LOCUS       CP000283             4892717 bp    DNA     circular BCT 28-JAN-2014
DEFINITION  Rhodopseudomonas palustris BisB5, complete genome.
ACCESSION   CP000283 AAKZ01000000 AAKZ01000001-AAKZ01000023
VERSION     CP000283.1
DBLINK      BioProject: PRJNA15749
            BioSample: SAMN02598336
KEYWORDS    .
SOURCE      Rhodopseudomonas palustris BisB5
  ORGANISM  Rhodopseudomonas palustris BisB5
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Bradyrhizobiaceae; Rhodopseudomonas.
REFERENCE   1  (bases 1 to 4892717)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S.,
            Chain,P., Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F.,
            Land,M., Hauser,L., Pelletier,D.A., Kyrpides,N., Lykidis,A.,
            Oda,Y., Harwood,C.S. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Rhodopseudomonas palustris BisB5
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4892717)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S.,
            Chain,P., Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F.,
            Land,M., Hauser,L., Pelletier,D.A., Kyrpides,N., Lykidis,A.,
            Oda,Y., Harwood,C.S. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (14-MAR-2006) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     URL -- http://www.jgi.doe.gov
            JGI Project ID: 4000372
            Source DNA and bacteria available from Caroline S. Harwood
            (csh5@u.washington.edu)
            Contacts: Caroline S. Harwood (csh5@u.washington.edu)
                      Paul Richardson (microbes@cuba.jgi-psf.org)
            Quality assurance done by JGI-Stanford
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LLNL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
FEATURES             Location/Qualifiers
     source          1..4892717
                     /organism="Rhodopseudomonas palustris BisB5"
                     /mol_type="genomic DNA"
                     /strain="BisB5"
                     /db_xref="taxon:316057"
     gene            649..2067
                     /locus_tag="RPD_0001"
     CDS             649..2067
                     /locus_tag="RPD_0001"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="ABE37241.1"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013159"
                     /db_xref="InterPro:IPR013317"
                     /translation="MSNMEHDRWSRVKGRLRSSVGEDVYSSWFARMDLEAVQQESVHL
                     SVPTRFLKSWIQTHYSEKVLTCWQAEMPEVCRIDLTVRSPMRAAVTKEAPAPAEHRRD
                     EHRPAADARSHAAAPAPSNHDALGGSPLDPRLTFASFVVGRSNTLAHAAAKQVAEGRR
                     GDPVMFNPLYIHSGVGLGKTHLLQAVTWAGNSGTERKVLYLTAEKFMYGFVASLKTQT
                     SLAFKEALRGIDVLVIDDLQFLQGKTTQAEFCHTLNALIDAGRQVVVAADRPPADLES
                     LDERVRSRLAGGLVVEMAPLGEELRLGILKSRVVAARTHHASFDVPQSVLEYLARAIT
                     HNGRDLEGAINRLLAHSKLNAQPVTLEMAEHEVRDLIRPQEPKRIKIEDIQRVVARQY
                     NVSRSDLLSSRRTANVVRPRQVAMYLAKTLTLRSLPEIGRRFGGRDHTTVLHAVRKIE
                     GLVSKDVTLSDEVESLKRQLQE"
     gene            2329..3447
                     /locus_tag="RPD_0002"
     CDS             2329..3447
                     /locus_tag="RPD_0002"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, beta subunit"
                     /protein_id="ABE37242.1"
                     /db_xref="InterPro:IPR001001"
                     /translation="MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENAQLAL
                     KATDLDLEVIETLPAETATAGSTTVPAHMFYDIVRKLPDGSQIVLESDGDRSVLAIRA
                     GRSRFTLQTLPESDFPDLAAGEMSHSFSLAASDVKRLIDRTQFAISTEETRYYLNGIY
                     LHTAGSAKAATLRAVATDGHRLAQVDLAQPAGASGMPGVIVPRKTVGEVQRLIEDNDA
                     EIAIELSAGKIRFTIGNVVLTSKLIDGTFPDYGRVIPQNNDKELVVDKKEFEAAVDRV
                     STISSERGRAVKLALSAGKLVLSVTNPDSGSATEELEVEYASDALDIGFNSRYLLDIA
                     AQIEGEVAVLKLADPGSPTLIQDRDTKNALYVLMPMRV"
     gene            3622..4758
                     /locus_tag="RPD_0003"
     CDS             3622..4758
                     /locus_tag="RPD_0003"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecF"
                     /protein_id="ABE37243.1"
                     /db_xref="InterPro:IPR001238"
                     /db_xref="InterPro:IPR003395"
                     /translation="MTASRITRLTLTHFRNYRAAALHTRGERVVLVGANGAGKTNCLE
                     AISFLSPGRGLRRATLDDVSDHQGDGSWAVSAEVEGALGLATLGTGIDPPRADAATTR
                     RCRIDREPVGSATAFGDHLRMVWLTPAMDGLFMGAASERRRFFDRLVLAIDSQHSSRV
                     SALDRSLRSRNRLLEERNADRHWLDAIERETAELAVAVAAMRGQTAARLAAMLDARGA
                     ASAFPSAKIMLDGWMESALLTEPATAVEDRYRAILRDGRLRDAAAGRTLDGPHLTDLQ
                     VIYAPKAMPARDASTGEQKALLIGLVLAHAQLVSEITGITPLLLLDEVVAHLDPARRR
                     ALFAELERLGAQVWMTGADPAGFAEIGPDAEIFTVESGRIAPQK"
     gene            4985..7426
                     /locus_tag="RPD_0004"
     CDS             4985..7426
                     /locus_tag="RPD_0004"
                     /EC_number="5.99.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="ABE37244.1"
                     /db_xref="InterPro:IPR000565"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR011557"
                     /db_xref="InterPro:IPR011558"
                     /translation="MTEPARQPIAETPPSVPAEYGAESIRVLKGLDAVRKRPGMYIGD
                     TDDGSGLHHMVYEVVDNAIDEALAGHATAVEVVLNADGSVTVRDDGRGIPVDIHKGEG
                     ISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSSKLILRVWRNGKEHIIEF
                     AHGDAVAPLSMVGDANGRRGTEVTFFASPETFTHIEYDFATLEHRLRELAFLNSGVNI
                     VLSDMRHAVEKREEMRYEGGVTEFVKYLDRNKKPIVPAPIVLAADLNGIGVEVALWWN
                     ETYHENVLCFTNNIPQRDGGTHLAGFRAALTRQVNGYADSNAKKEKIALTGDDCREGL
                     TAVLSVKVPDPKFSSQTKDKLVSSEVRPVVENVLNEALAAWFEEHPSEAKVIVGKVIE
                     AAAAREAARKARELTRRKGALDIASLPGKLADCQERDPSKSELFIVEGDSAGGSAKQG
                     RNREFQAVLPLRGKILNVERARFDKMLGSEQIGTLITALGTGIGRDDFDLSKLRYHKI
                     ILMTDADVDGAHIRTLLLTFFFRQMPALIEGGFLYIAQPPLYKVTRGKSEQYLKDERA
                     LEDYLISTGLDDCIFRPASGEERSGRDLLALVENARIVRGTLHNLHSRYNRSVVEQAA
                     IAGVLNPRITSDIPTANEAAAYIARRLDALADEVERGWVGRFTEGEGFSFERTVRGVK
                     DVAIIDDALLGSADARKLDEYAAILQEAYPRPGVLRRKDTETAIHGPVSLFEAVTDAG
                     RKGVSLQRYKGLGEMNPSQLWETTLDTNARSLLQVKVREVDEADDLFTKLMGDVVEPR
                     REFIQENSLSATVDV"
     gene            complement(7691..8461)
                     /locus_tag="RPD_0005"
     CDS             complement(7691..8461)
                     /locus_tag="RPD_0005"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37245.1"
                     /translation="MDSPGKQIHGGAMESDRLWAAASRLADYVKSPSLRHIRDPQNIQ
                     KLAREILQAVDQAGSVWSKWTAAREDIVKAAANCWVPPEDLRAFLNSLPGPALTATDV
                     AQRLRAIWEEPWTSYPKEELQAGCRALYDAEKAAGTEMRAIIGALEEFLEVEEERLRQ
                     EQNEAYQQFREQDRIRRQQRFLSGADCGWTPIDGSKELFCRRNGRAFRVGQAKDKRWK
                     LYRIAAVDDAGELLGTYAGRREASKALEQIAYQAEILR"
     gene            complement(8475..8738)
                     /locus_tag="RPD_0006"
     CDS             complement(8475..8738)
                     /locus_tag="RPD_0006"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37246.1"
                     /translation="MRYVAILAIVAVVPGPSAAQEPKPLKTLRIQQAAPGATELFVVD
                     DDGTVRIDWEKVETLARLKTDRIALPTAQVMLAIRDRTWKPMK"
     gene            complement(8751..9092)
                     /locus_tag="RPD_0007"
     CDS             complement(8751..9092)
                     /locus_tag="RPD_0007"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37247.1"
                     /translation="MIRTVAALIVLLLNAEVRSETVDVKYRGPVDLRTFECRDITRSS
                     FIQRVCYDQAQAYMIISLKGTYYHYCELSRATFDSLMGAPSMGQFFNQTIKGTGSDGP
                     FDCRTHRTPSY"
     gene            complement(9267..10505)
                     /locus_tag="RPD_0008"
     CDS             complement(9267..10505)
                     /locus_tag="RPD_0008"
                     /codon_start=1
                     /transl_table=11
                     /product="Divergent AAA region"
                     /protein_id="ABE37248.1"
                     /db_xref="InterPro:IPR007421"
                     /translation="MFVREIGAWRLVGGETDRIECKAGFRLQPEDRFSKALRAIAGLA
                     NNKGGYILFGVTDGTYQADGLSDDVFTKSDISLLNRILASALDPVPHVTKGLIELGGK
                     QVGVLYVEKHDHGPVIAVKNVSQDVKEGGIYFRYVGETRLIKPGELRQIIAAREQRAV
                     AEFSARMNRVAVGKEATIDLDSGEVAGTSGKFLIDKSLLSSIQFVREGEFDEKKGAPA
                     LRLIGDVEPVSAVERERTRVIRENVTPDAVVRNFLRNEKVAEPTQYIHFQAHSQRKWF
                     PVWFYIDQTRSTASEVAEDLRKQVATYPSSRDALVDRLAGKDAAFRQSTGKAEALRAK
                     LARGDIKAPTDIDADVVFAGAVQALPTTMKPKDLESIRTALLDCLDRAQDTDPRSSNR
                     RGAIYRAACRLDELLYSKKR"
     gene            10961..11476
                     /locus_tag="RPD_0009"
     CDS             10961..11476
                     /locus_tag="RPD_0009"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37249.1"
                     /translation="MLSGSYIWRHLPSAAQRALMATMAPKHHPTPLSGGDRKALQKEL
                     GKSRAMTGILARQAEEARSEGEALIRKADNLACQSWNERMWSDGGPAQPSPTIGQAIN
                     GGYPWLEVQCSRCKTISSVDLCEIKRPPETFVHTLEEALRCRKCSRSKWRPRGVLHQL
                     APNQRHTPPET"
