAEMLTGGTGIGFWLWDEWNNLKVEHIVIA
                     IFIIGVVGLVLEHLLLALARRFSYGNT"
     gene            complement(293016..294320)
                     /gene="nasF"
                     /locus_tag="Rmet_0277"
     CDS             complement(293016..294320)
                     /gene="nasF"
                     /locus_tag="Rmet_0277"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transporter, periplasmic component:
                     NitT family"
                     /protein_id="ABF07163.1"
                     /translation="MPSRLKVLKPQRANDTAAADAAPACHGRRRALATIAGASVMTLV
                     DPLVRSGAWAAGSDAPEKPEVRIGFIPLTDCASVVMASTLGLDKKYGIKITPSKEASW
                     AGVRDKLVNGELDAAHVLYGLIYGVQLGIGGPKKDMAVLMNLNHNGQAITLSSKLAEK
                     GVKDGASLKALMSREKRDYVFAQTFPTGTHAMWLYYWLAANGIDPMRDAKAITVPPPQ
                     MVANMRVGNMDGFCVGEPWGARAIADKIGFTAETTQAIWKDHPEKTLGTTAEFVQKYP
                     NTARAMVAAVLDASKFIDASASNRRKTAETIAAKSYVNTDMDIILDRMLGRYSNGLGK
                     TWDDPDSMKFYQDGLANYPFLSDGMWFLTQHKRWGLLKEHPDYLAVAKQVNRIDIYKQ
                     AAVAAQVPLPKSDFRTARLIDGVTWDATKDPKAYADGFKIKA"
     gene            complement(294684..295343)
                     /locus_tag="Rmet_0278"
     CDS             complement(294684..295343)
                     /locus_tag="Rmet_0278"
                     /codon_start=1
                     /transl_table=11
                     /product="probable response regulator (CheY-like) and
                     ANTAR domain protein"
                     /protein_id="ABF07164.1"
                     /translation="MHRNQAPSMTRRHPPPSAVAPPATTSRSLRILLVRDPHEADPLN
                     VETIRAGLAQAGFTEVQTVDADLRLPDTITASQPDLVIIASESAARDTIEHVCVSTQH
                     APRPIVLFTDNDDAQRIKAALSAGITAYIVDGLRAERVKTVLDVAYARFQLDQQLRAE
                     LDATKLKLAERKTVERAKGLLMQARGISEDEAFKRLRSMAMERGIRLVDAAQRVIDVM
                     A"
     gene            295395..296195
                     /locus_tag="Rmet_0279"
     CDS             295395..296195
                     /locus_tag="Rmet_0279"
                     /codon_start=1
                     /transl_table=11
                     /product="probable 2-keto-4-pentenoate hydratase /
                     2-oxohepta-3-ene-1,7-dioic acid hydratase (Catechol
                     pathway) oxidoreductase protein"
                     /protein_id="ABF07165.1"
                     /translation="MYPLPLPRPTRLGTTGHDTGCGVPSKKRKLESWMTEFVFAPQAP
                     VGVPVRGGSASFPVRRVYCVGRNYAAHAREMGSDPDREPPFFFCKPSDAVSYVADKTE
                     GAFPYPPGTGNCHYEVELVVAIGKGGRDIPVEQAASHVFGYAIGLDMTRRDLQNESKK
                     TGRPWETGKAFDKSAPIGPIVPVSAIGHPAKGAVTLAVNGVEKQRGDLSDLIWSVPEM
                     VSYLSKLFELQPGDLIYSGTPEGVGPVVKGDVMQCHIEGVGDLTVKVV"
     gene            296200..296847
                     /gene="maiA"
                     /locus_tag="Rmet_0280"
     CDS             296200..296847
                     /gene="maiA"
                     /locus_tag="Rmet_0280"
                     /EC_number="5.2.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="maleylacetoacetate isomerase"
                     /protein_id="ABF07166.1"
                     /translation="MLELHSYFRSSASFRVRIALNLKGLPYDYKGVHLLKEGGMQLKP
                     EYRALNADGVVPTLVVDGRPLIQSMAIIEYLDETHPEPALLPKDPFERAVVRGLAQEI
                     ACEIHPLNNLRVLKYLKHELKVSEEAKDAWYRHWIEQGFASLEVNLSQLGRVGRFAFG
                     DTPTLIDCCLVPQVFNAQRFNVDVSRFPTIAKIHATCMELDAFQKAAPGAQPDSE"
     gene            complement(296919..297941)
                     /gene="ftsY"
                     /locus_tag="Rmet_0281"
     CDS             complement(296919..297941)
                     /gene="ftsY"
                     /locus_tag="Rmet_0281"
                     /codon_start=1
                     /transl_table=11
                     /product="probable cell division protein; signal
                     recognition particle receptor FtsY"
                     /protein_id="ABF07167.1"
                     /translation="MAPPVAPPVVPPVASAPPPASYTPPVIEELELTPPPAQTAEAKR
                     GWMSRLRAGLSKTSRNIGVLFVGVKVDEALFEELETALLMADAGVEATEYLLGELRRR
                     IKNDRIETAEGVKAALKDLLTQLLKPLEKTMELGREQPLVMMIAGVNGAGKTTSIGKL
                     CKHFQSYHQSVLLAAGDTFRAAAREQLTIWGERNNVTVVAQESGDPAAVIFDAVNAAR
                     ARKIDIVMADTAGRLPTQLHLMEELKKVKRVIGKSMPTAPHEVLLVIDANTGQNALAQ
                     TRAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFKADEF
                     AEALLG"
     gene            297880..298245
                     /locus_tag="Rmet_6410"
     CDS             297880..298245
                     /locus_tag="Rmet_6410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADC45028.1"
                     /translation="MAGGGADATGGTTGGATGGATWTGDGAGVGTGAGVEAGAETGVA
                     TGAATGGATGVTAGAAAGAGAGSGAGAGAGAGVGAAAGGSTDSGAGSALRFFQKLNIG
                     KGVNTPVESIGKILADGVA"
     gene            298242..299756
                     /locus_tag="Rmet_0282"
     CDS             298242..299756
                     /locus_tag="Rmet_0282"
                     /EC_number="3.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase M16-like protein (Zn-dependent
                     peptidase)"
                     /protein_id="ABF07168.1"
                     /translation="MNHCADVSGAGVAKFPRRILSSLILASLIGPLAGTAWSQTPGEA
                     PTTATSASPRQGPPPTQPTATVGQAQAGTTEFRLSNGLRVIVKEDHRAPTVAHMIFYR
                     VGGFDEVSGTTGVAHMLEHMMFKGTPKVPVGEFSRQIALLGGRENALTNRDFTLYYQQ
                     ISKQYLPKMMELEADRMANLIFKKEEFEREMKVVMEERRLRTDDSPRGTVYEQLLATV
                     YTAMPYRHPVIGWMDDLVNMRVEDVHDWYKTWYVPNNAMVIVTGDVKPDEVRALAERY
                     YGKLKPHPLPLRKTQIEAPQKGIKRIWVKAPAENPYMVMAYKVPRLRDVEKDVDPYAL
                     EVLSAVLNGYDNARLTRELVRERRLADDVNVGYDSINRADSLFVLDGTPANGHTTEEI
                     EAALREEIQRIAKNGVSEEELKRVKAQVVAGQIYKRDSVFGQGMEIGVSEISEISWRQ
                     IDRMLDKIKEVTPAQVQAVAAKYFSDDNLTVATLLPQPIDPNKPKTPVPEGLRH"
     gene            299765..301129
                     /locus_tag="Rmet_0283"
     CDS             299765..301129
                     /locus_tag="Rmet_0283"
                     /EC_number="3.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase M16-like protein (Probable peptidase
                     signal peptide protein)"
                     /protein_id="ABF07169.1"
                     /translation="MSLSVMTIASPRLLRRLAGAAFGAAALLAGAVAHAAIPIESWTA
                     STGAKVFFVPSPSIPMLDVNIDFDAGSRYDPPGKAGLATLTAALLDKGASAQDGQPAR
                     NEAQIADAFADTGADFGGAAGGDRGGIGLRTLTASPEREQSLRLAAQLIKSPTYPDAV
                     VAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSATAETVGSITHDDLVKFW
                     QDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRIPH
                     PAQQASVALGQPAIARGDPDYFPLLVGNYVLGGGGFSSRLTDQVREKRGLTYGVDSYF
                     SPSKQPGPFSVSLQTKKENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVNGFPLR
                     IDSNRKLLTNVANIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHPDAMATVIVG
                     GPEK"
     gene            301238..301870
                     /locus_tag="Rmet_0284"
     CDS             301238..301870
                     /locus_tag="Rmet_0284"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methyltransferase"
                     /protein_id="ABF07170.1"
                     /translation="MNSQSRPSPAPRGRTSVPRKSPTQVRIIGGRWKRSLLPVLEAEG
                     LRPTPDRVRETLFNWLGQDLSGLTCLDLFAGSGALGFEAASRGASAVTLVEANPHVVR
                     QLRDNQYRLDASQVKIIQSDAFAAAAQMPAASFDVVFLDPPFAEDWLGPALEHAARLS
                     RPGGAIYVETDRALIGPDAPIPASLEIVRQARAGAVHFHLLQHRLANGAG"
     gene            302082..302567
                     /gene="coaD"
                     /locus_tag="Rmet_0285"
     CDS             302082..302567
                     /gene="coaD"
                     /locus_tag="Rmet_0285"
                     /EC_number="2.7.7.3"
                     /codon_start=1
                     /transl_table=11
                     /product="pantetheine-phosphate adenylyltransferase"
                     /protein_id="ABF07171.1"
                     /translation="MVVAVYPGTFDPMTRGHEDLVRRASNIFDELVVGVAHSPNKRPF
                     FSLEERIGIAREVLGHYPNVRVEGFSGLLKDFVRKNNARVIVRGLRAVSDFEYEFQMA
                     GMNRYLLPDVETMFLTPSDQYQFISGTFVREIAVLGGDVSKFVFPSVERWLQEKIGKA
                     E"
     gene            302634..302894
                     /gene="fdx"
                     /locus_tag="Rmet_0286"
     CDS             302634..302894
                     /gene="fdx"
                     /locus_tag="Rmet_0286"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin (4Fe-4S cluster-containing protein)
                     (fdx-like)"
                     /protein_id="ABF07172.1"
                     /translation="MALMITDDCINCDVCEPECPNEAISMGPEIYEIDPGKCTECVGH
                     FDEPQCQQVCPVACIPKDPNHVETHEVLMQRYRLLTAAKHVA"
     gene            complement(303018..303614)
                     /gene="pth"
                     /locus_tag="Rmet_0287"
     CDS             complement(303018..303614)
                     /gene="pth"
                     /locus_tag="Rmet_0287"
                     /EC_number="3.1.1.29"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="ABF07173.1"
                     /translation="MIKLIVGLGNPGAEYEATRHNAGFWLVDQLARMGGTTLRVESRF
                     HGLAGRARLWDQDVWLLKPSTFMNRSGLSVVSLARFYKILPDEIVVAHDEMDLPAGSA
                     KLKRGGGSGGHNGLKDISAHLTTQDYWRLRIGVGHPRNAPGGAAGGREDVVNFVLKPP
                     RKEEQQAIDEAIDRCIGPLGTLARGESERAMMELHTGR"
     gene            complement(303789..304400)
                     /gene="rplY"
                     /locus_tag="Rmet_0288"
     CDS             complement(303789..304400)
                     /gene="rplY"
                     /locus_tag="Rmet_0288"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L25 (General stress
                     protein CTC)"
                     /protein_id="ABF07174.1"
                     /translation="MKVVAFERSVQGTGASRRLRNSGKTPGIIYGGAAEPKMIELDHN
                     ALWHALKKEAFHSSILDLEVAGKSEKALLRAFQMHPFKPLVLHVDFQRVSATEKIHVK
                     VPLHFMNQETAPGVKLGHGIVSHILNDLEVSCLPADLPEFIEVDLAAAELNQTIHLSD
                     LKLPKGVTAITHGDENPAIASITLPAGAQSSEAAEGGEETPAA"
     gene            complement(304571..305524)
                     /gene="prs"
                     /locus_tag="Rmet_0289"
     CDS             complement(304571..305524)
                     /gene="prs"
                     /locus_tag="Rmet_0289"
                     /EC_number="2.7.6.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribose-phosphate pyrophosphokinase (RPPK)
                     (Phosphoribosyl pyrophosphate synthetase) (P-Rib-PP
                     synthetase) (PRPP synthetase)"
                     /protein_id="ABF07175.1"
                     /translation="MSVEGLMVFTGNANPKLAEAVVQHLGIPLGKALVGRFSDGEVQV
                     EIQENVRGKHVIVLQSTCAPTNDNLMELMVMVDALKRASARSITAAMPYFGYARQDRR
                     PRSARVAISAKIVANMLEVAGVERVLTMDLHADQIQGFFDIPVDNIYASPVLLGDLRE
                     KNYGNLLVVSPDVGGVVRARALAKQLDCDLAIIDKRRPKANVSEVMNIIGEVAGRNCV
                     IMDDMIDTGGTLCKAAQVLKERGAQKVFAYCTHPVLSGGAVARIAASALDEVVVCDTI
                     PLSDEARQTGKIRQVTTAPLLAETFTRIVRGDSIMSLFADA"
     gene            complement(305620..305696)
                     /locus_tag="Rmet_R0003"
     tRNA            complement(305620..305696)
                     /locus_tag="Rmet_R0003"
                     /product="tRNA-Gln"
     gene            complement(305764..306642)
                     /gene="ispE"
                     /locus_tag="Rmet_0290"
     CDS             complement(305764..306642)
                     /gene="ispE"
                     /locus_tag="Rmet_0290"
                     /EC_number="2.7.1.148"
                     /codon_start=1
                     /transl_table=11
                     /product="4-diphosphocytidyl-2-C-methylerythritol kinase"
                     /protein_id="ABF07176.1"
                     /translation="MTVGTALPPPELRNCPAPAKLNLFLHVTGRRPDGYHTLQTVFQL
                     IDWSDTLHFHRRDDGVITRVTDIPGVPADTDLVVRAARAMQAASGTRFGVDIAIDKIL
                     PMGGGIGGGSSDAATTLLALNRLWGVNLPREELMRIGLSLGADVPVFVFGQNAFAEGV
                     GEELTPVALPDSWFVVIHPRQHVPTAAIFSDERLTRNSPISIVADFAACTNKFAFGRN
                     DLETIATAKFGEVARALEWLKNYSPHARMTGSGACVFARFEDEQTAQRVMERLPSEWD
                     GRCVKSLSHHPLATFA"
     gene            complement(306639..307253)
                     /gene="lolB"
                     /locus_tag="Rmet_0291"
     CDS             complement(306639..307253)
                     /gene="lolB"
                     /locus_tag="Rmet_0291"
                     /codon_start=1
                     /transl_table=11
                     /product="outer-membrane lipoprotein lolB precursor
                     (involved in outer membrane biogenesis)"
                     /protein_id="ABF07177.1"
                     /translation="MLRSRRLALLCLATPLWLAACASVTPTRGFDASETAASQLYTGR
                     FSANYVRYGRNEGVQGSFRWQEQGRNVRLDLVSPLGQTLAIVTATPSGATLDLPNEAP
                     RNAPEVDSLMEQALGFSLPVSGMRDWLHGRAAPGTPSNVTRDANGRPDTLRQSGWTVR
                     YLAWQDTPENATPTTTLPRRIDMARDGNESPLSVRLVIDPENKE"
     gene            complement(307339..309246)
                     /locus_tag="Rmet_0292"
     CDS             complement(307339..309246)
                     /locus_tag="Rmet_0292"
                     /codon_start=1
                     /transl_table=11
                     /product="Tetratricopeptide TPR_2 repeat protein"
                     /protein_id="ABF07178.1"
                     /translation="MQDHLSSFQAMRPESSQMKAFTVTGPTISPAGRFRRHARALGVA
                     ACLALVSLASHAASAKVAQNDDEVIDVPAPSSAARAQRTPLPNVSLSPDILYRVLAAE
                     ISLQRGMAGASYRTYLDLARETRDPRLAQRATEIAFNARSSQQALDGARLWSELAPKS
                     PAASQVLATLLVLNGRWEEAEPLLSRQLATAPAAHRGDAILQLQQQMSRTSDPAGAVA
                     VLQRLTANDSKLPETHLALARAQEIAGNSQGALTELDEALRLKPNLEAAALMSAEMQA
                     ESAPDKSIAVMKRFLAKSPSSVNGHITLARLYLQQNDMDSARAEFEVLRKVAPTDPRV
                     PLALGLTSLQARSYDDAERYLKEYLQMAEKSPAANPDIAYQYLAQIAEEKKDYPAAID
                     WLDRIEDPRLTLAAQAKRGQLLARMGKLDDAQAVFGDMLADAEDIPDPAQRALRMSAI
                     RQAEVAALMDSKAYDRARKVLDERVKAEPDNADWIYELAMLDEREKRYDSMERGLLKV
                     IALQPDQKQGYNALGYSLADRNERLPEARKLLERASELGPDDPYIMDSLAWVKYRQGE
                     LQPAADLLKNAFAKAPEAEIGAHLGEVLWQLGQRDEARKTWNEAAKVEPDNQTLIDTL
                     RRYNQNVLLSK"
     gene            309517..310410
                     /gene="mutM"
                     /locus_tag="Rmet_0293"
     CDS             309517..310410
                     /gene="mutM"
                     /locus_tag="Rmet_0293"
                     /EC_number="3.2.2.23"
                     /codon_start=1
                     /transl_table=11
                     /product="formamidopyrimidine/5-formyluracil/
                     5-hydroxymethyluracil DNA glycosylase"
                     /protein_id="ABF07179.1"
                     /translation="MPELPEVEVTRRGLLPHVVGRRIADVIVRHRGLRWPVEPELEAR
                     LTGRIIGRIERRGKYLLLECLPPADATRAGTGEDAAPGWLLVHLGMTGTLRVYPAPPA
                     PGAHDHLDLLLAAGPDTAEAEPVVLRFRDPRRFGAILWTPLAESDLPGHPLLSRLGIE
                     PFDPRFDGAWLHRGMRGRSMAIKQALLAGDVVVGVGNIYCSESLFRAGIRPTTQAGRL
                     SLARCEKLAVAVRETLAEAIARGGSTLRDFVGSDGSSGYFQLDCFVYDRAGEPCRICG
                     TPIRQILQGQRSTFYCPHCQH"
     gene            310668..312686
                     /locus_tag="Rmet_0294"
     CDS             310668..312686
                     /locus_tag="Rmet_0294"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative GTPase"
                     /protein_id="ABF07180.1"
                     /translation="MEPSRGQLCNTSPKPINPSRKANHSMTSLAQQFEQYGAWRTGVL
                     HSLADFQSWLQQYDLYDATAEDRVQRIQNVLRSDRLKVAFIAEFSRGKSELINAIFFA
                     DYGRRILPSSAGRTTMCPTELRYDENEAPCIRLLPIETRLQDASTADFMEPGSANSHW
                     TTVPLDPSSPEGMLAAFQHVVETTRVSPAEAEALGLYNENDPDAAWAVDADGMVEISR
                     WRHAVINFPHPLLRQGLVILDTPGLNAIGTEPELTLRLIPDAHVVVFVLAADAGVTKS
                     DLDLWRSHVGAGHRRGCLAVLNKIDGLWDPLKSSSEIASEISRQVRTTAQTLGIEERR
                     VYPVSAQKGLVAKVTNDEPMLVRSNLMQFEHVLSDQLIPQRREIVADQVQRLVQEMSR
                     GAQQLLQSRRRDIVEQLFELRGLRGKNHAMVKHMLMRVQSEKEEFEQSIAKFQALRLV
                     FGRHSADIIKSLQLRDVRRTMRDAREQMKERFFSRGLREDMEALFGQLTGLITDADQK
                     IVGLHQLVESMYRRFNAEHGFTLPSPMQFVTSRYTNELQETLQLVNTHFGAVHMLTRS
                     RPQLVQNAFATMASRVLENFRDLNRDIEIWLKSVMTPLEAQVREHQKQLRRRVDSIER
                     IHEATDTLESRIAELEEVLNGLDERSTKIESFARRLVDAPPEATARAA"
     gene            312751..313968
                     /gene="mutY"
                     /locus_tag="Rmet_0295"
     CDS             312751..313968
                     /gene="mutY"
                     /locus_tag="Rmet_0295"
                     /EC_number="3.2.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="A/G-specific adenine DNA glycosylase"
                     /protein_id="ABF07181.1"
                     /translation="MQPPMYHVAPPVSGAFSFQDPAMPRKPAAAPAMPETIAVPSDFG
                     MRVVTWQRQHGRHDLPWQNTRDPYRIWLSEIMLQQTQVAAVIEYFQRFVTALPTVAAL
                     AAASADEVMALWAGLGYYSRARNLHRCAKTVVDEHAGVFPTDPEVLVTLPGIGRSTAA
                     AIAAFSAGVRSPILDGNVKRVFARVFGIHGYPGERAIENRMWALAEQALPPAGRHQAD
                     HMVAYTQGLMDLGATICSRGKPACLADAEACPLVADCLARKDNLTAVLPTPKPRAAIP
                     ERSTVMLIVRHGRDVLVQLRPSRGIWGGLWSLPEMPVDTVPFDSEAAEESALELARAY
                     GLPARAYLAGELTHVFTHFRLLIRAIRVDLDTVALEGDAASRWLSLDDLDMLGTPAPV
                     RKLLEDQARLGLF"
     gene            complement(313990..314643)
                     /locus_tag="Rmet_0296"
     CDS             complement(313990..314643)
                     /locus_tag="Rmet_0296"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase S16, lon-like protein"
                     /protein_id="ABF07182.1"
                     /translation="MSTFLSGTASDSATLDALPLFPLHTVLFPDGRLPLRVFEKRYVD
                     MVRNCMRDHLPFGVCLIATGEEVAQPGQTTEPESIGCLAEIVDCNVEQLGVLLIETRG
                     RQRFRVLSHATRDDGLLVANVELLPPDVIDCKLELLGECLAALRRIVTSLHTDQPDKP
                     KLPFGEPYLWDDPSWVVNRLCELLPVPLKAKQMLMELPDAGVRIEIVHRYMRQHHIV"
     gene            complement(314690..315580)
                     /locus_tag="Rmet_0297"
     CDS             complement(314690..315580)
                     /locus_tag="Rmet_0297"
                     /EC_number="2.7.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="probable nucleoside triphosphate hydrolase
                     domain protein"
                     /protein_id="ABF07183.1"
                     /translation="MRIILITGISGSGKSVALNVLEDAGYYCVDNLPAQFIPDLACYL
                     ADQGYSQLGVATDIRSRESLARLPDTVRELAANHQVQVLYLTASTDALVQRYSETRRR
                     HPLSAQVDVGAAAGTPNDTSLIEAIEKERELLSPLAESAHRIDTSNVRTNTLRSWIKE
                     LIQDENENKNSQQLTLLFESFGFKHGVPSDADLVFDVRSLPNPYYDLALRPLTGRDAP
                     VIDFLQSQPMVLAMAEDIRAYVEKWLPSFIADNRSYLTVTIGCTGGQHRSVFIAERLA
                     NYFRAHGNVLVRHRELAPAG"
     gene            complement(315695..316066)
                     /locus_tag="Rmet_0298"
     CDS             complement(315695..316066)
                     /locus_tag="Rmet_0298"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; signal peptide
                     protein; putative exported protein"
                     /protein_id="ABF07184.1"
                     /translation="MMCFHSQERSMKKLIAMCVLVTPLFATGAFAQGASAPAAEKSGK
                     APTAQQEKMSACSKQNKGKKGDDYKKSMSDCLSGSAAATAPAAPKTQQEKMSACSKEN
                     KGKKGDDYKKSMSDCLSKPAA"
     gene            complement(316242..317213)
                     /gene="hprK"
                     /locus_tag="Rmet_0299"
     CDS             complement(316242..317213)
                     /gene="hprK"
                     /locus_tag="Rmet_0299"
                     /EC_number="2.7.11.-"
                     /EC_number="2.7.4.-"
                     /codon_start=1
                     /transl_table=11
                     /product="HPr kinase/phosphorylase (HPrK/P) (HPr(Ser)
                     kinase/phosphorylase)"
                     /protein_id="ABF07185.1"
                     /translation="MELTGVTSQSIFDDNAADIKLSWVAGLEGADRAFDVEFAREATS
                     AADLVGHLNLIHPNRIQVLGKPEILYYQRLDDEPRKRQMGELILLEPPFLVVADGMEP
                     PPDLELRCTRSSTPLFTTPVSSAAVIDHLRLYLSRISAPRVTMHGVFLDILGMGVLIM
                     GESGLGKSELGLELISRGHGLVADDAVDFVRLGPDFIEGRCPPLLQNLLEVRGLGLLD
                     IKTIFGETAVRRKMKLKLVVQLVRRNDGEFERLPLDSQYLDVLGLPIHMVKIQVAAGR
                     NLAVLVEAAVRNTILRLRGIDTLRDFMDRQRAAMQADVVSRGQGRLL"
     gene            complement(317282..317776)
                     /gene="ptsN"
                     /locus_tag="Rmet_0300"
     CDS             complement(317282..317776)
                     /gene="ptsN"
                     /locus_tag="Rmet_0300"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS IIA-like nitrogen-regulatory protein"
                     /protein_id="ABF07186.1"
                     /translation="MRRLAFLTPRASPMNRLAKLLPPGNINLDVTVTSKKRVFEQAGL
                     LFENNHGVARATVTDNLFARESLGSTGLGAGVAIPHGRIKGLKQPLAAFMRLAEPIPF
                     ESPDGKPVSLLIFLLVPEQATQQHLEILSEIAQLLSDREMREGLATLPTPEAVHELLT
                     QWHP"
     gene            complement(317851..318141)
                     /locus_tag="Rmet_0301"
     CDS             complement(317851..318141)
                     /locus_tag="Rmet_0301"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein"
                     /protein_id="ABF07187.1"
                     /translation="MMGARRTRRWRTRYPSTSPATFGQPGVFATDAARCMLRHTTTTD
                     RTAPDNRPGIPRGKRSRDGGWQFSGWAIRPASSRHHSRRRRRSAQVRSGPAL"
     gene            complement(318214..318567)
                     /gene="rpoX"
                     /locus_tag="Rmet_0302"
     CDS             complement(318214..318567)
                     /gene="rpoX"
                     /locus_tag="Rmet_0302"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma 54 modulation protein,
                     ribosome-associated"
                     /protein_id="ABF07188.1"
                     /translation="MNFKISGHHLDITPPLREYVETKLERIVRHFDQVIGVSVLLSVD
                     NHKEKDKRQYAEINLHLKGKDIFVEAHHEDLYAAIDCLVDKLDRQVIRYKDRVQGHDR
                     EAVKYQMAAEQLQQQ"
     gene            complement(318618..320096)
                     /gene="rpoN"
                     /locus_tag="Rmet_0303"
     CDS             complement(318618..320096)
                     /gene="rpoN"
                     /locus_tag="Rmet_0303"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma 54 (sigma N) factor"
                     /protein_id="ABF07189.1"
                     /translation="MKPSLQLRLSQHLALTPQLQQSIRLLQLSTLELQQEVEQALTEN
                     PLLERENDWIESPLRVAADGSVNVQSAPAPASSEPQGNGDDRANGANGEDDSYGDSAG
                     DDYGSDWSLDDFARRPQGDDDEKTPMQLREAEPTLREYLMEQLTPLKISTRDKGLAIF
                     LIESLDDDGYLGATLDEICSELPKELEFEVDEVQAILTLLQSFDPPGVGARNAAECLT
                     LQLRRLQHPQRDLALSIVNHHLELLAVRDYTRLKKALQVDEIALKAAHDLIRSLAPYP
                     GHAYSRPEADFVVPDVFVRKSGSSWIAQLNPDVMPRLRINDMYAQILRGAKGEAGAAG
                     LQQKLQEARWLIKNIQQRFDTILRVAQAIVERQRNFFSHGEIAMRPLVLREIADTLGL
                     HESTISRVTTNKYMATPMGTFELKYFFGSHVSTETGGAASSTAIRALIKQLIGAEEPR
                     NPLSDSRIAELLGEQGFVVARRTVAKYREALKIPAVNLRKTL"
     gene            complement(320220..321011)
                     /gene="lptB"
                     /locus_tag="Rmet_0304"
     CDS             complement(320220..321011)
                     /gene="lptB"
                     /locus_tag="Rmet_0304"
                     /codon_start=1
                     /transl_table=11
                     /product="Probable ABC transporter ATP-binding protein"
                     /protein_id="ABF07190.1"
                     /translation="MNDTATLADQASSAPSTDSSTLVVRHLKKRYGSRTVVKDVSLDV
                     KSGEVVGLLGPNGAGKTTSFYMIVGLVALDEGDIVLDGQHISGLAIHERARMGLSYLP
                     QEASVFRKLNVEENIRAVLELQVVNGKPLPKQEIDRRLDSLLDDLQIAHLRNNPALSL
                     SGGERRRVEIARALASAPRFILLDEPFAGVDPIAVGEIQRIVSFLKARNIGVLITDHN
                     VRETLGICDHAYIISEGTVLAEGQPEEIIANESVRRVYLGENFRM"
     gene            complement(321037..321681)
                     /locus_tag="Rmet_0305"
     CDS             complement(321037..321681)
                     /locus_tag="Rmet_0305"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; OstA-like
                     protein"
                     /protein_id="ABF07191.1"
                     /translation="MTASLTTSSCRRTAPALMAAIAAIGLFLAQPAFAERADQTKPLV
                     LEADNASYDDVKQIYTLTGNVVLTKGTMVLKSDAAELRTDPEGYQYAIATSKPGRQAY
                     IRQKRDGVDEYIDGWGDRIEYDGKSEINKLIGNARAARVSGVGAKILDEIRGAVITYD
                     SRNEFYTATGGDNNASAGNPSGRVRAVLSPRANQASAPAGAPLDLKPSSQPAKP"
     gene            complement(321744..322370)
                     /locus_tag="Rmet_0306"
     CDS             complement(321744..322370)
                     /locus_tag="Rmet_0306"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein"
                     /protein_id="ABF07192.1"
                     /translation="MPEFLSRITGLIMRLLPLLLMAIVAGSTFWLVQINSPHEATAQA
                     QVKRHVPDYYMDRFSATELAEDGNTKIRFTGVKMVHFEDDQTYEVTTPAMRNYEPDRP
                     PVTANANRGVMNAEGSIIDLYGNAFIVRQAGTDVSKDPRMTAASQYFQLLVNDDIVKT
                     DKPVELTRGPSVMNANGLIFNNVTREVQLLGNVRGTIIMNSPGQASAQ"
     gene            complement(322374..323357)
                     /gene="kdsD2"
                     /locus_tag="Rmet_0307"
     CDS             complement(322374..323357)
                     /gene="kdsD2"
                     /locus_tag="Rmet_0307"
                     /EC_number="5.3.1.13"
                     /codon_start=1
                     /transl_table=11
                     /product="D-arabinose 5-phosphate isomerase"
                     /protein_id="ABF07193.1"
                     /translation="MIANFDADRALRLARQTLEIEAEAVSALAGRLTPAFTTAVEMIL
                     GCTGRVVVSGIGKSGHIGRKVAATLASTGTPSFFVHPAEASHGDLGMITRDDVLIAFS
                     NSGETAELLAIIPIVKRIGAGLISITGNAESNLAKLSNAHLDGAVAQEACPLNLAPTA
                     STTAALALGDALAVAVLDARGFGEDDFARSHPGGALGRKLLTHVRDVMRTGNAVPAVR
                     ESTPLAQALMEITRKGMAMTAVVDPDGRAVGVFTDGDLRRLLETPRDWKTVPIGEVMH
                     RNPHTVHLDKLAVEAVQIMETNRINQLLVVDDDGHLAGALHIHDLTRAKVI"
     gene            323463..325487
                     /locus_tag="Rmet_0308"
     CDS             323463..325487
                     /locus_tag="Rmet_0308"
                     /codon_start=1
                     /transl_table=11
                     /product="probable glutathione-regulated potassium-efflux
                     system k+/h+ antiporter transmembrane protein; Kef-type K+
                     transport system"
                     /protein_id="ABF07194.1"
                     /translation="MPGRRACLAGTFQSPMHSPLELTLVLLAAAVFGVVAFRMLQLPP
                     MLGYLAVGILIGPHALGLASDSGQTKYLAEFGVVFLMFSIGLEFSLAKLRAMKRLVFG