     gene            11481..12173
                     /locus_tag="RPD_0010"
     CDS             11481..12173
                     /locus_tag="RPD_0010"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF159"
                     /protein_id="ABE37250.1"
                     /db_xref="InterPro:IPR003738"
                     /translation="MCNLYSITKNQDAIRQIFRIARDTTGNLPPLPAIFPDGLAPIVR
                     AAGERELTMMRWGMPGPPQFGGIPVTNIRNTKSPHWRRWLKPENRCLVPATSFSEYNA
                     TANPKSLTYPDGSPHPMAGKKDVVWFALSPERPLFAFAGIWTEWTGTRGTKANPVEGA
                     HLLYGFLTTEPNAIVAPIHPKAMPVILTTEEERDVWMRAPWGEAAALQRPLPDGPLQI
                     VARGANKEDRST"
     gene            complement(12201..13025)
                     /locus_tag="RPD_0011"
     CDS             complement(12201..13025)
                     /locus_tag="RPD_0011"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37251.1"
                     /translation="MKATFIGFDSAWTDNPKRPGAICSIDYDGSEFSEFRGPTLVGFK
                     QALEFIQSAYDANRLTLVAVDQPTIVNNLTGMRAAERVAAAAVSWLGGGVQPASRSRS
                     GMFDDNAPIWKFLRELGACDDPERCKASRDGLFIMEVFPALALPAFHPGFCGRLSAPR
                     YNPARSKTFRQSDWEKVTKVVGEQVDAMQCPSFNDWCASLSSVPKPKKSDQDKLDASI
                     CLLIALHWMVQPRESSVMIGDLTSGYIVAPVVDEIRRRLTDKARSEYVAIDGKIPG"
     gene            complement(13025..15799)
                     /locus_tag="RPD_0012"
     CDS             complement(13025..15799)
                     /locus_tag="RPD_0012"
                     /codon_start=1
                     /transl_table=11
                     /product="helicase-like protein"
                     /protein_id="ABE37252.1"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001410"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR011545"
                     /translation="MDVKPLGRSTGLVGGGNLQRFSSRLGRLSHVYLKDQLRGASEYR
                     RIAGYFRSSIFDLVNEEIEGIGKVRIVCNSDLDPEDINAAKQARTQLLKEKWNEVDDA
                     VESFFRRPRYQRLFDILTKGNVEIRVVSRADAPFVHGKAGVIYRPDGTSSAFMGSLNE
                     TREGWSANYEFVWEDTSADGVAWVEDEFEYLWERGKPLPDAIIEEIGRSARRVEVQLA
                     DLTPAEVAPAALVEADIYRKGEELMPWQRAFVSLFLEHRETYGQVRLLLADEVGVGKT
                     LSLAGSALVSALLGDGPVLILCPATLTAQWQIELKDRLNIPSAVWLSQEKAWLLDPDE
                     IPMPSVGPEGVVKCPRQIALVSTGLIFHKTEERELLMSRRYGMVILDEAHRARGKTES
                     DEEERKANNLLSFMTEIAKKTTHVLLGTATPIQTDVEDMWDLLKILGMGAEHVIGDAW
                     SEWRSTEKVVPVITGKRKVTDDRDAWSLFRNPLPASAENEVIFGLMRGAIEMPPTRYV
                     TQKGFSDINDDFCREQFIDDVLTPKGDLGFFQRNNPVVRHVVLRKRSTLEQMNLLPRI
                     PVDIHPLPGQHMPALFDGLGLRTSSAFDAAYEAADKFTKVLRKRKKSAGFMRSLMLQR
                     LCSSYASGLSTAEKLLAGRSLDDEELMLDLGPNGVELIDEERLHLQTIIDVLSPHPTD
                     PKLDAVLYFLEDKGWLEKGCIIFSQYFDTTRWIGETLTGRLPREPVAVYAGAGKSGIY
                     IGGEWKSVEREQIKKAVKERTIRLVVATDAACEGLNLQTLGTLINVDLPWNPSRLEQR
                     IGRIKRFGQRRERVDMLNLVYHGSQQLTVDEKVYQKLSSRMKDRFDIFGTLPDVIDDD
                     WIDDEEEFDARLNDFTEKRKRANAFDLRYASDVDPKGERWELCEKVLARADVTKRLSR
                     GWGERERADG"
     gene            complement(15807..18746)
                     /locus_tag="RPD_0013"
     CDS             complement(15807..18746)
                     /locus_tag="RPD_0013"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase containing a Zn-ribbon"
                     /protein_id="ABE37253.1"
                     /translation="MDAKVMKSKVVPFSLKDAPSLIERVWPAQMISVEAQRERKAVHG
                     QTLTSLGSYWKGRKPLVLVRACILGALLPSTGDDEKDLAIFEKLMGMSDDQVACRFKE
                     KVSVEEVQKFGTVSQQSALIDDDGQGTTLRKLPKAQRESLMGSVIQRMPYDVRAQKLL
                     RPEEVDESVLTGPALDEVNKHLGTDASNLSELLEQLGLMRFGRRPVVVDTFSGSGSIP
                     FEAARLGCDVFASDLNPIACMLTWAALNVVGGSDASRKEIQQEQAALAKAVDEEITRL
                     GIEHDSHGNRAKVFLYCLEARCPQTQWLVPLAPTFVVSEARRVVARLVPNKSKKQFDL
                     EIVSGANAKEMAEAAAGTVRDGKMVYSLDGETYSTPIKTIRGDRREAGGIAANNLRLW
                     EKSDVAPRSGDILSERLYCIQWIEQETVGKSRQVTFFASPTAADLKRELKVKNLVSHK
                     LKEWQEGGFVSDMEIETGKENEGPIRTNGWKFWHQMFMPRAILTAALIAEHGQGRAHA
                     ALSLCKYLDNNSKSCRWKVSQSGGDGGAVSTFDSQALKTIFNWAFRALNVAPWQLGEF
                     ARSPIRTNATIECVDARNFRHSMDLSITDPPYADAVNYHEITEFFIAWIRKNTPTEFE
                     EWTWDSRRPLAIKGDGEDFRHGMVDAYKAMSEKMAPNGLEIVMFTHQSASVWADMAQI
                     FWGAGLQVMAAWYIATETTSDLKKGGYVQGTVILVARKRREREAGYKDEIVQEVKAEV
                     ADQIDTMSGLSQNLKGRGRIENLFEDADLQMAGYAAALRVLTKYERIDGTDMTKEALR
                     PRRAGEKNIVGEIIDFAVQVANEHMVPEHMPPKLWGDLSGAERFYFKMLDIETTSLRK
                     LDNYQNFAKAFRVNDYSALMGSMEPNKARLKSAKEFKKAGFEIPDFGPSSTRSALFAI
                     FELESDVEGDDVLSHLKDLMPNYHNKREDLAAIADYIARKRETVDETESRAARILHGL
                     IRNERLG"
     gene            complement(18758..19339)
                     /locus_tag="RPD_0014"
     CDS             complement(18758..19339)
                     /locus_tag="RPD_0014"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37254.1"
                     /translation="MSERKTIGFGVPNDIDPHHFTVEIPAVRANPVIITEHFGLSGGA
                     NGLPDSIERCRLPQEAWNAIRRELERVFNERLKEKKLTAARWKTGKNPVERLLGRELC
                     VLAWGVETAPKDTIPNAIRNWGAFKPEERWWLFAMAASLTGTSQDVDIGWRKAIRIAL
                     TETPTGEEVVAIRSKRPKSEGDRPRLPLFDDVK"
     gene            complement(19336..22488)
                     /locus_tag="RPD_0015"
     CDS             complement(19336..22488)
                     /locus_tag="RPD_0015"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37255.1"
                     /translation="MLQTIKDACQFDPKAIDYALSDQIENLDDLVGHDPVAAEAFFRK
                     TYVTGGMKTLLRQGLQRLAGSSGQAVFELKQAMGGGKTHSMLALGYLAANPKLFELVA
                     KDITQGIKAEPAQVVAISGRSISRDQHLWGDIADQLGKADKFLEFYKGMPQAPNEKDW
                     IGLIGDAPTLILLDELPPYFKNAITQNVGGGTLADVTTYAVSNLLSAALKLPRLCIVI
                     SNLSGAYEGATKSITTMVAKATRDLQNETGRQAKGITPVELGSDEIYNILRTRLLTKD
                     PDQKVINAVSTAFSDSISDAVKSKTIAKSATQIADEIAASYPFHPSFKHILALFKENE
                     RFRQTRGLMTMAALMVKSALGRPTNDVYLVGCQHIDLAQPDVRDVITNVYDLSGAITH
                     DIAGTATERAHAQTIDDVADTDAASQVARLVLMSSLSEANDAVKGLTKSQVVENLVAP
                     QRSPHEFDEAFEKLRIECWYLHRKENDAWYFSKNENLKKKIEKYASTAAQPKIDAEME
                     RRLQMVFEPKRRNAYSSVQALPKIEDIKPSGDRVLLVLSPDKRVPPEDAQRLFDAIVE
                     KNNFCVVTGDGTDLAKLEDKVRRIWATAKVLQEDGGDRSPNLAELQEETETAEFEFNS
                     TLIALFNRVYYPSRLPKPLPNGANEGLTYAALKLVERRTRENGPTTIDGEAAVEEALS
                     ATGASKLILTPADEGNAASLRNRAQDVLWGTTERKTRWKDVEERAISNVRWPWLPPKS
                     LDEIKRTAVSIGEWRDSGDGYIEKGPFPQAKTSVKVVTRAYNDDTGMATIEPTPVDAG
                     PNARVHFAPTKDVSGSSPVVPDTIFDRDDTVLWFLAVDPDGKHETGDPVKWSNTLTLT
                     HQPKEVMGKRTVELTVKPRGTIRWNIDGTNAREGKAYSGPIALNGDDEVKIYAYAEDA
                     GVEVTKVFPIRAAAEDEFKIDPELPVAIKKRQKIVSTKDVFATLKALKEARGLLKGSL
                     SATVGQGDVNATTRFGPQTNLNSAAIETFLGAARLSIAQEAAEVEIGFSEVHFETGRE
                     MEEFVKAVGWIVSPNEVEQQ"
     gene            complement(22544..22762)
                     /locus_tag="RPD_0016"
     CDS             complement(22544..22762)
                     /locus_tag="RPD_0016"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37256.1"
                     /translation="MVRKSIEKNIAPGRPGRKPPPGDRRQFLLTMSQDVIKAVKQAGL
                     EDDRPAWEIMEEAAKDWLERRKSKAKKA"
     gene            23030..23581
                     /locus_tag="RPD_0017"
     CDS             23030..23581
                     /locus_tag="RPD_0017"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37257.1"
                     /translation="MTQNPSTSAWQAALVARHPNAFNVEFNGRITTPGYPSVGDGWRE
                     LVETAVGRMVEAAAPRGSVTIVQIKEKFGGLRIYWHGRNLSAVSTRAIEEAVALAEAR
                     SACTCEVCGAEGRLHKHGGWFATACPEHARGDPVRVKPGFDNIRIVRSFEPGKPPILS
                     CRRYDRATDTFVDVDPASLGIKE"
     gene            23793..24572
                     /locus_tag="RPD_0018"
     CDS             23793..24572
                     /locus_tag="RPD_0018"
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="ABE37258.1"
                     /db_xref="InterPro:IPR004843"
                     /translation="MRLWILSDLHLELTRGWDLPAGDARPAFDMLVVAGDLIPRMERG
                     VRWLAERVTDRPVIYIAGNHEFYGTDIDRTVEKARDAAAGTNIHVLQNESLTIDGVTF
                     LGATLWTDFDLFDNQDYAMAAAGEVMNDYRKIRIDDYQRRLRPAHTLQRHWESRDFLA
                     HGLRGGGRNVVVTHHGAHPEAARRGYERDITSAAYTSDLEALILEGAPELWIYGHTHE
                     SRDFRVGATRMISNAKGYGPWLPSDPTWDNAQFAPNFVIEI"
     gene            24633..25244
                     /locus_tag="RPD_0019"
     CDS             24633..25244
                     /locus_tag="RPD_0019"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37259.1"
                     /translation="MPSEFESCPMLFTNPAQRDLFVSAKSTTAIPARHPLVRDALIQA
                     SLDPQVRSLEFVPAATVGATQVALNAIVVVRDDGRFHLDVVEARQVRDVEMEGLFLIA
                     LDDLKLVPLTLTADDITRQPRFANAKTVWAYRFHTVGIEMRMRVLSVLTEDGPLQLGC
                     LLKRTRGPRDPAPAVMALACSDLLELDIISRPLGPATMVRSRS"
     gene            25241..27334
                     /locus_tag="RPD_0020"
     CDS             25241..27334
                     /locus_tag="RPD_0020"
                     /codon_start=1
                     /transl_table=11