                     LGGSQVILSMLAVVPASWMFNWLFPLSWQASVALGGALAMSSTAIVSKMLSERMELES
                     EHGRNIISILLFQDLAVVPLLIVIPALSRDPGDLAFALGLATVKIAVALGAIFFLGQR
                     LMSRWFHVVAARRSQELFMLNLLLVTLGMAALTERLGLSMALGAFMAGMLISETPYRH
                     QVEEDIKPFRDVLLGLFFVTIGMLLNIRVVFDHVWLVLALLIVPILFKLVLIAVLARL
                     FGSRQGVAIRTGLGLAQAGEFGFVLLNQIDGMGLVDPVLIQVILASMLLSMLAAPFLI
                     QYSDAIVLRFAANEWLLQSLNMTRIAAQSLQTEKHAIICGYGRSGQNLAHMLEREGIT
                     YVALDLDPDRVRDAAAAGDTVVYGDAGRREALIAAGIHRAALVVVTYANTPSAVKVLH
                     HVQELAPALPVLVRTVDDSELDILQKAGATEVVPEIIEGSLMLASHALVLLGVPMRRV
                     VRGVQQARDARYSLLRGYFHGRDDEEDMVERDTVRLHAVSLGPEHTAVGRRLGALGLE
                     RIGVEVTAVRRRGIRAFDPEPDTVLEPGDIVVLRGTPEALESAEERLIKD"
     gene            complement(325477..325905)
                     /locus_tag="Rmet_0309"
     CDS             complement(325477..325905)
                     /locus_tag="Rmet_0309"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07195.1"
                     /translation="MCEIFIRANPDSYQTQSRSLRLHGMATSIRLENLFWEVLEELAQ
                     RDGMTVNQLLTRLHDELAEHRGETSLSANFASFLRVCCMRYLLLQNDGRIPADTSVPI
                     RSLDARAVLDSLPASWVEAGNSPLPRAARGEHASASSSSP"
     gene            complement(325964..326593)
                     /locus_tag="Rmet_0310"
     CDS             complement(325964..326593)
                     /locus_tag="Rmet_0310"
                     /codon_start=1
                     /transl_table=11
                     /product="putative intracellular
                     protease/amidase/DJ-1/PfpI family"
                     /protein_id="ABF07196.1"
                     /translation="MARQFEHPQPATIQETTVAKKILMLAGDFAEDYETMVPFQALQM
                     VGHTVHAVCPDKKAGDHCATAIHDFEGDQTYTEKRGHNFTLNATFADIDPARYDALVI
                     PGGRAPEYLRLNARVLEIVRHFAQANKPIAAVCHGAQLLAAAGVLEGRTCSAYPACAP
                     EVRLAGGKYADIPVDQAHTDGNLVTAPAWPAHPAWLAQFLAVLGTRIVE"
     gene            326669..327241
                     /gene="apt"
                     /locus_tag="Rmet_0311"
     CDS             326669..327241
                     /gene="apt"
                     /locus_tag="Rmet_0311"
                     /EC_number="2.4.2.7"
                     /codon_start=1
                     /transl_table=11
                     /product="adenine phosphoribosyltransferase (APRT)"
                     /protein_id="ABF07197.1"
                     /translation="MSNSIIQSPDLGDVTGYLRDRIRTVPDWPQPGVMFRDITPLLQN
                     PKTLRVLIDVFVHRYMDQNLDLVAGIDARGFILGSIIAYELNLGFVPIRKKGKLPFQT
                     VAEEYELEYGSATVEIHADACKPGDRVLLIDDLIATGGTMMAGRKLLERLGATVVEGG
                     AIVDLPELGGSKLLQASGLSLFTVCNFDGH"
     gene            327521..329197
                     /locus_tag="Rmet_0312"
     CDS             327521..329197
                     /locus_tag="Rmet_0312"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transporter"
                     /protein_id="ABF07198.1"
                     /translation="MGVLLHLLSGVALLIWGTNIVKVGILRVYGANLRHVLSVSVSNR
                     FAAFLAGVGVTGLVQSSNATAVIVSSFVGQGLIAVAPALAIMLGANVGTALMVQVFSL
                     DLSWLSPLLIFIGVILHLSWKGSKAGHVGRVLIGLGLITLALELISIATRPVVQAAGV
                     KVLFSTLTGDAALDMLIGAVLTILCYSSLAMVLFCGALASAGVVSIHVAMALVLGANL
                     GSGISALMSTSGNNQPGKRVTLGNLLSRLLGCVIALPLLTKAEELLALVGSEPQRMIV
                     NFHLLFNVALALLLLGATAPLARLCEAILPGRNTGDSQVTPRHLDPAALSTPTLALSN
                     AAREVLRIGDRVEQMLDNLLRVLRTNDLKLANATCRIDNEVDDLYTAIKLYLTQISTE
                     ALDEHDGERWTEIISLTINLEHAGDLIERVIVDTKEKKIAHNLSFSEAGMQEIAEMHA
                     RVVANLRLGLSVFLTGDLRSAQQLMAEKAAFRDLERDLSRSHLQRVAVQTVESIETSS
                     LHLDLIAELKRLNSLFCSTAYPVLERAGMMNRSRMKEDPEEKVAAVAGAR"
     gene            complement(329251..332118)
                     /gene="uvrA1"
                     /locus_tag="Rmet_0313"
     CDS             complement(329251..332118)
                     /gene="uvrA1"
                     /locus_tag="Rmet_0313"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase and DNA damage recognition protein of
                     nucleotide excision repair excinuclease UvrABC"
                     /protein_id="ABF07199.1"
                     /translation="MEEIKIRGARTHNLKNINLDLPRNKLVVITGLSGSGKSSLAFDT
                     LYAEGQRRYVESLSAYARQFLQLMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTVT
                     EIHDYLRLLFARAGTPYCPDHGIALQAQNVSQMVDAALALPEDTKLMILAPVVSDRKG
                     EHTDLFDTMQAQGFVRFRIRSGGGTAHEAEAKVYDVDALPKLKKTEKHTIEVVVDRVK
                     VRADIKQRLAESFETALRLADGRAIAMEMDTGREHVFSSRFACPICSYSLQELEPRLF
                     SFNNPMGACPSCDGLGQITFFDPKRVVAFPNLSLASGAIKGWDRRNQFYFQMLQSLAA
                     FYDFDTETPFEELPPEVQQVILHGSGETEIPFTYINERGRTTLRAHAFEGIIPNLERR
                     YRETDSVAVREELAKYQNNQACPVCQGTRLRTEARHVKVGEADQARAIFEINGWPLRD
                     ALTYFLTLDLHGAKREIADKIVKEITARLNFLNNVGLDYLSLERSADTLSGGEAQRIR
                     LASQIGSGLTGVMYVLDEPSIGLHQRDNDRLIGTLKHLRDIGNSVLVVEHDEDMIRAC
                     DYVVDIGPGAGVHGGMIVAEGTPDQIESSPASLTGQYLSGQRRIEVPKTRALPDDERL
                     LRIVNATGNNLRNVTAEIPVGLLTCVTGVSGSGKSTLINDTLYHAVARHLYGSTAEPA
                     PHDRIEGLEHFDKVINVDQSPIGRTPRSNPATYTGLFTPIRELFAGVPSAKERGYDPG
                     RFSFNVKGGRCESCQGDGVIKVEMHFLPDVYVPCDVCHGQRYNRETLEVLYKGKNISE
                     VLDLTVEQAHEFFNAVPVVRRKLQTLLDVGLGYIRLGQSATTLSGGEAQRVKLSLELS
                     KRDTGRTLYILDEPTTGLHFHDIELLLKVIHKLRDQGNTVVIIEHNLDVIKTADWLID
                     MGPEGGAGGGQVIAKGSPEVVAASKASFTGKYLAPLLKKQG"
     gene            332393..333649
                     /locus_tag="Rmet_0314"
     CDS             332393..333649
                     /locus_tag="Rmet_0314"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transporter, major facilitator family"
                     /protein_id="ABF07200.1"
                     /translation="MPSIPPSSQPASLADESTRTEPARDRMTKGELRASLTLASIFAL
                     RMLGLFLILPVFAEYARTLPDGHDAQRVGIAMGIYGLMQAFLHIPLGWLSDRVGRKPV
                     MVAGLLLFVAGALVAAFSDTLTGIIIGRALQGMGAISAAITACIADLTRERHRTKAMA
                     MVGGSIGLTFALSLVIASPLLHSIGMSGIFSLMAVFGVVAIGVTLFLVPAPPPPHPVR
                     LPFRQVLMNADLIRLNVGVLALHASQVAMFMVVPAMLSDAGMPLDQHWKVYLPVVLVS
                     FLLMLAPMMAAERYGKVRPVLLASVALMTVVQILFASVHGLWPIVGVLLLFFVAFNVL
                     EAMQPSLVSRYAAVSRGAALGVYNTTQSLGLFLGGVAGGWLLQHEGRSAVFIGCAVVL
                     VLWLIIAWSMKAPPARSQGSASAVAA"
     gene            333925..334470
                     /gene="ssb1"
                     /locus_tag="Rmet_0315"
     CDS             333925..334470
                     /gene="ssb1"
                     /locus_tag="Rmet_0315"
                     /codon_start=1
                     /transl_table=11
                     /product="Single-stranded DNA-binding protein
                     (Helix-destabilizing protein)"
                     /protein_id="ABF07201.1"
                     /translation="MASVNKVILVGNLGADPETRYMPSGDAVTNIRLATTDRYKDKQS
                     GEFKEATEWHRIAFFGKLAEIAGQYLRKGSSVYIEGRIRTRKWQDQSGQDKYSTEIVA
                     DQMQMLGGRGQGGGGDEGGYGGGAGGGAGGGGGYSRESQGGGGRSQGGGAQGGGQQGG
                     QRRQQQAPSNGFEDMDDDIPF"
     gene            334703..335569
                     /locus_tag="Rmet_0316"
     CDS             334703..335569
                     /locus_tag="Rmet_0316"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07202.1"
                     /translation="MRAGICKLTGQHGIFLKSHIIPAALTRKDKSAPFIEAGNGRPPK
                     RTWNSWFDSELVIQRGEKILTEFDTWAIANMRRAKLVWSGWGESTVLEPSMDFSATHQ
                     LLEEHDNHLGVHSIQGIDTARLRLFLLSLLWRAAVTKRPEFEEIKLPAGDEQQLRRML
                     LEGTAEPADFYPITLTQLSTLGPHHNQTPIYRDYHFGPDAERGLPPAKTYRFYFDGLI
                     AIVFLPGYSPDLYEGISAIAVGGKPDRLDVVTVPFEHSFQHENMGKVVLEAHTNWPEK
                     SERLNMAGGNRA"
     gene            335757..336953
                     /gene="int"
                     /locus_tag="Rmet_0317"
     CDS             335757..336953
                     /gene="int"
                     /locus_tag="Rmet_0317"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-based site-specific recombinase CMGI-7"
                     /protein_id="ABF07203.1"
                     /translation="MHTRFHMVVVRHRDGERLPILLDADRQPIGWINEYAIQRLRSRL
                     SANSLTKTLHVLGLLWLWAVQHSIPLQVRLLAGDGLSSDEIASQLYPWLRRDFQSRVA
                     VRRLVVAPTTVAQRLQVVMQFVRWHLERVMARLPIGSPELSHVRERLTTMQRTFATAG
                     PRRAEPVHHASPLSEERVSRLLSICRPGNDENPWKAAYQDRNYVIVLVLLLLGIRRGE
                     LLKLRVADCVLSGTIPEIRVERSPDDAKDPRRHEPQVKTESRQLPCDRALASLLNAYI
                     CRTRRAIPGADKSPFLFLSRDGAPMSLSRVNGLLTQVGAAHAEFRDLHPHCLRSTCAT
                     NFRARALRTGLDEERVEKHMMYFFGWRSSDSIRPYVWHAIRRESCELSLAYQSTIFNA
                     SMTGIE"
     gene            336950..337462
                     /locus_tag="Rmet_0318"
                     /pseudo
     CDS             336950..337462
                     /locus_tag="Rmet_0318"
                     /note="tyrosine-based site-specific recombinase
                     (integrase) (partial)"
                     /pseudo
                     /codon_start=1
                     /transl_table=11
     mobile_element  337454..340970
                     /mobile_element_type="transposon:Tn6049"
     gene            complement(337641..337856)
                     /gene="tnmC"
                     /locus_tag="Rmet_0319"
     CDS             complement(337641..337856)
                     /gene="tnmC"
                     /locus_tag="Rmet_0319"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein Tn6049"
                     /protein_id="ABF07205.1"
                     /translation="MTFHQPSGIAQGLPLLIDANWTPAQAWAVIELLDDLRDRLHAHY
                     QLALAQWLAEDRQEHPDGLGDLADNDF"
     gene            complement(337910..338743)
                     /gene="gspA"
                     /locus_tag="Rmet_0320"
     CDS             complement(337910..338743)
                     /gene="gspA"
                     /locus_tag="Rmet_0320"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase (type II general secretion pathway)
                     Tn6049"
                     /protein_id="ABF07206.1"
                     /translation="MNQPNLLALYGLKFNPFAQDIPVEAVFVPPKLDHFCWRIENGMA
                     REGGFAMVHGDPGCGKSVTLRLLHQRLMRVPDLMVGSIAHPQSNLADFYRELSDIFTV
                     PLKPHNRWGGFKALRERWLTHMEASRRRCVLLIDEAQEMAVPALSELRLLAQARFDSQ
                     LLLCVVLAGDARLPEKFSREDLIPLGSRIRCRLALESASIDELQACLDHLLAAAGNAT
                     LMTMPLRQTLCEHAAGNYRILMNLAGELLAQAAQRELPQIDEKLYLETYSATLNRRAR
                     R"
     gene            complement(338740..340179)
                     /gene="tnmA"
                     /locus_tag="Rmet_0321"
     CDS             complement(338740..340179)
                     /gene="tnmA"
                     /locus_tag="Rmet_0321"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase Tn6049"
                     /protein_id="ABF07207.1"
                     /translation="MSLSIDHRNRWARLRFSVIGPLLASPPAKGELQQAFQALAAKVW
                     RHPITGADVQFGASSIERWYYRARHVQDPVDQLKNRLRDDCGHFVSLSPAIIEALVEQ
                     YRQHPGWTMQLHYDNLRVATKDGPDTLPSYTTVCRYLKAQGLVRKPTPRSSTDGAIAA
                     AARREAREVRSYEVDHVAALWHLDFHHGSRKVLTPDGQWHKPLLLCIMDDHSRLVCHL
                     QWFLDETTASLVHGVSQAIMKRGLPRAIMTDNGAAMMADEFVEGLASLGILHQTTLPY
                     SPYQNAKQERFWGQLESRLMAMLEGESHLTLEQLNLATQAWVEQEYHHKEHAELEATP
                     LQRYLSCADVSRPSPEALALRRAFRIRQHRRQRRTDGTFTLDGVRFEIPGAYRHLEQV
                     CLSYARWDLSQVDLIDARIGAILAAVFPLDKSANADARRAHLTAKGASPANEEPAQAG
                     TAPLLRQLLAEHAATGLPPAYLPPAPTKL"
     gene            complement(340291..340860)
                     /gene="tnmB"
                     /locus_tag="Rmet_0322"
     CDS             complement(340291..340860)
                     /gene="tnmB"
                     /locus_tag="Rmet_0322"
                     /codon_start=1
                     /transl_table=11
                     /product="protein involved in mobility of Tn6049"
                     /protein_id="ABF07208.1"
                     /translation="MSPLLCRAMKETSAVCHALLQTPAFFALLRRIDEDLMKVARDRG
                     CCHCGSVLHSANYPRKPRGCPPAAHPDCNTRLSLCCAGCRKRMTPDSVRFLGRRVWLA
                     IVLVLRSSRATGACLDGLPAISWATLKRWRQWWTETFPKTPVGRWLRGLIPPTPEPFI
                     YPDCLLQSVEHDSEDERLAAVLLLLLGPA"
     gene            341083..342111
                     /locus_tag="Rmet_0323"
                     /pseudo
     CDS             341083..342111
                     /locus_tag="Rmet_0323"
                     /note="tyrosine-based site specific recombinase (partial)"
                     /pseudo
                     /codon_start=1
                     /transl_table=11
     gene            342116..344119
                     /locus_tag="Rmet_0324"
     CDS             342116..344119
                     /locus_tag="Rmet_0324"
                     /codon_start=1
                     /transl_table=11
                     /product="putative integrase"
                     /protein_id="ABF07210.1"
                     /translation="MAAVGRLEAPAGDDWIENGRQLIGKAKALMPFGDVEWDAPVWDV
                     SAAYEHRTRGYKANARGLRLPFTQHRQAGKGVGDPLPEGFADVVKALVCMRHQRRGQS
                     MASHSVFIRAARYICDAIRGTGHQLGELRKDDLDRAATVLLRRERETSAYKVLGHMEE
                     FADMVDGYRLSRMRLDWRCRRKARPRSLTPDRIGDPSTEVSDRLPTEEAIRALGWLYQ
                     TIPRAERPDDGRAADRTLILIATIMACTGLRVGEMLTLPVNPISIAKDGSRNLRYARL
                     KGRADDVMVEWHSKPLLSETVELVEAAVAELREATAGPRQVALKASRCGSLMPRSALP
                     PVLFTSDLRAVLGLNSWKLAQFLRARAIPFEIVDRRLRVNRDALCRGIEKDHWFGPVI
                     PGPPSQGLKLHQALCVVYANQFHRGTRTTLTYAARPVSDQNVQDFLAGRPAIPSAFER
                     YGLVGEDGLVLRVRSHGLRHFLNHLLDEGGAPDLVQTKWFGRQHEADTRAYQHLTAAQ
                     RAAQVVKEVLEGKLAGGIVEVAKSLPLEVAKTFLAARIQAVHDVGPGLCVHDFQMSPC
                     ERHLQCTAKCEDYLWIKGEEARAHELKRQAAVAYISLRTVTARARSRSLMQSDWYRHI
                     ATRYGQLMEQLATIGFHQADLVRYVEGCGDADKDSREREDERA"
     gene            344106..344498
                     /locus_tag="Rmet_0325"
     CDS             344106..344498
                     /locus_tag="Rmet_0325"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABF07211.1"
                     /translation="MSERKKACIIAELERWQDRELGTRLTWERVEAFSGYTRQALSRH
                     PDIVYAYQEAKRALADSDRKSRSRLRRDELAYLDQTVVSLRAKIRWYEQLEAQWLQRW
                     QRIANQCLQRGLSIEDLDRPLDPLNRRG"
     gene            344622..344747
                     /locus_tag="Rmet_6411"
     CDS             344622..344747
                     /locus_tag="Rmet_6411"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADC45029.1"
                     /translation="MRDVDAIYGEILETAMVMHLIAFPQFLIEIPLPPSRAAIGH"
     gene            complement(344940..345692)
                     /locus_tag="Rmet_0326"
     CDS             complement(344940..345692)
                     /locus_tag="Rmet_0326"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABF07212.1"
                     /translation="MFGLNRSFSAVRNKRSRIATKSRSSDSRLLATELRVSVARLIHP
                     TSLAAVAGETLLDCSEPARFALSFKQSILVMITYCPSYPKRAVQHRLLYWAMPLLASL
                     FLGACASSQKAANHSFSFDTRGAVPAVEVLNYRYGDSDMTGTRPPKWALEEGRIGQQA
                     GVYGRMRPADTLYVKWRIKSTGQIFEDSVDLRHRLPNDMTDKIVYFDIKGPQLFVYVV
                     SPEDYPLGTPRNSLRLYSYRPYVQIYPDQSKQ"
     gene            complement(346254..347447)
                     /gene="arsP"
                     /locus_tag="Rmet_0327"
     CDS             complement(346254..347447)
                     /gene="arsP"
                     /locus_tag="Rmet_0327"
                     /codon_start=1
                     /transl_table=11
                     /product="permease of the Major Facilitator Family"
                     /protein_id="ABF07213.1"
                     /translation="MEPSSSVIARLGVAQTLAWGSTYYLPAMLATPMAQDLGVSTPTI
                     FAAFSVALVVSALLGPAAGRMIDRTGGRSVLVATSLVFTIGLARLGVAQGVVGLFAAW
                     VILGIGMGAGLYEAAFATLVALYGNRSRGAITGITLIAGFASTVGWPLSTSMEAHIGW
                     RGACLSWAALHLTLGLALNLSIPRVAATATAPSRPTSQTGSALTHHADERSQRTASYA
                     LAFVFAATWFISTAMAAHLPRLLQAGGASLATAVMVGALIGPAQVGARILEFGLLRKV
                     HPLLSARIAAALHPLGALAFGLVGAPAAALFGVLHGAGNGILTIAKGTLPLVIFGPGG
                     YGHRQGVLMVPARVAQALAPWIFGMCLDQFGAKSLWLSSALGMMAILTLMAVRQSAPL
                     KTSTT"
     gene            complement(347466..348230)
                     /gene="arsH"
                     /locus_tag="Rmet_0328"
     CDS             complement(347466..348230)
                     /gene="arsH"
                     /locus_tag="Rmet_0328"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent FMN reductase (ArsH-like
                     protein)"
                     /protein_id="ABF07214.1"
                     /translation="MTVDLPNIVPAVLDTPDLSKLEPARASTHPPRILLLYGSLRETS
                     YSRLLVQEAERILQHFGAETRVFDPRELPMADSVPADHPKVVELRKLSEWSEGQVWCS
                     PERHGTLTAVFKNQIDWLPLEMGGIRPTQGRTLAVMQVCGGSQSFNAVNALRVLGRWM
                     RMVTIPNQSSVAKAYQEFDASGRMKPSSYYDRVVDVMEELYKFTLLVRDRSDYLTDRY
                     SERKEAAPANATTLAAAAMSHESEAQISDTDSGEVE"
     gene            complement(348227..348649)
                     /gene="arsC1"
                     /locus_tag="Rmet_0329"
     CDS             complement(348227..348649)
                     /gene="arsC1"
                     /locus_tag="Rmet_0329"
                     /EC_number="1.20.4.1"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase (glutaredoxin family) CMGI-7"
                     /protein_id="ABF07215.1"
                     /translation="MTVTIYHNPACGTSRNTLAMIRNAGIEPIVVEYLNMPPDRQTLQ
                     SMIRAAGLSVREAIREKGTPYAELGLGDPALTDDQLLDAMLAHPILINRPFVITELGV
                     RLCRPSEVVLDILPAPQQGAFTKEDGEAVIDTQGRRIR"
     gene            complement(348659..349723)
                     /gene="arsB"
                     /locus_tag="Rmet_0330"
     CDS             complement(348659..349723)
                     /gene="arsB"
                     /locus_tag="Rmet_0330"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenite efflux pump ACR3 CMGI-7"
                     /protein_id="ABF07216.1"
                     /translation="MSTAQRTAGASQPSAIGFFERYLTVWVALCIVAGILLGQWLPAA
                     FHTIGAMEIAQVNLPVGILIWIMIIPMLIKIDFGAMGQVAGHWRGIGVTLFVNWLVKP
                     FSMALLGWIFVRHLFAGWLPADQLDSYIAGLILLAAAPCTAMVFVWSQLCKGDPYFTL
                     SQVALNDAIMVVAFAPVVALLLGLSSITVPWDTLMTSVALYIVVPVLIAQVIRKVLLV
                     RGDATYKRVVGALGPYSITALLATLVLLFGFQGNAIVEQPLIILLLAVPILIQVLLNS
                     GLAYLLNRKLGVAHCVAGPSALIGASNFFELAVATAISLFGFQSGAALATVVGVLIEV
                     PVMLFVVGVVNRSQHWYESH"
     gene            complement(349720..350232)
                     /gene="arsC2"
                     /locus_tag="Rmet_0331"
     CDS             complement(349720..350232)
                     /gene="arsC2"
                     /locus_tag="Rmet_0331"
                     /EC_number="3.1.3.48"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase (thioredoxin family)"
                     /protein_id="ABF07217.1"
                     /translation="MTDKTFNVLVLCTGNSARSVMAEALFNVLGKGRFHAYSAGSHPS
                     GTVNPFAIERCQAIGYDTTGLRSKSWDEFALPDAPRMDFVITVCDQAAGEVCPIWPGT
                     PITAHWGFLDPAAIQGSDDEKRKIFAQVFRQILNRVSQFVNLPLHVLDRNAIQKEMHA
                     IGEQPVESAQ"
     gene            complement(350298..350786)
                     /gene="arsI"
                     /locus_tag="Rmet_0332"
     CDS             complement(350298..350786)
                     /gene="arsI"
                     /locus_tag="Rmet_0332"
                     /EC_number="4.4.1.5"
                     /codon_start=1
                     /transl_table=11
                     /product="Lactoylglutathione lyase (glyoxalase family)
                     CMGI-7"
                     /protein_id="ABF07218.1"
                     /translation="MKRFHVHVSVADLPASIRYYSALFDAEPTVVRDDYAKWALDDPR
                     VNFAISNRTEKLGVDHLGIQVETDAELAEMQGRLASADLPMQSQSETNCCYATSNKHW
                     SVDPTGIAWESFHTLGNVPTYGESRDRSAEASACCVPVQLNATPKPSTKTACCTPESG
                     CC"
     gene            complement(350790..351119)
                     /gene="arsR"
                     /locus_tag="Rmet_0333"
     CDS             complement(350790..351119)
                     /gene="arsR"
                     /locus_tag="Rmet_0333"
                     /codon_start=1
                     /transl_table=11
                     /product="Regulatory protein, ArsR CMGI-7"
                     /protein_id="ABF07219.1"
                     /translation="METENALEALAALAHGIRLAVFRLLVQAGPEGLPAGRIAELMEM
                     PASSLSFHLKELHRAGLLASRQEGRSIIYMAQFETMNALLGYLTENCCGGAPCSPVSS
                     CSVATES"
     gene            complement(351313..352131)
                     /gene="arsM"
                     /locus_tag="Rmet_0334"
     CDS             complement(351313..352131)
                     /gene="arsM"
                     /locus_tag="Rmet_0334"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-L-methionine-dependent
                     methyltransferase"
                     /protein_id="ABF07220.1"
                     /translation="MSTAVAQDTINRKAWRSWGARRWFKILSDWTDPGEAAALAFVAD
                     AVRDTPILDVGVGGGRTVPMLRKLSQHYEAIDYMPEMVEICQHNHPDIRVSQMDARDL
                     SAFEDNTFGLVVFSFNGIDAVDYAGRRAVLAEFARVLRPGGMLVFSTHNLHGPTYREN
                     LTQFLRLPAWSNNPIRLGFNVARTVVNLPLATINYLRNSQLNREFDGYAVRVCAAHKF
                     GIVIVYTDVPTQLRELKACGLQTEAVFGNLNDKAFQPGDPLDDVNWFHFVARKL"
     gene            complement(352361..353860)
                     /locus_tag="Rmet_0335"
     CDS             complement(352361..353860)
                     /locus_tag="Rmet_0335"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transglycosylase"
                     /protein_id="ABF07221.1"
                     /translation="MVNDRRRFLVIGARALAGASITWSGLAAAATPAIPAPKEKRLTP
                     PRQLNLTNKPWTGDFDGMFKHRTIRVLVPYSRTLYFNDRGRERGVTADTVRDFERYIN
                     KTMAAQLAKRPLTVYMIPVTRDRLLPDLNAGLGDIAAGNLTVTDSRLKQADFIVGQTS
                     KPIRELVITGPKSPTLATLDDLAGKAVHVRPSSSYYESLTALNDRFRKAGKPQMHLVL
                     LPDALEDEDALEMLNAGTLQILVVDDWKARIWAQILKRIKVRDDLAVREGSKIGWAIR
                     KGSPKLNAVLVDYNDNFIKKQGIADYRLKQYMKVIKQISDNTNGAEIKRFQDTLAFFE
                     KYGKLYHFDPLMLAAQGFQESQLNQNARSHVGAIGVMQIMPATGRELNVGSIKITESN
                     IHAGTKYLDQLMTRYFSDANFSESDRPLFAFASYNAGPGNISKMRTEAKARGLNPDKW
                     FNNVEIVTSERIGIETTTYVRNIYKYYAAYKLIEDAQEERSRAMKKVAG"
     gene            complement(354044..354850)
                     /locus_tag="Rmet_0336"
     CDS             complement(354044..354850)
                     /locus_tag="Rmet_0336"
                     /codon_start=1
                     /transl_table=11
                     /product="putative regulatory protein, IclR family"
                     /protein_id="ABF07222.1"
                     /translation="MSDDMLADAAKPQRGIQSLDNTGQLLGALVDAGQPLSLGELARA
                     AGMVPAKAFPHLVSLQKIGLISRNADGDFQAGTLGLELGLIALQRLSPTREAEPEVIA
                     LAHATGLSVAMAVQGPLGPTVIRLEESARPQHVSLRVGTVLSMVNTAIGRVVAAHLPD
                     DLLADALAQDAIRMAGTAFDGALPSGYLERLRGIRAGGIDHAVSRPVPGIDTLAAPVF
                     DHTGALALVVAVMGSSGSFDSRLDSDTAHVVRQAARRLSWRFGASGATPA"
     gene            complement(354847..355632)
                     /locus_tag="Rmet_0337"
     CDS             complement(354847..355632)
                     /locus_tag="Rmet_0337"
                     /codon_start=1
                     /transl_table=11
                     /product="putative regulatory protein, IclR family"
                     /protein_id="ABF07223.1"
                     /translation="MARTPGEGSGKTQRGIQSVEVGGRLLQALADARRPLPLAELAAA
                     AQLAPAQAHTYLVSLMRLGLIKREHVDGYYEPGPLALRLGMMRLDNEPAYRAAVQRVR
                     TLATDIGFNVAISLPTPQGPTIVHYAPAGTSLHLNLHVGTVMALATTATGRAYCAFQP
                     ESHWLPIWTQQQTPATASTLPAFLETLAAVRARGTERSIDSPSPAVSSLAMPLLDDDS
                     TLRLVLTAIGSTGAIDVAWDGPVASALRAAIGDIARAMREGDA"
     gene            355850..356809
                     /locus_tag="Rmet_0338"
     CDS             355850..356809
                     /locus_tag="Rmet_0338"
                     /EC_number="3.5.2.6"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase-like protein"
                     /protein_id="ABF07224.1"
                     /translation="MAKAFASQADLEAKQITFTQLSENAYAYTAEGDPNSGVIIGDDG
                     VMIIDTTATPAMAQDLIAKIRAITDKPIKYVVLSHYHAVRVLGASAYFAEGAQQIIAS
                     RGTYEMIVERGEADMKSEIERFPRLFAGVETVPGLTWPTLVFEREITLFLGKLEVRIA
                     HLGAGHTKGDTVVWLPQQKVLFSGDLVEYDAACYCGDAQLEQWPATLDALAALQPEKL
                     VPGRGPALTTREDVAKGLAYTKDFVSTLFQAGKEAVAGKMDLKAAMAHTRKSMDPKFG
                     QVFIYEHCLPFDVSRAFDEAAGVTHPRIWTAQRDQEMWAALQD"
     gene            356913..358667
                     /locus_tag="Rmet_0339"
     CDS             356913..358667
                     /locus_tag="Rmet_0339"
                     /EC_number="1.14.13.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Monooxygenase, FAD-binding:FAD dependent
                     oxidoreductase"
                     /protein_id="ABF07225.1"
                     /translation="MSSTKVDIDYQRIQYDYVPCAEQRGALTNAAPHPVIVVGAGPIG
                     LATAIDLARHGVPVVVVDDDCMLSVGSRAICFAKRTLDIFDRLGCGDRMVDKGVRWNL
                     GKVFLRDSQVYAFDLLPESDHQRPAFINLQQYYLEGYLLECAQAMPNIEIRWKSKAVA
                     IEQHADHVTLTIETPDGCYALRGAYVVAADGSRSPLRKMLGLESHGHTFRDRFLIADV
                     KMEAPFPAERWFWFDPPFHPNQSVLLHRQPDNVWRIDFQLGWDADPAFEKTPERVLPR
                     VQALLGPDAKFELEWVSVYTFSCVRMDSFRHGRVLFAGDSAHCVSPFGARGANSGVQD
                     AENLAWKLAYVLQGKAPESLLDTYASEREFAADENILNSTRSTDFITPKSAVSRIFRD
                     AVLTLARDHAFARQLVNSGRLSVPAVLRDSPLNTADAESFSGQMVPGAACVDAPVAGT
                     EGKPWLLPHLGDDFVALIFGAPAGIDAACREALTQLLQGDIPLRVVFVTDAAISASAE
                     AWPGAVVLRDAGGVAARRYDARAGTCYLIRPDQHVCARWRAVDANQIAGAIARATCNA
                     AATVAAQSPAAARTPALA"
     gene            358693..358902
                     /locus_tag="Rmet_0340"
     CDS             358693..358902
                     /locus_tag="Rmet_0340"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07226.1"
                     /translation="MPLNTAPNLAYPDEFYEALIEMHHDLDDAESQAVNARLILLLAN
                     HIGDLDTLREAMRLARDVALEPAAS"
     gene            358986..360347
                     /locus_tag="Rmet_0341"
     CDS             358986..360347
                     /locus_tag="Rmet_0341"
                     /codon_start=1
                     /transl_table=11
                     /product="Major facilitator superfamily (MFS_1)
                     transporter"
                     /protein_id="ABF07227.1"
                     /translation="MHTQSLGAAPVLPEIPSHAIPQVLPTQQEDALYRKVWLRIIPFL
                     FICYVVSFLDRINIGFAQLQMKHDLGFSDAMYGLGAAVFYVGYVLCEVPSNMLLARFG
                     ARRTFTRIMLLWGVASVGMMLVSQPSHFYLLRFLLGVFEAGFFPGIVLYLTYWFPARR