                     /product="AAA ATPase, central region"
                     /protein_id="ABE37260.1"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /translation="MTRTNAKANVKRARANVRRRAAVAKKPPRKIASKAGRKPARKGV
                     GRKVAAARPRGPWTTLVQPIEQPEGTNEVAESASSDPPLPRERPTARCALVAAAWTLA
                     TTGEIRARLKEGGSLAVVVVVPTSAWVASVKSMFEKRFGRGWEIFSIDDTTAKSPREQ
                     AAQNICAANELMKGHAVVGIAAQRDALPPALTTAADITIRIEPLRGSVIRRAIRLFTG
                     LPVGQVEDDIAAGGDFLDLLAAFRSGSTPTDILLRLRRATARSVDEGQRLPALESAVE
                     YGAAREWGLALARDIADYRAGRLDWREVDRGAVLHSEPGLGKTLFAQILARACGLPLI
                     ATSVADLFASSPGYLDSVIKASRAVFDRAAASAPCILFLDEIDALPNRATMSPRGADW
                     WTPVITDFLLRLDNAVANQRAGIVVIGATNNIAGVDGAMLRPGRLERSIEILRPDHAG
                     VINILRHHLERDLATAELTDVGHLLHGGTGAEIMMVVRQARRLARHDRRTLEVADLLR
                     AVVPIEEIAPDLLFRISAHEAAHAVGTLVLGCGSLLRSTVTPRGGRTTVAQDLGVAST
                     RATVESEAVMLLCGRAAERLILGDVSLGSGGTGASDLALATKMVAALHASSGLGETLT
                     YLSSHEDALETLRFDVGLRMRVEREMIAVQERADELVRRHRAAILAVAEQLRARRQLT
                     GTEIRQILDEMPPKS"
     gene            27411..27716
                     /locus_tag="RPD_0021"
     CDS             27411..27716
                     /locus_tag="RPD_0021"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37261.1"
                     /translation="MLVVKIEPAPSGFVPMRRCICGLAVANVSDLADIADYRVIGGES
                     PNGLKNRPAGIAETMFLNHPGRHRVWALVERPCGVIMKAGWVGLSNPHFDPNFVIEI"
     gene            27805..28395
                     /locus_tag="RPD_0022"
     CDS             27805..28395
                     /locus_tag="RPD_0022"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37262.1"
                     /translation="MFVHPKARASAHQFFVSAKTRTAIPTRHSLVREALVQASLDPLV
                     RDIGFVPSARVAAAQVALEAVVIVRDDGQFYLDIVPGRPLRDAEAEGLMLSALDELRL
                     APLTITEEDIRRQPRYTNARTVWHYQSTAVGIGMRMRIQRILIDAGPMRLGDLLMRDW
                     CSDPRPAVMSLACQDLLELNLMTEPLGPQTIVRCRS"
     gene            28823..29248
                     /locus_tag="RPD_0023"
     CDS             28823..29248
                     /locus_tag="RPD_0023"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37263.1"
                     /translation="MMSTEVLIRATEYPLDQVECVAERVVGENGDIVQVTCTDIASKV
                     IMGRLFVASEPAVWSVGLDLKDVVARVGGGYRHASITVDLATRELACRDEHLTRELRM
                     RKRLWRRRRRDPTSHNIRELAPSLAPSLAPSLPKGTIED"
     gene            29308..29997
                     /locus_tag="RPD_0024"
     CDS             29308..29997
                     /locus_tag="RPD_0024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37264.1"
                     /translation="MVVRNKAAKITRSDATRRVVTYRSGHFTGYVASRKSSTVVQYES
                     ILERDFIYLLETDRDVLWFSEQPAPLKFSDGIAHHTWTLDFEIERSSGRYLVEVKPLS
                     KVKKYRLDVIYGFARAAAKASGYQNLELWTDRELKALPRLPNAEILVGSDTTYHDPAY
                     DLALLSTIAEIAKVSERTTVRELRSLSRLGPLSYRAVMRQIAIGGLIPADSTVFLGDD
                     AILLIPGGGGF"
     gene            29997..32429
                     /locus_tag="RPD_0025"
     CDS             29997..32429
                     /locus_tag="RPD_0025"
                     /codon_start=1
                     /transl_table=11
                     /product="Integrase, catalytic region"
                     /protein_id="ABE37265.1"
                     /db_xref="InterPro:IPR001584"
                     /translation="MSMEQSFEPHVPLIRLHKNDQVVIDEVWYRETHRTKHAVTLHPI
                     GGTLPRVFTGRQLRELYFDPAKRMRIVRGPNEKLDPEVAAAASRPFESFSAGQQAEML
                     KRYDYVLACDRFFARKLFTKRPETGYARIAEIVARYRRLVRAHQENRPSCRFDLETVG
                     GSTLRDWYGRWLHSGRQLGALAPLLHSRGSKEKKMDPAVRALIADCVNEKYLTAEAPP
                     LTVVWDYICGRIDDLNEDGRHALAKPSEMAVRRWIKDNVDPFTEVFYRKGRKKATHQF
                     RLTNNAPLATRPLQIVEFDETPLDIMLVDDNGKNPRRAVLTAGICVATGMIVGWHIGY
                     EHPSWVTVMKALRMAVLAKDTSGSGAESPYPVYGVPEMIKVDNGPAYRSHSLVAAAGQ
                     LQFEIRLCPVAKPNLKGKVERFFREVTRDFLSIFPGRTFSNIQERGDYDSEGNARMTL
                     QTVQRLFTRWVVDIYHNRPNSRCFGQTPLERWEALSGFGVRVPPQSDDLTPLIGLIVN
                     RTIQADGITFMGLTYRDAALKLMRQKSHMGREWMVKIDPNDLRWIYILNDEAQCWVRA
                     GCQRADLIEGLSLKMWMEVVKAAKEATAARQRVSIATLRRARVALLREAEAMGNKPHG
                     KITARDQMWIEANMNQPAYLISVDPDELDAMPNRMLPRRRAKPAENEAKRDPSMVEPA
                     SRAGGHPIADQDLPDAPLDVAERELDDEVREQQERDDLRQWRKRAAALSSAVSTTQKT
                     DAQPLRTVTEAAPPIIPDQQEDVSQARQEAPVGAFERLATAACTRTPTRLADEDDIES
                     WNPNNDQKEIDQ"
     gene            32426..33565
                     /locus_tag="RPD_0026"
     CDS             32426..33565
                     /locus_tag="RPD_0026"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37266.1"
                     /db_xref="InterPro:IPR006162"
                     /translation="MSRAIQKGSVVSLETALPAKASKPAVCGQPRKGPEEDAMRPQPR
                     RDVRSKNPSRNARADRLKGLSDVAVRTGKLAVAEQMFDELVVAYYSKVEGNLMVVYGS
                     SGSGKTHVLRQLRKDEDLQLDETDPECARRPLLMIEAPSPCTLKTLGLAVLQGLGYEE
                     AGFANLREHEVWRRARANLSNQGTGILVIDEMHNVLAGRSNMESVKIAMTLKSLMVSE
                     VTPIQIVISGLKTVRDFAEHFKELQRRSQFLEMTPLTSPRDDKKLVLFLEGLEKELKF
                     RTCGFTRHDLPVRFMMASRGLIGRVAYFVKMAAKLAITLGDDEIKQEYLGKVYERIYR
                     VSANQNPFLMANVASFVMPREKEADELTFVRGVKEVSRRNGDAAD"
     gene            33552..35345
                     /locus_tag="RPD_0027"
     CDS             33552..35345
                     /locus_tag="RPD_0027"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37267.1"
                     /db_xref="InterPro:IPR000276"
                     /translation="MLPTSPHRNVGEGAIGFLMRLGETHGVRKFCDMLRDLGIRRFDL
                     SQGIGVDRVARAAMVARAALQFDSGTRTRQGVMLRGELLRPRQWSVHAGRRGCPACFA
                     GDRDGTVLPRQWHRAWWDIRAVTVCPLHGLLLIDACPRCGVPLDFKVNAIGQCRNGHP
                     LWDSSPERVTGFAGDEYIVGRLVGSDRIPNSLLDAGRLGEAIDALDLVGRCVLAGHHT
                     GGSGGLRRHVVLAAGFECFIDWPAAFDPLLDGLLRSSKQGVGKWGAAAAYGPLHYGLQ
                     ELGCGRIAMEMKAHLRRHAAANGVSISKPVFGTVPNVTGIYSVRHAARRFGMGFEGTR
                     TLLAREGVVPEETRRGTPIRISTAVVDRLATERSLTVGLGRLADHLALGRGQTRRLVG
                     AGFLGDRRPRPSLADADAMLAKLCIGAPANWDRSETASLPDACRSARCSIEVAVRSIL
                     AGAPDVKGYRPGAGLRGIFVRVSDLRAVGKLSRGRLTLADAAAALRVKWETARALAAD
                     GLLVTADDGVHPSALDNFQRDFIAAADLAKVARVRSQSLIKQLSGMGVSPAAGPPNCR
                     QVFYRRSSLRAVRALRRKLPGVYARALGQSR"
     gene            35342..37240
                     /locus_tag="RPD_0028"
     CDS             35342..37240
                     /locus_tag="RPD_0028"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37268.1"
                     /translation="MNVINRSTAVRRPLACRGPLWTDEPAYARANRLALMNGINSLAS
                     FGGEMRIPYRQIIWGWRNAEIAALAGMDPANLGAVTFRVGDDDRVRLGDEVLHIDDWS
                     YNVLRVCPACLRSDFERESRFPDLLPHIRSWWNLDAIEVCPLHRTPLLGGNPDIFGHR
                     NDPKILDVRFVAGVDCDLSSLQVEVGIVEDVRAESYILGRLGFMPRVRSEILDDLPLW
                     NAIRLMDRFGAVAAAGVRGFTSLGGSVSKREALSAGYAVFADGKDGLFCLLDRLVADA
                     DVARGKWGPRVAYGRIYEWLSHDTREEAYDPVRELVRQHAIDNIPMAAGDLVFDRPIG
                     DRHVFTLWHVSRELKTTPSATRRILKAMGHLSPDDDVKENWQVLLRKPVVDQVTADLA
                     DWLGFNEARALLGLPRAPMDALLQSGVLKAFLSVSTGVAEHIFRRRDLDAFMTSLVGG
                     APFSRKTEGLCDVVQAGRRSGTSTTDVVAALLAGRLTCCGRLSSATGMMQVLVDIEAV
                     RALRASGEVRRPGMTVEDARRKLGVTWPVVSNLIGLGLIKTIETRAGPKNRKQSFIED
                     SELEAFTAEFVSATEIAEARKTHVRVLVPALRKQGIEPAIEKTAVGQYFYTREKFTLS
                     RAVVESEH"
     gene            37353..37691
                     /locus_tag="RPD_0029"
     CDS             37353..37691
                     /locus_tag="RPD_0029"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37269.1"
                     /translation="MTFFRRLLSAFLSFFRRRGKPRERARDLSRSAVQLKRWNGDDRP
                     PPLMWKDCHPRTQAIFKAELTCSNGHSISLRGHSISLEGHVTPSVVCQASGCDFHDYV
                     RLAGWTAGAL"
     gene            complement(37697..38431)
                     /locus_tag="RPD_0030"
     CDS             complement(37697..38431)
                     /locus_tag="RPD_0030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37270.1"
                     /translation="MPSVAAEDAPLVHWSGSAYRLIPSRFPPVSIYDGLIASDRQEEL
                     VAVENLTNPRLRSLGRFQEAGSPGPCADPKLQNWNLAPFAYGNPDGSTFFGEERPCLE
                     LAMEQQTALAVSVAKRQAFMEATNEAPIGLDMRMLCHPVDGIFWDLRDVPISWSELGQ
                     AKRYELGAKMPIGAQGILFRPVERPTGTCLVVLTGDILQRSQQTVHFRFVWDGKKISQ
                     LYVFNNEGTRIDADKLAGREDVLAAT"
     gene            complement(38412..38798)
                     /locus_tag="RPD_0031"
     CDS             complement(38412..38798)
                     /locus_tag="RPD_0031"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37271.1"
                     /translation="MPTRAPVPQGEAERSKIPAELEAFFEVAERWRLSAEEQIVLLGS
                     PGRSTFFKWKKEGATLPADTRERLSHILGIWKSLRILFTQDDRGEAWIRAKNRYFDGA
                     SAIDVMLEGMVGLIRVRRYLDAQRGG"
     gene            38941..39660
                     /locus_tag="RPD_0032"
     CDS             38941..39660
                     /locus_tag="RPD_0032"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37272.1"