                     RAAVMAIFFAGVAVAGVLGGLISGWIMRDMAGVLGMRGWQWMFAIEGAPAVLLGLIAA
                     VCLVDGPRQARWLTPAEQDYLVAQHEAESRGAGGHAHSMQALRQALANPRVYLFAFIY
                     FALTCGSLTLSFWMPLMIRDFGIQDVVAVSLYSVIPNAIGAVGLILIARRSDRLGERH
                     GHFLCCTAGGALALAALTLHVPSLGVSLAILSVAAVLIFAALPIFWALPPSHLPAQTA
                     ATGIAFISSIGITSGIVSPWVIGQIKAHTGSMDNALYLLAGLLLASGLALWKGVPRTP
                     TAH"
     gene            360492..361400
                     /gene="gltI"
                     /locus_tag="Rmet_0342"
     CDS             360492..361400
                     /gene="gltI"
                     /locus_tag="Rmet_0342"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate and aspartate transporter subunit;
                     periplasmic-binding component of ABC superfamily"
                     /protein_id="ABF07228.1"
                     /translation="MNQFFMTRAAVLMAVSLGAGSALAVDVAASPTLSKIKSSGTISI
                     GHRTSSIPFSYYDANQKVIGFSQDICDRVIDAVKKETGTPNLQVRMVPVTSQNRQSLV
                     QNGTVDLECGVTTNLKSRQQQVAFSTTFFVAGTRLLVKKGSPVHDFGDLSGKAVVTNA
                     GTTSERILRKLNDEKGANITIQSAKDYGESFLILQSGRVAAFMMDDVLLSGSRTLAPN
                     PNDWVVVGTPQSFEAYGFMMRKDDPGFKQVVDATTTGLMRSGEINTLYTKWFLKPVPP
                     KNLSFDLPQSEQIKKAYANPNDEAFE"
     gene            complement(361413..362309)
                     /locus_tag="Rmet_0343"
     CDS             complement(361413..362309)
                     /locus_tag="Rmet_0343"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="ABF07229.1"
                     /translation="MPASTPKPPQSLDALLAQLRADFPNLSAQFQSGARYLLDHPRDI
                     AIQSMRKVAGNAGVQPATLVRLSQALGFEGWQGLRELFVEAVRDGDSQPYARRARKVV
                     RESGSSRMFAEMIEVQHHNLDALLASNADALPRAAELLAAAPMVHVAGFRSCFPIAFS
                     FHYIYGLFRSSVRLIRGDAGTLEMELRALSPKDAVLVAGFAPYSQESMRVATAAREAG
                     CTVIALTDSTVAPIALEADCTLLFAIDSPSFFPSITSGVAMVEALVEHLLAKKGKGAI
                     RALEQTEGQLHRTGAYLPSRRG"
     gene            362513..363838
                     /locus_tag="Rmet_0344"
     CDS             362513..363838
                     /locus_tag="Rmet_0344"
                     /EC_number="2.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Aminotransferase class-III"
                     /protein_id="ABF07230.1"
                     /translation="MTHVFHRNPKQTLPVAVGGQGIELIDSNGRRYLDASGGAAVSCL
                     GHGHPRVIEAIKAQVDTIAYAHTSFFTTEVSETLAQTLADAAPGDLDHVYFVSGGSEA
                     VEAALKLARQYFVEIGQTQRRHFIARRQSYHGNTLGALAIGGNAWRREPFLPLLVPAH
                     HVSPCYAYRDQAAGEADTQYAQRLADELEAKILELGPDSVAGFVAETVVGATAGAVPP
                     VADYLKRIRAVCDKYGVLLILDEVMSGMGRTGYLFACEEDGVVPDIVTIAKGLGAGYQ
                     PIGAMLSTSRIYDAIIGGSGFFQHGHTYIGHATACAAALAVQRTIVEDKLLDNVLARG
                     EQLRARLRESLGDHPNLGDVRGRGLFVGVEFVADRATKATLDPAKKTHAVLKRTCMEH
                     GVLVYPMGGTVDGIHGDHVLFAPPFICTPTDIDNIVDRFTQAVKTVLPA"
     gene            363850..364719
                     /locus_tag="Rmet_0345"
     CDS             363850..364719
                     /locus_tag="Rmet_0345"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07231.1"
                     /translation="MPNQNPVATADTLRRPFALAVAPNGARKTHADHACLPITPDELA
                     QCARECVDAGAAMIHLHVRKADATHSLEVVDYEPAIAAVRKAVGNALVLQLTTEAVGI
                     YQPAQQIATVRALRPEAASVAIRELVPNVAALPAAAEFFQWMHHEHVVAQYILYDADD
                     VRRYAALRESGAIPAGRHWVLFVLGRYSAGQKSSPADLLPFLAAWRETGLDQSGVEWA
                     VCAFGKQEADCAATAVMLGGHARIGFENNMTLPDGAMAPDNAALLQAVRTPLLALGYV
                     SMTADVLRERFAD"
     gene            364800..365999
                     /locus_tag="Rmet_0346"
     CDS             364800..365999
                     /locus_tag="Rmet_0346"
                     /EC_number="2.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Aminotransferase, class I and II"
                     /protein_id="ABF07232.1"
                     /translation="MSTSPSRQSSLTEAPPRARDVVHALRASRIREVANAGIGLPDVL
                     PFWFGESDQVTPSFIRDAASRALANGATFYNHNLGIAPLRAALSEYVTRLHGATPVDH
                     IAVTSAGVNALMLAAQLVTGPGDRVVAVTPLWPNLVEIPRILGAAVETVTLDYGADGW
                     TLDVDKLLAALTPGTRAVMINSPNNPTGWVMPRGAQQAVLDHCRRHGIWIIADEVYER
                     LYYGDEGAVAPSFLDIAGRDERVIAVNSFSKAWLMTGWRLGWMVVPSSMMDDLGKLIE
                     YNTSCAPSFVQEAGVVAVREGEAFTQDLVKRLRSARDHLVSALSALPGIDAHAPDGAM
                     YVFFRLKGATDSLDLCKRLVRDAHLGLAPGSAFGDEGEGFVRWCYACDEARLDEGVKR
                     LRGYLGR"
     gene            complement(366071..367537)
                     /locus_tag="Rmet_0347"
     CDS             complement(366071..367537)
                     /locus_tag="Rmet_0347"
                     /codon_start=1
                     /transl_table=11
                     /product="RND efflux system, outer membrane lipoprotein,
                     NodT family"
                     /protein_id="ABF07233.1"
                     /translation="MRAIPTLLMCAAAMSLAGCAVGPDFRTPDAPADARYTSGPQPER
                     LDAKDYPSQSLVEGDVPAQWWTLFRNPQLDETIRVALANSPTLTQAQAKLREAQENLA
                     ARTGATRFPQVDANFNATRQQVNLQSVGITQFPSPGPFTLYNASVQVSYALDLFGGQR
                     RELEGLQAAVDYQRYEFEAARLSLAANVATAAIREAGLRAQLADTVALADAQKRQLAI
                     MQQRLGQGGVARVDVQRQQAELAQTQALIPGLSQQIDATRHQLAVYTGQTPAAAQLPE
                     FRLEDMQLPETLPVSLPSELARRRPDIRAAEALLHQASADIGVATANLYPQITLTASG
                     GTQAMRMSDLFNSFNVWSLAAGVVQPVFHGGELRAQKRAKEAAYEASLGAYRQAVLQG
                     LQNVADTLRALDADAGTLQARADNAKQTRDTLAIVNEQYRLGGVSQFAVLDAERQARQ
                     AALDLAQARATRLADSAALMQALGGGWWGESETVGSLK"
     gene            complement(367550..368704)
                     /locus_tag="Rmet_0348"
     CDS             complement(367550..368704)
                     /locus_tag="Rmet_0348"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type multidrug transporter, permease
                     component"
                     /protein_id="ABF07234.1"
                     /translation="MKAVRRQISRFSAHRWWSIVLKEFLQLRRDRVTFGMMIGIPIIQ
                     LLLFGFAINSDPRHMPTAVIVAEHSDFSRTFIAALDNTTYFKVVRTMPDEASGREALM
                     RGDVQFVVSIPADFSRRLLHGDRPSILVEADATDPSATGQAIAALAQLPATVARIDLK
                     GALAPLAGGQPAFDVNVHRLYNPEGITQYNIVPGLMGTILTMTMVMMTGLAMTRERER
                     GTMENLLATPVQPLEVISGKIIPYIFIGLIQATIILLAAHFVFGVPFVGSPVAVYLAA
                     LLFIAANLTVGITLSSLAANQLQALQLTFFYFLPNILLSGFMFPFAGMPTWAQWIGNV
                     LPMTYFNRMIRSIMLKGSGWIELWPNVWPVALFTVIVLTIAVRFYKRTLD"
     gene            complement(368701..369687)
                     /locus_tag="Rmet_0349"
     CDS             complement(368701..369687)
                     /locus_tag="Rmet_0349"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type multidrug transporter, ATPase
                     component"
                     /protein_id="ABF07235.1"
                     /translation="MNGELAIDVHGLNKRFGDKHVVNDLTMQVARGEIFGFLGPNGSG
                     KTTSIRMMCGLLTPDSGAGTCLGFDIIKESAEIKRNVGYMTQRFSYWEDLSIRENLDF
                     VARVYAMPNRREVVDRALEDLGLASRAEQLAGSLSGGWKQRLALAACLLHEPQLLLLD
                     EPTAGVDPKARRDFWEQLHQLAARGISVLVSTHYMDEAERCHKLAYIAYGKLLAQGTS
                     AEVVASQNLTTWSVSGDELAELSTQLQGKPGVDQTVAFGTALHVTGKDGTALEQTLRQ
                     YAGRDHRIEPVETSLEDVFIHMMGDAQDNMAVPAKEATKESAERASGPKGDA"
     gene            complement(369684..370646)
                     /locus_tag="Rmet_0350"
     CDS             complement(369684..370646)
                     /locus_tag="Rmet_0350"
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein (HlyD-related)"
                     /protein_id="ABF07236.1"
                     /translation="MSYPVPRHAWSLLIMAAALAACGNDKPVSWQGYVEGEFVSVASP
                     FAGRLEKLSVDRGQQVADGAPLFVLESDDERAARQQAAEQLRAAEAQLADIQIGKRPV
                     EVAVTQAQLSQAQAQAQRSAAQRRRDEAQFEIGGVSRQQLDDSRATADADAARVRELQ
                     RDIDVARLPGRKDQLAAQSAQVDAARAALTQAEWKLSRKFVNATVPGLVYDVPFRPGE
                     WVPAGSTVVRMLPVTNVKVRFYVPETVVGALKNGQAVHIRCDGCAAPVAAKITYISNE
                     AEFTPPVIYSNETRRKLVFLIEARPDPAEAPKLRPGQPVEVTQS"
     gene            complement(370664..371356)
                     /locus_tag="Rmet_0351"
     CDS             complement(370664..371356)
                     /locus_tag="Rmet_0351"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, TetR-family"
                     /protein_id="ABF07237.1"
                     /translation="MPAKSSSDPSPAPRQRRPGRPTANANDADQRNRLIDAAVTLFAR
                     HGVAATSTKAIAAEAGVTPALVHYYFHDRELLLDAVFDERLEPLFEQVFETLAGHAGD
                     IVTVIPALAGQLIRTASATPWFPGLWIREIVGTDGHLRERMVERVALRRASLIMGPLA
                     AAHAQGKLTPGLEPALVMVSLIGLALLPPATTHIWRSLPGAADIDTETLVRHVTTLLT
                     HGLSAGTPSQDK"
     gene            371486..372964
                     /gene="oprB"
                     /locus_tag="Rmet_0352"
     CDS             371486..372964
                     /gene="oprB"
                     /locus_tag="Rmet_0352"
                     /codon_start=1
                     /transl_table=11
                     /product="Carbohydrate-selective porin"
                     /protein_id="ABF07238.1"
                     /translation="MGLWLSCPPIHWMPACAHPLPPIPMSRSCPPAAPQRLRPSFARR
                     FAVPFAALLVAGGLALPWAAQAQEATGPGQEAVSDVESPFAIHGQTTYIWQRKPSFGA
                     GYSGENSLTPDRAKSYSFTATLDLGLRLWQGAEFHFNPEVAQGVPFSELHGVGGPSNG
                     ELAKTASTNPKFYRARAFIRQTWGLGGGEEKLEADFNQFARTVDKQRVVLTAGNFSVL
                     DVFDQNPYGSDPRTQFMNWSFLTHGSFDYAADARGYNWGASVEYIGDGWSARFGRFLQ
                     PLESNGQELDTRMFEHYGDVLELEKRYQIGGRPGQARLLLWRNKAKMGAFNDAIAFGL
                     ANNVTPDVADVRREHAKVGVGLAFLQEVNDSLGLFLRANWSDDKTETYAFTEIGRQVA
                     WGGTLKGTAWGRPKDEVGLGMAINMLGSNHRNYLAAGGLGAFLGDGALNYGPEQVFEI
                     YYSFAVWKTLSLSPDFQYMRNPGYNRDRGPAKFIGIRAHAEF"
     gene            complement(372977..373810)
                     /gene="queF"
                     /locus_tag="Rmet_0353"
     CDS             complement(372977..373810)
                     /gene="queF"
                     /locus_tag="Rmet_0353"
                     /EC_number="1.7.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent 7-cyano-7-deazaguanine reductase
                     (NADPH- dependent nitrile oxidoreductase)"
                     /protein_id="ABF07239.1"
                     /translation="MTLPEHSPLGKPSAYKTEYDASLLFPIPRQPKRAEIGLPEGRAL
                     PFFGVDIWNAYEVSWLNLKGKPQVALATFIIPADTPNIVESKSFKLYLNSFNQTKIAS
                     PEALQQLLHHDLSEATGGTVQVRLVTEADLGTQKMGELDGLLLDRLDIETDIYEPDPT
                     LLSAEQEESPVEETLVSHLLKSNCLVTGQPDWGSVQIRYVGAPIDQEGLLKYLISFRN
                     HNEFHEQCVERIFTDVMRMCKPVKLAVYARYTRRGGLDINPFRTNYNTPWPDNRRNAR
                     Q"
     gene            complement(373822..375519)
                     /gene="ilvA"
                     /locus_tag="Rmet_0354"
     CDS             complement(373822..375519)
                     /gene="ilvA"
                     /locus_tag="Rmet_0354"
                     /EC_number="4.3.1.19"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine deaminase"
                     /protein_id="ABF07240.1"
                     /translation="MSAGRCPTTVAVTAPVARQLPTWHCQVRHPLSLAVSADFSGFFA
                     AAPRRRTPQTMTRTPAKPDYLKKILTAKVYDVAQETELTYAPALSARTGNAVWFKRED
                     TQPVFSFKLRGAYNKMASLTPEELKRGVIAASAGNHAQGVALAAARMQCKAIIAMPTT
                     TPQVKIDAVRERGGEWVQIVLHGESYSDAYLHAAELEKKHKLAFIHPFDDPEVIAGQG
                     TIAMEILRQHPGPIHAIFVAIGGGGLISGIAAYVKAVRPEIKVIGVQTFDSDAMKRSV
                     DAGKRVELKDVGLFSDGTAVKLVGKETFRITRELVDDIILVDTDAICAGLKDVFQDTR
                     SILEPAGALAVAGLKAYAEREKLKHQHLVAIACGANMNFDRLRFVAERAEVGEAREAV
                     FAVTIPEERGSFKRFCEQVGTRSVTEFNYRIADKGVAHIFVGVQIASRAESDKIAANF
                     RRHGFDTLDLSNDELAKQHIRYMVGGHSPLAHDELLYRFEFPERPGALMKFLSSMSPN
                     WNISLFHYRNQGADTSNILVGIQVPKNEKRAFRSFLSTLGYVHWDETDNPVYKLFLS"
     gene            375533..376351
                     /gene="otsB"
                     /locus_tag="Rmet_0355"
     CDS             375533..376351
                     /gene="otsB"
                     /locus_tag="Rmet_0355"
                     /EC_number="3.1.3.12"
                     /codon_start=1
                     /transl_table=11
                     /product="trehalose-phosphatase (Trehalose 6-phosphate
                     phosphatase) (TPP)"
                     /protein_id="ABF07241.1"
                     /translation="MLRSCVMSSLPLIEPDTALFLDFDGTLADLAPRPELVQVEPELV
                     GTLRALHTCLDGALAIISGRPVAELDGFLQPLRLPAAGVHGAELRHDGEALFMPPAPG
                     ITALMPRLEAFVARHPGLRIERKSVAVAIHYRQAPELEAQVRAMVADTLHDVDGLEGL
                     PGKMVVEIKPAGVDKGGAIAAFMRMAPFEGRKPLFAGDDVTDEAGFVVARELGGVGVL
                     VGERATAATVSVTGPAALRCWLHRSAHALLALRAQRGGKPQSVSSTSSETEDSL"
     gene            376348..378210
                     /locus_tag="Rmet_0356"
     CDS             376348..378210
                     /locus_tag="Rmet_0356"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycoside hydrolase, family 15"
                     /protein_id="ABF07242.1"
                     /translation="MNAPPTPAAHHPEAPAFNTDTNCTGRHADPSLSLGMIGNCAFSA
                     LVDGRGRIVWCCLPRYDADPVFNALLDSSENGGHFSIEVEDLAKSTQWYEPNTAILRT
                     RLYDKHGHCLEITDFCPRFFRLGRYFRPLTLVRRIRPVRGAPRVRVTVAPRFNWGRIK
                     PQMTRGSSHVRYIGEDLTLRMTTDAPLAYVLSNTPFLVTRNYNFILGPDETLAHGVEE
                     TARDFEQETTSYWRIWSRRLAVPREWQDAVIRAAITLKMSLYEETGAIVAAMTTSIPE
                     APGSGRNWDYRYCWLRDAFFVVRALNSLSEVGTMEDYMRWLTNVVVQAQDGHIQPLYG
                     IGLERELPESVLDHLGGYRNMGPVRVGNQAQEHFQHDVYGNVVLGAAQAFHDHRLLHR
                     GGLTEFHRLEDVGEQAVRVFGTPDAGMWELRTRARVHTSSALMSWAACDRLAKIATKL
                     EHPQRAAYWAEHADRMKQRILAESWSESRQAFAESFGGNVLDASVLLMAEVNFIDPKD
                     PRFIATLKALEETLCDGPYMRRYEAPDDFGKPETAFNICTFWRIDALARIGRREEARE
                     IFEAMLAARNPLGLLSEDTHPVTGEMWGNFPQTYSMVGLINGAVRLSAPWDSVI"
     gene            378242..379636
                     /gene="otsA"
                     /locus_tag="Rmet_0357"
     CDS             378242..379636
                     /gene="otsA"
                     /locus_tag="Rmet_0357"
                     /EC_number="2.4.1.15"
                     /codon_start=1
                     /transl_table=11
                     /product="trehalose-6-phosphate synthase"
                     /protein_id="ABF07243.1"
                     /translation="MGRLVAVSNRVADPRNHAAGGLAVALSDTLNKTGGLWFGWSGKV
                     VDASRGGTPGEGELHQIQAGNVTLATVDLSREDFESYYLGYSNGVLWPVFHYRVDLAD
                     FDSGGNLNAYRRVNQLFARKLAPLLKPDDVIWIHDYHLIPLAAELRAIGCGQRIGFFL
                     HIPLPPRLILATIPQHEWLMRALFAYDLLGFQSHDDVEHFSRYVQGEAGAEPMGEYRF
                     RAFHRTVRAQAFPIGIDVDEFIELGRADEARETYEMMRGQYARRRLLLGIDRLDYSKG
                     LPQRLKAFQTLLAEYPENRSSATLIQIAAPSRESVDAYADLRRDMEGITGAINGEYGE
                     LDWMPVRYIHRSTARRRLPGLCRACNVALVTPLRDGMNLVAKEYIAAQDPEDPGVLVL
                     SRFAGAAEQLKEALLVNPYDTRATAQAIQQALHMSLSERQARHQKLLERIRQQDVHWW
                     SGEYLRALMETEGG"
     gene            complement(379683..380279)
                     /locus_tag="Rmet_0358"
     CDS             complement(379683..380279)
                     /locus_tag="Rmet_0358"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07244.1"
                     /translation="MTKPVLSQSDLPIGILLAAGFGRRFDPAGARNKLLEKLPDGRTV
                     AWRSARTLAAALPGSIAVVRPGNPELSEELRRGGCKVVESADAEAGMGAALRAGVTAC
                     ADARGWVVALADMPWLSMELVRAVALTITSRDTIAAPWRDGQRGHPVGFGAAWREELL
                     KLDGDEGARALLKSQPVTRILTDDDGPFRDVDVPGDLK"
     gene            complement(380276..381313)
                     /gene="coxI"
                     /locus_tag="Rmet_0359"
     CDS             complement(380276..381313)
                     /gene="coxI"
                     /locus_tag="Rmet_0359"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon monoxide dehydrogenase accessory protein"
                     /protein_id="ABF07245.1"
                     /translation="MDLEVLKCSVRWQQEGHGVLLVTVVRTWGSSPRPEGAMLAVRDD
                     GHVVGSVSGGCIEDDIIDRVRHEGIHSGLPEAIKYGISAEEAHRFGLPCGGTIELVTE
                     PLSAASGIVDLLDAVENGRLIARTLDMATGAATLGPAEATDGLAFDGKTLLTIHGPRY
                     RMLVIGAGQLSKYLCQIAVGLGFQVTVCDPREEYTETWDIAGVTMVRTMPDDTVMEMK
                     LDERCAVIALTHDPKLDDLALMEALRTPAFYVGALGSRRNNHARRERLKEFDLTELQL
                     ARLHGPVGIYIGSRTPPEIAISILAEVVAAKNHVSLPDILQVEGAKAAREIAAGEAAC
                     PILPTASAAQP"
     gene            complement(381295..381858)
                     /gene="coxG"
                     /locus_tag="Rmet_0360"
     CDS             complement(381295..381858)
                     /gene="coxG"
                     /locus_tag="Rmet_0360"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon monoxide dehydrogenase accessory protein"
                     /protein_id="ABF07246.1"
                     /translation="MTQTQRLPVPQQVAWDALNDTALLKQCIPGCESIEPDGDNAYQL
                     ALTAAVGPVKARFKGRMALQDIQAPESYTIQFDGQGGAAGFGKGSAQVKLTPEGDETL
                     LTYVVHAQVGGKIAQIGSRLVDAAARKMADTFFARFTEAVGGGGANEDDDNTETEQSA
                     DAGKTTDGGDDTGTKRKRSWTAWISKS"
     gene            complement(381855..383141)
                     /gene="coxE"
                     /locus_tag="Rmet_0361"
     CDS             complement(381855..383141)
                     /gene="coxE"
                     /locus_tag="Rmet_0361"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon monoxide dehydrogenase accessory protein"
                     /protein_id="ABF07247.1"
                     /translation="MPRAVPSAPSAPFAPFSRPDTSGTPPPLPMLARNVTHFMRLLRD
                     TGFGLSPAHAVDALEALRHIDIGARDEVRAALAALVLSGPDQRPLFDAAFDLFWRDPD
                     WESKLRAMLLPRVDAGIPPPRRSNRLADALAARQPPSPKPDQPPREERFTAPLTFSDQ
                     ERLAGRDFETLNAEEWRALQHLVRTRRARLALQKTRRLRPSTCGTHADLRASARLAVR
                     QHGEWLRWKYRKRAERKPPVVLLLDISGSMSQYSRAVLYFCHALTQSRERLHVFLFGT
                     RLTNVTRALRERDPDDAVNLITEQVRDWAGGTRIGAALATFNRQWARRTLSGRATVLL
                     VSDGIDLEHIDLLEQEMARLRRFAHRIIWLNPLLRYEGFTPQARGIQAILPHVDALRA
                     AHNLDSLFALESLLADPARVPPVKASRPQPGYPSWK"
     gene            complement(383144..384040)
                     /gene="coxD"
                     /locus_tag="Rmet_0362"
     CDS             complement(383144..384040)
                     /gene="coxD"
                     /locus_tag="Rmet_0362"
                     /EC_number="3.6.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative carbon monoxide dehydrogenase accessory
                     protein, putative chaperone-like ATPase, involved in
                     protein complex assembly"
                     /protein_id="ABF07248.1"
                     /translation="MLPTSIDQTLSLLEKQQYFADRETATVLYLALRMQRPLFLEGEP
                     GVGKTALAQAMARALGTRLLRLQCYEGLDAASALYEWDYPRQIMALRLAEARGERPEQ
                     QSLYHDDYLLKRPLLEALLPDPAAPNVPRVLLIDEIDRADEPFEAFLLEVLSEYQVSI
                     PEIGVVQAERPPLIVITSNRTREVHDALKRRCLYQWMGYPGRDRELQIVAARAPEAAM
                     ALQRQAVDFIHRLRGIDLFKAPGIAEAIDWCRALAALGVTELDPQSVRDTLGVLLKYQ
                     DDLARADGPTIAELLAGAAPAG"
     gene            complement(384117..384917)
                     /gene="coxM"
                     /locus_tag="Rmet_0363"
     CDS             complement(384117..384917)
                     /gene="coxM"
                     /locus_tag="Rmet_0363"
                     /EC_number="1.2.99.2"
                     /codon_start=1
                     /transl_table=11
                     /product="putative carbon-monoxide dehydrogenase
                     (acceptor)"
                     /protein_id="ABF07249.1"
                     /translation="MYAFQYERAADANAAVAKLKADGDAKFLAGGQSLLAAMKLRLAS
                     PSTLVDVSRIPGMNGIRVEGDALVIGAATRHADVAANADVMRRIPALAALANGIGDRQ
                     VRAMGTIGGSLANDDPAADYPAAVLGLNATVVTDRRSIAADDFFKGLYETALEPDELI
                     TAVRFPSPDQAAYIKFRNPASRFALVGVMVARTGKTVRVAVTGAADSVFRAPALEQAL
                     AASFTPAAARAVKMDPSGLNVDLHASAEYRAHLIPVLAARAVEQALKG"
     gene            complement(384934..387312)
                     /gene="coxL"
                     /locus_tag="Rmet_0364"
     CDS             complement(384934..387312)
                     /gene="coxL"
                     /locus_tag="Rmet_0364"
                     /EC_number="1.2.99.2"
                     /codon_start=1
                     /transl_table=11
                     /product="putative carbon-monoxide dehydrogenase, large
                     subunt"
                     /protein_id="ABF07250.1"
                     /translation="MNAPEKLIGSPVRRKEDYRFLTGNGQYTDDVVLPHQSYGYFLRS
                     PHAHARIKSIDTSEAAASPGVIAVLTGDDMAADKVGGLPCGWLIHSIDGSPMKEPPHP
                     SLAHGKVRHVGDQVALVVAESLQQARDASEKIVVDYEELPAVIGLANASSAASLVHDD
                     VPANTCYTWGHGDKAATDAAFAKAAHVTTLQIVNNRLIPNAIEPRAVNASYTRQDDGY
                     TVYVANQNPHVERLLMGAFVLGLPESRLRIIAPDVGGGFGSKIFLYPEDVALTWASKK
                     VGRPIKWTAERSESFLTDAHGRDHVTKAELALDADGNFLAMRVHTIANMGAYLSTFAS
                     SVPTILYATLLAGQYATPAIYAEVHAVFTNTSPVDAYRGAGRPEATYVVERLVEAAAR
                     ETNVDPATLRRKNFIRTFPYATPVGLTYDTGDYEPCLARAEELADVAGFPARRAEAKQ
                     RGKLRGLGYSCYIEACGLAPSNIAGALGARAGLFEVGEIRVHPTGTVTVFTGSHSHGQ
                     GHETTFAQIVADRLGIALDAVEIVHGDTGRVPFGMGTYGSRSLAVGGSAIMKALDKIE
                     AKAKKIAAHLLEASDADIEFKDGVFRVAGTDRTKTFGEVALTAYVPHNYPLDKLEPGL
                     NENAFYDPTNFTYPSGAYICEVEVDPDTGESHVVKFTAVDDFGNVINPMIVEGQVHGG
                     IGQGLGQAMLEQCVYDPESGQLLTGSYMDYAMPRAGDLPDFTVETSTGTPCTHNPLGV
                     KGCGEAGAIGSPPAFINAMVDALSPLGVHDLQMPATPHRVWQAIQSAQSGTA"
     gene            complement(387324..387845)
                     /gene="coxS"
                     /locus_tag="Rmet_0365"
     CDS             complement(387324..387845)
                     /gene="coxS"
                     /locus_tag="Rmet_0365"
                     /EC_number="1.2.99.2"
                     /codon_start=1
                     /transl_table=11
                     /product="putative carbon monoxide dehydrogenase, 2Fe-2S
                     iron-sulfur small subunit"
                     /protein_id="ABF07251.1"
                     /translation="MRAPTQETSMAIPIRLTVNGKPVDAQVEPHTLLVQFLREHLRLT
                     GTHVGCDTAQCGACTVHLDGRAVKSCNVLVVQADGGSVTTIEGLAVNGEMHPVQQAFR
                     ECHGLQCGFCTPGMVMAATALLKDRPNADAQAIRDQLEGNLCRCTGYHNIVRAVQQGQ
                     AAMQGSAAVASAE"
     gene            388068..388646
                     /locus_tag="Rmet_0366"
     CDS             388068..388646
                     /locus_tag="Rmet_0366"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07252.1"
                     /translation="MDAFIHWLFDTLALPTVGLPAIFVVSLVSATLLPLGSEPAVFGY
                     VKLNPDMFWPAVLVATLGNTVGGAIDWWMGYAAKLAVVRYRLRRQNRQHEREHEQHLE
                     HPKKASKPALDAKYFRWMRRWGPPTMLVSWLPGIGDPLCTLAGWLRMPFWPSVGYMAI
                     GKFLRYLAMTGSLLWIPDSFWHGVGQIFHRLF"
     gene            388816..392790
                     /locus_tag="Rmet_0367"
     CDS             388816..392790
                     /locus_tag="Rmet_0367"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative Fe-S oxidoreductase FAD/FMN-containing
                     dehydrogenase oxidoreductase protein"
                     /protein_id="ABF07253.1"
                     /translation="MNAPLVLDAKLAAKDAPPRLREIPYNYTSFSDREIVIRLLGEEA
                     WRILDELRGERRTGRSARMLYEVLGDIWVVRRNPYLQDDLLENPKRRQMLVSALHHRL
                     GEIEKRRAADRAEHAEPAAEDRSHRVEQLVAFAKQAIEAFKQEFSDAYALRKRAQRVL
                     GKVTQHDNIKFDGLSRVSHVTDATDWRVEYPFVVLTPDTEEEIAGLVKGCFELGLTII
                     PRGGGTGYTGGAVPLTPFSAVINTEKLEQLGEVEQTDLPGVSRKVATIFSGAGVVTRR
                     VADAADKAGLVFAVDPTSIDASCIGGNVAMNAGGKKAVLWGTALDNLAWWRMVDPEGN
                     WLEITRMDHNLGKIHDVPVATFELKWSDGNRKPGEKVLRTETLAIEGRKFRKEGLGKD
                     VTDKFLAGLPGVQKEGCDGIITSARWVLHRMPKHMRTVCLEFFGQPRDAIPSIVEIKD
                     FLDGESKREGGAILAGLEHLDERYLRAVGYATKSKRNAFPKMVLIGDIVGDDEDAVAR
                     ATSEVIRMANGKSGEGFIAVSPEARKKFWLDRSRTAAIARHTNAFKINEDVVIPLPRM
                     GEYTDGIERINIELSIKNKLKLTDELEAFFARGNLPLGRSDDANEIPSAELLEDRVQH
                     ALTLLREIRARWRYLQDHLDTPLAAARAALIGHGLGLLGPAFEQRLQTQPDATVFHLM
                     QDRTIRVSWKNEIRAELRKIFSGGEFKPILDEAQKIHKQVLRGRVFVALHMHAGDGNV
                     HTNIPVNSDDYDMLQDAHRAVARIMTLARSLDGVISGEHGIGITKLEFLTEDEISEFR
                     DYKQRVDPQGRFNKGKLLPGADLRNAYTPSFGLMGHESIIMQQSDIGAIAESVKDCLR
                     CGKCKPVCATHVPRANLLYSPRNKILATSLLIEAFLYEEQTRRGVSIKHWDEFSDVAD
                     HCTVCHKCVTPCPVKIDFGDVSMNMRNLLRKMGQKKFNPGTAASMFFLNATNPQTINM
                     TRAAMIGWGYKAQRLGNELLKKFARKQTQHPPATVGKPPVQEQVIHFINKKMPGNLPK
                     KTARALLDIEDNEIVPIIRNPKQTTAETEAVFYFPGCGSERLFSQVGLATQAMLWHVG
                     VQTVLPPGYLCCGYPQRGAGQYDKAEKMVSDNRVLFHRVANTLNYLDIKTVVVSCGTC
                     YDQLAGYEFDKIFPGCRIIDIHEYLLEKGVKLEGVTGTRYMYHDPCHTPIKTMDPTKL
                     VNDLMGGNQGGGKIEKNERCCGESGTLAVTRPDISTQIRFRKEEEMRKGADKLRAGDF
                     NGDVKILTSCPSCLQGLSRYNEDASVTADYIVVEMAKHLLGENWLPEYVAKANAGGIE
                     RVLV"
     gene            392869..393303
                     /locus_tag="Rmet_0368"
     CDS             392869..393303
                     /locus_tag="Rmet_0368"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Histidine triad (HIT) protein"
                     /protein_id="ABF07254.1"
                     /translation="MTRARNCPLCEADGGELVWMGDRARVILVEHDRFPGFCRVVWND
                     HVAELTDLDEHDMAWLMRLVARVERIVREVMTPDKVNLAAFGNMVPHLHWHIIPRYRW
                     DSHFPEAIWAAPQRTADTARVAELADRLPALRAALSALDSAD"
     gene            393454..395364
                     /locus_tag="Rmet_0369"
     CDS             393454..395364
                     /locus_tag="Rmet_0369"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transporter, ATPase and permease
                     components"
                     /protein_id="ABF07255.1"
                     /translation="MSTTPSSVIVPGPAVPAKALKDQSRLRLAATWALIMPYWKSEDR
                     KAGLGLLTLVVALNLGIVYINVLLNEWNRVFYNAIEQRDFVSFKALLLRFSWIAACFI
                     VLAISRQYYQMMLQMRWRTWMTGRFMQRWLGHQAYYRIEQTHSTDNPDQRLADDLRQF
                     TDGALSLSMGLLNSVVTLVSFIGILWVVSGPISLALGGSELTIPGYMVWFAIGYAVVG
                     SLITHFVGRPLIGLSFQQEQYEANFRFMLVRLRENSEPVALYRGEATEQAGLRARFER
                     IRENWNQLMRYTRRLTFVNSGYGQFAIIFPLLVAAPRYFSGKLTLGGLMQINSAFGQV
                     QGALSWFVDSYATLVGWKAAANRLIDFQQAIRVAEREDLTHEGPGDIEVVESTDKADN
                     SITITGLGLALPVRGGPGPDDEGVDPLKRPGQRPLVAPFSLSIGPGERWLVNGPSGCG
                     KSVLFRALAGIWPYGHGQITVPHKRMLFLPQRSYLPIGTLADALSYPDAGNAHSREAL
                     ANVLRQARLGMLIKHLDVFDNWSLRLSPGEQQRLAFARALLQKPDYLFLDEATSALDE
                     ETEGAMYRLMVETLPDAAIISIAHRSTVAAFHDRRLHYLPVGDASDESGGGPRDGQLE
                     GGGVSYRVVQDA"
     gene            395435..395851
                     /locus_tag="Rmet_0370"
     CDS             395435..395851
                     /locus_tag="Rmet_0370"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07256.1"
                     /translation="MAGLEKDTPHPTALTVHTQSRVLEIGFDNGNTWRLPFELLRVYS
                     PSAEVQGHGPGQETLQTGKRDVGIAAVEPVGNYAIQIRFDDGHDTGIYSWELLYRLGD
                     QQEALWADYLKRLADAGLDRDAPMAAAGGHACGHHH"
     gene            395887..396618
                     /gene="ubiE"
                     /locus_tag="Rmet_0371"
     CDS             395887..396618
                     /gene="ubiE"
                     /locus_tag="Rmet_0371"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional
                     2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
                     S-adenosylmethionine:2-DMK methyltransferase"
                     /protein_id="ABF07257.1"
                     /translation="MSETHFGFEKVDESEKAGKVAGVFHSVASKYDVMNDLMSGGMHR
                     LWKVFTIAQANVRPGQKVLDIAGGTGDLAKAFAKQAGPTGEVWLTDINESMLRVGRDR
                     LLNKGVVTPVALCDAERIPFPDNYFDLVTVAFGLRNMTHKDAALAEMRRVIKPGGKVM
                     VLEFSKVWKPLEKFYDVYSFKVLPWLGERVAGDAPSYRYLAESIRMHPDQGSLVRMME
                     QVGLEQVEYFNLTAGVVALHVGRKY"
     gene            396681..397670
                     /locus_tag="Rmet_0372"
     CDS             396681..397670
                     /locus_tag="Rmet_0372"
                     /codon_start=1
                     /transl_table=11
                     /product="import inner membrane translocase, subunit
                     Tim44"
                     /protein_id="ABF07258.1"
                     /translation="MSSFRGKFLAMSLIATLALGAALDANAKRLGGSRSIGKQSSGVT
                     QQRQQAPAQQNTPPAQQPAQAAPATAGAAGAAGGAAAAAAPKRNWGGMLGGLAAGLGI
                     GYLLSHFGLGGAAASILSNVILFGVIALIAMWLIRKFRGGSARTQQPSYAGMGGNGSN
                     YGGPSHAEPTLRTAEPVGNGGAASNPVMGGAAAAATAAAVQQPWGVPADFDTESFLRN
                     AKVHYVRLQAAWDAGNQDDIREFTTPEMFAEIKMDLSERGSEVNKTDVVTLDAQLLGI
                     ESTPAQHIASVRFSGMIREKAGEPAQPFGEVWNLAKATSGNGGWLLAGIQQES"
     gene            397791..398462
                     /locus_tag="Rmet_0373"
     CDS             397791..398462
                     /locus_tag="Rmet_0373"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07259.1"
                     /translation="MNALPTPLAAPIVAALNHLIEQEPWACSLLTPFAGRVIRFDASA
                     FALSLKVTEQGGIDQAPEAEAAAVTLIVPLQQWPLVVADVAEGGQAAAMRHVRIDGDA
                     ELANVVSTLARNLRWDAAEDLSRALRGVMGGPVSDSVAQRVVEGARQVHESATRAGRA
                     LLDNVTEYLLDEQPTLVRHAALEGFGDDLARLRDDLARLEKRLERLERAPGAGSPDAL
                     PSAHR"
     gene            398504..400081
                     /gene="ubiB"
                     /locus_tag="Rmet_0374"
     CDS             398504..400081
                     /gene="ubiB"
                     /locus_tag="Rmet_0374"
                     /codon_start=1
                     /transl_table=11
                     /product="Probable ubiquinone biosynthesis protein ubiB"
                     /protein_id="ABF07260.1"
                     /translation="MTRLLRLCKILFVILYYGLDELVLSGFKNRRIKFLVRVITIGRK
                     LDQPRGERLRMALTALGPIFVKFGQVLSTRRDLMPPDIADELAKLQDQVPPFESAVAV
                     KIIEKSLGRRLTELFETFEHEPVASASIAQVHFATLRGGPSHGREVAVKVLRPGMLPV
                     IDSDLALMRDMATWLERVWVDGRRLKPREVVAEFDKYLHDELDLMIEAANASQLRRNF
                     AESDLLCVPEVFWDWCTSSVFTMERMHGIPISRTESLKAAGVDMHKLAEEGVEIFFTQ
                     VFRDGFFHADMHPGNILVSVRPETFGRYIALDFGIVGALSEFDKNYLAQNFIAFFRRD
                     YHRVALLHVESGWVPPETRVEELESAVRACCEPYFDKPLREISLGMVLMRLFQTSRRF
                     NVEIQPQLVLLQKTLLNIEGLGRQLDPDLDLWKTAKPFLERWMYEQVGWQGAWERIKI
                     EAPQWAKMLPDFPRLAHQFLERRALQNNEGQERLLTQLVAEQRRTNRRLSTALLLMGG
                     FLAGIVIVQALAWAGYW"
     gene            400091..400324
                     /locus_tag="Rmet_6412"
     CDS             400091..400324
                     /locus_tag="Rmet_6412"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADC45030.1"
                     /translation="MKRRWFPLSPAGGGRGEPPYNTQVNQDGDLPALGGIFAPRMGAR
                     RYNPRFDSATTAKCPPGRPRPRPMNWTPAGPNP"
     gene            400416..401852
                     /locus_tag="Rmet_0375"
     CDS             400416..401852
                     /locus_tag="Rmet_0375"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Na+/solute symporter"
                     /protein_id="ABF07261.1"
                     /translation="MLIWFVIIYWIISVGIGLWAALRVKGTADFAVAGRSLPFYIVTA
                     TVFATWFGSETVLGIPAVFLKEGLSGVVSDPFGSSLCLILVGLFFARPLYRMNLLTIG
                     DYYHNRYGRLAEVLTTLCIVVSYLGWVAAQIKALGLVFYTVSDGALSQDAGMMIGAAS
                     VLVYTLFGGMWSVAVTDFIQMIIIVIGMLYIGYEVSGQAGGVTAVVSHAAAAGKFEFL
                     PSLDLVQIIGFAAALFTMMLGSIPQQDVFQRVTSSRTEQIAGRASVLGGVLYFFFAFI
                     PMFLAYSATLIDPAMVEKYINSDSQLILPQLILTHAPMFAQVMFFGALLSAIKSCASA
                     TLLAPSVTFAENILRPYFRHLADKQFLRVMQVVVLVFTSLVTLFALNSHLSIFHMVEN
                     AYKVTLVSSFVPLAFGMFWKPATRQGGLAAILLGLASWLTCEIAFADATVPPQMVGLL
                     FSISGMVFGSLLPQWISDRPPVREVHIA"
     gene            402076..402405
                     /locus_tag="Rmet_0376"
     CDS             402076..402405
                     /locus_tag="Rmet_0376"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07262.1"
                     /translation="MPIYAYRCDACGYGRDVLQKMSDAPLTDCPSCGAAGTYKKQLTA
                     AGFQLKGSGWYVTDFRGGSGGTSAPATSGNATAPAAPAASAESSTASTTSAAPAAGGC
                     GDSCACH"
     gene            402420..403127
                     /locus_tag="Rmet_0377"
     CDS             402420..403127
                     /locus_tag="Rmet_0377"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07263.1"
                     /translation="MVTKKTSALKTWFLTGLLVLVPLGITLWVLNAVISTMDQSMALL
                     PLAWQPENLFGLRIPGLGAILTLLFILVVGVLAHNFIGQRLVKWWEALLRHIPVVGPI
                     YTSVKQVSDTLLSSSGNAFRKALLVQYPREGSWTIAFLTGRPGGDVQNHLQGDYVSVY
                     VPTTPNPTSGFFLMMPRADTIELDMTVDAALKYIVSMGVVAPADLPRKSGADTRPAHG
                     AVADADADDAVADTHTN"
     gene            403176..404984
                     /gene="aspS"
                     /locus_tag="Rmet_0378"
     CDS             403176..404984
                     /gene="aspS"
                     /locus_tag="Rmet_0378"
                     /EC_number="6.1.1.12"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl-tRNA synthetase"
                     /protein_id="ABF07264.1"
                     /translation="MSSMRTHYCGLVTEQLIGQEVALTGWVQRRRDHGGVIFIDLRDR
                     EGLVQVVCDPDRPEMFKAAEEIRNEFCIRITGKVRPRPAGTENANLTSGKIEVLCHEL
                     TVLNPSVTPPFQLDDDNLSETTRLTHRVLDLRRPQMQYNLRLRYKVAMEVRKYLDAQG
                     FIDIETPMLGKSTPEGARDYLVPSRVNPGHFFALPQSPQIFKQMLMVSGFDRYYQITK
                     CFRDEDLRADRQPEFTQIDCETSFLTEQEIRDLFEDMMRTVFKNAIDVDLDAKFPVME
                     FREAMARFGSDKPDLRVKLEFTELTEVMKDVDFKVFSGPANSDNGRVVGLRVPGGGAI
                     SRGEIDAYTQFVAIYGAKGLAWIKVNEVAKGRDGLQSPIVKNLHDAAIAEILKRTGAQ
                     DGDIIFFGADKAKIVNDAIGALRLKVGHSEFGKSTGLFEDTWKPLWVIDFPMFEYDEE
                     DARWVAMHHPFTSPKDEHLQYLETDPGKCIAKAYDMVLNGWEMGGGSVRIYREDVQSK
                     VFRALKINDEEARAKFGYLLDALQYGAPPHGGLAFGLDRIVTMMAGADSIRDVIAFPK
                     TQRAQDLLTQAPSTVDEKQLRELHIRLRAQEPKTTA"
     gene            405163..406098
                     /locus_tag="Rmet_0379"
     CDS             405163..406098
                     /locus_tag="Rmet_0379"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07265.1"
                     /translation="MNLDTELIRAFLQVHAETILTWLAAGLLMMLLARFELRRAVRKS
                     AQAMSQSVAATVAACVPDIAHAAQQGHTVPGELAATGTEPVATQRADALRKLALDTVA
                     TVMTRGRWLEDVGNLRLGEDALLSGRRAGGADPLLVVAPQPVVQAYLNAQRTFDDEAT
                     TLQNHRREALRLQEALQALNAEAAHVEQETASIVMRFEQVNAQVAQGVEAGDYQRFLI
                     QKYNQLGVREKEIGQERASMAAQAREAADALASLAHTASQRYTQALAPLMQQLRSAWG
                     HGDSPEVFDTWLRAAPAAQPGDRQATIRPGEHTLA"
     gene            406145..406666
                     /gene="ntpA"
                     /locus_tag="Rmet_0380"
     CDS             406145..406666
                     /gene="ntpA"
                     /locus_tag="Rmet_0380"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="dATP pyrophosphohydrolase protein"
                     /protein_id="ABF07266.1"
                     /translation="MLWFVPAALPMRYKIPESVLVVIHTPDLQVLLIERADRPGYWQS
                     VTGSLDAEDEPLPMTAAREVAEETGLIASRYSLTDWQHTIDYEIYPQWRHRYAPGITR
                     NTEHWFGLCVPAPMPVTLAPREHLRFEWLPWQAAAARCFSSSNAEAVRQLAWRVAGGQ
                     GAGLDVTNGAAAP"
     gene            406663..407418
                     /locus_tag="Rmet_0381"
     CDS             406663..407418
                     /locus_tag="Rmet_0381"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative endonuclease/exonuclease/phosphatase
                     protein"
                     /protein_id="ABF07267.1"
                     /translation="MKLRVVTYNIHKGVKGFTGKPRIQSVRTGLQSMDADIVFLQEVQ
                     DRNDRLIAAELFDPDHTQLNYLATDAYPHSVYGRNAVYDHGHHGNAILSRHPILMSEN
                     LDISDHRFEQRGLLHAVADINGVEAHLICVHFGLFAGSRVRQTTALVERVRSVVPADA
                     PLVIAGDFNDWNHKLDSKICNTLNAVESANAKNGRIHTFPSHMPWWQLDRIYARGFEF
                     ERTQALTGREWAQRSDHVPLMAELARRVAIPEV"
     gene            complement(407435..407944)
                     /gene="mobB"
                     /locus_tag="Rmet_0382"
     CDS             complement(407435..407944)
                     /gene="mobB"
                     /locus_tag="Rmet_0382"
                     /EC_number="1.5.3.4"
                     /codon_start=1
                     /transl_table=11
                     /product="Molybdopterin-guanine dinucleotide biosynthesis
                     protein B"
                     /protein_id="ABF07268.1"
                     /translation="MKVFGIAGSSGSGKSTLLDQLIPRFVADGLRVAGIKHTHHGFDP
                     DTPGKDSWRMREGGCQNVVLVGARHLTLMRHYPEEKPSPEIGEALSVLPPDTDLVMVE
                     GYKWSDFPKLEIYRPANGKAPLWTDVPGVVAVATDVPEEVSRQTTLPVLNLSDVDAIY
                     AWIRGYLDR"
     gene            408002..409387
                     /locus_tag="Rmet_0383"
     CDS             408002..409387
                     /locus_tag="Rmet_0383"
                     /EC_number="2.7.8.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative phospholipase d/transphosphatidylase"
                     /protein_id="ABF07269.1"
                     /translation="MCRSRPFADNRAMSRINDRVSPPTSSAPGTPESPSSALHQEVGD
                     PAATTVANATAPLMRWVRRRGSPVQGNLVDLLSNGQEYFPALIEAIDAARVHVVLETY
                     IYADDDVGALVTDALIRAAQRGVDVRLVVDGFGAGDLPATLASRLRDGGVRLEVFRPV
                     RGFRLARRHLRRLHRKMAVIDDSVAFVGGINIIDDHNYGPLELPEVGPRYDFAVRVRG
                     PLVAQIALASARLWFRMAQQRGLRETATAFTEVETLTTAARQARREHHAGGVAAALLL
                     RDNLRNRRTIEREYLYALGAARHDVIIANAYFLPGTKMRRALLACRERGVRVRLLLQG
                     MVEYRLQHFATHALYARLLEAGIEIYEYEASFLHAKVAVIDNSWATVGSSNLDPFSLL
                     LAREANVAVYDPSFAGVLRARLERAMAQRSARVVPEVHARLPRLRRFANWAAYYVLRL
                     GVVIAGVTGRY"
     gene            409722..410360
                     /locus_tag="Rmet_0384"
     CDS             409722..410360
                     /locus_tag="Rmet_0384"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator,
                     TetR/AcrR-family"
                     /protein_id="ABF07270.1"
                     /translation="MRHQSVRLESAAAPAPLRKGEMTRVAILDAALELSSRDGLEGLT
                     IGLLAERMQMSKSGVFAHFGSREDLQVEVVREYHRRFEQEVFYPSLQEPRGLPRLWSM
                     VRRWMEKRIQEVTTGCIYISGAVEYDDRAESPVRDELVKSVTIWRAALMRAIDQAKEE
                     GHLRADCDPRLMLFEMYSLELGLHHDARFLRLPDSAELAMVALNKLIQSYRT"
     gene            410451..412238
                     /locus_tag="Rmet_0385"
     CDS             410451..412238
                     /locus_tag="Rmet_0385"
                     /EC_number="1.3.99.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Acyl-CoA dehydrogenase"
                     /protein_id="ABF07271.1"
                     /translation="MGQYTAPLRDMQFVLHELLGAEAELKAMPQHADIDVDTINQVLE
                     EAGKFCSDVVFPLNQPGDREGCTYVGDGVVRAPKGFKEAYQQFVEAGWPALACDPEFG
                     GQGLPIMINNALYEMLNSAGQAWTMYPGLSHGAYEALHAHGTPELKQTYLPKLVSGVW
                     TGTMCLTEPHCGTDLGILRSKAEPQADGSYSITGTKIFISAGEHDMAENIIHLVLARL
                     PDAPGGTKGISLFVVPKFIPDANGNPGERNGIKCGSIEHKMGIHGNATCVMNLDGARG
                     WMVGEPNKGLNAMFVMMNAARLGVGAQGLGLTEVAYQNSLAYAKDRLQMRSLTGPKAP
                     DKPADPIIVHPDVRRMLLTQKAYAEGGRAFAYWTALQIDRELSHPDESVRKEAGDLVA
                     LLTPVIKAFLTDNAFTSTNEGMQVFGGHGYISEWGMEQYVRDARINMIYEGTNTVQSL
                     DLLGRKVLGDMGAKLKAFGKIVQTFVEEEGTSEAMQEFVNPLADIGDKVQKLTMEIGM
                     KAMGNADEVGAAAVPYLRVVGHLVFSYFWARMAKIALDKQDSGDKFYTTKLATARFYF
                     AKLLPETAGEIRKARAGASTLMALDADLF"
     gene            412352..414778
                     /locus_tag="Rmet_0386"
     CDS             412352..414778
                     /locus_tag="Rmet_0386"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative 3-hydroxyacyl-coa dehydrogenase
                     oxidoreductase protein"
                     /protein_id="ABF07272.1"
                     /translation="MSNFIVKKVAVLGAGVMGAQIAAHLINARVPVILFDLPAKEGPK
                     NGIADRAIENLKKLSPAPLGIKEEAGLIRAANYEDDIALLKECDVVIEAIAERMDWKH
                     DLYKKVSPHLAPNAIFATNTSGLSITALSDGFDADLKSRFCGVHFFNPPRYMHLVELI
                     PTATTKPEILDRLESFLTTSLGKGVVRAKDTSNFIANRVGIFSILAVFAEAEKFGIPF
                     DIVDDLTGTKLGRAKSATFRTADVVGLDTMAHVIKTMQDNLTDDPFAPVYKTPAVLKG
                     LVDAGALGQKTGAGFYKKEGKAIKVLDAKSGQYVESGKKADEIVVRILKKEPAERIKL
                     LRESTNPQAQFLWGVFRDVFHYIAVYLEQIAGSAADIDLAIRWGFGWNSGPFEDWQAA
                     GWKQVAEWVKEDVEAGKALSNAPLPAWVLNGAVAENGGVHGAQGSWSPAASAFVKRAE
                     LPVYQRQVFRAALKGTDSPDPRRAGKTIEENDGARIWTTDGADDVLVISFKSKMNTVG
                     PDVLDTIVRAVELAEASYKGLVVWQPTSLQLGAPGGPFSAGANLEAAMPAFMMGGAKG
                     IEPFVKKFQDTMMRVKYAAVPVVPAVSGIALGGGCELMLHSAKRVVALESYVGLVEVG
                     VGLVPAGGGLKEAAIAAAKAAQAAGSTNYLNFITNRFQAAAMAKVSSSALDAQKIGYV
                     QPTDTIVYNVHELLYVAQNEVRALANAGYRAPLPGQLIPVAGRSGIATIKASLVNMRD
                     GNFISAHDFLIASRIAEVVCGGDVEAGSLVSEDWLLALERRAFIDLLGNGKTQERIMG
                     MLQTGKPVRN"
     gene            414803..415999
                     /gene="fadA"
                     /locus_tag="Rmet_0387"
     CDS             414803..415999
                     /gene="fadA"
                     /locus_tag="Rmet_0387"
                     /EC_number="2.3.1.16"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA C-acyltransferase"
                     /protein_id="ABF07273.1"
                     /translation="MKQLQDAYIVAATRSPIGKAPKGAFKNTRPDDLLATILQAAVAQ
                     VPSLDPALIEDAIVGCAIPEAQQGLNVARIGALLAGLPNTVGGITVNRFCASGLSAVA
                     MAADRIRVGESDVMIAAGVESMSMVPMMGNSPSMSPSIFERDENIGIAYGMGLTAEKV
                     ATQWKVSREDQDAFSLASHQKAIAAQQAGEFKDEITPIEVVERFPDLASGQINVKTRT
                     ISLDEGPRPDTSVEGLGKLRAVFANKGSVTAGNSSQTSDGAGALILVSEKILKQFNLV
                     PRARFVSFAVRGVPPEIMGIGPKAAIPAALKAAGLTQDQIDWIELNEAFAAQSLAVMR
                     DLELDPAKVNRMGGAIALGHPLGATGAIRSATVVHALRRHNMKYGMVTMCVGTGMGAA
                     GIFERV"
     gene            416113..417069
                     /locus_tag="Rmet_0388"
     CDS             416113..417069
                     /locus_tag="Rmet_0388"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07274.1"
                     /translation="MQETAILADAACDMPRAMMDALGVRTIPFRIRAGDRFVVDTRDE
                     AELPNLYQKYLVGKQDHYAESIPLLERELEDHLLKNVVAGCDRAILLTIASSRSKLYS
                     NATGAVVGTVARSFKLRKDAGRSGLFDLTVIDTGAIGPGQALIVREAARMLADGASAA
                     SVVDAVENRLRDAAHMFLIPDELLYMYTRAKLKGENSITWSRYMLGSAFNIRPVIHMH
                     RGVTQAIAKARGNEEGVRRLLSHVEACIRADSLLTPAVAACYAGDIDEVESLPAWQSL
                     KHIAASRNVELMLAPMSLTVALNVGAGAFGLSYLSEAPPPFV"
     gene            417104..417880
                     /locus_tag="Rmet_0389"
     CDS             417104..417880
                     /locus_tag="Rmet_0389"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="Enoyl-CoA hydratase/carnithine racemase"
                     /protein_id="ABF07275.1"
                     /translation="MSIATSIDQGVLTIGFDRIDKKNAITAAMYQTMADALRAAETDA
                     AVRVIVIEGKPEVFTAGNDIEDFLKRPPTNGADGAPAPVFQFLQAISRATKPIVASVS
                     GAAVGIGTTLLLHCDLVYASETAKLALPFAQLGLCPEAASSLLLPRMVGYQRAAEKLL
                     LGEAFSAQEAFEIGLVTKVLSVAELQGYVRQQAAKLAVLPASSLRETKRLMKGDDAAA
                     VEKKMLEEGEVFRRMLVAPEAKEAFTAFFEKRKPDFSKFS"
     gene            complement(417962..418435)
                     /gene="yciA"
                     /locus_tag="Rmet_0390"
     CDS             complement(417962..418435)
                     /gene="yciA"
                     /locus_tag="Rmet_0390"
                     /EC_number="3.1.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative thioesterase Protein"
                     /protein_id="ABF07276.1"
                     /translation="MPRLSQRSDNPAGLRFIRPERPAMTTSSFVPELPSGKNPALRVV
                     PMPADANVHGDVFGGWIMSQVDMAGSIPAVERAQGRVATVAVNSFLFKNPVFVGDLVS
                     FYADIVKTGRTSITVSVEVYAQRMRHANEIVKVTEATLTYVATDESRQPRVLPAA"
     gene            418454..420346
                     /gene="atmA"
                     /locus_tag="Rmet_0391"
     CDS             418454..420346
                     /gene="atmA"
                     /locus_tag="Rmet_0391"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transporter, ATPase and permease
                     components: HMT family"
                     /protein_id="ABF07277.1"
                     /translation="MRRYSTTAEPAPAEPANSLFQGGGARRSDWQTVRNLLPYVWHYK
                     WRVMLALTCLVAAKVANLGVPVLMKKLVDSMNIAPGDPAALLAVPVGLIVGYGLLRLS
                     STLFTELREILFSKVTQSAVREIALQVFRHLHALSLRFHLDRQTGGMSRDIERGTRGI
                     QSLISYSLYSILPTLVEMSLVIGFFVVRYDIWFAAITICALAGYIVFTIVVTEWRTHF
                     RRKMNELDSRANQKAIDSLLNFETVKYFGNEEYEARRYDENLRTYRTAAIRSQNSLSF
                     LNFGQQAIIALGLILILWRATVGVAAGKLTLGDLVLVNTLMIQLYIPLNFLGVIYREI
                     KQATTDMDRMFVLLGTQQEVADTPGAPVLAVNGAEVRFRHVGFGYEKNRVILDDVDFT
                     IAAGTTTAVVGHSGSGKSTLARLLFRFYDVTRGSIEVDGQDIRKVRQVSLRASIGIVP
                     QDTVLFNDSIYYNIAYGRPEATREEVIEAARAAQIDTFISELPQGYDTPVGERGLKLS
                     GGEKQRVAIARTLLKNPPILVFDEATSALDSRTEQAIQSELMRLAQNRTTLLIAHRLS
                     TVVHADQILVMDRGRIIERGTHAELMRANGHYAEMWQIQARNAAEGSPDADALAIDVG
                     DATQDA"
     gene            420529..421587
                     /locus_tag="Rmet_0392"
     CDS             420529..421587
                     /locus_tag="Rmet_0392"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, periplasmic component: TauT family"
                     /protein_id="ABF07278.1"
                     /translation="MPQSPLRRHLLKLCTAMGTTMVLSTLCAGTAQAQTATKIRFQLD
                     WRFEGPSALFLLGEQKGYYKAEKLDVSIDAGNGSGNVVNRVASGTYDMGFADLASVME
                     FYGNNPDAKNKPVAVMMVYNNTPAAVLALKKSGIRAPKDLTGKKLGAPVFDAGRRAFP
                     IFAKANGLQAASFNWQAMDPTLRETMLTRGDLDAITGFSFTSILNLNARGVKDEDIVV
                     LPYPQYGVKLYGNAIIASEQFLKAHPEAVKAFLRAFAKSAKDVIANPEEGIKAVKARD
                     GIIDEKLEVRRLKMALDAVVKSPDAKAEGFGRVNKPRLSLMASQVADAFATKGRINPD
                     ALWTDAYLPSAAELDVLR"
     gene            421584..422429
                     /gene="tauB"
                     /locus_tag="Rmet_0393"
     CDS             421584..422429
                     /gene="tauB"
                     /locus_tag="Rmet_0393"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein : TauT
                     family"
                     /protein_id="ABF07279.1"
                     /translation="MMARQALHPATGGASNATRPFVDFNRVWLAYDDDLARRGEFAVE
                     DISLQAAEGEFIAIVGPSGCGKSTFMKLATGLRQATRGAVSINGEKVSGPLKQVGMAF
                     QAPTLLPWRTTLDNVMLPLEIVEPYRSTMRAKRDEYVARARDLLKTVGLAGYEDKYPW
                     QLSGGMQQRASICRALIHQPRMLLLDEPFGALDAFTREELWCVLRDLWQAQRFNVILV
                     THDLREAVFLADTVYVMSARPGRILLRREIDLPRPRPLDVTYSEPFAERVHELREKIG
                     HVRQQ"
     gene            422426..423205
                     /locus_tag="Rmet_0394"
     CDS             422426..423205
                     /locus_tag="Rmet_0394"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transporter, permease component: TauT
                     family"
                     /protein_id="ABF07280.1"
                     /translation="MIMNTMSSIQAKRVQRVAPWLLLGAFLLLWQVACLAFNVSDFIL
                     PSPSSIVASMAEYGDVIAAHAWRTFWTTMVGFGLAIAVGVVLGMLMGSSKLAYAATYP
                     LMTAFNALPKAAFVPILVVWFGLGAGPAILTAFLISFFPIMVNIATGLATLEPELEDV
                     LRVLGAKRRDVLLKVGLPRAMPFFFASLKVAITLAFVGTTVSEMNAANEGIGYLLVSA
                     GSAMKMPLAFAGLVVIAIMAMGMYELFSVLEKRMTGWAHRG"
     gene            complement(423273..423731)
                     /gene="ybaO"
                     /locus_tag="Rmet_0395"
     CDS             complement(423273..423731)
                     /gene="ybaO"
                     /locus_tag="Rmet_0395"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AsnC-family"
                     /protein_id="ABF07281.1"
                     /translation="MDRYDRQILSILQEDATVPVAEIGEQVGLTSTPCWRRVQKLEES
                     GIIRKRVALLDPAKLNVGVTVFVSVRTNQHSEKWLKTFHGLVASIPEVTEFYRMAGDT
                     DYLLRVVVPDIAAYDAVYKKLIQGTELADVSSSFAMEQIKYTTALPLDYA"
     gene            complement(423795..424349)
                     /locus_tag="Rmet_0396"
     CDS             complement(423795..424349)
                     /locus_tag="Rmet_0396"
                     /EC_number="1.13.11.20"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative cysteine dioxygenase type I"
                     /protein_id="ABF07282.1"
                     /translation="MQTSAPCASSGAPEPSPLTPFTSGIEATLAKNARMVAEQVAASL
                     PDAETLLASLPPGAREGSPDTYTRHLVHADPFERFSVMLLVWRPGQFSPVHGHRTWCA
                     YRVLRGTMYERHYRWDPESRTASQVGAVTREAGDTFSVPAGLQHIHALGNASDDVTVS
                     LHIYGVEQSRISTGVNLLVDTVVS"
     gene            424373..424546
                     /locus_tag="Rmet_6413"
     CDS             424373..424546
                     /locus_tag="Rmet_6413"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADC45031.1"
                     /translation="MASIIGGPSEHNDAKFSLEWIGIVILFYWLRIFGNDLARRASGR
                     APGDNPRHGNQMA"
     gene            424482..425471
                     /locus_tag="Rmet_0397"
     CDS             424482..425471
                     /locus_tag="Rmet_0397"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR-family"
                     /protein_id="ABF07283.1"
                     /translation="MRAVRPGGRRVIIRAMEIKWLEDFVSLAETHSFSRSAELRHVTQ
                     PAFSRRIQSLEAWVGTELIDRSSYPTSLTAAGKVFYEQALAMLAQVSETRALMRGQRS
                     ANAQVLEFAVPHTLSLTFFPEWLKGVERKVGTLPCRLRALNVHDAVLMLVEGGCDLVM
                     VYHHSRQAIQLDPAHYDMLVLGTERLSPYSVPDASGRPLFRMPGTDKKPVPYLSYTPN
                     AFLGRMVDMLLAESPETLKLDKCYETDMAEALKVMALAGHGMAFLPESAVREDVAAGR
                     LVRADAAKGLPQSIDMEIRLYRERPPEHANERRGSQQRRKRQLVDKIWAALTS"
     gene            425606..426913
                     /gene="gdhA"
                     /locus_tag="Rmet_0398"
     CDS             425606..426913
                     /gene="gdhA"
                     /locus_tag="Rmet_0398"
                     /EC_number="1.4.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate dehydrogenase"
                     /protein_id="ABF07284.1"
                     /translation="MSSAAPTQNVSNGHTLPSYLNADNLGPWGIYLQQVDRVTPYLGS
                     LARWVETLKRPKRAMIVDVPIELDNGTIAHFEGYRVQHNLSRGPGKGGVRFHQDVTLS
                     EVMALSAWMSVKNAAVNVPYGGAKGGIRVDPRTLSHGELERLTRRYTSEINIIIGPSK
                     DIPAPDVNTNAQVMAWMMDTYSMNSGSTATGVVTGKPISLGGSLGRHEATGRGVFVVG
                     SEAARNLGMDVKGARVAVQGFGNVGAVAAKLFHEAGATVVAVQDHRTTLFDPAGLDVP
                     KMMEYASHSGTIEGYRAEVISTEQFWEVDCDILIPAALEGQLTASNAPKIKAKLVIEG
                     ANGPTTPEADDILRERNILVCPDVIANAGGVTVSYFEWVQDFSSFFWTEEEINERLVR
                     IMQEAFRAIWQVAQDNKVTLRTAAFIVACTRILQAREMRGLYP"
     gene            427217..428116
                     /gene="gltI"
                     /locus_tag="Rmet_0399"
     CDS             427217..428116
                     /gene="gltI"
                     /locus_tag="Rmet_0399"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate and aspartate transporter subunit;
                     periplasmic-binding component of ABC superfamily"
                     /protein_id="ABF07285.1"
                     /translation="MNVAKLAGLMIAAGVLCGNAQAAEQLTGTLQKIKDTGVITLGVR
                     DSSIPFNYNLGGVRQVGYSYDINMKIVEAIKDQLKLPNLQVKEIPITSQNRITLLQNG
                     TIDIECGSTTNNLERQKQVSFTDTIFIIGTRIMVKKDGGIKDWADLKGKNVVTTAGTT
                     SERLLRKMNDDQKLGMNIISTKDHGQSFLTLESGRAVAFMMDDALLYGERAKAKNPND
                     WIVVGKPQSREAYGCMIRKDDAPFKKVSDQVIAGLMKDGSINTMYTKWFMQPVPPKGL
                     NLDFPLSDDMKALFKTPNDKALD"
     gene            428182..428910
                     /gene="gltJ"
                     /locus_tag="Rmet_0400"
     CDS             428182..428910
                     /gene="gltJ"
                     /locus_tag="Rmet_0400"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate and aspartate transporter subunit;
                     membrane component of ABC superfamily"
                     /protein_id="ABF07286.1"
                     /translation="MDYAFHWGVFLEQAAANETYLDWMISGLKVTIALGLSSWIIALA
                     IGSVLGVLRTVPNKWLSGIAATYVEIFRNIPLLVQLFIWYFVGPELLPGGEAIKQMNP
                     FTQQFLAAMLCLGTFTAARVCEQVRSGINSLPRGQKNAGLAMGFTLPQTYRYVLLPMA
                     FRVIVPPLTSEFLNIFKNSAVASTIGLLELAAQGRQLVDYTARPYESFIAVTVLYALI
                     NFTVMLIMRWVERRTRVPGFIGGK"
     gene            428922..429605
                     /gene="gltK"
                     /locus_tag="Rmet_0401"
     CDS             428922..429605
                     /gene="gltK"
                     /locus_tag="Rmet_0401"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate and aspartate transporter subunit;
                     membrane component of ABC superfamily"
                     /protein_id="ABF07287.1"
                     /translation="MAYEFDFSSINPSTLHVLGEGMLVSAKITVTAVIVGIVWGTILA
                     MMRLSSNKLLNWFAQGYVTLFRSIPLVMVLLWFFLIIPQLLQKTFNLSAASDLRMTSA
                     LIAFSLFEAAYYSEIIRAGIQSVSRGQMFAAQAMGMTYGQSMRLVILPQAFRNMVPLL
                     LTQGIILFQDTSLVYVSALADFFGQAYGIGERDGRIVEMLLFAGLIYFIICFSASLLV
                     KRYQKKVAV"
     gene            429602..430336
                     /gene="gltL"
                     /locus_tag="Rmet_0402"
     CDS             429602..430336
                     /gene="gltL"
                     /locus_tag="Rmet_0402"
                     /EC_number="3.6.3.28"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate and aspartate transporter subunit;