                     /translation="MDGQVEILERRSRGMEYPVNGAMAAFPDNVVNGREVLTRSGLVP
                     ASEYRLILVRNGRTRLIGTDDDVDLDKEHGGSFRAFLSDRDFGFTVDEVGQVWGTADM
                     EVDEFLRIWPQHPEHRWVLERDDEPDTVLTPGGVLSFGPKGVEHVVSRKDAHPDKVMV
                     TVVTTAGVYPAEGAKRYPRSTRISDVLNDAARKLDIRDSSTWIVTVAGRDVSPTLTFA
                     QANLTGTVELEWGPREGGGGA"
     gene            39653..40090
                     /locus_tag="RPD_0033"
     CDS             39653..40090
                     /locus_tag="RPD_0033"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37273.1"
                     /translation="MLEALSKATFDRDIGRIDPRSVRMYDWAIVQANYPVFDVIFNHA
                     QVAPLRLRLVCDDWDEIPPSIELLNKEGQPLATAPPNVGNVFNGSTHPNTGRPFVCMR
                     GAREYHTHGSHTSDLWDNYRGQSGMDLGGIVVQLWRAWKRSVG"
     gene            40087..40557
                     /locus_tag="RPD_0034"
     CDS             40087..40557
                     /locus_tag="RPD_0034"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37274.1"
                     /translation="MSSIICTRSVLERTISIIRRDGNRGEERVALWLATAAQRSPAAI
                     VEVYEPEQVVEVDSFYIPPASMRALMNHLRSTRRRIAAQIHTHPGRAYHSDADAKWAI
                     IRHSGALSLVLPHFANATTVENFLEEVMTYEYSPAGEWIHCPNVGAGARVVVTA"
     gene            40554..41921
                     /locus_tag="RPD_0035"
     CDS             40554..41921
                     /locus_tag="RPD_0035"
                     /codon_start=1
                     /transl_table=11
                     /product="UBA/THIF-type NAD/FAD binding fold"
                     /protein_id="ABE37275.1"
                     /db_xref="InterPro:IPR000594"
                     /translation="MNKATQQNAMMLASLLGVGEAEAGERLARTVLITAAPGWKSGWA
                     VEVGELIGRTVQVSHQQEPTDPDLELVIGDVTPRTSARRVYADLGSEGAAASLEPVAK
                     LAGEPHGLYAAAAACAVSAVVVHAVIDAADLPQARLPMRLDYAQLGVPNGALDLRVDV
                     GHAVMAGAGAVAHAFLKAARHIDIHGDLAIVDPKVVQGGILNRCLYLEDNDVDRQKAE
                     VLAERAQRDFPHLRLLPFVTDFKAYVRQLGHPPETVFVTVDSRLVRRSIQLEVPRRII
                     DASTTDASGVIVHSNVLPTQHACLACIYRHVPEEHARERSIAEGLGVDLADVQAGLIT
                     AEVARRIVRTHKSIDGDAIVGLAFDSLFRQLCSEQALATPEGRQVLAPFAFVSAWAGV
                     MMAVEMLRSFAGAAKTNYWSVDPWNTPKARGRMLRQRHPECQFCSKPEYEPIIQSLWG
                     ELAEA"
     gene            42301..44961
                     /locus_tag="RPD_0036"
     CDS             42301..44961
                     /locus_tag="RPD_0036"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37276.1"
                     /translation="MRASRRTVVVHTVLAGRMERTAAARSNELGVQIVTMGQLAARLA
                     GGLLRPVDSEALQEAVFAALPVVDMGELEPIKLLPGMPGAVTATFDKAWRAGVDLSSA
                     AHPRLAALAALEQEVVGRLPASMKRPAELVAMAKERIAQASTVIGSLEIHGHSEMSPC
                     WRPLLEALANVVPLTWVAGPRHVPAWLEGTGVTVAKTDPTATATASYSCANQQHEVIE
                     AFRWVRKLLAEGVQAADIAIAATGPADYDDHMFAQVQESNLPVHFVSGVKALTTADGQ
                     AAAALAEVLAKGLSQERVRRLFALLRGSPALERIPREWTRLLPLGAPLTEMERWERVF
                     ARVEASDWPEGQDLSALVLEVLRLLDRGLAAATDVGEALLTGVPLSLWRRSLREGPPA
                     ALPVTLGRLRTPDALEPAASVIWCSAIDLASSPRPHVWLLGMNAGRWPRRISEDRLIP
                     NHVLPIEELDPLPIADGDKRDFGTILATATEVAMSHSRRDAGGRLRGRSPLIKSFAVT
                     YLDRGRTPEHAASEADRLLACPAEFAKLPVAVSGIGCWRDWFSGGLTAHDGLVAANHP
                     RITKLFERSLSATSLKLLLRDPIRFVWRYGFRWTAPEDADEPLTLDGLAFGNLVHAVL
                     QNAVDGLSEAGGLAAADRAAIDARIAAAIGGTVAAWEAEFPVPPAVIWRSAVERASTT
                     ATAALTYPMAALPDQRSWTEIPFGKPDEAEGERDLPWPTEKTVEIPGTGLLIDGKIDR
                     LDLAGDRSKARVLDYKTGKLDRKMAEKVIDGGRELQRCLYAFAVRTLVEAGVGVEAAL
                     FYPNAPEGEQAVFPLTDAALEAALAKVTQAVSLSRDALLAGAAVPGEDAADKYNDLRF
                     ALPANAGYLPRKKLPAIDRLGQAAAVWSET"
     gene            44958..48305
                     /locus_tag="RPD_0037"
     CDS             44958..48305
                     /locus_tag="RPD_0037"
                     /codon_start=1
                     /transl_table=11
                     /product="UvrD/REP helicase"
                     /protein_id="ABE37277.1"
                     /db_xref="InterPro:IPR000212"
                     /translation="MKPIPDLVARARALTAIENTLLVEAGAGSGKTSVMAGRVAVLFG
                     KGVEPKNIAAITFTELAASELRLRIEKFTTALSLGDVPPDLTQAFPEGVPEAEKANLY
                     RACQSFDQLACTTIHGFAQSLIKPYPAEAGIDPGADIVDPDEAELAFGERYDAWLKQR
                     LSVDDADGLVAQLVLADEGGGLKLIEEVAQFLRKNRDARCAPAAWAEKTMADVIAAVK
                     RFEDALAAVGFEEEDTGLRCRTLIALVDILNPGKLSAGAPDTAALIAALNFPRHTSCF
                     TEKGTRRQLRNGTKWQDAAAKVGLKKADGKKTSDALVPLYDGCHNALETLLAAIAGEL
                     LSRLCAEMQGLLLEWRDYKRDAALLDFDDLLFTARDLLAGHPEVRRALSQRYRYVLVD
                     EFQDTDPLQTEILWMICGEDCEGADGAPLKRPLRPGALFMVGDPKQAIYRFRGADVNA
                     YLAARSAVPQDARLAITANFRSVEPILAFVNKRFERVLSEEAGQPGFAELSPVRPPNG
                     DAPAVVALDVTLPQGASGVSAIRDAEAAALAELCCRLVGNLQVHDPETKELRPCRLGD
                     IALLAPAGTELWRFEEVLEDRGIPVATQAGKGFFRRQEIHDLIALVRTLADPRDTLAL
                     GALLRGPLIGLTENELLDIMEGLPVDPDRPARLPTLTVGTNPEHIAHAVARKAIENLQ
                     ALRRRIRITTPYALLADAMSDFHVRPHLRQRFRTGAERAVANVDLFLEFARAYDVRGL
                     RAFSRDMTAKWEDDEDQAEGRPDAEEESVSLITVHAAKGLEWPVVIPINMTGKPFAGG
                     VLMQDRPNSRFSIPVLGTEPSDYAAMKTMNALERDRERVRLWYVGVTRSRDLLVLPRH
                     TELPKECWATLVDLDVGALPAVDPESFGPAGTRAARIEANEQTREIFAAEAGRIFAAR
                     EKIVWRQPSRSEVDGEGEKPDIRIDHSEPPGPAEVEKPVVVGSAQRGVILHKLMEEII
                     NGEVGEHMSEIESRAALLKQHLGIEPTAEPQPVELAATVLKTLALPAIKALRPRMVAE
                     LPVFGSVAGADEEVLISGQVDVVALDDAGEIDVVVDWKSDVDPSAAAVDHYRQQIGDY
                     RRLTGAKKALLVFMTAGQVVEILLRSR"
     gene            48319..49446
                     /locus_tag="RPD_0038"
     CDS             48319..49446
                     /locus_tag="RPD_0038"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37278.1"
                     /translation="MLIYRFCFSAGGEQIAMARTKTLNSNGKKISKKNGPRYPTQVID
                     IGFNFAGYPIFSATAAALLRKMHTQKVRPPQPDHISGMAPYSRIPFAETSFIIGHWFL
                     ETALNETAMFFVRRAYQQTKQFASETEAVKQIDDFFSLSVSSPVKKVEAYDKICGTQI
                     AGKADLMEKIWTICAIRDLLYHHEANRYRGGKAPACVAKLFGYISDTPDQRSWIKAGW
                     SPVLGSKSAFDFVVQTVIDFTDTMSAELGHKHRFQTVDHLAKKPGIVSLCAEPGLVPP
                     KETIKSIQEKYTDPKTKAKVIAFDGTRRGTYYLFSKNKKYYVVHVTNRGRERTVPAWE
                     ILKIKNADRIGWIPIPWKGMDSELKRSVRERVSDIEIYRSA"
     gene            complement(49431..49802)
                     /locus_tag="RPD_0039"
     CDS             complement(49431..49802)
                     /locus_tag="RPD_0039"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37279.1"
                     /translation="MSSKKRIKPQRKDRDAAAGVQGLVQGSKQRARGDLRWRHRHQIR
                     KNGLLLNKIHHAAYDADLRVHISERLLSQQGDPLLAKAVAAMKGAKQRLPRRDKTNKI
                     QIGWRKGSSKNKQRCDRYAER"
     gene            complement(50548..51813)
                     /locus_tag="RPD_0040"
     CDS             complement(50548..51813)
                     /locus_tag="RPD_0040"
                     /codon_start=1
                     /transl_table=11
                     /product="Thiolase"
                     /protein_id="ABE37280.1"
                     /db_xref="InterPro:IPR002155"
                     /translation="MMPEVYVIGTACTPFGKRPQTSFKALTREAYLAALADAGMADGR
                     DIAMAWFGNCGMGTFGQRNIRGQVCLSPLVREGLFPERIPTMNVEGGCATASQALHGA
                     WKDIASGDAQLSLAIGVEKTFVPDDPARTQEIFDGGIDQLDPGEWLAYYRDAGEVSGK
                     PFQPDDKRGTIFMDTYAMQAAYHMKRYGTTQRQIAIGAAKNHHHGSLNPLAQYRFTMT
                     ADEVLADRPISYPLTRSMCAPIGDGAAAALVCSKDYLASLPRGVRERAVKIRASAMSG
                     GKYRSLDEPGLSRIAADRAYKMAGISPSDIDIAEVHDATSFCEIYQVEMLRFCAEGQG
                     GAYVASGATALGGDRPVNLSGGLVSKGHPVGATGLSMIHELVLQLRGEAGERQAKNAR
                     LALAENGGGVVGFDEAACAITILERLEPN"
     gene            complement(51851..53074)
                     /locus_tag="RPD_0041"
     CDS             complement(51851..53074)
                     /locus_tag="RPD_0041"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="ABE37281.1"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002397"
                     /translation="MPNLDFADPKINADPFPVFAQLRESDPVHWSPVLKAWVITRYDD
                     VRRVAVSNADMSAERLAPFFATVPAESQSGFANLMTYLGKWMVFRDPPEHTRLRRLFT
                     KAFTSRSVMALEPNVGEIVALLFDEMEQKARSTGVVDWIADFAYPLPATVMMDLLGVP
                     RDDLHRVKDWSNDIALFIGTSRATADKYLRAEAGAKAMAEYFRGIIASRTVDPQDDII
                     SQLVTEPDKREALTDDEVIATCILLLFAGHETTTNLLGNGFYYTMNAPEQWARVKDDP
                     SLAETAVEEWLRYDGPSGALVRVVTADVEFGGRTMLQGQRVFAFINSANRDPEQFGDA
                     DRLDLGRSPNPHLTFGHGIHFCLGAQLARLEGQIALRALIERFPGISLATDSAPGWRD
                     SIILRGMQSLPIRLR"
     gene            complement(53163..55085)
                     /locus_tag="RPD_0042"
     CDS             complement(53163..55085)
                     /locus_tag="RPD_0042"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase and ligase"
                     /protein_id="ABE37282.1"
                     /db_xref="InterPro:IPR000873"
                     /translation="MGAWEVKGPAKGTCRSWRDAYPELAGMVARITAPRGRGIAWEGT