                     ATP-binding component of ABC superfamily"
                     /protein_id="ABF07288.1"
                     /translation="MIEINNVSKWYGAFQVLTDCTTKVAKGEVVVVCGPSGSGKSTLI
                     KTVNALEPFQKGDILVDGTSVGNPKTNLPKLRSRVGMVFQNFELFPHLSITENLTIAQ
                     MKVLGRSKDEAMAKGLKYLERVGLKSQAEKYPGQLSGGQQQRVAIARALSMDPICMLF
                     DEPTSALDPEMVNEVLDVMVQLAQEGMTMMCVTHEMGFARKVANRVIFMDAGKIVEDC
                     AKEEFFGNIDARSDRAKQFLSKILHH"
     gene            complement(430457..431287)
                     /gene="yafJ"
                     /locus_tag="Rmet_0403"
     CDS             complement(430457..431287)
                     /gene="yafJ"
                     /locus_tag="Rmet_0403"
                     /EC_number="2.4.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferases class-II"
                     /protein_id="ABF07289.1"
                     /translation="MCQLLGMNCATPTDVTFSFTGFAARGGVTDHHSDGFGVAFFEDK
                     ACRLFIDNQSAGTSPVADLIKRYPIKSKNVISHIRKATQGTVLLENCHPFMRELWGRH
                     WIFAHNGDLHGFAPFLSGVYQPVGDTDSELAFCALMQGLRKRFPGSQPPLNELGHALA
                     DITRDITLHGVFNFLLCNGQALFAHCSTRLYYIVRQWPFSKAHLIDADLSIDFAQVTT
                     PDDRVAVIATAPLTDNETWTQFAPGELIMFEDGRPTMTWSVPIPPEVQAKNAANTACT
                     "
     gene            431492..432490
                     /gene="ttuC"
                     /locus_tag="Rmet_0404"
     CDS             431492..432490
                     /gene="ttuC"
                     /locus_tag="Rmet_0404"
                     /EC_number="1.1.1.93"
                     /codon_start=1
                     /transl_table=11
                     /product="tartrate dehydrogenase/decarboxylase"
                     /protein_id="ABF07290.1"
                     /translation="MDATARRFGIDFQWDHFDFSSYAYYERHGKMLPDDWFDTLVKYD
                     AIYFGAVGWPAKIADHVSLWGSLLQFRRSFDQYVNLRPVRLMPGIKSPLADRKPGDID
                     FYVVRENTEGEYSSIGGRMFPGTEREIVMQETVMSRHGVDRILKFAFELAQKRPKKHL
                     TSATKSNGISITMPYWDERVEAMAANYPGMKVDKYHIDILTAHFVQHPDWFDVVVASN
                     LFGDILSDLGPACTGTIGVAPSGNINPDKVYPSLFEPVHGSAPDIAGQGIANPIGQIW
                     CGAMMLEHLGHAEAGAAVLAAIEQVLAAGPGHAPLTRDIGGTASTADLGQAIAEAL"
     gene            432487..433785
                     /gene="ttuD"
                     /locus_tag="Rmet_0405"
     CDS             432487..433785
                     /gene="ttuD"
                     /locus_tag="Rmet_0405"
                     /EC_number="1.1.1.81"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxypyruvate reductase"
                     /protein_id="ABF07291.1"
                     /translation="MNPQVDPRTLLLESFRAAVAAADPLEIVAAHLPPPHAGGRTLVV
                     GAGKAAASMALAVERAYQGKAKLEGIVVTRYAHGLPTEHIRVIEAGHPVPDEAGEQAA
                     ADILARVQALGPDDRLIVLVSGGGSSLLSLPAEGIPMADLKATTRELLRCGAPITDMN
                     IVRKHTSRIQGGRLAQASRAPVTTLIVSDVAGDDPSAIASGPTVPDASTYADALAILK
                     RYGAAVPATVQAHLERGARGEVEETPKPGDPLFMNVDNRMIATAHDSLEAAAAEFRRQ
                     GVNAVVLGDTVTGEAQEVARVYAALVREIRAYNAPFAAPVALISGGECTVTLPSGASE
                     SARGGRCSEFLLSLAIELAGTPNVHAIAADTDGIDGSEDNAGALLAPDSLARAEGSGT
                     SARQKLDAHDAWGFFDAIGDLVVTGPTRTNVNDYRAILIL"
     gene            433818..434852
                     /gene="pyrC"
                     /locus_tag="Rmet_0406"
     CDS             433818..434852
                     /gene="pyrC"
                     /locus_tag="Rmet_0406"
                     /EC_number="3.5.2.3"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydro-orotase"
                     /protein_id="ABF07292.1"
                     /translation="MTQKLTITRPDDWHLHLRDGAALAAVLPDTARQFARAIIMPNLK
                     PPVTTVDQASAYRARILAALPAGMAFEPLMTLYLTDNTPPEEIVAARASGFVHGVKLY
                     PAGATTNSDAGVTDIRRCAATLEAMQREGVPLLVHGEVTDGDIDIFDREAVFIDRVMK
                     PLRRDFPELKVVFEHITTRDAAQYVAEAEGPVGATITAHHLLYNRNAIFTGGIRPHYY
                     CLPVLKREIHREALVKAATSGSPRFFLGTDSAPHARGLKEHACGCAGCYTALHAMELY
                     AEAFDAAGALDKLEAFSSFNGPAFYGLPRNSGTLTLTREDWELPAELPYGDTTLVPLR
                     AGETLRWKAS"
     gene            434858..435646
                     /locus_tag="Rmet_0407"
     CDS             434858..435646
                     /locus_tag="Rmet_0407"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07293.1"
                     /translation="MLSTIDWTRPWFLPFAASASCLDGSDLREAFNAAALGSLNAQGL
                     PLRFVPQDSLPEGVAYESHIFATGQVPTRDNLHDTFNALIWLHFPETKRLLNRLQAEA
                     IERDGVQAVRGGLRDAATLFDENAVILVSEDATIANALRGFAWRKLFVSRRDAWRDTC
                     AVVPFGHALLEKLVQPYKSVTAHAWWIPASPTTPIARLDGMLAASLAEAAEQGRLKGG
                     RSFAPLPVMGIPGWCGESAAPGFYDDASVFRPGRRGAAANAEAG"
     gene            435726..436006
                     /gene="rnpB"
                     /locus_tag="Rmet_R0004"
     misc_RNA        435726..436006
                     /gene="rnpB"
                     /locus_tag="Rmet_R0004"
                     /product="RNA component of RNaseP"
     gene            complement(436105..436527)
                     /locus_tag="Rmet_0408"
     CDS             complement(436105..436527)
                     /locus_tag="Rmet_0408"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07294.1"
                     /translation="MECKVTWMGPEGMSFVAQTGSGHIVAMDGAPDGGGNNLAPRPME
                     MVLLGTGGCTAYDVVLILKRGRQDVRGCSVKLEAERAETDPKVFTKINFHFTVTGRNL
                     DPGKVERAIELSHEKYCSASIMLAKTAEITHTTEIVEG"
     gene            436610..436819
                     /locus_tag="Rmet_6414"
     CDS             436610..436819
                     /locus_tag="Rmet_6414"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADC45032.1"
                     /translation="MRELASGHAIPHEILRVSSNAMPARPRGFLSNSLFNKECEAFDM
                     IYSQFHIAVSHFALQIFLQRLCRYV"
     gene            complement(436756..437100)
                     /locus_tag="Rmet_0409"
     CDS             complement(436756..437100)
                     /locus_tag="Rmet_0409"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABF07295.1"
                     /translation="MWLFVKMAGGQQRAIELDGQPASRFRWAALAKDEKKPKSVGLGF
                     ESTKGGGWRRHRAIDGAGLGGRCDERFGYVTDFRFRTLARSHAPSFDGLNYTYRHSRC
                     KKICSAKCDTAI"
     gene            436843..437034
                     /locus_tag="Rmet_6415"
     CDS             436843..437034
                     /locus_tag="Rmet_6415"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADC45033.1"
                     /translation="MRARQSAKAKVGNVPKSLVAPPAKTGPVDRPVSPPPSSFGGFEP
                     KSNRLGFFFVFCKGGPAKS"
     gene            437287..437715
                     /gene="rplM"
                     /locus_tag="Rmet_0410"
     CDS             437287..437715
                     /gene="rplM"
                     /locus_tag="Rmet_0410"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal subunit protein L13"
                     /protein_id="ABF07296.1"
                     /translation="MKTFSAKPAEVKRDWYVIDATDKVLGRVASEVARRLRGKHKPEF
                     TPHVDTGDFIIIVNAAKLRVTGTKEQDKKYYRHSGYPGGIYETTFGKMQQRFPGRALE
                     KAVKGMLPKGPLGYAMIKKLKVYAEAEHPHSAQQPKVLEI"
     gene            437730..438122
                     /gene="rpsI"
                     /locus_tag="Rmet_0411"
     CDS             437730..438122
                     /gene="rpsI"
                     /locus_tag="Rmet_0411"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal subunit protein S9"
                     /protein_id="ABF07297.1"
                     /translation="MIGNWNYGTGRRKSAVARVFIKSGKGDIIVNGKPIKEYFARETS
                     LMIVRQPLELTAHAETFDIKVNVTGGGETGQAGAVRHGITRALIDYDATLKPTLSKAG
                     YVTRDAREVERKKVGLHKARRRKQFSKR"
     gene            438341..439096
                     /locus_tag="Rmet_0412"
     CDS             438341..439096
                     /locus_tag="Rmet_0412"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA binding; transmembrane protein"
                     /protein_id="ABF07298.1"
                     /translation="MGVTYRPLRPRRGLRSHAAVIRQQRPWRVWVLVVALLLVGGALA
                     AWMYEMGRRAGKPAVESFTDGSEKIAQLQQQLVDVTGERDRLRATANTAGAELQMARA
                     AQERLAQQLKTAEADVGQLKEDLGFFESLLPATGDTSGIHVRSFRVALDEAQPRAVHY
                     RLLAMQGGSKAFVEQPDFMGELQFTISAVRDGKPLTLTLPQPGDPPLPKVRLTHYQRI
                     EGDLMVPQGAEVRAVMVRIVQNGQVRATQSATP"
     gene            439120..439614
                     /locus_tag="Rmet_0413"
     CDS             439120..439614
                     /locus_tag="Rmet_0413"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07299.1"
                     /translation="MLFSKKKGLSIDTLIGLGATIEGDVTFSGGLRLDGRVRGNVIAA
                     EGKSSMLVISEKGLVEGEIRVDHLILNGTVTGPVHAAELLELQPHARVYGEVRYAALE
                     MHQGAIVEGRLVPLTQTEVRALPNLAPSAEAKTDAPANDGEATASDQAADNDKAPEGA
                     GVPA"
     gene            439723..440091
                     /gene="erpA"
                     /locus_tag="Rmet_0414"
     CDS             439723..440091
                     /gene="erpA"
                     /locus_tag="Rmet_0414"
                     /note="hesB-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster assembly accessory protein
                     (yadR)"
                     /protein_id="ABF07300.1"
                     /translation="MNAVAEAPATEDVPAPFVFTDSAADKVKQLIEEEGNAELKLRVF
                     VQGGGCSGFQYGFTFDEDVNEDDTTMVKNGVTLLIDSMSYQYLVGAEIDYKEDINGAQ
                     FVIKNPNASTTCGCGSSFSV"
     gene            complement(440183..441325)
                     /gene="anmK"
                     /locus_tag="Rmet_0415"
     CDS             complement(440183..441325)
                     /gene="anmK"
                     /locus_tag="Rmet_0415"
                     /codon_start=1
                     /transl_table=11
                     /product="Anhydro-N-acetylmuramic acid kinase (AnhMurNAc
                     kinase)"
                     /protein_id="ABF07301.1"
                     /translation="MPASPQSSEMFIGLMSGTSMDGADGVLVDFSGAQPAVLAAAHTP
                     FPAPLREAFGALQQPGDDEIHREALASNGLARVYADCVATLLRTASVTADRVAAIGAH
                     GQTIRHRPGQYDGTGYTRQSQHPALLAELTGIDVVADFRSRDVAAGGQGAPLVPAVHA
                     ALFGAADETRVVCNIGGISNISILPAAGTGRPVTGFDCGPGNALLDDWIHRHRGTPYD
                     DGGAWAASGKVDESLLDQMLAEPYFRALPPKSTGRDLFHPGWLQSLLDTYGNAQPQPV
                     DIQATLATLTATAIAQDVQRYAPEARRLIVCGGGAHNDFVMTTMANQLPGVLVQTTGD
                     FGVPVSQVEAIAFAWLARQCTRRAPGNVATVTGAAGPRVLGAIYPR"
     gene            complement(441328..442722)
                     /locus_tag="Rmet_0416"
     CDS             complement(441328..442722)
                     /locus_tag="Rmet_0416"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane associated
                     metalloendopeptidase"
                     /protein_id="ABF07302.1"
                     /translation="MWSSLREVFARELVVLVDPTNPQHARRRKQLTVAVGTVFTLGMA
                     AAMGVAPRNAFDDPLAPRVEQALRMPDVRQQLELLTETDEQSVYVRQERMQRGDTIAT
                     LLRRLGVDDPDAQSFILKNPTARGLFGLNPGQTVQAEIDDSNLLVALQANLGGDAASS
                     RELVVERVAPQKDGGDYTYRARIASVDNDVHYEMASGAIENNGFFKSMDAANVPDEIV
                     SQMISIFSGVIDFHHDITRGDRFRIVYEAGFRDGAFVRNGRVVAIELINRNTLYQALW
                     YSPTDGEPGAYYTFDGRSMKRPFLRSPVEFSRVSSGFGGRDHPLHHKWAQHKGVDFAA
                     PTGTKVFASGEGTVEFVGQQNGYGNLIILRHAGGYSTYYAHLSGFAGLRDGQHVGQGE
                     VIGYVGSTGWATGPHLHYEFRYNDVPQNPLTTTLMEAPTLTGKSRSEFLNYTSAMLSR
                     INMLRTYNVLTASN"
     gene            442941..444182
                     /gene="tyrS"
                     /locus_tag="Rmet_0417"
     CDS             442941..444182
                     /gene="tyrS"
                     /locus_tag="Rmet_0417"
                     /EC_number="6.1.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Tyrosyl-tRNA synthetase"
                     /protein_id="ABF07303.1"
                     /translation="MSEVSPAAAANYPLTPSVMRALEITKRGCDELLVESEWLQKLAR
                     SEATGVPLRIKLGLDPTAPDIHLGHTVVLNKLRQLQDLGHQVIFLIGDFTSTIGDPSG
                     RNSTRPPLTREQIEANAQTYYRQASLVLDPARTEIRYNSEWCDPLGARGMIQLAAKYT
                     VARMMERDDFTKRFRSGIPISVHEFLYPLMQGYDSVALKSDLELGGTDQKFNLLVGRE
                     LQKEYGQESQCILTMPLLVGLDGVEKMSKSKNNYIGVTEAPNDMFGKLMSISDELMWQ
                     YYTLLSFRPMSEIDLMKSEVALGRNPRDCKVALAQEIVTRFHSQADAEKALEDFNHRA
                     RGGVPDDIPAVSLEGAPLGIAQLLKQANLVPSTSEANRNIEQGGVKIDGAVVSDKSTK
                     VVAGTYVVQVGKRRFARVTLS"
     gene            444196..444666
                     /gene="dtd"
                     /locus_tag="Rmet_0418"
     CDS             444196..444666
                     /gene="dtd"
                     /locus_tag="Rmet_0418"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="D-tyr-tRNA(Tyr) deacylase"
                     /protein_id="ABF07304.1"
                     /translation="MIALIQRVSQARVTVDGRTTGEIGAGLLALVCAERGDTEAQAER
                     LLAKLLSYRVFSDAEGRMNLPVQNMDGQGNAGGLLVVSQFTLAADTNSGTRPSFTPAA
                     APEDGRRLYDHFVTRARAAHPSVQTGEFGAMMQVSLTNDGPVTFWLRVPPAANA"
     gene            444700..445347
                     /gene="ybhB"
                     /locus_tag="Rmet_0419"
     CDS             444700..445347
                     /gene="ybhB"
                     /locus_tag="Rmet_0419"
                     /codon_start=1
                     /transl_table=11
                     /product="Phospholipid-binding protein"
                     /protein_id="ABF07305.1"
                     /translation="MKLWSKAFADNAPIPGEFAFCVPDSASHVALSSNRNPDLHWDDV
                     PAATRSFVLICHDRDVPSKGDDVNQEGREVPESLPRVDFFHWVLIDVPPGLHTISAGS
                     HSDGVIARGKPGPEALVGTATAGGLRHGLNDYTGWFAGDADMKGDYFGYDGPCPPWND
                     SIIHHYVFTVYALDIDRVPVEGKFTGADVRRAIQGHVLAEASLTGTYTLNPRLVK"
     gene            445409..446083
                     /gene="gpmB"
                     /locus_tag="Rmet_0420"
     CDS             445409..446083
                     /gene="gpmB"
                     /locus_tag="Rmet_0420"
                     /EC_number="5.4.2.1"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase 2 protein"
                     /protein_id="ABF07306.1"
                     /translation="MSQSTGPQSLAYTHLIVIRHGETAWNRERRLQGQLDIPLNDTGR
                     AQARALAEALAGEPIDAVYSSDLGRAMQTAAPLAETLGLQVRPERRLRERCYGDLEGM
                     TYAEVAEKRPEDFARWQARVPDYAPPEGESLREFHDRAVEVALYLSRRHPGERIALVA
                     HGGVLDCLYREAAGMTLEAPREHELLNASVNRLRCDTAHLTLLQWADVSHLEALALDE
                     VDRRVP"
     gene            complement(446213..446797)
                     /locus_tag="Rmet_0421"
     CDS             complement(446213..446797)
                     /locus_tag="Rmet_0421"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein Putative lipoprotein precursor"
                     /protein_id="ABF07307.1"
                     /translation="MNRRNFVTRMAGSGLLVATAMAAGCTTTGSSDSKDAAARRQEID
                     AGADGALNRLFTSVNGSRELADKAQGILVFPRVLAGGLVIGGEYGDGVLRSKGANVGY
                     YRTLAASFGLTAGGQSRSVIIMFMTPEAYNKFLQAKGWTAGVDASVALAKVGANGKVD
                     TVTGQQPVIGFVQTNAGLMFDVSLDGSKISKLDL"
     gene            complement(446844..447455)
                     /locus_tag="Rmet_0422"
     CDS             complement(446844..447455)
                     /locus_tag="Rmet_0422"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein (secreted)"
                     /protein_id="ABF07308.1"
                     /translation="MNLRAKPTSLISVLAAAAALAIGATGVAHAQKPQAKTPAPIGVA
                     EEAVVSGKVVDVDPQSKAVLVQGPRGNLVELVAGDEAKNIGNVHKGDIVTLTRGAAVV
                     AALQPVDSKDTPLLEQVERVSHAAEGGKPGVMREITTTITAQITKVDVAKRMVTFRGP
                     RETLRTVKVQDPNIDLASIKQGQMAKIVVREVVAITVKSPNAG"
     gene            complement(447658..448725)
                     /gene="ruvB"
                     /locus_tag="Rmet_0423"
     CDS             complement(447658..448725)
                     /gene="ruvB"
                     /locus_tag="Rmet_0423"
                     /EC_number="3.1.22.4"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase, component of RuvABC
                     resolvasome"
                     /protein_id="ABF07309.1"
                     /translation="MIETDKLTGADRLPDRVISATPASTQEEAFERALRPKLLDEYVG
                     QEKVRGQLDIFMHAARKRREALDHVLLFGPPGLGKTTLAHIIAREMGVNLRQTSGPVL
                     ERPGDLAALLTNLEAHDVLFIDEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARSVK
                     LDLQPFTLVGATTRAGMLTNPLRDRFGIVARLEFYTPDELARIVARSALLLNAAIDPA
                     GALEIARRARGTPRIANRLLRRVRDFAEVKSDGTITRELADAALEMLDVDSVGFDLMD
                     RKLLEAVLHKFDGGPVGVDNLAAAIGEARDTIEDVLEPYMIQQGYLQRTPRGRMATAA
                     AYRHFGLASPRDGGADLAEGL"
     gene            complement(448795..449376)
                     /gene="ruvA"
                     /locus_tag="Rmet_0424"
     CDS             complement(448795..449376)
                     /gene="ruvA"
                     /locus_tag="Rmet_0424"
                     /EC_number="3.1.22.4"
                     /codon_start=1
                     /transl_table=11
                     /product="component of RuvABC resolvasome, regulatory
                     subunit"
                     /protein_id="ABF07310.1"
                     /translation="MIGRIAGTLLEKNPPHLLVDCHGVGYEIDVPMSTFYNLPAIGHP
                     VTLLTQQIVREDAHLLFGFATATERNTFRELIKITGVGARMALAVLSGLSVPELAQAV
                     TMQEAGRLTKIPGIGKKTAERLLLELKGKLGADLGHAPGATPLADSAVDILNALLALG
                     YSEKEAAQAIKQVPAGTGVSDGIKLALKALSKG"
     gene            complement(449431..450609)
                     /gene="glpQ"
                     /locus_tag="Rmet_0425"
     CDS             complement(449431..450609)
                     /gene="glpQ"
                     /locus_tag="Rmet_0425"
                     /EC_number="3.1.4.46"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative glycerophosphoryl diester
                     phosphodiesterase, periplasmic protein"
                     /protein_id="ABF07311.1"
                     /translation="MHHPFITRFTLAALTAGLIAGCAAPPRAPTSTAAREAPSTAYAT
                     TSAAPKPVLIIGHRGASALRPEHTLASYQKAIDDGADIIEPDLVATKDGVLVARHEND
                     ITGTTNVAEMPEFADRKRVKVIDGERLTGWFTEDFTLAELKTLRARERIPKLRPANAK
                     LNDQFEIPTFDEILKLAELAAMKRGRPVGIYPELKHPTYFRGIGLPLEERLVTALQGS
                     AYAKTVPVYVQSFEAAPLRTVKRLLGNSMPNVMIVQLIGNPRSRPADWRLAGDTRTYA
                     DMLKPIGLREVATYANGIGPEKNSVIPRDASGNLASPTALLANAHAAGLVVHPYTFRP
                     ENAFLPKSLRAPGDDATRNPAGMISEIQTFAAAGVDGVFTDDPALGRRAVDPPANGGH
                     "
     gene            complement(450724..451269)
                     /gene="ruvC"
                     /locus_tag="Rmet_0426"
     CDS             complement(450724..451269)
                     /gene="ruvC"
                     /locus_tag="Rmet_0426"
                     /EC_number="3.1.22.4"
                     /codon_start=1
                     /transl_table=11
                     /product="component of RuvABC resolvasome, endonuclease"
                     /protein_id="ABF07312.1"
                     /translation="MRILGIDPGLRTTGFGVLEKHGNKLAYVASGTIRSNGETSLPER
                     LKTLYDGISEVARTYAPDCAAIEKVFVNVNPQSTLLLGQARGAAICGLVGQGLPVFEY
                     TALQLKVAVVGYGRANKEQVQEMVMRLLSLSGRPSSDAADALGVAICHANGGDTLGTL
                     AGLAPELARKGMRVRRGRLVG"
     gene            complement(451396..452970)
                     /gene="purH"
                     /locus_tag="Rmet_0427"
     CDS             complement(451396..452970)
                     /gene="purH"
                     /locus_tag="Rmet_0427"
                     /EC_number="3.5.4.10"
                     /EC_number="2.1.2.3"
                     /codon_start=1
                     /transl_table=11
                     /product="fused IMP cyclohydrolase;
                     phosphoribosylaminoimidazolecarboxamide formyltransferase"
                     /protein_id="ABF07313.1"
                     /translation="MIKQALLSVSDKTGIVDFARELNALGVTLLSTGGTAKLLAEAGL
                     PVTEVADYTGFPEMLDGRVKTLHPKVHGGILARRDLPEHMAALAEHNIPTIDLLVVNL
                     YPFQQTVAKDDCTLPDAIENIDIGGPTMLRSAAKNHRDVTVIVDPADYAVVLGEMRAN
                     GNSVGYDTNFRLATKVFAHTAQYDGAITNYLTSLGADKSHQARSAYPQTLNLAFEKVQ
                     EMRYGENPHQSAAFYRDLKAFDGALANYVQLQGKELSYNNIADADAAWECVKSFDAAN
                     SAACVIIKHANPCGVAVGANALEAYDKAFKTDSTSAFGGIIAFNVELDEAAAQAVAKQ
                     FVEVLIAPSFSAAARNVFAAKQNVRLLEIPLGKGVNQYDLKRVGGGLLVQGPDARNVQ
                     PSELRVVTRRHPTPKEMDDLMFAWRVAKFVKSNAIVFCGNGMTLGVGAGQMSRVDSAR
                     IASIKAQNAGLTLAGSAVASDAFFPFRDGLDVVVDAGATCVIQPGGSMRDDEVIAAAD
                     ERGIAMVLTGTRHFRH"
     gene            complement(452993..453226)
                     /locus_tag="Rmet_0428"
     CDS             complement(452993..453226)
                     /locus_tag="Rmet_0428"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative Fis-like DNA-binding protein"
                     /protein_id="ABF07314.1"
                     /translation="MSRNAIDQCIRDSLDTYFRDLDGEVPSNMYNMVLEAVERPLLEA
                     VMTRAERNQSLAAAYLGINRNTLRKKLQQHGLL"
     gene            complement(453223..454368)
                     /gene="dusB"
                     /locus_tag="Rmet_0429"
     CDS             complement(453223..454368)
                     /gene="dusB"
                     /locus_tag="Rmet_0429"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase B"
                     /protein_id="ABF07315.1"
                     /translation="MRRPQGLAGACFCISPASPERTQHRSIVQIGPHQLRNNLFVAPM
                     AGVTDRPFRQLCKQLGAGYAVSEMVASNAQLWKSEKTMRRANHAGEVEPISVQIAGAE
                     PSMMAEAARYNVDRGAQIIDINMGCPAKKVCNVAAGSALLQNEPLVVRIVEAVVAAVG
                     DRVPVTLKIRTGWDREHKNALRVARMVEDAGISMLTIHGRTRADLYHGEAEYETIAAV
                     KSSIRIPVVANGDITTPQKARHVLAVTGADAIMIGRAAQGRPWLFREIEHYLKTGELL
                     PSPEVAEIRAIMNHHLADHYAFYGEFTGVRTARKHIAWYTRGLKGANLFRHRMNTLES
                     TDAQLAAVNAFFDEQAAISDRLVYVDENAAPDDDALDNNKKRELLAA"
     gene            complement(454491..455744)
                     /gene="ubiH"
                     /locus_tag="Rmet_0430"
     CDS             complement(454491..455744)
                     /gene="ubiH"
                     /locus_tag="Rmet_0430"
                     /EC_number="1.14.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="2-octaprenyl-6-methoxyphenol hydroxylase,
                     FAD/NAD(P)-binding protein"
                     /protein_id="ABF07316.1"
                     /translation="MTLPASTDALAVEPRDIAIVGGGPVGLALAAQLLRTTSWRITLI
                     DAATPARAARDPRAIALSHGSRQLLEQIGAWPVPAQAIEHIHVSQRGRFGHVKLHGDD
                     YGVPALGYVVRYGDLCQTLERALARAADAAPGRLERAFETRIDNIDQGDRSDRSDAAL
                     VRLTGTSHAEHEGLPVAFAARIAVQAEGGLFHQQIQRLSHGTEAVRRRDYQQTAIIGH
                     VTCTQPQPGWAWERFTEEGPLALLPHEEHGVQGYALVWCCPPEQAMRRLALTEDEFAY
                     ELGQAFGTRMGQFTLVGKRHAFPLGLNAAPVTVDGRVAAVGNAAQTLHPVAGQGLNLG
                     LRDAFALADSLRAGCTPQALEAFASRHRVDRAMTIGITDLLPRVFAVGGPMAAHARGA
                     SLAALACVAPLKHALARQMMYGARG"
     gene            complement(455722..456186)
                     /locus_tag="Rmet_0431"
     CDS             complement(455722..456186)
                     /locus_tag="Rmet_0431"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07317.1"
                     /translation="MKALLSKLFGTGVTKTHTTRAVDPNEPFVINIYDDRVVVHRPDG
                     QREELAWDALEKVVVRVSDRAPWAGTAWLILAGDAASQQGCVVPMTAANHEALVRRLQ
                     ELPGFHQQKLDNAMRDATSGKSRTDANLWKRSEAEAQARKDEEASHDAASQH"
     gene            complement(456183..457580)
                     /gene="pepP"
                     /locus_tag="Rmet_0432"
     CDS             complement(456183..457580)
                     /gene="pepP"
                     /locus_tag="Rmet_0432"
                     /EC_number="3.4.11.9"
                     /codon_start=1
                     /transl_table=11
                     /product="proline aminopeptidase P II"
                     /protein_id="ABF07318.1"
                     /translation="MSAPDSALLGACSDRRARVLKHLRANGGGVAIVPTAPEAMRNRD
                     SDYPYRHDSYFYYLTGFTEPEAVLVLVAGGPGDDTNSSILFCRPKHEEREIWDGFRYG
                     PEGARAMFGFDEAHSVEDIDKLLPPMLANRATLAYPLAATADFDARVRGWLDAVRMQG
                     RAGVSSPSAALDVRALLDEMRLFKDAGELVTMRRAAEISAQAHVRAMRTSRHGLREYH
                     LEAELLYEFRRHGAQSVAYNSIVATGPNACVLHYRAGPAELRDGDLCLIDAGCELDGY
                     ASDITRTFPVNGRFTPAQRELYDLVQAAQDAAIAETRAGVPYNVPHDAAVRVLAQGML
                     DTGLLDRNKEGTLDDVLASGSYRRFYMHRTGHWLGMDVHDVGEYRVPGPLPAGHEGER
                     AWRPLEAGMVVTIEPGIYVRPAEDVPERYWHIGIRIEDDAVVTSGDCELITRGVPVKA
                     DEIEALMRDNGGMSR"
     gene            complement(457709..458407)
                     /locus_tag="Rmet_0433"
     CDS             complement(457709..458407)
                     /locus_tag="Rmet_0433"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate-sugar pyrophosphorylase"
                     /protein_id="ABF07319.1"
                     /translation="MIFAAGRGDRMRPLTDACPKPLLAVGGKPLIVWQVEALVRAGLT
                     DIVINHAWLGEQLESALGDGSQFGARIHWSAEGTALETAGGIAHALPLLTGKTDADDV
                     FLAVSGDIFCDFDYRTLLPRARAMAMAPRPHMHLVMVPNPPFHPRGDFVLDTAGLLRM
                     PSADAHALTFGNIGLYDTRLFREIERGAKVAMSPYYRESIAAGLATGERFDGRWENVG
                     TPAQLAALDRSLRA"
     gene            complement(458413..458736)
                     /locus_tag="Rmet_6416"
     CDS             complement(458413..458736)
                     /locus_tag="Rmet_6416"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADC45034.1"
                     /translation="MSQMTLLWVFIGAGLATFLIRLSFIAVEGRVRLPAWFRTALQFV
                     PAAMLSALIAPDLLMRDGAVFVSPHNARLIAGVVAIVIAARTRSVGWTIAGGMAALIA
                     LEALI"
     gene            complement(458733..459530)
                     /locus_tag="Rmet_0434"
     CDS             complement(458733..459530)
                     /locus_tag="Rmet_0434"
                     /codon_start=1
                     /transl_table=11
                     /product="predicted branched-chain amino acid permease
                     (putative transporter)"
                     /protein_id="ABF07320.1"
                     /translation="MEVPSDTPDTPLAPEAITRSGEWWAGARALAPMLLGVMPFGLIY
                     GVLAVNAGMPAWLACAMSAIVFGGASQMILTQLWAAGTPALVVAFTVAMVNLRHALYS
                     ATIAASLAPLPRRWKALIAYLLTDEAFAAMTRRLGDTGPRARYRHWFYFGAGFALWAS
                     WQVSTLAGVLVGAQVPRDWPLDFFLPLTFIGIIVPNLKHRSQTAAALVASVLAVACFA
                     MPHKLGIMVAALGGIAAGMLLRGRDRDGTGRRSSDASGRTDGKEHAA"
     gene            complement(459542..460588)
                     /locus_tag="Rmet_0435"
     CDS             complement(459542..460588)
                     /locus_tag="Rmet_0435"
                     /codon_start=1
                     /transl_table=11
                     /product="predicted phosphotransferase to Ser/Thr protein
                     kinases"
                     /protein_id="ABF07321.1"
                     /translation="MSALLHAPGQDPRIEQLKTWVARLGAAWSIDPDSCAPASADASF
                     RRYFRVRTGHPAHPTAIVMDAPPSHEDCRPFIHVAKLFGDAGVTVPTVLAQDLDQGFL
                     LLADLGSQTYLSRLDDTSAHNLYTDAAAALVKIQAATRPGELPAYDRALLQRELDLFP
                     QWYIAKHLGVTLDDRQQADLREVFETILTNNLAQPQVYVHRDYHSRNLMVLPEAGNPG
                     VLDFQDAVIGPITYDAVSLWRDAYIEWEEEQQLDWLIRYWERARKTGLPVAADFGEFY
                     RDFEWMGLQRHLKVLGIFARLYHRDGKDGYLANLPLVLRYTRNVAGRYSEMRKLVRLL
                     DAIEGTERPTGFTF"
     gene            460771..463245
                     /gene="ostA"
                     /locus_tag="Rmet_0436"
     CDS             460771..463245
                     /gene="ostA"
                     /locus_tag="Rmet_0436"
                     /codon_start=1
                     /transl_table=11
                     /product="organic solvent tolerance protein"
                     /protein_id="ABF07322.1"
                     /translation="MTEQRRSPHHPATRPPAPPGTSRRVRLPASALRPLVLAMAGLTV
                     SAHAQYGATSAIPNIDLVEPVVTQTPEAPPPPAEGGDLVPRLTEPATRTAPSGNTLNL
                     SPSSTPSNPNAPAYVSGDRVTGYSEKGVEMEGHAELRRDGGVIKGDRLTYDQDTDEAH
                     ATGNVRLSKSGTLAVGPEARMRVQANEGYMLSPDYYFQQTGGSGSAERVDFLDPDRST
                     LKKATYTTCSPDNADWYFSARKLDLDSDRQVGTAYGGVLNFFGVPIAGAPAFSFPLNG
                     ERRSGVLPPLFGYGSNSGADLTVPYYFNLAPNRDLTIYPRILTSRGVQLGEDFRYVGD
                     GYSGRIRGEFLPDDKKAGRNRWAYSIQHYQSIIPGMTAYVNVSKVSDDKYPDDLTRSV
                     SQSTLRQYTQEGGVIYAWQDWVFMARVQKFQTLLPSEPSYEREPQLNAKYNRYDFHGF
                     DISLETDYTRFRIPLTSTGFQQPEGNRAFIQPTISYPIIHPGWYVTPKFIFNAAQYNM
                     DAGTNTTGASNTLNRAIPTVSLDSGMTFERDAPGVSKLFGVKYTQTLEPRLFYVYTPF
                     YDQSQFPLFDTVQSDFGYGQIFTENPFTGNDRIADNNKLTLGLTTRLIESETGVERFR
                     GTIAQRVDFTGQRVQLNGTLPDAKPSYSDLLAATTIQLFRGYYLDAGIQWNPDQDKVN
                     YSNVALAYRPESRKLINFGYRYRRPTSVTDNTAIDQIEMSGQWPITQRTYGIGRVAFD
                     KSANQLVDALAGFEYAADCWVGRFVYQRFRNTSNGYTGRVFFQVEFRGLSKIGSNPLD
                     MLRLNVPGYEPVTARPVPTTPYDHYE"
     gene            463255..464736
                     /gene="surA"
                     /locus_tag="Rmet_0437"
     CDS             463255..464736
                     /gene="surA"
                     /locus_tag="Rmet_0437"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase (PPIase)"
                     /protein_id="ABF07323.1"
                     /translation="MKRQAFSLLSRLNPWQQLLLSAVLVTLAAPAAAQLRAPGTRTQG
                     IFTQQGSQSASQGSTVAPSQPMMGVPQPSSQPRSQLVDEVVAVVNNSVITRRELLDRA
                     DEIESQLRAAKREVPPRPDLLGEVLERLVMERVQTQAAQEAGIKVTDQEVDRAIESVA
                     QQNKMSATELRSRVEASGMSWTKYRDELRKQVQVIRLREREVDSKVQVYDGEIDNYLA
                     ARNGGQAAASGPTEFNVAQILVRVPEDASDAQKAQLKTKAEGLLKQVQGGADFAELAK
                     ANSEAPEASQGGSLGFREIGRLPAVFANAVVDLQPGAVVPEVLESANGFHVVKLVSKR
                     TAAAQPAASDRIAQTQVRHILIRTGPNMPEAEAKRQMATIRDRITHGVDFADAARRYS
                     QDGSASQGGELGWVSPGELVPEFEQAMNRLRPGEISDPVVTQFGVHLIQVENRRETEV
                     SPEKQRDFARAEVREQKLRAAYDDWVRQLRSAAYVEYRINRQR"
     gene            464753..465829
                     /gene="pdxA"
                     /locus_tag="Rmet_0438"
     CDS             464753..465829
                     /gene="pdxA"
                     /locus_tag="Rmet_0438"
                     /EC_number="1.1.1.262"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-L-threonine phosphate dehydrogenase,
                     NAD-dependent"
                     /protein_id="ABF07324.1"
                     /translation="MPDPAPLDLAITTGEPAGIGPDITIGALLQFAANHGGNVGHGGA
                     VRFHVIGDARLLDQRAEALGVAHAWARRIADGDVIVEDIALGVHCEPGRLDARNGHYV
                     LALLDAAVDGLRTGRYAAMITAPVQKSTINDAGVPFSGHTEYLAECAGVPRVVMMLAG
                     PQPAHDNAMLRVALATTHLPLRAVPDALNIPMLVETLAIVDADLRRNFGIARPRILVT
                     GLNPHAGESGHMGREEIDVISPALEQARDADIDARGPYPADTLFQPRHLRDADCVLAM
                     YHDQGLAPLKYGTFGHGVNITLGLPFIRTSVDHGTALDLAGTGRAEHGSMIEAIRCAI
                     TMAGHASGRHSNGRADNGISNGQH"
     gene            465833..466669
                     /gene="ksgA"
                     /locus_tag="Rmet_0439"
     CDS             465833..466669
                     /gene="ksgA"
                     /locus_tag="Rmet_0439"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine-6-N',N'-adenosyl (rRNA)
                     dimethyltransferase"
                     /protein_id="ABF07325.1"
                     /translation="MRSNVHQGHVARKRFGQNFLVDDGIIHGIVSAIDPQPNDIVVEI
                     GPGLGALTDPLLERLPGMQVVELDRDLVERLRRRYGDRLVVHAGDALAFDFGKLREPG
                     RALRIVGNLPYNISSPLLFHLVDFADDVRDQHFMLQKEVVERMVADPGSKSYGRLSIM
                     LQVRYHMEHVLDVPPASFNPPPKVDSAVVRMIPWPRAEDGTLRSPYAACDAGVLGDVV
                     TAAFSQRRKVLRNTLSFLRDQVDFDALGFDLTRRAEEVPVAEYVELARIVGGAEPPAR
                     VA"
     gene            466712..467740
                     /gene="trpS"
                     /locus_tag="Rmet_0440"
     CDS             466712..467740
                     /gene="trpS"
                     /locus_tag="Rmet_0440"
                     /EC_number="6.1.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="Tryptophanyl-tRNA synthetase"
                     /protein_id="ABF07326.1"
                     /translation="MTDQTNPDKRPVILTGDRPTGPLHLGHFVGSLKSRVTLQETHKQ
                     YVLLADTQAMTDNAHDPDKVRRNVLEVALDYLAVGIDPAKTTISVQSHLPALAELTLM
                     YLNFVTVSRLERNPTIKEEIQARGFGRDIPAGFLCYPASQAADITGFKAVLVPVGEDQ
                     APLIEQTNEIVRRVNNQVGREVLPEAAALIPKHGRLPGVDGKAKMSKSQGNAIPLGAS
                     PDQIREAVHKMYTDPNHLKVSDPGQVEGNVVFTYLDAFDPNPAEVEALKEHYRRGGLG
                     DMVLKRRVEGVLQEMLRPIRERREQLAQDPGYVFDILKKGTAEAREITQQTLDEVRGA
                     LGMFSFPQ"
     gene            complement(467806..468711)
                     /locus_tag="Rmet_0441"
     CDS             complement(467806..468711)
                     /locus_tag="Rmet_0441"
                     /codon_start=1
                     /transl_table=11
                     /product="predicted permease, DMT superfamily"
                     /protein_id="ABF07327.1"
                     /translation="MSAQAMTRRPLDGTAIGLMVLLCAAWGLQQVIIKVTAPLMGAVL
                     QAGVRSAIAALLVFGFAAWRGTPLWERDGTLRAGLVAGLLFGAEFFCIFVGLGHTTAS
                     RMAVFLYTAPIFTALGLHLFVPGEHLHRGQWLGVVLAFCGIALAFADGIASPSTQGST
                     VIGDVLGMVAGALWAATTVVVRGSKLSGAPASKTLLYQLGVSAVMLLLMALAAGQAHT
                     VEITGFVVASLFYQSVLIAFASYLIWFWLLRQYLASRLSVFSFLTPLFGVAFGVLLMH
                     DHVGVRFALAAVMVLGGIVLVNRRA"
     gene            complement(468718..469125)
                     /gene="gloA"
                     /locus_tag="Rmet_0442"
     CDS             complement(468718..469125)
                     /gene="gloA"
                     /locus_tag="Rmet_0442"
                     /EC_number="4.4.1.5"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase I, Ni-dependent"
                     /protein_id="ABF07328.1"
                     /translation="MRLLHTMLRVGDYQRSIDFYTRVLGMTLLRESDNPEYKYRLAFV
                     GYGPETETAVIELTYNYGVDKYDLGTAYGHIALEVPSAAEACERIRSAGGKVTREAGP
                     VKGGTTVIAFVEDPDGYKIELIERHSTRDAARP"
     gene            469176..469373
                     /locus_tag="Rmet_6417"
     CDS             469176..469373
                     /locus_tag="Rmet_6417"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADC45035.1"
                     /translation="MPRNASAAVNVGPYADIRFRYAWFDNSVRGDQSPEAGDYSQEWN
                     VSVEGAWAHGMRGERRGRRSV"
     gene            complement(469433..470311)
                     /locus_tag="Rmet_0443"
     CDS             complement(469433..470311)
                     /locus_tag="Rmet_0443"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07329.1"
                     /translation="MKLLRPAPETPGAQLELPLAEALPPVTPEQQDLSPTSAPQTPET
                     ASPWPPALPNGRRLQVGERTVHYALKRSSRRTIGFTVDDRGLSITAPRWVTLADVEAA
                     ILEKQRWIFNKLGEWRHREARRILPTVQWRDGASLPFLGQPITLQLESPAGVLMFNAE
                     LRMLHLALPAHADEQQIKDRVQGWMQNQARRLLAERLDIYAAKLGVRHTGFALTSAAT
                     RWGSCTADGKIRLNWRLMHFPLSMIDYVAAHELAHLKEMNHGPRFWETVESIFPEFRD
                     ARAQLRAHPPELLPTF"
     gene            complement(470308..471069)
                     /gene="plsC"
                     /locus_tag="Rmet_0444"
     CDS             complement(470308..471069)
                     /gene="plsC"
                     /locus_tag="Rmet_0444"
                     /EC_number="2.3.1.51"
                     /codon_start=1
                     /transl_table=11
                     /product="1-Acylglycerol-3-phosphate O-acyltransferase"
                     /protein_id="ABF07330.1"
                     /translation="MTFLRSLLFSLYLLALTPPYACLCFIVFPFMNAENRFRFVRGWT
                     RLVIWAGRLICGIHYRIEGMEQAQSMLDKHVVLLSKHQSAWETVAYVALMPKPLCFVF
                     KRELLLVPFFGWALGMLKMVHINRKDGPRAFASAARQGRDRLAEGAWIIMFPEGTRTA
                     SGLEKPRYKSGGARLAVETGAWVIPMAVNSGRLWPRNSFLKYPGMITISIGAPIASAN
                     KTADMLNQEVEAWIEAEMRRIDPDSYRRAGNQATA"
     gene            complement(471099..471680)
                     /gene="gmhB"
                     /locus_tag="Rmet_0445"
     CDS             complement(471099..471680)
                     /gene="gmhB"
                     /locus_tag="Rmet_0445"
                     /EC_number="3.1.3.15"
                     /codon_start=1
                     /transl_table=11
                     /product="D-glycero-D-manno-heptose 1,7-bisphosphate
                     phosphatase"
                     /protein_id="ABF07331.1"
                     /translation="MPQSQLKFVILDRDGVINRDSDQFIKTPDEWIPIEGSLEAIAML
                     NQAGYRVVVASNQSGIGRGLFEMSALNAMHEKMYKALANLGGRVEAIFFCPHTAADNC
                     DCRKPKSGLYEQIGERFGIELRTVPTVGDSLRDLQAGVAVGCIPHLVRTGKGMKTLEK
                     GGLPDGTRVHDDLAAFARWLIDDAAPKPQPTAP"
     gene            complement(471716..473839)
                     /gene="glyS"
                     /locus_tag="Rmet_0446"
     CDS             complement(471716..473839)
                     /gene="glyS"
                     /locus_tag="Rmet_0446"
                     /EC_number="6.1.1.14"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine tRNA synthetase, beta subunit"
                     /protein_id="ABF07332.1"
                     /translation="MSQPMTDSLLIELFTEELPPKALARLGEAFAQGLFDGLGARDLL
                     EAGATVTPFATPRRLGALVSGVRRTAPDREQREKVLPLTVALDANGAPTAPLGKKLAA
                     LAKSVGVAEIDWQTLERASDGKADAFFYRYTARGATLADGLQAALDETLTKLPIPKVM
                     SYQRPDGTTVHFVRPAHSLIALYGAEIVPVSALGLQASNLTQGHRFLSQGTIEIPHAA
                     EYAGLLESRGRVVASYADRRERIRTALLKEAGADKVIMPDSLLDEVNSLVEWPVIYPC
                     HFEEAFLAVPQECLILTMQTNQKYFALTDAEGHLRNRFLIVSNLATDTPQSIITGNER
                     VVRPRLADAKFFFDQDRKKTLASRVPQLANVVYHNKIGNQLDRVQRLQQIAGHLADAM
                     NATGAPVDKAAAMRGAELAKADLLTDMVGEFPELQGTMGTYYARHDDEAEDVALACSE
                     HYRPRFAGDALPAGNVSTAVALADKLETLIGIWGIGLQPTGEKDPFALRRHALGILRM
                     LIEKPLALPLNDVLGLTEQAFAGIAAVKPSREAITDFLFDRVRGYLKDKGYTTNEVEA
                     VVSLRPQQLHDILARMEAVRTFAALPEAEALAAANKRITNILKKTDEAIGSVDVSLFQ
                     EAAEGALHEAIERVRPGVEAAFAGGDFTAALRDLAQLRDAVDRFFNDVMVMAEDAKLR
                     ANRLALLATLHGLANRVADISKLAA"
     gene            complement(473870..474490)
                     /locus_tag="Rmet_0447"
     CDS             complement(473870..474490)
                     /locus_tag="Rmet_0447"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07333.1"
                     /translation="MTPHLRGVCAIVALAVSAVAVFGGSADALARTASPPSPQALYLP
                     EDLSNICEADQQALQLAITRHWRPALKSIDQWTQLVRSFSCDLSGSRDLGWHRVPLRA
                     YESAIRYPLQWAEWEDHNGRPRRTVRTYYSAAQLPAKIEFWIGGRIDEIRYDRRTQRI
                     DARFPAAGTRGASGVAVQCAYTTLQFRQQNGLWLLSGVEPNLSPRC"
     gene            complement(474487..475440)
                     /gene="glyQ"
                     /locus_tag="Rmet_0448"
     CDS             complement(474487..475440)
                     /gene="glyQ"
                     /locus_tag="Rmet_0448"
                     /EC_number="6.1.1.14"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine tRNA synthetase, alpha subunit"
                     /protein_id="ABF07334.1"
                     /translation="MLTFQQMILTLQAYWDRQGCALLQPIDLEVGAGTSHVHTFLRAI
                     GPEPWRAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPENILELYLGSLEALGL
                     DLKQNDIRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITY
                     GIERLAMYLQKVENIYDLVWTEWQENGETRRLTYGDVYHQNEVEQSTYNFEHSNTEIL
                     FRHFAEHESEAKRLMGDTGEKAEGAQEKAAGTRLALPAYEQVLKAAHTFNLLDARGAI
                     SVTERAAYIGRIRNLSRQVAQAYYDSREALGFPMCKTEARA"
     gene            complement(475924..477456)
                     /gene="lnt"
                     /locus_tag="Rmet_0449"
     CDS             complement(475924..477456)
                     /gene="lnt"
                     /locus_tag="Rmet_0449"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="ABF07335.1"
                     /translation="MQVTSRSGTVFRLLIAAVLGVAHTQAFAPHNWWWLQILSLAGLV
                     ALIAGAPRPRAAAATAYAFGLGWFLSGIWWLFISMHVYGEMPSWMAGLAVVLFAGYLS
                     IWPALAGAAWHWLTQRGRNGVLPALAFGATWALSEWLRGVVFTGFPWLGSGYPHTDGP
                     LAGFAPLIGVYGISALAGFIAALLVAVVGAIGRQRKARSAVLAGGLAVGVLACGAALA
                     PIQYTSPIGQPIHVRLLQGNVAQDIKFEPVGIERSLELYRDLITEAPADLVVTPETAF
                     PVILQELPVEIARAVRTFMEKTGTTIIFGAAGADSPVDFTNSVFAIGPEQDQLYRYNK
                     HHLVPFGEFIPFGFRWFVDMMKMPLGDFRRGTLDQPAVPVRGIHVAPNICYEDLFGEE
                     IAATLRQQATPANMLANVTNLAWFGDTIALDQHLQISRMRALEMRRPMLRATNTGMTA
                     VVAPDGTVQAKLPTFQVGTLTATVQGMQGLTPYIRWGNVPVLIGSLLVLLVAARARRA
                     RG"
     gene            complement(477549..478436)
                     /gene="corC"
                     /locus_tag="Rmet_0450"
     CDS             complement(477549..478436)
                     /gene="corC"
                     /locus_tag="Rmet_0450"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium and cobalt efflux protein CorC"
                     /protein_id="ABF07336.1"
                     /translation="MNDPYPSSKPANHKQTDRPRSLLERLSDFISPEPDTRAELLEVL
                     QDAHERNLIDADSLSMIEGVFQVSELTARDIMVPRAQMDTVNIADAPETFIPYMQQTA
                     HSRFPVYEGNRDNIIGILLAKDLLRYYTDPNFDLRETLRPAVFIPESKRLNILLREFR
                     INRNHIAIVVDEYGGVAGLVTIEDVLEQIVGDIEDEFDLDEDHDNILPTADGAWRVHG
                     LTEIEQFNETFGTAFPDDDVDTVGGLLTNHVGHVPHRGEIITLPPMQFEVLRADARQV
                     HLLLVRREAPAEPALVAEA"
     gene            complement(478581..479318)
                     /locus_tag="Rmet_0451"
     CDS             complement(478581..479318)
                     /locus_tag="Rmet_0451"
                     /codon_start=1
                     /transl_table=11
                     /product="putative metal-dependent hydrolase"
                     /protein_id="ABF07337.1"
                     /translation="MTKKSPNATSLVLFDADGRARKANAHALRIQLADGRSLTLDLSQ
                     AGDGVVALLAEHTDTRQQAGLLVRPDNSDALSVAVTATPIVTTTGTPATPPALELDVQ
                     HGDGVSKRNGLPSRKQIEKWVKSALYADAALTVRFVDETEGRTLNRSYRGKDYATNVL
                     TFAYAENDDDPVAGDIVLCCPVVESEAKAQKKSLEAHYAHLIVHGVLHAQGYEHDDDT
                     EAEEMEAIETETLQALGFEDPYKPIRE"
     gene            complement(479321..480316)
                     /gene="phoL"
                     /locus_tag="Rmet_0452"
     CDS             complement(479321..480316)
                     /gene="phoL"
                     /locus_tag="Rmet_0452"
                     /codon_start=1
                     /transl_table=11
                     /product="putative enzyme with nucleoside triphosphate
                     hydrolase domain"
                     /protein_id="ABF07338.1"
                     /translation="MKIPTAEFVAPRDDNTRLQNLCGPLDENLRQIEQALDVTIQRRG
                     HRMTVRGERAQDATLALERFYNNARVALSIDDVQLGLVESRQVAAHGAYLPSTEGNDG
                     SSIDDESPVLHTRRTGLQGRTAMQRDYLRNILSHDLTLGVGPAGTGKTYLAVACAVDA
                     LERDVVKRIVLTRPAVEAGERLGFLPGDLAQKVDPYLRPLYDALYDLLGFDRTQKMFE
                     RQMIEIAPLAYMRGRTLNHAFIILDEAQNTTPEQMKMFLTRIGFGSKAVITGDTTQID
                     LPRGQKSGLVEAQHVLRDVRGVSLTRFTSVDVVRHPLVARIVEAYDEYHAQHKDA"
     gene            complement(480337..481689)
                     /gene="miaB"
                     /locus_tag="Rmet_0453"
     CDS             complement(480337..481689)
                     /gene="miaB"
                     /locus_tag="Rmet_0453"
                     /codon_start=1
                     /transl_table=11
                     /product="isopentenyl-adenosine A37 tRNA methylthiolase"
                     /protein_id="ABF07339.1"
                     /translation="MKKVFVKTYGCQMNEYDSDKMVDVLNATQGMEPTDNVEDADVIL
                     FNTCSIREKAQEKVFSELGRMKALKAAKPDLVIGVGGCVASQEGASIVSRAPYVDVVF
                     GPQTLHRLPDLINRRQQTGLSQVDISFPEIEKFDHLPPARVDGPSAFVSIMEGCSKYC
                     SYCVVPYTRGEEVSRPFEDVLAEVAGLAEQGVREVTLLGQNVNAYRGAMGGTSEIADF
                     ALLIEYVADIPGIERIRYTTSHPKEFTSRLIELYGRCDKLVNHLHLPVQHASDRVLAG
                     MKRGYSVLEYKSIIRRLRALRPDMSMSSDFIVGFPGETDADFDKLMAMVHEIGYDTSF
                     SFIFSPRPGTPAANLHDDTPHEVKLRRLQLLQATIEENVQRISQSMVGTVQRILVEGP
                     ARKDPTELHGRTENNRVVNFALPGVPQAQRDRMIGQMVDVNVTQAFPHSLRGEFVVRQ
                     "
     gene            complement(481753..482130)
                     /locus_tag="Rmet_0454"
     CDS             complement(481753..482130)
                     /locus_tag="Rmet_0454"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein"
                     /protein_id="ABF07340.1"
                     /translation="MPMLFSRLSLVACAATLLMSVAPAMAQETQPIPGAPVRVIPADA
                     MMARMEIVRSTDTDPMRAKLDGKAFGLAPGLRIFSTETLLMNPVTVAGKKFPVRYKLD
                     LYGQLLTAWVMTDAEVKAWKAAH"
     gene            complement(482296..483978)
                     /gene="clcB"
                     /locus_tag="Rmet_0455"
     CDS             complement(482296..483978)
                     /gene="clcB"
                     /locus_tag="Rmet_0455"
                     /codon_start=1
                     /transl_table=11
                     /product="voltage-gated ClC-type chloride channel"
                     /protein_id="ABF07341.1"
                     /translation="MRLRFLEDQEVTLFAAIPVGILAGIVTTLFKAALESSGLVMFGT
                     EADIVMVFAGLAVAWRVVIPALGGALAGGLLVLANRLAAAEPGPADYMDAVSRGTGQL
                     PLKITLLRSLSSFCSIISGSSVGKEGAMIQLAALCGSLFPSARADHTSGDTNMRRMLT
                     ACGAAAGLASVYHTPLSAAVFVAEVVFGALAVQRLMPLFLASVAGAMVSQWHGGLQPL
                     YPGLHIEPDLRPQMLMAAVLLGVLAGAAGALFMRATTIARNGFRHVPGGPVARLALGG
                     ALVGLLAIVVPEVVGNGYFTIQTILQGHPLSVPVWGVLVAKLVATVASIGSGAVGGVF
                     TPSLFVGAALGQLLAMLVPGGGMAPVLPLVGMTAFLAATSQAPLMSVLMVFEMTLAPA
                     LLLPSMIGAVAAYYTASRCQTLSLYSVVVEREQASAAAERARRLQLAGLCDPTDTVID
                     PGASVAQAADKFAETGTRYLYLVNADGALIGAISIHAVQRAQRDAPSANLLDLGDLGF
                     PSLTPDSRLRDALEIFSVHGINRIPLVRDTTSRELMGTVSKQRVLQEASSLF"
     gene            484218..485840
                     /gene="rhlE1"
                     /locus_tag="Rmet_0456"
     CDS             484218..485840
                     /gene="rhlE1"
                     /locus_tag="Rmet_0456"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA helicase"
                     /protein_id="ABF07342.1"
                     /translation="MSFSELGLSDKLVRAVAEQGYTTPTPIQAQAIPAILKGGDLLAG
                     AQTGTGKTAGFTLPMLQLLSETAARANGGNAPRGARPNVRALVLTPTRELAAQVEESV
                     RNYGKYLKLRSMVMFGGVGINPQIEALRRGVDIVVATPGRLLDHVAQRTIDLSHVELL
                     VLDEADRMLDMGFIHDIRKVLNVLPPKRQNLLFSATFSDDIRALADRLLDNPASIEVA
                     RRNTTAETVAQRVFPVDRERKRELLAHLVRQHDWHQVLVFTRTKHGANRLAEQLTKDG
                     LSALAIHGNKSQSARTRALTEFKAGTLRLLVATDIAARGIDIDQLPHVVNFDLPNVPE
                     DYVHRIGRTGRAGAEGEAISLVCVDEHGLLRDIERLIKRQIEQVLLPGFEVDPSIKAE
                     PIQKGRQQQRGGQPRGNGQGNAGNGGERRQPRAAQGERQEAPRQPRPAQPARGEARNG
                     NAGGSGNAPRTGQGGGRGNGHANSTAKGTAKGTAKGNAQGNAQGNANARGANPRPQQA
                     RPAQDNTAAPPARNRRPAPQAALLGGGRKPAH"
     gene            485852..486898
                     /gene="yihE"
                     /locus_tag="Rmet_0457"
     CDS             485852..486898
                     /gene="yihE"
                     /locus_tag="Rmet_0457"
                     /codon_start=1
                     /transl_table=11
                     /product="Aminoglycoside phosphotransferase"
                     /protein_id="ABF07343.1"
                     /translation="MSEPDRPSSTDEVPYAGLTPECILDALEAAGFYPDGRLLALNSY
                     ENRVWQVGIEDAAPVVAKFYRPGRWTDAAILEEHAFVQQLAGAEVPAVPALAANSGDQ
                     SGTTLFTHEGFRFAVFPRCGGREPALDKAETRTWLGRFIGRIHAIGATAPYQARPALD
                     IDTFGIASRDYLLAHDCIPADLLAPWRAAADLALDGVRRSYERAGEVRLLRLHGDCHR
                     GNVLWIDEEDARGRGTPGPHFVDFDDSRMGPAVQDLWMLLEGDRVAMQDQLADIVAGY
                     EDFAEFDARELWLVEALRTLRLLHYSAWLASRWRDPAFPAAFPWFGTARYWQDRILEL
                     REQIALMDEAPLWA"
     gene            complement(486953..487387)
                     /gene="uspA1"
                     /locus_tag="Rmet_0458"
     CDS             complement(486953..487387)
                     /gene="uspA1"
                     /locus_tag="Rmet_0458"
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein, UspA family"
                     /protein_id="ABF07344.1"
                     /translation="MPQIVLATDGSAFSDAAARFLADGKLLQTGFTVHVIHITPDVTG
                     QVRAFVSKETIDAWHQEESGKAMASVCEILSAAKVPFEQHALHGFPPEKIVAYAKSVD
                     AGAIVMGTHGRGSFLDAVIGSVAGRVLAHAGCPVIMVKPEKS"
     gene            487717..488340
                     /locus_tag="Rmet_0459"
     CDS             487717..488340
                     /locus_tag="Rmet_0459"
                     /codon_start=1
                     /transl_table=11
                     /product="putative two component transcriptional
                     regulator, LuxR family"
                     /protein_id="ABF07345.1"
                     /translation="MSNALVIDNHPGVRAAASAALMESMGFEEVRLATTATEALEELR
                     TRQRPDLVMVDLDLGDLPGDAVVEEVVSHHPATRVLVLSAASGAAERALLSGAHGYVD
                     KGNGIGGIEHAVRAVMSGYAAFPLALLTTIRRAANAPADPILVLSRRELTVMRFLAAG
                     HSNKAISVVLGISNKTVSSHKASIMTKLGFRSLIDLAEFARRHHLAC"
     gene            488468..490126
                     /locus_tag="Rmet_0460"
     CDS             488468..490126
                     /locus_tag="Rmet_0460"
                     /EC_number="4.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Pyridoxal-dependent decarboxylase"
                     /protein_id="ABF07346.1"
                     /translation="MKARKAGRSDNAREATGNDAEMGEGCPLHWFDADLGAFDDLERR
                     VAEHPADFFAGQDFDPVGACATREASFASVQIPEDPTAPQQHADHLLNDVFRHVMPVA
                     SPTFVGHMTSSLPSFMPSLAKIVAALNQNVVKLETSGALTGLERQVIGMLHHLVFARD
                     DAFYAQWLHNAEHSLGAFCSGGTTANLTALWASRNNTLRARDGFAGINQAGLVAALRH
                     YGYAGLAIVVSERGHYSLRKAADILGIGRENLVPVGVDEDGRMRVDLLRDTLRDLQQR
                     NIRTVAIVGIAGTTETGAVDPLDAIADVAQEIGCHFHVDAAWGGATLLSARERARFAG
                     IERADSVVIDAHKQFYVPMGAGMVLFRDPAWTQDIIQHANYIVRKGSVDLGRHTLEGS
                     RGSAAVMLYANLHLLGRKGLAKLIDTGIDNAKYFASLIEQQPDFELDSRPQLCILTYR
                     YVPAPVRAALLSASPEQREQLLEALDALTINIQEMQRDAGRSFVSRTQLTSSQWGGRP
                     IAVFRVVLANPDTTHEILQSLLEEQRGLAKQSPMLPALMAMVGG"
     gene            complement(490136..490390)
                     /locus_tag="Rmet_0461"
     CDS             complement(490136..490390)
                     /locus_tag="Rmet_0461"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABF07347.1"
                     /translation="MFRIVALGNLRARAMPRGSPLTSGSQAKQVATRITSKAAAHPPQ
                     ATAELPWRRYQNEAKRFWLDARPQTVQVARQGCATTPESC"
     gene            490317..490487
                     /locus_tag="Rmet_6418"
     CDS             490317..490487
                     /locus_tag="Rmet_6418"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADC45036.1"
                     /translation="MPLVKGDPRGIARARKLPKATIRNMKQNLGFAFVRRPVPTSQNK
                     KPQSREGLRLFK"
     gene            complement(490489..490565)
                     /locus_tag="Rmet_R0005"
     tRNA            complement(490489..490565)
                     /locus_tag="Rmet_R0005"
                     /product="tRNA-Met"
     gene            complement(490734..492431)
                     /locus_tag="Rmet_0462"
     CDS             complement(490734..492431)
                     /locus_tag="Rmet_0462"
                     /codon_start=1
                     /transl_table=11
                     /product="permease of the Major Facilitator Superfamily"
                     /protein_id="ABF07348.1"
                     /translation="MANAQNVAMPGGKAHNAPMTREEKKVILASSLGTVFEWYDFYLY
                     GSLAAVIAKQFFAGLDPTSAFIFALLAFAAGFIVRPFGALVFGRLGDMIGRKYTFLVT
                     ILIMGLSTFIVGLLPGYATIGWAAPIILIALRMLQGLALGGEYGGAATYVAEHAPHGK
                     RGAYTAWIQTTATLGLFLSLIVILLCRELTGPQFDTWGWRIPFLVSILLLAMSVYIRL
                     SMSESPAFQKMKAEGKTSKAPLTEAFGQWRNLKIVILALVGLTAGQAVVWYTGQFYSL
                     FFLTQVLKVDAKTANLLIAGALVIGTPFFIFFGSLSDKIGRKWIIMLGCALAVLTYFP
                     LFKAMTHYANPALERAQQTAQIVVTADPKTCSFQGSPIAREIDFRSSCDIVKRTLAQA
                     SASYEVVQAPAGTMASVKIGDKEIKAFDATVTGGHSFDDASKKQIAAFKKEVSESMSA
                     AGYPTKADPAQMNTIMVLVVLVILVIYVTMVYGPIAAMLVEMFPTRIRYSSMSLPYHI
                     GNGWFGGLLPTISFALVAQNGNIYYGLWYPIIIAAMTFVLGALFVRETKDVDIYAND"
     gene            complement(492790..493110)
                     /locus_tag="Rmet_0463"
     CDS             complement(492790..493110)
                     /locus_tag="Rmet_0463"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="ABF07349.1"
                     /translation="MRKAPPDRMTPRERLAWRHNLRWIAVLLVIWFVVTFVISWFARE
                     LRFDFFGWPFSFWAAAQGALIVYVAMAALYAWHMNRVDRELDSETPDAETHPAPPTNP
                     AGRS"
     gene            complement(493107..494681)
                     /locus_tag="Rmet_0464"
     CDS             complement(493107..494681)
                     /locus_tag="Rmet_0464"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sensory histidine kinase in
                     two-component regulatory system with Rmet_0465"
                     /protein_id="ABF07350.1"
                     /translation="MSLLRLPWRRRSAAGPARATDPTRPTLADAAAEDQALADALPHL
                     EETSAHPAPRSLFGEILDWMLAPLLLLWPMSIAVTYLVAKSIANGPFDRALEASAIVL
                     SQQVREVNGRVTLQLPLSAREILRADETDNIYYQVVGKHGEYVAGDHDLPLPSEDEEG
                     HAGLVSLRDDRVAGNDVRVAYTYVELKNISGAQPVLVQVAETLDKRARLANEIIKGVI
                     LPQFVILPLAVVLVWFGLTRGLAPLTAIQQRIRARNPGDTSPIDERAAPQEITPLVAS
                     FNDLLSQLEQSVQTQKRFIADAAHQMKTPLAGLRMQAELAQREQSPEELHRSLAQIAG
                     SSKRTAHLVTQLLSLARMENLAGVGGMTPVNLTALARDVVKDLLPQAWARQIDLGLEG