                     EIWAYRDRPSSISECLAANVARWPDREAYVFHPGGERLTWGEVGAQVDRVAAALRQEF
                     GFRKRDRLCLLTAGCPEYVIAYLAIVQLGGVAVPVNLGLTDEGLAAQINKVGAKGLVV
                     SSEVWSGKLDAVRGGLDSVEAVFVIGGAAPQGTLAFSELSSLRTTPVDHEAVDEWDLC
                     AISFTSGTTGVPKGTMAMHINALGCAQNVVIAAKGLGPDDVNLCMPPLYHNTAVYADF
                     LPALLSGGKCVIMSAFTPLEAIKLIEAERATWAVAAPIMLWMMMNHPEFRNHDCSTLK
                     KILFGGHASSETFINQLNREFAPIAMVNAGSVSESTAVGFALPTEDAIRKITSCGLAT
                     PNTDIAIFDDAGNEVLEPNVIGEVAYRGQQTNAGYWEEPGKTAEVFRRDGFVLSGDWA
                     KIDEDGYLWLLDRKKDMVVRGGQNVYCIEVENKLYLHPKVLRAAVVGVPDHVFSERLK
                     AIVVLKPGESATADEIREHCAKHLAKYETPEYVVFGASLPANAAGKTLKRPLVDFWGD
                     SPGTPLARFSAFCASLPPALFDTPHLKLDGRPMTPREALGELQQGSERGQHLARMIEQ
                     QGVCGLTTPDEARFRK"
     gene            55237..55872
                     /locus_tag="RPD_0043"
     CDS             55237..55872
                     /locus_tag="RPD_0043"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein, TetR"
                     /protein_id="ABE37283.1"
                     /db_xref="InterPro:IPR001647"
                     /translation="MIAKSRRTRTASQTRQAKPARENRAADKRPALSGDRRQALISEA
                     ARLFGNKGYENTSMRDIAAAVGILPGSLYHHFSSKEELFVAVYSFAVSQSVDAVTAAI
                     EPRSAPWIRLEAACIAHMQSLLDKSRFAAVLVSHLSVSGLPEQVVALRDSYEAVFKDL
                     IAELPLPAGTDRRIFRLGLLGSMNWAITWYRPGGETPASIARKLLNAIRRD"
     gene            complement(56111..56848)
                     /locus_tag="RPD_0044"
     CDS             complement(56111..56848)
                     /locus_tag="RPD_0044"
                     /codon_start=1
                     /transl_table=11
                     /product="pentapeptide repeat"
                     /protein_id="ABE37284.1"
                     /db_xref="InterPro:IPR001646"
                     /translation="MKLEPGTTLDGADLSGFELSELDLSGATFNACTIADANVSGGCF
                     EGARFAKCRIIRCRFANADFRDAIFEECDFADDQGHLGVQFAFSRIEQARFHRCNLSF
                     AKFERSDLFGMEMETCNLRGAVFKKVDFARAFGGKVVKWAGAMKGCNLELADLSEIRM
                     PDCDLNNSRFREAVLFDADLQGADLRGCDFAQAFAAGAKLARADMRGANLSGINLVEL
                     GNFDRLMVSADQMHPLLAALGVDVSSE"
     gene            complement(57042..57812)
                     /locus_tag="RPD_0045"
     CDS             complement(57042..57812)
                     /locus_tag="RPD_0045"
                     /codon_start=1
                     /transl_table=11
                     /product="Enoyl-CoA hydratase/isomerase"
                     /protein_id="ABE37285.1"
                     /db_xref="InterPro:IPR001753"
                     /translation="MEHLTLSRPAPDLAVVQLRGAGRVNLMSYAMLEELWRVANDLQS
                     DRAVRVVIVTGSEQAFSAGMNLRQKEVSEFESYSIEERLQIHSIGARACKAWEDLHAV
                     TIGAIEGYCIGGGLAFASALDYRVASSMATLSAPELRHGMNMSWQSVPRLVALVGPAK
                     ARRLIMLAEQVAAADALAWGLVDVVCDPGAALASAEAEAQRFLAMPAAPLRMTKQAIN
                     QAAGALNHAASYMDLEQYVLCQSTQAHRDSIDAFTGRS"
     gene            complement(57862..58605)
                     /locus_tag="RPD_0046"
     CDS             complement(57862..58605)
                     /locus_tag="RPD_0046"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family"
                     /protein_id="ABE37286.1"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /translation="MRESMNQSSDPDQDIAQQPPAEAVEAAGEDLISSADRAYKIIEA
                     RIVQLKYPPGHALSEHQLSRELGISRTPVREAFRRLAVEQLVEILPRKGAFVTEIKIN
                     QYLHLLDLRQQLETFMAVRAAKRATPQQRQAMATLAQELRDGIMEPEQAIFVFADRAY
                     KDILVEASRNPFVGGIIAPMHALSRRFWYYYRDQWTEGEAEVAIKRHLALMDAVAIGD
                     EAATHTAVQNLFSYLEGFARRIMDSEYKI"
     gene            complement(58602..60155)
                     /locus_tag="RPD_0047"
     CDS             complement(58602..60155)
                     /locus_tag="RPD_0047"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase and ligase"
                     /protein_id="ABE37287.1"
                     /db_xref="InterPro:IPR000873"
                     /translation="MTDIAIYDWIASHAKSRPDRIALVDDFSGRSFSYAELDRRVGAL
                     AAFMLDTLGIAVGDRVATLGHNSTNILEIQFACMRVGALFVPLNVRLAAPELIEVIRD
                     CGARVVFHDCEFRAVVADIAAAVGATPVEMNESGQACAYEEAIAGHVPRGPRHGGTLG
                     DTWTLIYTSGTTGRPKGVLISYQMVLYHAVNYGFSTGLTPDSHGLTFLPMFHTSGLNL
                     PANPALHAGATVTVMRRFDPPRALALMGRKESPVSHTFGVPANYLFMRLLPEFAEADL
                     RGVRSLGVGGAPMPIPLLQAYADKGVSMQQTFGMTETGPTVTILSAERGFDKLGSAGL
                     PIVHVETLIADKDGAAVAPGDIGELCVRGPSITTGYWNRPEESRSAFRDGWFRTGDMA
                     RQDEDGYFYIVDRSKNMYISGGENVYPAEVERVIEKLAGVVEVAVVAEADEKWGEVGR
                     AYVVRDPSVALTEDDIIRYCRAEIAGYKVPRYVSFIGALPHNATGKLDRLHLRKIADK
                     ESENACTPV"
     gene            complement(60305..61537)
                     /locus_tag="RPD_0048"
     CDS             complement(60305..61537)
                     /locus_tag="RPD_0048"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type branched-chain amino acid transport
                     systems periplasmic component-like"
                     /protein_id="ABE37288.1"
                     /translation="MTTKMTRLLRNAALAGAALLATAAQAQDTIKVGALLPLSGNYGF
                     LGVTERLGIDMAVEEVNSAGGILGKKVVVVYEDAGTPAQTTRKATQMLEQDKVAFFVN
                     GGGSAVSATMFEFAQRNKVIDLAIDPNAEELVTTKAGKYAFLVPAPSSMIANAVIPEA
                     IKLGKTAMFLTHDYSFGHAQTGEQRRVLKDKGGVKEVGEIKIPLNTRDFSSQIIAIRN
                     AKPEMLIINVAGVDATALLEQIWEFELYKQTKIVVPLLDFEDSWAIGREKNQLIALAG
                     IEWHYNVPAADALAFKERYQKQFPKAEYPVPTTNTVNAYLGVRETLRAIQRAGSLDSA
                     KIVAALENHEVKDSLKPNPLVIRAKDHQWMQDFFVYKMKNPASSKELGDIYELITVAK
                     GADIVVPEAQRTTDLNAQ"
     gene            complement(61605..63122)
                     /locus_tag="RPD_0049"
     CDS             complement(61605..63122)
                     /locus_tag="RPD_0049"
                     /EC_number="1.2.99.3"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase (acceptor)"
                     /protein_id="ABE37289.1"
                     /db_xref="InterPro:IPR002086"
                     /translation="MTTKTTKKPEPSRDDWHERGLKVTPRNQLYIDGGWQPAASGGTF
                     ACISPIDGRTITDVAAGDAEDIDRAVKAARTAFESGVWSRQTPAQRKKVLLQFAKLVR
                     EHRDELALLETLDVGKPIRFSRAVDIPQVEEAISWTAEAIDKLYDEVAPTGDKSLALV
                     RREAVGVVGAVVPWNFPLLMAAWKFAPILATGNSLVLKPAEQSPLTALRVAELATEAG
                     IPNGVFNVVTGFGETAGKALGLHPDVDVLAFTGSTQVGKYFLGYSAQSNMKQVWLECG
                     GKSPNIIFDDVYDIDAAVKAAAMGIFFNQGQVCNAGSRLLVHKAVKAQFMEKLVAFTK
                     RMTPADPMDPATILGSIVSVEQARRILDYIEIGAGEGARLVAGGKPVQPVEGGCFIEP
                     TIFDGVGAAMRIAQEEIFGPVLSVIEFESDDEAISIANDSMYGLAAAVWTRDLNRAHR
                     MGQRLKAGLVWVNCYDAGDMTVPFGGVKQSGFGRDRSLHALEKYTQLKTVWINLR"
     gene            complement(63145..63843)
                     /locus_tag="RPD_0050"
     CDS             complement(63145..63843)
                     /locus_tag="RPD_0050"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related"
                     /protein_id="ABE37290.1"
                     /db_xref="InterPro:IPR001687"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MLEVRDINTYYGNAHILFDLSLTIAAGECVALLGRNGAGKTTTL
                     RSIMGLSPPRKGAIEFRSAEIQGWVPYRIAQAGIGFVPEDRRIFPVLTVEENLKLGQK
                     RGTSETTWSLERVYQVFPKLKQIRDRAGGNLSGGEQQMLSIARALMGNPDLLLLDEPT
                     EGLAPIVVEELVHAIARLKQDAMTVLLVEQNINVALALADRCYVLDHGAIVAEGSAEF
                     IRNNEKLRSDLLGI"
     gene            complement(63836..64612)
                     /locus_tag="RPD_0051"
     CDS             complement(63836..64612)
                     /locus_tag="RPD_0051"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related"
                     /protein_id="ABE37291.1"
                     /db_xref="InterPro:IPR001687"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MSGLRTENLSVQFGAVKPVDGVSVEIAAGKLTSIIGPNGAGKTS
                     FFNLLTGLYLPTRGKVYFDGNDVTDMPVHQKVRCGLTRTFQILNVFDALTVEENIRVA
                     VQRRHGRSRKLFCAADVHGPVEDEVAEITERIRLPDKRKVRACDLSHGHRRHLEIGLS
                     LATRPKTLLLDEPMSGLGMYESSIMGEFVRELAQSLTVVLVEHHMSVVLSISDTILVL
                     SQGRLLASGTPAEIQANPAVQEAYLGSGRYDLPQERAAHA"
     gene            complement(64609..65649)
                     /locus_tag="RPD_0052"
     CDS             complement(64609..65649)
                     /locus_tag="RPD_0052"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="ABE37292.1"
                     /db_xref="InterPro:IPR001851"
                     /translation="MNALISNPTARRTPIRMFVGLLALFAVLPWLLTAIGLGVNLATE
                     VLIIALFAMSYNILLGTTGLASFGHAAFFGSGAYAVGILQRYGLNGIVISLAAAIAAG
                     LVASLFVGLLVRKKRGIYFGLLTLSFGQMFYIVALRWDELTGGETGLTGLKRPAPFGL
                     DLSSHINFYYFTLAIFMVALWLIWRITNSPFGSLLTAIKSNEVRTQYLGYDTALYKLA
                     AIVISGSFSGLAGGLYAWFQYAAYPQNLFWIESGNIVILTLLGGGLSSFFGPILGAAV
                     FVGAQDLISGYTQHWMFFFGLIFIVVVTTFPNGLPEAFAKFVASARRRFGRTAGETVI
                     SAQSSSRYGADQ"
     gene            complement(65655..66530)
                     /locus_tag="RPD_0053"
     CDS             complement(65655..66530)
                     /locus_tag="RPD_0053"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="ABE37293.1"