                     DEHPVMVTGNRVMLTEMLNNLVDNAIRYTPPGGHATVRVIADAFEPFAYLDVEDTGPG
                     IPPSERGRVMERFYRVLGTNTEGSGLGLAIVREIVQQHGGEISIDDNVYQTEPRLAGA
                     RFHVTLRRAPPEETNT"
     gene            complement(494703..495392)
                     /locus_tag="Rmet_0465"
     CDS             complement(494703..495392)
                     /locus_tag="Rmet_0465"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator in two-component
                     regulatory system with Rmet_0464"
                     /protein_id="ABF07351.1"
                     /translation="MRILIAEDDDVLADGLTRSLRQSGYAVDHVANGVEADSALSTQS
                     FDLLILDLGLPRMSGLEVLKRLRARSAMVPVLILTAADSVDERVKGLDLGADDYMAKP
                     FALSELEARVRALVRRGAGGGATLMRHGPLAFDQVGRIAYLNEQMLDLSAREVGLLEI
                     LLTRSGRLVSKEQLVDHLCEWGEEVSNNAIEVYVHRLRKKIEVGGIRIATVRGLGYCL
                     EKYQPAVAAHG"
     gene            495632..496693
                     /gene="recA"
                     /locus_tag="Rmet_0466"
     CDS             495632..496693
                     /gene="recA"
                     /locus_tag="Rmet_0466"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA strand exchange and recombination protein
                     with protease and nuclease activity"
                     /protein_id="ABF07352.1"
                     /translation="MDDKKAGAGVSAEKQKALAAALSQIEKQFGKGSIMRLGDGEIEQ
                     DIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQVVAEMQKLGGTCAFI
                     DAEHALDVQYAGKLGVDVGNLLISQPDTGEQALEITDALVRSGSIDLIVIDSVAALVP
                     KAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKIGVMFGSPETT
                     TGGNALKFYASVRLDIRRIGSIKKGDEVVGNETKVKVVKNKVSPPFREAFFDILYGQG
                     ISRQGEIIDLGVDAKIVEKAGAWYSYNGEKIGQGKDNAREYLRENPDIADEIENKVRL
                     ALGVAPLNTVAGAPAEVEG"
     gene            496732..497280
                     /gene="recX"
                     /locus_tag="Rmet_0467"
     CDS             496732..497280
                     /gene="recX"
                     /locus_tag="Rmet_0467"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein for RecA"
                     /protein_id="ABF07353.1"
                     /translation="MRRLFCFHPGFPYRAAPTAGFLVISRMPRPPLSLKARAVGYLSR
                     REHSRAELARKLAPHAESAEEVEALLDVLERDNWLSNERFVDSLVHRRASRYGAARVL
                     QEAKTHQLGNDQLRDLQDRLRDSELDRAREVWRKRFGVPPDSPEARAKQIRFMMARGF
                     SRSVVGKIIRGAEDEGMDDLGE"
     gene            497530..498291
                     /locus_tag="Rmet_0468"
     CDS             497530..498291
                     /locus_tag="Rmet_0468"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07354.1"
                     /translation="MVVLPMDQAVCRDELPPIRHFQSAASAPGVMPLSPPANRVLRHR
                     RAITAEAYLRDDGLWDIEARLTDTKPRDIELAGGRIRPEGQPLHDLWLRVTIDLRMNV
                     VDAEACSDWVPYPTHCDLIGPAYRKLIGLNLSKGFRKAVRERLGSVAGCTHLTELAGV
                     LPTAAIQAFAGDVFNIRDGVQDIDPEPPMQLHGCHALHFEGEVVRQFYPRWYGHQPKP
                     KAGAAASSPQTASRADAPASGGEDTLAHRPNGTSG"
     gene            498381..499547
                     /gene="sucC"
                     /locus_tag="Rmet_0469"
     CDS             498381..499547
                     /gene="sucC"
                     /locus_tag="Rmet_0469"
                     /EC_number="6.2.1.5"
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-CoA synthetase, beta subunit"
                     /protein_id="ABF07355.1"
                     /translation="MNIHEYQGKEILRKYNVPVPRGIPAFSVEEALKAAEQLGGPVWV
                     VKAQIHAGGRGKGGGVKVAKSIDEVKTYATNILGMTLVTHQTGPEGKKVNRLLIEEGA
                     DIKKELYVSLVVDRVSQKVALMASSEGGMDIEEVAAHTPEKIHTLIIEPSEGLKDSDA
                     DDIARKIGVPDASVPQARQALQGLYKAFWDTDASLAEINPLILTGDGKVVALDAKFNF
                     DSNALFRHPEIVAYRDLDEEDANEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTI
                     KLFGGEPANFLDVGGGATTEKVTEAFKLMLKNPNVQAILVNIFGGIMRCDVIAEGVIT
                     ASKAVQLGVPLVVRMKGTNEELGRKMLADSGLPIISADTMEEAAQKVVAAVAGK"
     gene            499606..500487
                     /gene="sucD"
                     /locus_tag="Rmet_0470"
     CDS             499606..500487
                     /gene="sucD"
                     /locus_tag="Rmet_0470"
                     /EC_number="6.2.1.5"
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-CoA synthetase, NAD(P)-binding, alpha
                     subunit"
                     /protein_id="ABF07356.1"
                     /translation="MSILINKDTKVITQGITGKTGQFHTRGCRDYANGKNCFVAGVNP
                     KKAGEDFEGIPIYASVKDAKEQTGATVSVIYVPPAGAAAAIWEAVDADLDLVVCITEG
                     IPVRDMMEVKDKMRRQNKKTLLLGPNCPGLITPDEIKIGIMPGHIHRKGRIGVVSRSG
                     TLTYEAVGQLTALGLGQSSAVGIGGDPINGLKHIDVMKMFNDDPETDAVVMIGEIGGP
                     DEANAAYWIKENMKKPVVGFIAGVTAPPGKRMGHAGALISGGADTAQAKLEIMEACGI
                     KVTKNPSEMGRLLKAML"
     gene            500530..500724
                     /locus_tag="Rmet_6419"
     CDS             500530..500724
                     /locus_tag="Rmet_6419"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADC45037.1"
                     /translation="MQSDCRTCGACRLLPERIAAIVAPASEAGAMSFLRRKILGYIPR
                     LLQRGLKPNRKVRTINLHVW"
     gene            500801..501496
                     /locus_tag="Rmet_0471"
     CDS             500801..501496
                     /locus_tag="Rmet_0471"
                     /codon_start=1
                     /transl_table=11
                     /product="Membrane protein TerC family, possibly involved
                     in tellurium resistance"
                     /protein_id="ABF07357.1"
                     /translation="MELLSSSAFWIALGSIILTNIVLSGDNAVVIALASRNLPPAQQK
                     KAIFWGSAAAIIMRVVLTVAAVKLLSLPYLKIVGALLLVYIGVQLLTGDDDEEGHDAK
                     DNIWAAIRTILIADLVMSLDNVVAVAAAAQKGPEGSQLMLLVLGLGLSIPLIVFGSTI
                     LLKVMERFPIIIVLGAALLGYLAGEMLVSDPVDAEWFQVHVPHAHLVFGVVGAVLVVM
                     LGKLLRRRSAQTA"
     gene            501865..502413
                     /gene="pilA"
                     /locus_tag="Rmet_0472"
     CDS             501865..502413
                     /gene="pilA"
                     /locus_tag="Rmet_0472"
                     /codon_start=1
                     /transl_table=11
                     /product="Type IV pilus structural subunit PilA"
                     /protein_id="ABF07358.1"
                     /translation="MTRQIKVVFLREQRRALERKNRRGFTLIELMIVVAIIGILAGVA
                     IPQYQDYIARSQFAEGMSLASGQKAGVIESFAAAGACPNNASAAVDGVPVASAIKGSY
                     VQSVTTGGTASNAGGCTIIAKFKDEGITRGLLGKQVTLTMGNADGGSVTWQCESSADK
                     RYVPQACAKASESGKTTTTTTG"
     gene            502738..503157
                     /gene="pilE"
                     /locus_tag="Rmet_0473"
     CDS             502738..503157
                     /gene="pilE"
                     /locus_tag="Rmet_0473"
                     /codon_start=1
                     /transl_table=11
                     /product="Fimbrial protein precursor (Pilin) (Strain P1)"
                     /protein_id="ABF07359.1"
                     /translation="MIVVAIVGILAVIAVPQYQDYVARAQFAEGLTLASAQKAAVVES
                     FSQRGFCPSNSYSEYDGIPVSGHISGSYVQSVIVGGSATEGGVGCTITATFRTENVSP
                     GLSGKTLTLTMFGGSSGSIAWLCKSDAENRYIPRSCT"
     gene            503388..505175
                     /locus_tag="Rmet_0474"
     CDS             503388..505175
                     /locus_tag="Rmet_0474"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipidA core O-antigen ligase
                     transmembrane protein"
                     /protein_id="ABF07360.1"
                     /translation="MPAPRATLPATAIVVAFTLPLLVSKHTLPLATFYGEWTAGLLGV
                     FLIIALALRPSQSGSRASRSFPWIMLLPIWLIVTTVAQAVTGMVDVTGSRQLTQIVLA
                     LGAALMLAAWRASQSMSTDERASIVDSLAIAFMIAGLLGTLAQWVQVFHLEDQAFNLV
                     SEYFYDNNRRLWGNLNQPNHQATIQGLALVASVWLATRGWLRFPGWLVAVLLLESGIV
                     LSGSRTGVLHIGLAALYALIAAHLARGTPRGTDPMHRAPGLIVAAVLMVVGIVVLQPA
                     IKHAGQLFDWRLFDTVAQLQSGDQVSARGALWAHAWAMFRAHPLLGVGYGEFGWAQFQ
                     QMAEVGKTAEMSLHAHNAVLDLLAKTGLVGTIGVALVLVGWLWRVVRDRIWAASSSER
                     AMAVPMLFWLAMYGAHSMLEYPLHYLYFFLPFCFLLAWLEPSGFGKRLPRAVPAIACV
                     LFIVVSAFLLVTLWQDYKRVEAREYAHEDKRDSLPMPRLWFRQHAASDTVEHARITPD
                     NAASLLPAHMAALHLLPTPNLIGRTAWLLALTGDQAKARQWVERLPYYFQGDEATILE
                     MLSRDCDALGADRRPREFCAWARLRARRG"
     gene            complement(505198..505737)
                     /locus_tag="Rmet_0475"
     CDS             complement(505198..505737)
                     /locus_tag="Rmet_0475"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein"
                     /protein_id="ABF07361.1"
                     /translation="MNLRTLSLLTLATTASLGLGACAVMPSGPTVMALPGSNKTFDQF
                     RGDDYNCRQFAFQQIGGTTAQQNANAAAVGSTVVGTALGAAAGAAFGGGSGAAVGAGA
                     GMLTGAAVGTGAAYNSAYGTQRQYDAAYVQCMYATGNRVPVYGQMVSAPPPGPAHEPM
                     PPANYQPYYPPPPPPGYVR"
     gene            complement(505734..506198)
                     /locus_tag="Rmet_0476"
     CDS             complement(505734..506198)
                     /locus_tag="Rmet_0476"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein"
                     /protein_id="ABF07362.1"
                     /translation="MNGRKLCQIALVAAAALAFVSTSAQAHGGGHGGGGGHAHVGVGV
                     VVGPGWGWGWGPGWGWGPGWYAPYGPYYYPGYYPPYYPPAAAVAPSEPPQYVEQGNVS
                     NHGAPGDANAWWYHCSRPEGYYPYVKDCPGGWQRVPPQQPSSSNPSNPGVSS"
     gene            complement(506519..506764)
                     /locus_tag="Rmet_0477"
     CDS             complement(506519..506764)
                     /locus_tag="Rmet_0477"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein"
                     /protein_id="ABF07363.1"
                     /translation="MKTLLMLAAACAALGAGMAHAGNGPRDMYLDGARTPDPYTDGAK
                     ATRFDVYTDGASVLGTRDVFSDGSSTIDKRDAFTDGA"
     gene            complement(506943..507131)
                     /locus_tag="Rmet_0478"
     CDS             complement(506943..507131)
                     /locus_tag="Rmet_0478"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABF07364.1"
                     /translation="MEKPSEVATSTHPKSLIYKDVQVALLTIYDMCKAVDRGMVMGNV
                     KLLEKHGGKSGDWVAGGA"
     gene            507316..508245
                     /locus_tag="Rmet_0479"
                     /pseudo
     CDS             507316..508245
                     /locus_tag="Rmet_0479"
                     /note="ABC transporter, ATP-binding protein-related
                     protein"
                     /pseudo
                     /codon_start=1
                     /transl_table=11
     gene            complement(508286..509536)
                     /gene="tnpA"
                     /locus_tag="Rmet_0480"
     CDS             complement(508286..509536)
                     /gene="tnpA"
                     /locus_tag="Rmet_0480"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS1090"
                     /protein_id="ABF07366.1"
                     /translation="MPRKPKAPLAELPAIPAELLEQFGNGPMTAEAIHAATLALKKAL
                     IERALGGEMNHHLGYSPGAAKPAAVTNQRNGKGAKTVLTEDGPIRIEVPRDRDGSFEP
                     LLIPKHERRFTGFDDKIVAMYARGMTVREIQGFLQEQYGTEVSPDFISSVTDEVMAEV
                     TAWQARPLEQMYPVVFFDALRVKIREDAVVRNKAVYLALGVLPDGTREILGLWIENTE
                     GAKFWMKVFNDLKTRGVNDILIAVTDGLKGMPEALSAVFPATTLQTCIVHLIRNSLNY
                     ASWKDRKALAAAIRPIYTAPSAEAAEAELNTFAAGPWGQKFPTVSASWRNAWDRVIPF
                     FAFPPAVRRVIYTTNAIENINSQLRKIIKTRGHFPSDEAATKLIWLALRNITSDWGRA
                     AKDWKDAMNQFAILYQDRFVRPSV"
     gene            509588..510289
                     /locus_tag="Rmet_0481"
                     /pseudo
     CDS             509588..510289
                     /locus_tag="Rmet_0481"
                     /note="ABC transporter, ATP-binding protein-related
                     protein"
                     /pseudo
                     /codon_start=1
                     /transl_table=11
     gene            complement(510375..510857)
                     /locus_tag="Rmet_0482"
     CDS             complement(510375..510857)
                     /locus_tag="Rmet_0482"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein; putative exported protein"
                     /protein_id="ABF07368.1"
                     /translation="MLYHLVMETSIWISLASLVISGSLSSAAFLHTRRDSLLKLRREA
                     LAHARASAVEWQCVLNDIEALKLGEVRSLLPMPSRAEFDAWLNAVHDTFKGSTERAQA
                     IAENVSANFHKLTRHEAILVIRACEDGTPVVSAAREELRRKMEDFAKRLEREASRRVS
                     "
     gene            510846..511022
                     /locus_tag="Rmet_6420"
     CDS             510846..511022
                     /locus_tag="Rmet_6420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADC45038.1"
                     /translation="MVKHGDYGMASNVWQKFLWDHLIRPEDELPPRGPPRASRRTPAI
                     VNTRSPLVARARTQ"
     gene            511185..512711
                     /gene="tnpA"
                     /locus_tag="Rmet_0483"
     CDS             511185..512711
                     /gene="tnpA"
                     /locus_tag="Rmet_0483"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase catalytic site ISRme4"
                     /protein_id="ABF07369.1"
                     /translation="MIDVAILSIIRRWHLRDQIPLREIARRLGISRNTVRRYLRTDVT
                     APAYPTRQSPSKLDGHAAKLAAWLKTEANKPRKQRRTLKQIHADLCALGFTGSYDRVA
                     AFARRWRQEQQEQARSSGRGTYIPLRFAEGEAFQFDWSEDWAVIAGERTKLQVAQFKL
                     SHSRAFFLRAYLLQTHEMLFDAHHHAFVAWGGIPRRGIYDNMKTAVDRVRQGKLRDVN
                     LRFGTMVSHYLFDAEFCNPASGWEKGQIEKNVQDSRHRIWQRVPAFGSLAALNDWLAD
                     QCVRLWQQTRHPELDMTIWEAWSLERPHLMPVGQAFDGFVEHTKRVSPTCLVNFERNR
                     YSVPASFANRPISLRVYATRLLFVAEGQVIAEHVRHINRGHHPGHTVYDWRHYLAVLQ
                     RKPGALRNGAPFAELPEGFRRLQATLLKRPGGDREMVEILALVLLHDEQAVLTAVELA
                     LEAGAASKQTVLNILSRLLEGGPVAPITTPQALALQVEPQANVARYDSLRDREVPHAA
                     "
     gene            512701..513486
                     /gene="tnpB"
                     /locus_tag="Rmet_0484"
     CDS             512701..513486
                     /gene="tnpB"
                     /locus_tag="Rmet_0484"
                     /codon_start=1
                     /transl_table=11
                     /product="IstB-like ATP binding protein ISRme4"
                     /protein_id="ABF07370.1"
                     /translation="MQHEAMMEMLKSLKLHGMAHALGDLAAQDSPAYQSAVAILSRLL
                     KAETTEREVRSLAYQMKVARFPAYRDLTGFDFSCSEANEALVRQLHRCEFLESAHNVV
                     LVGGPGTGKTHLGTAIGVQAVEHHHRRVRFFSTVELVNALELEKVSGKPGHLATRLMY
                     ADLVILDELGYLPFSQVGGALLFHLISKLYERTSLIITTNLSFGEWSSVFGDAKMTTA
                     LLDRLTHHCHIVETGNDSYRFKHSTTQPKKEKRTAKQPAQSDT"
     gene            complement(513544..513915)
                     /locus_tag="Rmet_0485"
                     /pseudo
     CDS             complement(513544..513915)
                     /locus_tag="Rmet_0485"
                     /note="ser/tyr recombinase family protein (fragment)"
                     /pseudo
                     /codon_start=1
                     /transl_table=11
     gene            complement(514059..514538)
                     /gene="moaC"
                     /locus_tag="Rmet_0486"
     CDS             complement(514059..514538)
                     /gene="moaC"
                     /locus_tag="Rmet_0486"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis, protein C"
                     /protein_id="ABF07372.1"
                     /translation="MSQLTHFDNAGQAHMVDVGNKANTHRVAVATGTITMLPATFALV
                     RDGSAKKGDVLGIARVAAIMATKRTADLIPLCHPIGLTKVAVDFALDEPSSTIACIVR
                     TETHGQTGVEMEALTGVQVALLTIYDMCKAVDRGMVMGNVKLLEKHGGKSGDWVAGA"
     gene            514576..516393
                     /locus_tag="Rmet_0487"
     CDS             514576..516393
                     /locus_tag="Rmet_0487"
                     /EC_number="3.4.24.-"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc metalloprotease, peptidase family M48"
                     /protein_id="ABF07373.1"
                     /translation="MGTSSAGRYHSNMPKTLRPFRLSARPSARPLAAAAPASRASHMT
                     RALAAVLVLTMAAPAWPQGVQGTGAKPAGTTSIAPAAPPPPSDASDQVYDNLNRSVRA
                     GQKSEFGLRSANTVVESSGNQLPDLGDPSTASLSPDMEKRLGDRIMRDIRRDPDYVSD
                     PLMNDYLNALGYRLVQAARRQNISGSNGSGTFATGFELFGVRDRSINAFAMPGGYIGV
                     HTGLLVQSETESELASVLGHEIGHVMQRHIARGITNQNQSMWIALASMVLAGLAATKS
                     GDAAAALAMGGQGAAVANLLSFSRGAEREADRVGFQIMTAAGFDPQGMPDFFQRLQRV
                     MGISDNSVPAYVRTHPLTSERIADMQDRVSHVPPHKIPNTPEYEFARARARVIQEPTP
                     NDVRNVLAVFQAQVNSNTSAVRLPAVYYGIAFANQRLGRFADAEKALAEARRLYGNIP
                     GATSGSPMLDVMAVELARAEGRTQDALTQAMATMRAFPLSHAAALAYADTLVAANKLD
                     DAVAFLRSRTREETSRSEWWELLARAYAAQGKRLQQHQAMAEKYAMDGSYQAAIEQLQ
                     IARKAGDGDFYTLSEVDARLHQLQLQFKEEKQDNKGMPN"
     gene            complement(516438..517010)
                     /locus_tag="Rmet_0488"
     CDS             complement(516438..517010)
                     /locus_tag="Rmet_0488"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07374.1"
                     /translation="MDEVVKQAMARWPNVPYCYGWLALDRRGQWRMRNEFAQQHGLSG
                     DPIRHEALIGFIERNYTHDERGAWYFQNGPQRVFVSLMYTPWVARLHNGRLTTTSDRP
                     FTPTACYTDEQGNVVFAGTVQGVDNAVQVALLHDHDLEAFSEACDWHGEACGATLGVF
                     HHDGVDIDIEPVTEAELPKRYGFVRTPVAE"
     gene            complement(517074..518111)
                     /locus_tag="Rmet_0489"
     CDS             complement(517074..518111)
                     /locus_tag="Rmet_0489"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase of the alpha/beta-hydrolase fold
                     family, YheT type"
                     /protein_id="ABF07375.1"
                     /translation="MLFGEAFQTPWWLRGGHAQTILPARFTRHRRIVFRRERWDTPDG
                     DFIDLDWTTHPTTPGAPLVVMFHGLEGDSRSHYAQTLMAALRERGWQGVIPHFRGCSG
                     ELNIAPRFYHSGDSAEIRWVLERVRNQVHTVQPGRQMLAVGISLGGNALLRYLGEEGS
                     GANFLSAAASVSAPLDLAAGGAALSSGFNMIYTRMFLQTLKRKSLAKLEQFPGLYDRE
                     TMLGSRDLYAFDNVVTAPLHGFRDTDDYWARASSKPILGEIRVPTLVLNARNDPFLPA
                     RHLPGPREVSADVLLEQPEHGGHVGFMTPREGLLGQLPLLPFAGHIEWLPTRILDYFD
                     SVRATQATPAT"
     gene            complement(518129..518569)
                     /locus_tag="Rmet_0490"
     CDS             complement(518129..518569)
                     /locus_tag="Rmet_0490"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07376.1"
                     /translation="MPRFARLFDSAEDIVDAFREAMKLRDADGALRLWLDEDSVTCVM
                     PDGQRLIGHDQLRQAFALLLEEQPVLIDAIETSSHASLAVSIFDVTEALRFGTDRVEA
                     DLYVHTTYVLMQNHEGWRLAHIHCSPANAVQVAAVAAAPGQALH"
     gene            complement(518580..519644)
                     /gene="rfaF"
                     /locus_tag="Rmet_0491"
     CDS             complement(518580..519644)
                     /gene="rfaF"
                     /locus_tag="Rmet_0491"
                     /EC_number="2.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-heptose:LPS heptosyltransferase II"
                     /protein_id="ABF07377.1"
                     /translation="MPGHRITGPRNTHNMRKALVIAPNWIGDALMAQPLFALLKARHP
                     QLVIDALAPKWVAPVLARMPEIGKVFPTDLAHGKLQLSARLLFAQQLKHEGYDMAYVL
                     PNSLKSALIPFLAGIPLRIGYRGEARFGMLNVRHANPPRDKRPPMVEHYARLALKPGA
                     RLPESIPDPKLKSDPRRMAATAERFGIAPGTRLISFCPGAEFGPAKRWPAAHFAALAQ
                     MLRRSFPYAQIIALGSAKDAEIADEIVKGAPFVRNLCGQTSLDDAVDLLALSEAAVCN
                     DSGLMHVTAALNRPQVAVFGSSDPRHTPPLSQAASIMWLQLECSPCFKRECPLGHLRC
                     LKEIEPEMVFVELRKLLHRP"
     gene            complement(519718..519912)
                     /locus_tag="Rmet_0492"
     CDS             complement(519718..519912)
                     /locus_tag="Rmet_0492"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07378.1"
                     /translation="MTQTASVVEIGAEDMPLHCPTANTPAWNYHPRVFLDVADTGEVR
                     CPYCGTVYKLKPGTVLKGHH"
     gene            complement(519972..520892)
                     /gene="ilvE"
                     /locus_tag="Rmet_0493"
     CDS             complement(519972..520892)
                     /gene="ilvE"
                     /locus_tag="Rmet_0493"
                     /EC_number="2.6.1.42"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino-acid aminotransferase"
                     /protein_id="ABF07379.1"
                     /translation="MSMADRDGKIWMDGKLIEWRDAKIHVLTHTLHYGMGVFEGVRAY
                     KTPEGTAIFRLKEHTRRLFNSAKIFQMAMPFDEATLEAAQREVVRANNLESCYIRPLV
                     WIGSEKLGVSAKGNTIHVAIAAWPWGAYLGEEGLERGIRVKTSSFTRHHVNVSLVRAK
                     ASGYYINSILANQEATGLGYDEALLLDTEGYVSEGSGENVFIVRNGVIYTPDLASCLD
                     GITRDATLTIARDLGIEVREKRITRDEMYCADEAFFTGTAAEVTPIRELDDRVIGEGR
                     RGPVTKRIQDAFFAAVGGTDEKYKKWLTLV"
     gene            520891..523968
                     /locus_tag="Rmet_0494"
     CDS             520891..523968
                     /locus_tag="Rmet_0494"
                     /codon_start=1
                     /transl_table=11
                     /product="Superfamily II DNA/RNA helicase, SNF2 family"
                     /protein_id="ABF07380.1"
                     /translation="MVVSLCSPGKCRKGTIVSRASLRANEGRRIERSTIAPSDLPPFR
                     SRVSQPELPVERADHDADSVADGGWQATLCALEALAGGVDEAAGTGDGRRLLWALTLD
                     ADGVVGTIEPLEQTHGARGWSKPRPVPLARVAEDDTLPQWDVRVARAIRRDASRNRRH
                     VLDRAAAVVALVGHPAVVLSHAPTVPMEVVESAPSLEAVREGDRYVLRIVPPLREALA
                     MEDFLPAAARQEAESLRQITVLQDGPRRLRVVRFTPAQQGAAKLIAGGLSVPADAQAR
                     LDSTLRALAGHFQIHADSSGEARERDPESRLRAEVAPVGRGISLRLVVTPLGVLGPRL
                     APGHGRAQLMATIGGETHVTYRDLDAEHAHVAEVFEALPFLVQQAPAGGEHTWTLDDP
                     EDALTAIEVLPGLAGVIDLEWPRGRELRVLPADIAQLAVSVETGSEWFKLVGELRVAE
                     GLVISLEKLVAWAHGHAGRFMPMAHGVYVALTRQLRDRLRDLAGVGDGVRDGIRVPLV
                     AAPWLDDVLAGAGIDPDAHFRTRVKQLRAARGHDAPVPPTLVAELRPYQLEGFRWMMS
                     LAEAGFGACLADDMGLGKTLQSLAVLLARAAGGPALVVAPTSVCGNWATEARRFAPAL
                     RVHVYADGDREAIVGQAAAHDLVIVSYNLLQQARKAFCDRHWHTVVADEAQSFKNPSS
                     RRAQAMFALPADCRIALSGTPVENRLAELWAVMRFCVPGLLGSLARFNEHFANPIERS
                     GARDPRQRLRRMIAPFVLRRTKAQVLDELPPRTELVIRVTPEPTEAAHYEALRRQALS
                     EAERALLRPRKDKKAPAAMTEPEARIHVLAQLMRMRRAACDPRLVTPDVGQPGAKVRA
                     FAELAATLAANGHKTLVFSQFVDFLQMLRQALVDAGLAWQYLDGATPAGERTRRVAAF
                     QAGEGDVFLISLKAGGFGLNLTAADYIVIADPWWNPAAEDQAMGRAHRIGQQRPVTVY
                     RLIAAGTIEERIVDLHQGKRALADGVLDAMDGEAIGRDVPLPDVDELVGLLRR"
     gene            524193..525710
                     /locus_tag="Rmet_0495"
     CDS             524193..525710
                     /locus_tag="Rmet_0495"
                     /EC_number="3.5.1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="Amidase"
                     /protein_id="ABF07381.1"
                     /translation="MGSVQDDNGATVTLPDLSPADAVQPEASFHPVHQAAAQLARGET
                     TAQALVDACHAAWAARNGEINAMVLADFEAARHAARQSDARRRAGQALGPLDGIPFSI
                     KESFDVAGWPTTCGSPARRAHRAGSDAVVVERLRAQGAVLLGKTNVPLGLRDWQSYNA
                     IYGTTRNPHDLSRTPGGSSGGSAAAVCAGMSYFDIGSDIGSSLRNPAHYCGVFSHKSS
                     HGIVPLRGHGNAAAGFAGQDINVAGPVARSAYDLELILRAISGPDAAELPAWKLDLPA
                     CDHARLADFRVAVLPTHPLAEVDATVSGAIEGLGHWLTGQGARVDWNVRPDFDAAALW
                     RTYVLLLRATTSLYMDDAAFADALAKAGDAGNDEDYATLQFSGATLSHRDWLLLQHAR
                     ARFADAWERFFADYDVLLCPAASTTAFPLDEAGEPWQRTIDVNGTAWPLTSQLFWAGH
                     SGLCGLPSTVAPIGPASDGLPVGVQIVARRFGDLTSLRFAQQLEAAGHVFRQPRA"
     gene            525747..527072
                     /locus_tag="Rmet_0496"
     CDS             525747..527072
                     /locus_tag="Rmet_0496"
                     /codon_start=1
                     /transl_table=11
                     /product="Major facilitator superfamily (MFS_1)
                     transporter"
                     /protein_id="ABF07382.1"
                     /translation="MLDWFRELSRAERKGFYGAFLGHAVDVFDFMIYSFLISTLLAQW
                     GMSKSMAGAIVTWTLVSSLVGAIGAGLLADRFGRVRVLRWTILVFAVSCFLCGISTSP
                     EQLMMFRMLQGLGFGGESSLCMVLVTELIRNPAHRGKYSGFTASSYSFGWGGAAIAYA
                     ITFNLFEPEVAWRVCFFLGILPALVVVYLRRNLQEPEVFLKSRAERGNVSAAADLARV
                     FRGPLLRKTVLCSLLSGGMLGAYYAIATWLPTFLKTERGLSVFGTSSYLAVTILGSLV
                     GYVAGAYATDRWGRRLTYMAFAAGAFVMAMIYMVIPVSNTSMLFLGFPLGVLMQGVFS
                     GIGATISESYPSSIRATGYGVSYNLGRVIGSFFPLAVGWLNSGRTTLALAIAMVAGVG
                     YALVMVSAAMLPETSGIDLGQAGGGDDGEAKQQAAAEPVTVAPTAGRPA"
     gene            527260..528060
                     /locus_tag="Rmet_0497"
     CDS             527260..528060
                     /locus_tag="Rmet_0497"
                     /codon_start=1
                     /transl_table=11
                     /product="Branched-chain amino acid transport protein"
                     /protein_id="ABF07383.1"
                     /translation="MTPRPLSPVWQRLWHRFAEVERDAFLEGARFFARFQPAIFSWGL
                     VTGVAMSKSALTVPEAIGMSLLVYAGSAQLAVLPLFAAGMPIWTVLLTSAVVNLRFVI
                     FSAALQPHFSYLPLWRRTVLGFFNGDLHFVYFMQRYTEPGYAPGKEGYFWGMALFNCV
                     TWQVSSIIGILLASLFPDSWGLALAGMMALIPVMVSTINSRSTLLAVAVSSVLALLCF
                     DLPYRLGLVVAVIGAIAAGMASDEMAARATLRGIRARKSAQPQAGDQT"
     gene            528057..528380
                     /locus_tag="Rmet_0498"
     CDS             528057..528380
                     /locus_tag="Rmet_0498"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     membrane protein"
                     /protein_id="ABF07384.1"
                     /translation="MSHLEIWISIIGMTLVTVVTRALFLMAGEHVTVPDRIQRALRYA
                     PAAALAAIILPEFLSFEGHFSFSPTNDKLMAGIAATACYLLTKRMVGMIVVGMGVYTA
                     LRLLG"
     gene            complement(528432..529565)
                     /locus_tag="Rmet_0499"
     CDS             complement(528432..529565)
                     /locus_tag="Rmet_0499"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LuxR-family"
                     /protein_id="ABF07385.1"
                     /translation="MVTEDMHETIRGLYQGVLEPQAWQRSLSALCDLSQSERASLLVF
                     DPASGSVSVRQTAALAALASQATPHDSPQTLSFNERLNVGGWFIHRRDTGFAATLGAF
                     PQEDIAGVAPASMMTCLIDRQPGHEIYLSLQRPAGADGFLEADARALDWIIPHLREAV
                     AMRDRAQAASTHGRVSANLLNQLPFGVIVFTAAGEPLLANAAGEPWIGRLMPIRADGA
                     ADGTLVPAGQGWRLSKPFHEVMRGLTDAGAPLEAGAIHAVSTDGHEAQIVAMRLTPGT
                     PLSSACLGQPLLVAIHESHGTPRTVPTVLRDLYGLTPAETRLAALLTTGIGLPEASIQ
                     LGIKRETGRSQLKSIFTKTNTSTQAQLAHLLTRLGSVLAEPAR"
     gene            complement(529627..530679)
                     /locus_tag="Rmet_0500"
     CDS             complement(529627..530679)
                     /locus_tag="Rmet_0500"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, LuxR-family"
                     /protein_id="ABF07386.1"
                     /translation="MDQATMHGAIRGLYEGILDPAAWQQSLRALTAIAGTTHASMMVW
                     DTVRDQVTVNEVVNPVEELFLAYENDFQAMDPAKAFAPRLVPGAWYVDARDLGHQAMA
                     RHPFYGEFFHKFELGSYMACLVERQPHYEVYFSMQRSLAQGNFSGDDAQRLDWVVPHM
                     RSAIAIRDRTLALSTMTTLATRLIERLAFAVAVYSPDRRLLLANTAGERWARRLDPLG
                     KTTEWQLSRSFMEMLHGACDPAKPQAAMAARATGPNGSQAEVLVLPLPASHAFASTWQ
                     TPAALVVVHEAGAPSVLLDSVMRNLYGLTPAETRLVARLATGEGLPEASRQMRIRHET
                     ARTQLKAIFLKTGCTS"
     gene            530997..532253
                     /gene="pgk2"
                     /locus_tag="Rmet_0501"
     CDS             530997..532253
                     /gene="pgk2"
                     /locus_tag="Rmet_0501"
                     /EC_number="2.7.2.3"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase (PgK)"
                     /protein_id="ABF07387.1"
                     /translation="MPVFPISTGGACRPRPALIAMTSVLRLTDLISQGKISGKRVFIR
                     ADLNVPQDDAGNITEDTRIRASVPAIQACLEAGATVMVTSHLGRPTEGEFKPEDSLAP
                     IATRLSELLGKPVKLVQNWVDGVEVAPGQIVLLENCRVNKGEKKNSDELAQKMAKLCD
                     VYVNDAFGTAHRAEATTHGIAKFAPIACAGPLLAAEIDALGRALGQPARPLVAIVAGS
                     KVSTKLTILKALADKVDNLIVGGGIANTFMLAAGLKIGKSLAEADLVGDAKTIIDIMA
                     ARGASVPIPVDVVCAKEFSATAAATVKDVKDVTDDDMILDIGPKTAAMLADQLKAAGT
                     IVWNGPVGVFEFDQFGNGTKVLAEAIATSKAFSIAGGGDTLAAIAKYGIADRVGYIST
                     GGGAFLEFLEGKKLPAFEVLEQRAAG"
     gene            532337..533776
                     /gene="pykA1"
                     /locus_tag="Rmet_0502"
     CDS             532337..533776
                     /gene="pykA1"
                     /locus_tag="Rmet_0502"
                     /EC_number="2.7.1.40"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate kinase II"
                     /protein_id="ABF07388.1"
                     /translation="MTRSTKIVATIGPASSTLEVLTRMIGAGVDVVRLNFSHGTAQDH
                     IDRAALVREAAAACGREVAIMADLQGPKIRVGKFENGKITLKPGDAFILDSACQMGNQ
                     ERVGLDYKDLPRDVGPGDLLLLNDGLIVLVVDRVLGNEIFTTVRIGGELSNNKGINRQ
                     GGGLSAPALTAKDMEDIKTAMALGADYVAVSFPKNATDMEMARQLTNVAGQPHNHKAR
                     MIAKIERAEAIRPGVLEEILLASDGIMVARGDLAVEVGNAAVPALQKRMIKLAREANK
                     LTITATQMMESMIVNPVPTRAEVSDVANAVLDGTDAVMTSAETAAGRYPVETVEAMAA
                     ICLEAEKSEVVQLDTDFLNQTFARIDQSIAMGALFTAYHLGVKAIAALTDSGATALWM
                     SRHRIHVPIYAMTPNLASQRKMQLYRNVVPLPLQSSADRDVALEQAEELLLSQGVVQR
                     GDFIVLTIGEPMGQPGGTNTLKIVRVGTR"
     gene            533897..534961
                     /gene="cbbA3"
                     /locus_tag="Rmet_0503"
     CDS             533897..534961
                     /gene="cbbA3"
                     /locus_tag="Rmet_0503"
                     /EC_number="4.1.2.13"
                     /codon_start=1
                     /transl_table=11
                     /product="Fructose-bisphosphate aldolase (Fba)"
                     /protein_id="ABF07389.1"
                     /translation="MPLVSMRQLLDHAAENNYGLPAFNVNNLEQVQAIMQAADEVNAP
                     VIMQASAGARKYAGEHFLRHLIEAAVEAYPHIPVVMHQDHGQSPAICKAAIDLNFSSV
                     MMDGSLKEDGKTPSDYEYNVDVTRKVVQMAHALGVTVEGELGCLGSLETGEAGEEDGI
                     GAEGKLDHSMLLTDPEQAADFVKATQLDALAIAIGTSHGAYKFTRKPTGDILAIGRIK
                     EIHARIPNTHLVMHGSSSVPQELLAEIRQFGGDMKETYGVPVEEIQEAIKYGVRKINI
                     DTDIRLAMTGAIRRFFVENPSKFDPREYLKPAREAAKLVCKARYIAFGCEGQASKIKA
                     VSLTDVAQQYKAGKLAQVVQ"
     gene            535064..535972
                     /gene="purC"
                     /locus_tag="Rmet_0504"
     CDS             535064..535972
                     /gene="purC"
                     /locus_tag="Rmet_0504"
                     /EC_number="6.3.2.6"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoribosylaminoimidazole-succinocarboxamide
                     synthase (SAICAR synthetase)"
                     /protein_id="ABF07390.1"
                     /translation="MSDALYESSIQSLPLLGKGKVRDNYAVGDDKLLIVTTDRLSAFD
                     VILGEPIPAKGRVLNQMANFWFKKLAHIVPNHETDVTAESVVAPNEVEQVKGRAVVVK
                     RLKPILVEAVVRGYLAGSGWKDYQATGKVCGIALPAGLQNAQKLPEPIFTPAAKAEMG
                     EHDENISFDEVEARIGKELAAKMRDISIRLYKEAADYAATRGIIIADTKFEFGLDENG
                     TLTLMDEVLTADSSRFWPADSYQVGTNPPSFDKQFVRDWLEAVRIDGKPWPKTAPAPK
                     LPEDVVQKTADKYKEALTRLTGEALQ"
     gene            535994..536491
                     /gene="purE"
                     /locus_tag="Rmet_0505"
     CDS             535994..536491
                     /gene="purE"
                     /locus_tag="Rmet_0505"
                     /EC_number="4.1.1.21"
                     /codon_start=1
                     /transl_table=11
                     /product="N5-carboxyaminoimidazole ribonucleotide mutase"
                     /protein_id="ABF07391.1"
                     /translation="MSNESKPVVGVVMGSSSDWDVMQHAVAMLKDFNVPFEAQVVSAH
                     RMADDMFRYAEAARGRGIRAIIAGAGGAAHLPGMIAAKTIVPVFGVPVPSKYLRGEDS
                     LLSIVQMPKGVPVATFAIGEAGAANAALHAIATLATTDDALASALEAFRAKQTEAARA
                     MTLPV"
     gene            536521..537765
                     /gene="purK"
                     /locus_tag="Rmet_0506"
     CDS             536521..537765
                     /gene="purK"
                     /locus_tag="Rmet_0506"
                     /EC_number="4.1.1.21"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoribosylaminoimidazole carboxylase ATPase
                     subunit (AIR carboxylase) (AIRC)"
                     /protein_id="ABF07392.1"
                     /translation="MPTDIHPHLSEAHTPESRAEFGVNSPNSPILPGAWLGMLGGGQL
                     GRMFTHAAQSMGYRVCVLDPDQDSPAGSVADRHICAAYTDDAALAELSSLCEAVSTEF
                     ENVPSISLERLEEAGVFVAPRGYCVSIAQNRIGEKKFFASCADRTGVPPAPHWVIQHD
                     ADVDRLPDEVLPGILKTARMGYDGKGQARVKSRDDVRAAWKAMQHVPCVLERMLPLAY
                     EVSVLAARAADGSTATWPLAENVHRDGILFSTTMPSTSVSDDISQRARNAAATIASEM
                     GYVGVLCIEFFVLTDGTLVANEMAPRPHNSGHITMDACETSQFEQQVRAMARLPLGST
                     RQHSAGKMLNLLGDCWFEFGLERTPAWDEVLAQPGAKLHLYGKNDARPSRKMGHVNCV
                     GDHAEAADRTFDAAAKALHIPS"
     gene            537781..538773
                     /locus_tag="Rmet_0507"
     CDS             537781..538773
                     /locus_tag="Rmet_0507"
                     /codon_start=1
                     /transl_table=11
                     /product="putative translation factor (SUA5)"
                     /protein_id="ABF07393.1"
                     /translation="MSSRMPTAAELDEAVRLLEAGELVAFPTETVYGLGADAENPEAV
                     ARIFAAKGRPSNHPVIVHVVDGADVGYWSDDVPEAAQKLIDAFWPGPLTIILKRAAHI
                     PAAVAGGQDSIGLRCPSHPVAQALLSRFRRGRGGIAAPSANKFGQVSPTTAEHVRDEF
                     GGSVYVLEGDGVDVGIESSIVDLSRLDTAGPVLLRPGAITAAMMADVLGTMPLPPDAA
                     APRASGTLKAHYAPRTTLTLAQADALPQYLHGLSADGRLAWVGRAPATSDPRCTFVEA
                     PATPDAYAQELYRLLRRLDKEGFQRLVFEPLPESLEWDGVRDRLGRAAAAFEDC"
     gene            complement(538842..540398)
                     /gene="dacB"
                     /locus_tag="Rmet_0508"
     CDS             complement(538842..540398)
                     /gene="dacB"
                     /locus_tag="Rmet_0508"
                     /EC_number="3.4.16.4"
                     /codon_start=1
                     /transl_table=11
                     /product="D-Alanyl-D-alanine carboxypeptidase, S13 family"
                     /protein_id="ABF07394.1"
                     /translation="MSAMPIRPSLLRRSLSPVIATAALLAFGLTGAQAKPVKSVKATK
                     PSVQRVSAEAADPAAARTGLPATVTTALRRAHVPLSAASFYVIKVGAPRPRVSWNAEA
                     PMNPASTMKLVTTFAGLQLLGPDYRWLTSLYADGQPGPDGVINGNVYLRGRGDPKLVP
                     EEMAKLVNTARSTGATAINGDLVLDRSFFADTQDNSYTIDGETQRAYNVNPDALLYAF
                     KTLTFTITPDAAGRAVDVAVTPALAQLRVDNRLTLVNGRCGDWRARANPSITPQSDGT
                     IVAAFDGNYSADCGEHVVNLATLSHSDFIWGGFVAEWQAAGGRFVRPPGLRGGTVPRG
                     AFLLARHYGQPLGEIVRDINKFSNNVMARQLFLTIGAEIDRSGPASTEKSTRVIKRWL
                     SRQGLDMPDLVLENGSGLSREERISAYDMARLLQQALASNVGPVLMDSLPILGVDGTL
                     RNRLTRANAAGNAYLKTGTLQDVRALAGYVDALDGQRYVVVAYINHPNASGAQEAHDA
                     LMQWVYKGTP"
     gene            complement(540400..540591)
                     /locus_tag="Rmet_6421"
     CDS             complement(540400..540591)
                     /locus_tag="Rmet_6421"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADC45039.1"
                     /translation="MTRSSRSLASRRRRIASLPIARRPTRNRGNPTVRRAVDLSNKMR
                     PETVENGRIHVIHRAWAMR"
     gene            complement(540515..540976)
                     /locus_tag="Rmet_0509"
     CDS             complement(540515..540976)
                     /locus_tag="Rmet_0509"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     membrane protein"
                     /protein_id="ABF07395.1"
                     /translation="MRTTADRIRHTVGFELIGLLIFAPLASLVFGYALHQMGLVGAVA
                     SLIAAVWNYVYNILFDRGMLRFTGQLRKTPAIRVLHAILFEGGLLLVFLPSVAWYLDM
                     TLLDAFIMDIAVAGFYMVYALVYNWVYDAVFPIPGLKAKEDSQPADCPSAN"
     gene            541123..542058
                     /locus_tag="Rmet_0510"
     CDS             541123..542058
                     /locus_tag="Rmet_0510"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR-family"
                     /protein_id="ABF07396.1"
                     /translation="MREGRKPTRTHTMSLSLEQLQAFAAAAETGSFSAAARQLGKAQS
                     VVSAAVANLEIDLGNALFDRTARYPVLTPAGERLLVEARVILERCEHFRGVAKSLGEG
                     VESRLTLAVDELYPEETLGVLLDEFSQRFPSVELELLFPLMEDVSRLVLSQCADLGIM
                     WRQEILPPELGFHALGWVPMPIICAPDHPLAAQPRVDFEELKRYRQLMVATRSDSEEK
                     KRLRVAAEVWWVESQWVIVELVKRKLGWAFVPWHVAANSPAAAGLVSPQLTFQDQDWP
                     VAMEIVWHKQRPLGKAATWLRERVSQQPLPMPGGR"
     gene            complement(542098..543591)
                     /locus_tag="Rmet_0511"
     CDS             complement(542098..543591)
                     /locus_tag="Rmet_0511"
                     /codon_start=1
                     /transl_table=11
                     /product="Cation/multidrug efflux system outer membrane
                     porin"
                     /protein_id="ABF07397.1"
                     /translation="MKAIAMSRSQFSFTVVALACALLTGCAVGPDYQRPDAPVPKAFK
                     EASEDMPAWTGDWKTAEPQDIMARPDWWRVFDDPVLDALMSQVKISNQNIKAAEAQYR
                     QATASLSAARAGYFPTVGANAGVSRGATSSNGQIINGQNLTLSANWEIDVWGRVRRQV
                     ESAQAGAQASEADLASILLSTQATLAQSYFLLRVADAQHALLDRTVADYAKSLQLVQN
                     QYKAGTAQRSDVLQSETQLKSAQAQQLDIQITRQQLEHAIAVLVGKPPADLTVATVDN
                     RDAIPRVPVAVPSQLLERRPDISAAERRMASANANIGVAEAAYYPTLSLSATGGLTAS
                     TLARWLSLPDRVWSIGAGLAGTVFDGGLRRANTAIAVAQYDQTVANYRQTVLGAFQEV
                     EDNLASARVLEQESIVQNDALRSAREALSLVNNRYKAGTAALLDVLTAQTAAYTAENT
                     TLTIMGRQYTAAITLIKALGGGWHGQAMEVGKVDSTAPATAPASTAQ"
     gene            complement(543591..546893)
                     /gene="mdtC"
                     /locus_tag="Rmet_0512"
     CDS             complement(543591..546893)
                     /gene="mdtC"
                     /locus_tag="Rmet_0512"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux system, subunit C"
                     /protein_id="ABF07398.1"
                     /translation="MNLSATFIHRPVATALLTIGILLAGIAAFRLLPVSPLPQVDFPT
                     ISVSASLPGASPETMAATVATPLERALGTIAGVTEITSNSSLGSTRVTLQFDLSRNID
                     GAARDVQAAINASRATLPTSLPNNPTYRKVNPADAPIMIIGLTSQTMSRGQLYDAAST
                     ILAQKLSQVEGVGQVTIGGSSLPAVRVELNPTSLNKYGISLEDVRNTISATNANRPLG
                     VLENSNNAWQVYANDQAMAAKDYMPLIIRYATPGTYSSASAGALIASTANAAAGGNVS
                     TKTVNGVTTTTITTSSGTTTITTGATGGSNGAKGPNGFAVPIRLQDVANVVDSVQDIR
                     NAGSANGKPSVLLVLNRSPGANIIETVDRVNDILPQLGKMIPAAISMDVMMDRTPTIR
                     ASLREVEQTLIISVALVVMVVFLFLRNVRATLIPSVAVPVSLVGTFSVMYLAGFSLNN
                     LSLMALTIATGFVVDDAIVVLENISRHIEEGMKPLAAALRGAREVGFTVLSMSLSLIA
                     VFIPLLLMGGIVGRLFQEFAITLSVAILVSLVVSLTTTPMMCARLLRPVHEESQGRFH
                     RATEHVFTWMQQAYARTLGAALRHSTLVWIVLLATVALNVWLYVIVPKGFFPQQDTGR
                     LIGFIRADQATSFQAMRTKLDNFIQIVQTDPAVVNVVGFTGGSQRNTGQMFVTLKPLS
                     ERKESADAIIARLRGKLAKEPGASLFLQSVQDIRVGGRQSSSQYQFTLQSDDLNVLRD
                     WEPKVRAAISNIKGIEDVDTDTNDKGLQTSVIIDRDTASKLGVSAQQIDAILNDAFGQ
                     RLVSTIYHPLNQYRVVMELSSEYLQGPHALQDVYVVTGGGKRVPLAAFTRVMPTSTPL
                     GVNHQGQFAASTISFNLAEGYSLSQATDAIKDALARIGAPETLQANFAGGAKAFQDSL
                     KSQPILILAAIITIYIVLGILYESYVHPLTILSTLPSAGVGALLALLLFKTEFSIIAL
                     IGVILLIGIVKKNAIMMIDFAIDAERRDGLSPRDAIYRACLLRFRPIMMTTMAAMLGA
                     IPLALGHGDGAELRAPLGISIVGGLLVSQLLTLYTTPVVYLTLDRWRLKVKAWRERRR
                     TQASGTTPHLEH"
     gene            complement(546893..550048)
                     /gene="mdtB"
                     /locus_tag="Rmet_0513"
     CDS             complement(546893..550048)
                     /gene="mdtB"
                     /locus_tag="Rmet_0513"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux system, subunit B"
                     /protein_id="ABF07399.1"
                     /translation="MNPSRIFIERPVATALLMVAILLSGLVAFRLLPLSALPEVDYPT
                     IQVTTLYPGASPDVMTSSVTAPLERQFGQMPGLKQMSSSSSGGASVITLQFELTLSLD
                     VAEQEVQAAINAGSNLLPADLPMPPIYSKVNPADAPIMTLAMTSDTLPLPKLQDMVDT
                     RVAAKISQIQGVGLVTISGGQRPAVRIQANPTALANLGMSIDDLRTAIGNANVNGAKG
                     SFDGPARASTIDANDQLKSADEYKQIIIGYQNGAPIRITDVADIVDAAENSRLAAWAN
                     AKPAIVLNIQRQPGANVIEVVDRIKTLMPQLRASLPASVQVQQLTDRTTTIRASVKDV
                     EFELLLAVALVVMVIFIFLRNLSATIIPGVAVPLSLVGTFGVMYMAGFSINNLTLMAL
                     TIATGFVVDDAIVMIENIMRYIEEGDPPMEAALKGSKQIGFTIISLTFSLVAVLIPLL
                     FMGDVVGRLFREFAITLAVSILISAVVSLTLTPMMCARLLRHVPESEMSRFHVVTGRF
                     FDSVIEQYGRALNWVLERQTATLLVAVGTLVLTGLLYVVVPKGFFPVQDTGMIQAITE
                     AAQTSSFQSMGRKQEAVQKVILEDPAVDSVSSFIGVDGTNTTINAGRMIINLKPKDER
                     DSMAVVTDRLQASVQKLGGVALYMQPVQDLTIEDRVARTQYQFTVEDPDPAVLAEWVP
                     KLIERLKQEPELRDVASDQQNNGLRAYVEIDRDAAARFGITTAVIDSALYSAFGQRLV
                     STIFTQSSQYRVVLETMPQFRVSPESLSALRLPSSSGGQVPLGSIAHISERTGPLVIN
                     HQGQFPSATISFNLAPGESLGAAVDKITKVESEIGLPISMATEFQGAALAFRASLSNT
                     LWLILAAVVTMYIVLGVLYESTIHPVTILSTLPSAAVGALLALLVSGQDIGIIAIIGI
                     ILLIGIVKKNAIMMIDFALEAEREGGMKPRDAIFQACLLRFRPILMTTMAALLAALPM
                     MLGTGIGSELRRPLGITMVGGLLVSQVLTLFTTPVIYLAFDRVAIRLKAWRRNRFGDP
                     DEGGTGEDGGQQPHRPQEPNV"
     gene            complement(550070..551641)
                     /gene="mdtA"
                     /locus_tag="Rmet_0514"
     CDS             complement(550070..551641)
                     /gene="mdtA"
                     /locus_tag="Rmet_0514"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux system, subunit A"
                     /protein_id="ABF07400.1"
                     /translation="MLQAIPLTARHPARAMRHTAATSTSQCLCEYRWHAPLFRRAAPR
                     IPVMSNPEQGQPTPPNPPTPGGNTRSRRRTWIAGAVIVVLAGAGWYWHGHRKAAQQAG
                     ATSAGAASGAAGMGAGKRGPGGASGAGGPGGPGAQQRSPVVVNRVTRRNMDVVLNGLG
                     NVTPVANVTVRAQVSGPLLKVLFKEGQMVKAGDVLAEIDPRPFQATLDQAVGQLARDQ
                     ALLQNARLDQKRYKTLLAQDSISSQQVDTQDALVRQYEGTVKTDQGNVDNARIQLGYT
                     RIVAPTSGRIGLRQVDPGNIVNPSDTNGIALITQIQPIAVLYTIPEDNLPSVLKKLNA
                     GEKLAVQAWDRQMRNQLGEGTLLTTDNQIDTTTGTVKLKAIFANTDGMLFPNQFVNVR
                     TRIDTLEDATVIPIAAIQRGQQGTFVYVVDDQSTVKVQVVTLGPGDGSHSAVLKGLEP
                     GQRVVVDGADRLKEGMTVEAVDPAARAAALTPASSPRARGRRGGGASGVHGASGARAA
                     SGAHGSGASPQQAQP"
     gene            551784..552518
                     /gene="ompR"
                     /locus_tag="Rmet_0515"
     CDS             551784..552518
                     /gene="ompR"
                     /locus_tag="Rmet_0515"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator in two-component
                     regulatory system with EnvZ"
                     /protein_id="ABF07401.1"
                     /translation="MRTNQPTQILVVDDDPELRDLLREYLTSQGFAVSVLHDGDGLQA
                     RLERERPALIVLDLMMPKVDGLTALRNLRAKNDDIPVILLTARSDEIDRIVGLEIGAD
                     DYLGKPFSPRELLARINAVLRRKLARPAAAPEDRESVVFGPFRVNFRQRSLERSGQSV
                     SISDTEFALLKLLLSHPLEVLSRERIVELMYGTANGISDRGIDVQIWRLRRLLDEDAQ
                     RPRYIQTVRGRGYTFVPDEAEDSIPQ"
     gene            552515..553798
                     /gene="envZ"
                     /locus_tag="Rmet_0516"
     CDS             552515..553798
                     /gene="envZ"
                     /locus_tag="Rmet_0516"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase in two-component
                     regulatory system up with Au"
                     /protein_id="ABF07402.1"
                     /translation="MKLRIDTLFGRIALLIAAVLVISHFSWLAILRMDRRQQQIDYSV
                     EQMIFQLDSIQRALDATPPLPLPSLVEVADASTADEHASVPQAGRARRLVEQFTRRLP
                     PGTEVRLEDELSTPRLWIKLPKRNRWIAMPILFVHNPPPDNRLLPGVVLVVGIAIIFA
                     LLIAWQIQRPVRDMAEAAEKLSRQQLVSPLRERGPHELRQLIERFNRMVADLVRIDQE
                     RNTMLAGIAHDLKTPLARLRLRAEMLSDPKAAAGVTRDVESMSAIVEQFLTFAQSSEP
                     TARPVPVDKRIGELAASLQEQDRKVVLELNAGDGFRMIATQLDRIIGNLVDNAYAYGE
                     PPVCVATSRTQEGWKLIVEDEGPGIPDDAIERVTMPFVRLDPARGGNAHSGLGLAIVD
                     RLVRQAGGRLSIANREEGGLRVEMVFPFAAMAQAA"
     gene            complement(553873..554481)
                     /locus_tag="Rmet_0517"
     CDS             complement(553873..554481)
                     /locus_tag="Rmet_0517"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane protein"
                     /protein_id="ABF07403.1"
                     /translation="MINLLFAVIAYLIGSVSFAVVVSKVMGLPDPHSYGSGNPGATNV
                     LRTGNKKAAIFTLIGDALKGLAAVLLAKHFGPAYGVDETGIALVALAVFLGHLFPLYH
                     RFAGGKGVATAAGILFAIDPILGAGTLATWLIIAFFFRYSSLAALISAIFAPFFYVLM
                     NGVDIMAGAILVISVLLIARHRANIAKLLAGKESRIGEKKKV"
     gene            complement(554580..555071)
                     /locus_tag="Rmet_0518"
     CDS             complement(554580..555071)
                     /locus_tag="Rmet_0518"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07404.1"
                     /translation="MSKSKHVSETPATQMLRKHGVTFGEHTYDYVDHGGTGESSRQLG
                     VPEHDVVKTLVMEDEAAKPLIVLMHGDCSVSTKNLARQIGAKSVQPCKPDVAQRHSGY
                     MVGGTSPFGTKKKMPVYVEASILTLDKIYINGGRRGYLVSVAPAVLEALVDAKPVECA
                     LPD"
     gene            complement(555094..556002)
                     /gene="xerD"
                     /locus_tag="Rmet_0519"
     CDS             complement(555094..556002)
                     /gene="xerD"
                     /locus_tag="Rmet_0519"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-based site-specific recombinase"
                     /protein_id="ABF07405.1"
                     /translation="MTAALDGDLSLVDRFCDALWLEDGLARNTIDAYRRDLAMLARWL
                     HESGTTALLGVDDTALSGYFAARHLETRASSANRRLTVFRRFYQWALREHMIEADPCL
                     LLRPAKQPPRFPKTLSEAQVVALLEAPDIETPLGLRDRTMLELMYASGLRVSELTNMK
                     TIEVGLNEGVARVVGGKGNKERLVPFGAQAGDWLHRYLSDARPTLLAGRACDELFVTQ
                     RGEGMTRQTFWHLIKKHARDAGIHAPLSPHTLRHAFATHLLNHGADLRVVQLLLGHAD
                     ISTTQIYTHVARERLRELHLHHHPRG"
     gene            complement(555999..556478)
                     /gene="ogt1"
                     /locus_tag="Rmet_0520"
     CDS             complement(555999..556478)
                     /gene="ogt1"
                     /locus_tag="Rmet_0520"
                     /EC_number="2.1.1.63"
                     /codon_start=1
                     /transl_table=11
                     /product="Methylated-DNA (protein)-cysteine
                     S-methyltransferase"
                     /protein_id="ABF07406.1"
                     /translation="MQHHFDAVLPAPFGKVGVRVDGTQVHEIVYLPDSFAEVPPTSAL
                     TKRVAEQLDAYYANADTVFDLPLARRGTDFQRKVWAAISAVPRGGLTTYGTIAKSLQS
                     MPRAVGQACGQNWFPIVVPCHRVVAANGLGGFAHHGEEGFHLGVKRWLLRHEGAMLL"
     gene            complement(556664..557644)
                     /gene="bug"
                     /locus_tag="Rmet_0521"
     CDS             complement(556664..557644)
                     /gene="bug"
                     /locus_tag="Rmet_0521"
                     /codon_start=1
                     /transl_table=11
                     /product="Extra-cytoplasmic Solute Receptor protein"
                     /protein_id="ABF07407.1"
                     /translation="MQARKTALIAAVAAAASVASVAHAQSNYPTKPIRLIIPFAPGGT
                     TDIVGRGVADQMSRILGQTVVVENRAGGGGSIGADSIAKAAPDGYTIGISTVSTMAVN
                     PACNPKLSYDPIKDFKPIANVANVANVIAVNPNFPAKDYKEFLAVLKANPGKYSYASS
                     GTCGFGHMLGEQFKVSTKTFMVHIPYRGAGPALNDVLAGQVPIMVDNLPSSMPYIKAG
                     KLRPIVVAWNKRVEGLPDVPTFGEMGLKEPNDPAWYGLVAPAGTPDDVINKLNAAVVK
                     ALQDKAFVQRLQAAGAEPSGNTPAQHAAEIKKEFDKMKNLVKVQNIKLEQ"
     gene            complement(557748..558365)
                     /locus_tag="Rmet_0522"
     CDS             complement(557748..558365)
                     /locus_tag="Rmet_0522"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABF07408.1"
                     /translation="MKSLKSPSRTTALSRRFAATLCATLALWTLMPPASAMVIEGVRF
                     DDATRLGGKELALNGAGLRSVFVIKGYVAGLYLPERARNATVALATRGPKRLQLRVLR
                     EVEAESFIKALNEGLRENHSELQMRMLADRLAQLQQTMTEMGAAHRGDIINFDFTPEG
                     GTVVALNGIPRGQAIAGEDFYQAVLRIFLGDHPVDRNLKRGLLGG"
     gene            558367..559419
                     /locus_tag="Rmet_0523"
     CDS             558367..559419
                     /locus_tag="Rmet_0523"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative membrane protein, predicted permease"
                     /protein_id="ABF07409.1"
                     /translation="MRRAAGKPRARRNTACHAAGILKKYPSVSALGCTFHDARQTSRC
                     DENDKTNETMSSALLLVPDFSLILIGWLLVRYTPFDRGFWAGVERLVYFVLFPALLLQ
                     STNSAKFDFSSTSAMLGLALLTMVFGMATGYLVKWVLRPAPADFASGLQTAFRFNSYI
                     GLALAARLGNGEGLALMALVVGVTVPLCNVVAVWALAKHGEARVLRELVRNPLILATA
                     TGLVTNLLGLHPPEVVAMTLNRLGSASTALGLMTVGAGLQMSGATGTAGPMAWWSGVK
                     LLAMPCFAWLVGKYLPLTPLQYQIVVVYASLPTASSSYILAVRMGGNGPMVAATISAM
                     TVVAIVTTPVWLSLVS"
     gene            complement(559432..560565)
                     /locus_tag="Rmet_0524"
     CDS             complement(559432..560565)
                     /locus_tag="Rmet_0524"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Fe-S electron transport protein"
                     /protein_id="ABF07410.1"
                     /translation="MPSTSSPQAARDSLASLVAQIRAWGGELGFDAIRIADVDLRHAE
                     AGLLAWLQAGYHGDMDYMANHGTKRARPAELVPGTVRAIVARMPYLPMQRDDGWRRHE
                     LARLDDPSTAVISLYARGRDYHKVLRNRLQQLAARIETAIGAFGYRVFTDSAPVMEVA
                     LASQGGLGWRGKHTLLLDRDGGSMFFLGEILVDIPLPADSAEAPHCGNCRRCIDICPT
                     QAIVEPYLVDARRCISYLTIEHKGAIPEDLRAPMGNRVYGCDDCQLTCPWNKFAHRAT
                     LPDFDVRNGFDAPDMATLFDWSEAEFNQRLEGSPIRRIGHERWLRNLAVGLGNSLRAA
                     AVNDPALAERIRASLRARLDAATPLVREHIEWALAQDRAPERG"
     gene            560633..561166
                     /locus_tag="Rmet_0525"
     CDS             560633..561166
                     /locus_tag="Rmet_0525"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATPase or kinase"
                     /protein_id="ABF07411.1"
                     /translation="MPLLEERILPLPDEAATERFGAALATAARAMPPRTIHLQLSGDL
                     GAGKTTLTRAVLRALGHVGKVRSPTYTLCEPYEVLRADGSPLTVYHFDLYRFADPEEW
                     IDAGFRDCFAEPALNLVEWPEKAGRLLGEPDLHVLLQSDNRVSHWADNGADAGADRRM
                     ATLRAYTPTGLTLLNAC"
     gene            561160..562653
                     /gene="amiC"
                     /locus_tag="Rmet_0526"
     CDS             561160..562653
                     /gene="amiC"
                     /locus_tag="Rmet_0526"
                     /EC_number="3.5.1.28"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="ABF07412.1"
                     /translation="MLIKRLATDRPDGPDGLLKARRKWMAQALKVSAGTVVLTIAGPQ
                     IAFGAGIVAVRVWPAEDYTRVTIESDERLVAVHQMIRNPDRLVVDIDGLDLSPTLREL
                     VAKITPNDPYIQSVRVGQNRPRVVRMVFDLKEDVSPQVFTLAPISDYRNRLVFDLYPV
                     NPPDPLWKLVRDTEDKQRRFAAAPPPAGTDGVSGAPAGAEEDAIGAIVRKFEDRDQLP
                     SPTTAPPPALAGVKPRPPLPSPAPVAPPPTARTNLPPPSEFKMRRLLTVAIDPGHGGE
                     DPGAIGAAGSREKDVVLQIATRLRAKIDAQPNMRAMMTRDSDFFVPLNVRVQKARRVQ
                     ADLFVSIHADAFLSPEARGASVFALSERGASSSAARWLANKENNADLIGGANMGNKDA
                     QVARVLLDLSTTAQINDSMQVGRSVLQEIGGINKLHKGSVEQAGFAVLKAPDIPSILI
                     ETAFISNPEEERKLNDDSHQEQLANAILRGIKAYFARNPPLSKNPSV"
     gene            complement(562773..563864)
                     /locus_tag="Rmet_0527"
     CDS             complement(562773..563864)
                     /locus_tag="Rmet_0527"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sodium-dependent transporter"
                     /protein_id="ABF07413.1"
                     /translation="MNLHSRQDEGPIPSGNPYALSLSMSAILAPFKKIYDLIDGFVLI
                     MLTAIGIALIAPEIGTGDGPLRLGVVTNLGVALVFFLHGAALSRDKLVAGAKHWRLHV
                     FVQSFTYIVFPIVGVLLMLSLRNTLPPELLLGVFYLCALPSTVSSSVAMTSMARGNVP
                     GAIFNATISGLIGMALTPLLMGLVISASGASMPLGRALMGVALQLLLPFALGQAARPL
                     IGNWLAKKKQITNKIDRGVIVLIVYSSFCDATAAGLWHQYHWQTIGAVMGIAAVLLFV
                     ILGTTTFTARRLGFSVEDEITAVFCGSKKSLANGIPMAKILFAGHPALGLLVLPLMVY
                     HQLQLIVCSVIAARYANRDDVETREAVRA"
     gene            563893..564798
                     /locus_tag="Rmet_0528"
     CDS             563893..564798
                     /locus_tag="Rmet_0528"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding transcriptional regulator
                     (LysR-family)"
                     /protein_id="ABF07414.1"
                     /translation="MNYTLRQLRVFLAVAGHGSFSRAADAVGLTQPAVSRGVAELEEA
                     LGVRLLDRTTREVVLTEAGTALVPALERLLGQLDDTLEETRQSGERYRGRVVIASAPT
                     ISARLMPMYVAACASQYPDIRLFVRDNVQADGLEQIRAGAVDFGVLIDPMAREGLTIA
                     PLATDPFCFVCRRDHPLAEADSVPWTALHGERLVLLDFASGSRPLIDRIFARHGAVPQ
                     VVQELGHSASVFGMVEAGIGASVLPSFSLPLPEASPLVSKPLTPREERSIVMVRREDR
                     SLSPAAAAVWNMVQTMPIPAETATG"
     gene            complement(564835..565605)
                     /locus_tag="Rmet_0529"
     CDS             complement(564835..565605)
                     /locus_tag="Rmet_0529"
                     /codon_start=1
                     /