                     /db_xref="InterPro:IPR001851"
                     /translation="MPSLAEVVSQLTNGVILGLILALVASGFTMVLSVMGVINFAHGL
                     LFALGAYLALSLHKVVGYWPALLIAPLVVGALGVMLEQTFIRRLYGKDPLFVLLLTFG
                     IAMAGEDVIQMIWGKLAYSISPPDLAKGSIDLGFMVYSKYRLFMGGFALVAIFSVWLF
                     LAKTPYGAMIRAGSHDSEMVGILGKNLPRIRALVFGLAAAMAALAGIIAAPLWSVRPQ
                     MGLDALLPAFLIVVIGGMGSFWGSVLAGLLVGVANSFAVMVVPRFSDLMMYVLAVVVL
                     IYRPRGLLGTRSVLE"
     gene            complement(66611..67423)
                     /locus_tag="RPD_0054"
     CDS             complement(66611..67423)
                     /locus_tag="RPD_0054"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="Enoyl-CoA hydratase"
                     /protein_id="ABE37294.1"
                     /db_xref="InterPro:IPR001753"
                     /translation="MSFSQLTYEVDGQVAVISLNRPERMNALTQVLENELRDAIEQAD
                     ADSAVRAIVLTGKGKAFCAGMDMDELEVLPPDDIQRRDWMRPYDMNRRADYQTRYSYF
                     PASNKPIISAINGAAAGLGLVMALYSDFRLASEKAVFATAFAKRGLIAEHGIAWILPR
                     VVGHANAIDLLLTSRKIDAAEAREMGLVGRVLPPDQLMPAAMALAAVLATEVSPRSVQ
                     VMKRQLWEAPYQELGDAISDANREMFLSIQSDDFREGVAHFIERRPARFTGK"
     gene            complement(67486..67848)
                     /locus_tag="RPD_0055"
     CDS             complement(67486..67848)
                     /locus_tag="RPD_0055"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37295.1"
                     /translation="MRLAPSWIIRQSQLLASTERAAEQSVAPTFAECGHSPLEGWTPH
                     SARQKMQLPVSSHPHRDIVLSAAAPGHIVDACEKSRPNQPRSRIDVVDICLQTTPSPA
                     SAVSPHRSREPRKSLTSN"
     gene            68026..69015
                     /locus_tag="RPD_0056"
     CDS             68026..69015
                     /locus_tag="RPD_0056"
                     /codon_start=1
                     /transl_table=11
                     /product="Integral membrane protein TerC"
                     /protein_id="ABE37296.1"
                     /db_xref="InterPro:IPR005496"
                     /translation="MDFLLLEWLGKPAWMWLGFLAIVGLLLAFDLGVLHRKQKEIEVG
                     ESLALSAGYIALGTAFAGLVWWQLGETAGIQYLTGFVVEKSLALDNVFVIALIFGFFA
                     VPRKYQHRVLFWGILGVIVLRAIMIGIGATLVAEFAWVLYLFAAFLILTGIKMLVIGD
                     KETDLAKNPVLRFIRRRFRVTDALHGERFFVKLPDPKTGQLVRYMTPLCLALILIEIA
                     DVIFAVDSVPAVFAITSDPYIVYTSNIFAILGLRALYFALAAVLHRFAYLKQALAVLL
                     IFIGAKIFVADLLGLEKFPAAWSLGATFAILAAGIAYSLWRTRNPAPHLKGET"
     gene            69012..69314
                     /locus_tag="RPD_0057"
     CDS             69012..69314
                     /locus_tag="RPD_0057"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37297.1"
                     /translation="MMPLLLCPNDNGSMQTVQRSGVEFDICPTCRGVWLDRGELEKLL
                     AVSRSDDSGDAQAHAQPVRDAFNARPAPRSEGRREWDDDDDYGRKRRRSSIFDIFD"
     gene            69369..69836
                     /locus_tag="RPD_0058"
     CDS             69369..69836
                     /locus_tag="RPD_0058"
                     /codon_start=1
                     /transl_table=11
                     /product="Tellurite resistance protein-like"
                     /protein_id="ABE37298.1"
                     /translation="MPNRRSPGRPSERLLEDFGDEVQQAQNEHLMEGIVAGCALVAYA
                     DGWVTPEEHDRMLSLIRGFEPITAFGLDEVTATFEALTKRFATDQRDGEAAAFAAVAR
                     VKGAARYPALLVGVCCAIAAADGGFDAEERKAALRICEVLGLDPTEFDLADAP"
     gene            70113..70730
                     /locus_tag="RPD_0059"
     CDS             70113..70730
                     /locus_tag="RPD_0059"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37299.1"
                     /db_xref="InterPro:IPR002453"
                     /translation="MRDLDKALADIIAIRSQIAAGTAFRGYGPTALAATAGLALITAV
                     LQSLWLDEPDSHPLSFFSGWAATACLSGAIIWIEMRARSHRHHSGLADAMIHQAIEQF
                     LPAGVAGALLALTLWKFAPETLWMLPGLWQILVSLGIFASVRSLPRSVAFVGAWYFVA
                     GFAVLALASANHALSPWTMGLPFMVGQLLMAAFVHFASGEIDAEG"
     gene            70717..71097
                     /locus_tag="RPD_0060"
     CDS             70717..71097
                     /locus_tag="RPD_0060"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, ArsR family"
                     /protein_id="ABE37300.1"
                     /db_xref="InterPro:IPR001845"
                     /translation="MPKAEANNAPFSYDGLDRVIHEKARLGLLASLMAHPKGLAFADL
                     KKLCGLTDGNLSRHLQVLQEAGLVDVIKGYEGNRPHTFCRLTKTGRRRFLDYLAVLEQ
                     LVRDAAKAAGQDDAAPTRLGILPA"
     gene            71131..71868
                     /locus_tag="RPD_0061"
     CDS             71131..71868
                     /locus_tag="RPD_0061"
                     /EC_number="2.5.1.31"
                     /codon_start=1
                     /transl_table=11
                     /product="Undecaprenyl pyrophosphate synthetase"
                     /protein_id="ABE37301.1"
                     /db_xref="InterPro:IPR001441"
                     /translation="MQRTLLSKQNAAKLHVGIIMDGNGRWATRRGLSRLRGHEAGVEA
                     IRRVVEAAPRQGVGTLTLFAFSSDNWRRPKAEVAALMGLLRIYLANEVKSLVRNGVRL
                     TVIGRRDRLPDGIAAAIAAAEVDTTGGETLNLRIAVDYSARDAILNAAAHAREIGNCS
                     RETFSDLVTGDPRLRDVDLIIRTSGEKRLSDFLLWESAYAELHFTERMWPDFDEDDLA
                     DALASFHRRERRFGGLQPIDPNLALSV"
     gene            71985..73535
                     /locus_tag="RPD_0062"
     CDS             71985..73535
                     /locus_tag="RPD_0062"
                     /EC_number="1.14.13.81"
                     /codon_start=1
                     /transl_table=11
                     /product="Magnesium-protoporphyrin IX monomethyl ester
                     anaerobic oxidative cyclase"
                     /protein_id="ABE37302.1"
                     /db_xref="InterPro:IPR006158"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR011772"
                     /translation="MRILLINVPHPSIGSRIPDDHLPPLGLLAIGGPLIDDGHDVRLI
                     DGEFGPMSTSAIVEQAVAFLPDAVLFGHSGSTSGHPVIAEVAHDLANAIPGVHIVYGG
                     VFPTYHWRDIMADEPYVTAIVRGEGEETALRLMAALARGESLGDVPGIAYREADETRA
                     TKPATVIRDLDAYRIGWELIDHKRYSYWGGLRAVVVQFSRGCPHLCSYCGQRGFWTQW
                     RHRDPVLFAKELARLHREQGVKVINFADENPTVSKKIWRTFLEALIAEDVDLILVGST
                     RADDIVRDADILPLYKKAGWVRFLLGLESTDEKTLELIRKDAATTTDREAIRLMRQHG
                     ILSMATWVVGFEEETDRDHWRGLRQLLSYDPDQIQLLYVTPHRWTPYFNSVAGRRVIQ
                     TDRRRWDYKHQVLATRNMPPWRVLLWVKWTELVLQGRPKAIWRVLFHRDVRLREAMRW
                     YTRMGRRVWPYEIINFLLDRRLKNGPTVTQFWGASQDSEEQSMSSAGRGRPTGVKSRL
                     RKTRTVIE"
     gene            73673..74686
                     /locus_tag="RPD_0063"
     CDS             73673..74686
                     /locus_tag="RPD_0063"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37303.1"
                     /translation="MASRHFLKGLIKLSTREPWSDRFEQILEDHLILACDETGLEIDD
                     VVSTIGEDLFMSTVWACAFEDFLTREFDDGENAIDDYLKRRGWKESAAVVTYMAALRN
                     STMSLYEVSDLVPGASFRARDLIRGGEPVLISERSALQVYPGFHSTGATSWSWVAEGK
                     PAPARSGAGESSTKSLTFESWLDDGALVLGDIRLEDQSLVLRVNSRQRSDRGCALLSE
                     VLGPRVGAPSVKMESVEQMMASRGVAAPDQLDIPEQEQCAIIHRSMDRHYRDVLDQPV
                     AMLGGKTPRAAVKTKSGRTKVVDWLKMIENQSAKSADPSSPMANYDFGWLWAELGISE
                     LRR"
     gene            complement(75240..76196)
                     /locus_tag="RPD_0064"
     CDS             complement(75240..76196)
                     /locus_tag="RPD_0064"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AraC family"
                     /protein_id="ABE37304.1"
                     /db_xref="InterPro:IPR000005"
                     /translation="MRRRFDSNWRTALAEPKRVSAVDRASEQVGRPPRSAIRSWSQRK
                     IEVGYWSIDWPGVVQREMSLSTKAFCELSMVLTPVDDMTLLCGETTIRTGPLQSGRFR
                     VAPANTTLSASVSASSTVKFLKVFFAEETARAIGSAIHSHSIDIEMEDPMLGTDDPFL
                     VSLGREVVENINDPRPTSRAFAEEAAILMAGRVVSHYSTARYCTSMAVRSRGLDPDLD
                     RALQLMRDHICGTIDLGMLATSVDMPAFSFVRAFQKKYGLSPIRYHRHMRMEQAKTLL
                     STTAFPIGKISNMLGFSESSHFVSAFRKATGRTPLAYRRTRS"
     gene            76970..79036
                     /locus_tag="RPD_0065"
     CDS             76970..79036
                     /locus_tag="RPD_0065"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis sensory transducer"
                     /protein_id="ABE37305.1"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /translation="MTIKTTRSSEPRTSGLLDLFTNRKIGTKVAVGFVLIQVLMVVLA
                     VLNYFSFENVRQAFVALDQRVQVVGIVRDVDRGFTAFRRFVREYSLTGDEALIHEAES
                     RQNALRESIAQGLKEIHDPSRLAKMREISQTFEAYTTSFADVIRMRREQSTLIREVLD
                     PTGQKARLKLEQLQAATTAEVGGETTSLLVAEAVKQLLLLRIDVNKVLGRHDQAAADA
                     AEKALVDLRGAMSALKIAIGSSAGRKQIGEIEVDIKNYADAYQKASRVAHEVEVLVNG
                     AMPKVATVIADGAASIKQSGIADQQMIAKNTEALLDDTKSQILIITVGAVAIGLVLAW
                     LIGRAISRPIIRMSGAMKELAGGNLRVDVPGSGRLDEIGLMACTVEVFKRNALEVERL
                     KTEQEEAESRVAAEHKAEMHRLADNFEGAVGEIIQTVTSASTELEASAGSLTTTADRS
                     QQLATTVAAASEQASANVQSVASATEEMASSISEISRQVQTSARIAGEAVDQARKTND
                     RIGQLADAANRIGDVVDLINTIAGQTNLLALNATIEAARAGDAGRGFAVVAQEVKALA
                     EQTAKATGEISQQVSGMQAATQDSVGAIREIGGTIERMSEIASTIASAVEEQGAATQE
                     ISRNVQQAAQGTQQVSSNICDVQRGATETGSASTQVLAAVQSLSRDSNRLKDEVTRFV
                     ETVRAA"
     gene            79164..81395
                     /locus_tag="RPD_0066"
     CDS             79164..81395
                     /locus_tag="RPD_0066"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase/phosphodiesterase with GAF
                     sensor"
                     /protein_id="ABE37306.1"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="InterPro:IPR003018"
                     /translation="MISAPLPDNEQARLAALRRYDILDTPPEDCFDIFPRLVVRAIGV
                     PSAVISFVDRERQWFKARINVGDQQTPRDIAFCAHAILLERPLVVADATIDPRFHDNP
                     LVTAPGGMRFYAGAPIRTADGFPIGVLCAIDKVPRLLGKAQLETLRELASLVADQLEL
                     RLANRRLARELAERERTENHLLSMSRTLELSNLRLDAALNNFLHGLCMFDGDRKVVVS
                     NARFSEIYSLEPDEIECGVPLSAIQSVCRERGTFVETWSERRLGRSSHEISEVSSLLD
                     GRAILVRCQPVAGGGWMTVHEDITERYRSEQQIAHMARHDLLTGLLNRGAFHERMDEA
                     CARLRRWGETFSVIMLDLDRFKLVNDSLGHPAGDALLRAVVSRLKACIRETDVLARLG
                     GDEFAVLQTRTKDSYEEAVAFADRIVNCLIDPIEIEGHQLVISTSAGIALAPQHGTDS
                     DELIKNADLALYQAKAAGRNGYVTFETAMKDRANARQQLEGELRQAILHREFDLYYQP
                     QVDARSGRVIGAEALLRWRHPRRGFVPPSEFIPIAEETGLIEKLGEWVLTEATTEAIR
                     WPAPIKLAINLSPIQLTRGKLVDTVTQALRFSGLPPGRLEVEITETVFLEDEVNNLAV
                     IRQLRALGVSVALDDFGTGYSSLSYLTRFPFDQIKIDKFFSMNLIDRRDCAAIVSSVI
                     TLARGLGISTVAEGVETVRQFELLREAGVDYFQGYLFGHPVPASALDFGTAQAVARIT
                     EVA"
     gene            complement(81952..82028)
                     /locus_tag="RPD_R0001"
                     /note="tRNA-Arg5"
     tRNA            complement(81952..82028)
                     /locus_tag="RPD_R0001"
                     /product="tRNA-Arg"
     gene            complement(82163..83650)
                     /locus_tag="RPD_0067"
     CDS             complement(82163..83650)
                     /locus_tag="RPD_0067"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding region, ATPase-like"
                     /protein_id="ABE37307.1"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /translation="MQAADRQPETRVWRRGLEPKIGLSGKLLLLTIPLILIAEILIYV
                     PSIANFRLNRLNDRLAAASTAALVLDASASGTVPDTLARQVLDSIDARAVAIKMGQQR
                     RLLASSNVPTTIDYVVDMRNVTPWGAIIDAFVVMLESGNQTIRVMGPTEGNAQFIEVV
                     IDEAPLRIAMYRFSSNLLLVSLTITSLTTALIYLALHFLFVRPMRRLTANMVNFRRDP
                     ESPASIVVPGPRGDEIGLAERELSDMQRDLVSMLHQKSRLAALGLAVSKINHDLRNLL
                     ASSQLLSDQLSSVPDPRVQRFAPKLVRSLERAIAFCQSTLSYGRAQEAAPDRRVILIE
                     PVVNEVRETAGLASDTGVSSITWVSAIERGLTMDADPDQLFRVLLNLVRNAAQALEGQ
                     PRNEVALQQIRITGRREGSVTILEVSDTGPGVPQKARDHLFEAFHGSARAGGSGLGLA
                     IAAELVRAHGGDIKLVEGTLGATFRLSIPDRPVDLYSLRNERARA"
     gene            83786..84514
                     /locus_tag="RPD_0068"
     CDS             83786..84514
                     /locus_tag="RPD_0068"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease P protein component"
                     /protein_id="ABE37308.1"
                     /db_xref="InterPro:IPR000100"
                     /translation="MPNAGLARIGGPIRQKRRRAQLTRPGRSRISRANCPRWPGSTGA
                     VHFLGCLRLICEPHHRAYLNLLNNLPGLRRTTREADLSTEQIGAQAPSRLSCPSCHRW
                     WPKGAGGAPRPRTQASERLSGPSRDQIMDRLRQRADFIAVAGGLRISGPAFVLQGRRR
                     DDEGPVRVGFTVTKKIGTATERNRIRRRMRELVKRADRSFMLPNSDYVLVGRRAALSR
                     DFAVMLGDLRSALDRIARRSSKPD"
     gene            84531..86396
                     /locus_tag="RPD_0069"
     CDS             84531..86396
                     /locus_tag="RPD_0069"
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase subunit yidC"
                     /protein_id="ABE37309.1"
                     /db_xref="InterPro:IPR001708"
                     /translation="MTDNRNTILAVILSGLVLLGWQYFFNIPQMEKQRAAQQAQQQQE
                     AAKQQTPPAATTPGAPNAPAAPGAPGAPANQPAANAPVVSRDAAIAASPRIKVETPRL
                     DGTLSLKGARIDDLSLSQYHETVDPKSAPIHLFSPSGSANPYYAEFGWVGAAGSNVKL
                     PDQNTLWEQEGSGALTPANPVTLKWDNGEGLTFRRQIAVDDRYLFTIKDDVTNVGGGP
                     VTLYPFALISRHGTPHVEGFYILHEGLIGYLGEQGLQEYGYAKIDEAKTVGFKATNAW
                     MGITDKYWASALLPDTNAQLQARFSSNQVGATRTYQTDYLEDAKTVPIGGTATATARL
                     FAGAKEARVVGINFPFAGLGGYNQQLGLNHFDLLIDWGWFYFITKPMFLALDFFFHLV
                     GNFGVAILLVTVLVKLIFLPLANKSYASMAKMKAIQPQLLALKERHPDDKAKQQQEMM
                     EIYRKEKINPVAGCLPVLLQIPVFFSLYKVLFVTIEMRHAPFFGWIHDLSAADPTNLF
                     NLFGLIPYDPSTLPVIGSYLVLGVWPLVMGFTMWFQMKLNPQPPDPTQQMIFAWMPVI
                     FTFMLAHFPAGLVIYWAWNNTLSVIQQAYIMRRNGVKVELWDNLKSAVVKPKKTA"
     gene            86689..87342
                     /locus_tag="RPD_0070"
     CDS             86689..87342
                     /locus_tag="RPD_0070"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding"
                     /protein_id="ABE37310.1"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR005289"
                     /db_xref="InterPro:IPR006073"
                     /translation="MTDAINPTLIERGRKVFAGDWHFIWASPSIETLPPMAGIEVAFA
                     GRSNVGKSSLINALTGRNALARTSNTPGRTQELIFFDGPTDAGLRLVDMPGYGYAAAS
                     KAKVASWTSLIHKFLQGRATLARVYVLIDGRHGLKDVDLDILKTLDKSAVSYQIVFTK
                     ADQVKAAELEQRIAATKTVLAKHPAAFPELLMTSSRTGAGMPELRAAMIRLLDERGA"
     gene            87339..87707
                     /locus_tag="RPD_0071"
     CDS             87339..87707
                     /locus_tag="RPD_0071"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF423"
                     /protein_id="ABE37311.1"
                     /db_xref="InterPro:IPR006696"
                     /translation="MTPLLRVLIVCAGIAGAAGVALAAAAAHVPDASRLGPASSMLLF
                     HASAILAAVLLCERGGVHRIPGLAAGCGFVIGAALFAGDLSLRQFSGHALFPMAAPTG
                     GVLLIGSWLLLAVAGLWPRR"
     gene            87857..88816
                     /locus_tag="RPD_0072"
     CDS             87857..88816
                     /locus_tag="RPD_0072"
                     /EC_number="2.7.2.8"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglutamate kinase"
                     /protein_id="ABE37312.1"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR004662"
                     /translation="MLAVLPANRSENPTTQRKTRFMTDAPVISPIDQARILSEALPHM
                     QRYDEETIVIKYGGHAMGAENDAKAFARDIVLLEQTAVNPVVVHGGGPQIATMLKRLG
                     IKSEFAAGLRITDGATIEIVEMVLAGSINKQLVGYINEAGGKAVGLCGKDGNMVTASK
                     ATRTMVDPDSRIEEVVDLGFVGEPEKVDLTLLNQLIGHELIPVLAPLATSATGQTFNV
                     NADTFAGAVAGALKAKRLLLLTDVPGVLDKSKQLIPELSIKDARKLIADGTISGGMIP
                     KVETCIYALEQGVEGVVILDGKVPHAVLLELFTNQGTGTLIHK"
     gene            88816..89970
                     /locus_tag="RPD_0073"
     CDS             88816..89970
                     /locus_tag="RPD_0073"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidoglycan-binding domain 1"
                     /protein_id="ABE37313.1"
                     /db_xref="InterPro:IPR002477"
                     /translation="MTGAKATSSCPGRGAARSAAPQTRDPGSAEPHKPGPRIISAPRR
                     EGRRAALHPGHACLFVATLLASLAGNTAAHADLKLCNRMSYVIETAIGIDDKATTATR
                     GWLRIDPAQCRVVLQGALSADRVMLHARALAVYGASPIPQNGTDRLCITPENFVIAAA
                     RQCRSGQTLAPFTEIKPTQQDDGNMVAYLAEDSEYDDEQARLAAIQRLLVIAGYDAAP
                     IDGVDGPKTQAALAAFLKSRGLKPDIVSAPDFFDTMIKAVESPSATGLTWCNDTRSRI
                     MAAIAEDDGKTITSRGWYRIEPGKCLRPDLSALPKRVFSFAEAVDGNARPITLKDKPL
                     NWGGATLLCTRESKFEISEQGDCSARGLNATGFAPVDLSGGGKTVRFATP"
     gene            89967..90668
                     /locus_tag="RPD_0074"
     CDS             89967..90668
                     /locus_tag="RPD_0074"
                     /codon_start=1
                     /transl_table=11
                     /product="Pyrimidine 5-nucleotidase"
                     /protein_id="ABE37314.1"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006402"
                     /db_xref="InterPro:IPR010237"
                     /translation="MTELSKRGFGHVDTWVFDLDNTLYPHHVNLWQQVDGRIRDFVAD
                     WLKVTPEEAFRIQKDYYKRYGTTMRGMMSEHGVSADDYLAYVHAIDHSPLEPNPAMGA
                     AIAQLPGRKLILTNGSTDHAGKVLERLGIGHHFEAVFDIVAAELEPKPAAQTYHRFLT
                     LHGVDPARAAMFEDLARNLAVPHQLGMTTVLVVPDGSKDVVREDWELEGRDAAHVDYV
                     TEDLTGFLAGLNEAV"
     gene            90762..91607
                     /locus_tag="RPD_0075"
     CDS             90762..91607
                     /locus_tag="RPD_0075"
                     /EC_number="2.3.1.117"
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
                     N-succinyltransferase"
                     /protein_id="ABE37315.1"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005664"
                     /translation="MSLSALENTINTAFDARDTISAATKGEVRDAVDQALDLLDRGEA
                     RVAERDASGTWTVNQWLKKAVLLSFRLNDMHTIAGGPGGATWWDKVPSKFEGWGESRF
                     REAGFRAVPGAIVRRSAFIAKNAVLMPSFVNLGAYVDEATMVDTWSTVGSCAQIGKRV
                     HISGGVGIGGVLEPLQAGPVIIEDDCFIGARSEVAEGVIVRRGAVLAMGVFLGASTKI
                     VDRETGEVFIGEVPEYAVLVPGALPGKPLKNGTPGPSTACAVIVKRVDERTRSKTSIN
                     ELLRD"
     gene            91810..92097
                     /locus_tag="RPD_0076"
     CDS             91810..92097
                     /locus_tag="RPD_0076"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37316.1"
                     /translation="MELLMAEFRRIIIKTAEVMMVLLVIITILATAGLGAISGSETSG
                     ALAVAGFVLGGVGGLIVSSIFASSFFLILEIAENTRQVLRYYEPKVDGASR"
     gene            92115..93281
                     /locus_tag="RPD_0077"
     CDS             92115..93281
                     /locus_tag="RPD_0077"
                     /EC_number="3.5.1.18"
                     /codon_start=1
                     /transl_table=11
                     /product="succinyldiaminopimelate desuccinylase"
                     /protein_id="ABE37317.1"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR005941"
                     /db_xref="InterPro:IPR011650"
                     /translation="MTSSRDALSIAQALLRCPSVTPADAGALGVLETLLKDAGFTAHR
                     VTFSEPGAADIDNLYARIGDGAPHLCFAGHTDVVPPGDADAWSHGAFSGDVEGGLLYG
                     RGAVDMKGGIACAVAAVLDHLAAHGGRPKGSISFLITGDEEDVAVNGTVKLLQWAADR
                     GETFDHCIVGEPSNVEAIGDTIKIGRRGSQSGMLIVDGLQGHVAYPHRASNPIPDIAA
                     LITALNDEPLDQGSAQFQPSNLEFTSVDVGNPATNVIPAQARAKFNIRFNDHHTQDSL
                     KALIEQRLAAACGNRIRARIEWLPSNADVFVTKPGNFTDLVTASIADVTGRTPDLNTG
                     GGTSDARFIAKYCPVVEFGLVGQTMHQIDERTPVADLDQLTAIYRGVLERYFKS"
     gene            complement(93536..94498)
                     /locus_tag="RPD_0078"
     CDS             complement(93536..94498)
                     /locus_tag="RPD_0078"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family"
                     /protein_id="ABE37318.1"
                     /db_xref="InterPro:IPR002559"
                     /translation="MAQDSFIEALLPAGFGRNERLERISGLIDWDRLAVLIRKVRPGE
                     TGRPPYAPLAMFKALLLQQWYGLSDPGLEEALLDRVSFRRFCGFALDAQTPDETTLCR
                     FRNALQQAGLGDALFQEVLRQLEAAGYVLKTGTLIDATLVQSSGRTPPSGSTPREVES
                     RSSHDPQADWTRHGAGRRLFFGYKAHIAIDQGSGLIRARKLTGAKTYESEVADDLVLG
                     DEKAVYADKAYEKRARRQALKARGIKDRIQHRRNKHQKALPRWQAVRNKLIGRVRQAI
                     ERTFAQLKGRYGFTRMRYAGITANAFHLDLISIAYNLRTAAAIR"
     gene            complement(94698..95435)
                     /locus_tag="RPD_0079"
     CDS             complement(94698..95435)
                     /locus_tag="RPD_0079"
                     /EC_number="4.2.1.70"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="ABE37319.1"
                     /db_xref="InterPro:IPR001406"
                     /translation="MPRYKLTIEYDGAPFCGWQLQPVLPSVQGALEAAALATCGEAVR
                     VHGAGRTDAGVHALGQVAHLDIAKPFRADRLRDALNAHVRPYPVAVLSTEIVPDSFEA
                     RFSAIRRHYRYRIVNRRSNLALEIGKVWRVPKPLDTDAMHRAAQVLIGKHDFTTFRDT
                     ECQAASPEKTLDVLDVVRSGDCVDIITSARSYLHSQVRSMVGSLVWVGEGRWSADDLA
                     AALAARRRSACGPVAPPDGLYLVKVDY"
     gene            complement(95609..96541)
                     /locus_tag="RPD_0080"
     CDS             complement(95609..96541)
                     /locus_tag="RPD_0080"
                     /EC_number="2.1.2.9"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="ABE37320.1"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR005793"
                     /db_xref="InterPro:IPR005794"
                     /translation="MPLRLVFMGTPDFAVPTLLALSAYGHDIAAVYSREPKPAGRGMK
                     LQHSPVAQEAQRFGIPVLTPKTLKTDEALAEFRSHDADAAVVVAYGMILPQAILDAPR
                     LGCYNLHGSLLPRWRGAAPLNRAIMAGDAESGVMVMKMDAGLDTGDVAMAERIAITDA
                     MTVTDLHDSLARLGADLMVRAMAALERDQLQLTRQSEHGVTYAAKIDKAEAKIDFARP
                     AQAVLRHIHGLSPFPGAWCELPIDGEAVRVKILRCASATGGGAPGQVLDDRLTIACQD
                     GAIRVLQLQRAGKQPMQADEFLRGTPIAAGAVIV"
     gene            complement(96621..97148)
                     /locus_tag="RPD_0081"
     CDS             complement(96621..97148)
                     /locus_tag="RPD_0081"
                     /EC_number="3.5.1.88"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="ABE37321.1"
                     /db_xref="InterPro:IPR000181"
                     /translation="MALREIIILPDKRLREISKPVAEVTPEIRKLADDMFESMYDAPG
                     IGLAAIQIAEPVRLITMDIVRKEGNGKSDPRAFINPEIVGASAEMNVYEEGCLSIPEY
                     YADVERPAVVRIRYTDLDGNVKEEDADGLFATCIQHEIDHLDGVLFVDHLSKLKRAMV
                     VRKFEKAAKRGIKYV"
     gene            97298..98515
                     /locus_tag="RPD_0082"
     CDS             97298..98515
                     /locus_tag="RPD_0082"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF195"
                     /protein_id="ABE37322.1"
                     /db_xref="InterPro:IPR003798"
                     /translation="MNETLFYLGDAPVSIGAALFGASAMALLLLLAIVLVIAHGLQSG
                     SAAALAQARRASDLEQRLSGLIRFQSEANGRVDAMGRALAGRQAEMARAVSERLDTVT
                     HRVGQSMTQSTRHTMESLQALHERLGIIDRAHDNLTELTDQVTSLRDVLANKQARGAF
                     GQARMESIVQDGMPKGAYAFQYTLSTGKRPDCVVFLPDQRPLCIDAKFPLEAVTALRE
                     SRSDGEKKAASQRLRLDVMRHVDDIAAKYLIPGETQDTALMFVPSESVYAEIHDGFDD
                     VIQRAYRARIVLVSPSLLMLAIQVMQQILKDARMRDAADQIRTEVLSLGDDLARLRER
                     VTKLQTHFGQVNDDVRQILISADKIERRAVRIEELDFSAVEPSTGTQAPLAPEARDLF
                     ASRAFKIDEVASD"
     gene            98724..100097
                     /locus_tag="RPD_0083"
     CDS             98724..100097
                     /locus_tag="RPD_0083"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily MFS_1"
                     /protein_id="ABE37323.1"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /translation="MTAPDASSNPEPLPPVAPASTWREAMTVYLQPRVLIVLFLGFSS
                     GLPLALSGSTLLVWMRESGVDLGTIGLFALVGTPYTLKFIWAPLVDALHVPLLSRLFG
                     RRRGWLVISQLLLIGAILLLALTDPAHAPLFVAIGALLVAAASATQDIVVDAFRVESL
                     PENEQAAGMASYVAAYRIGMLISTAGVLFLVSAYEGIGLARSTAWMWGYVTMAGMVLI
                     GTVTALLATEPEQSRRAEAATSGESAFTRVTRAAIGAFSEFLGRTDALAVLAFVVLFK
                     FTDAFSGTMTAPFVIDLGFSRNDYAAIVKGVGLAATLVGGFAGGYLARRYTLTTSLWI
                     GAVLQALSNLAFAWLATVGVNQWALALAISVENFTGAIGTVIFVAYLSALCQNPLHTA
                     TQYALLTALSAVGRTYLSAGAGYVAQATGWPAFFMISVAVAAPSLVLLIWLQRRDHFA
                     ALGPVKV"
     gene            complement(100126..100554)
                     /locus_tag="RPD_0084"
     CDS             complement(100126..100554)
                     /locus_tag="RPD_0084"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37324.1"
                     /translation="MTDLILKPSMIFAAVLSLSAAPAYAQGTESRAALPKPMAMQVGD
                     VLNGELTAMRSRANGKGKKIPVYQLTSEPRRLPPPAGLCNLENGPETFQIVPAGDAQA
                     AQLKSHLGKQIALKVEAVACAEEAGQYSEAVVTKWSMVAK"
     gene            complement(100574..101179)
                     /locus_tag="RPD_0085"
     CDS             complement(100574..101179)
                     /locus_tag="RPD_0085"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecR"
                     /protein_id="ABE37325.1"
                     /db_xref="InterPro:IPR000093"
                     /db_xref="InterPro:IPR006154"
                     /db_xref="InterPro:IPR006171"
                     /translation="MATAVAGPEIERLIQLLARLPGLGPRSARRAALHLIKKRDALMT
                     PLASALQVAIDKIEVCKSCGNIDTRNPCTVCTDPRRDPSIIVVVADVADLWALERASA
                     TNGRYHVLGATLSPLDGVGPDDLTIDALVARAHDPAVSEIILALNATVDGQTTAHYVT
                     DLLQEAGVKVTRLAHGVPVGGELDYLDEGTLSAAMRQRTLF"
     gene            complement(101293..101613)
                     /locus_tag="RPD_0086"
     CDS             complement(101293..101613)
                     /locus_tag="RPD_0086"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein 103"
                     /protein_id="ABE37326.1"
                     /db_xref="InterPro:IPR004401"
                     /translation="MADFLGMMKQAAQLQSKMKAMQAELDQIEVEGSSGGGLVQVRMS
                     AKMEVRGVSIDPSLLKPDEGGVLEDLLVAAHADAHRKAEAAMQEKMQALTGGLGLPPG
                     LGLG"
     gene            complement(101648..103522)
                     /locus_tag="RPD_0087"
     CDS             complement(101648..103522)
                     /locus_tag="RPD_0087"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, subunits gamma and tau"
                     /protein_id="ABE37327.1"
                     /db_xref="InterPro:IPR000862"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR012763"
                     /translation="MTDSGPPAIPSGDSEQTGLGLGAAPAGAYRVLARKYRPNSFEDL
                     IGQEAVVRTVSNAFDTGRIPQAWILTGVRGVGKTTTARILARALNYEMPDGSVKGPTI
                     HMPVHGVHCKAIMESRHMDVLEMDAASHTGVDDVRQINDSVRYAPASARYKVYIIDEV
                     HMLSTAAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVEADVLMKH
                     LAGIAAKEGVEVEPEALGIIARAAEGSVRDSLSLFDQAIAHAAGLVRADQVRQMLGLA
                     DRTRVIELFDALARGDIASAFQEFRDQYDTGADPVVVLSDLAEFVNFVTRVKIVPATA
                     DNVAFGETERLRGRDFAAKLSMRVLSRMWQMLLKGIAEVQGATRPAAAAEMVLVRIAY
                     AADLPTPDEALRMLAQDGGSATPLPSGGGAAPRGASSPPVSAASVASAYAAPAAAAMP
                     PRSAPTMARGGADSMARPQISAPAAAPQQDAALKITTFPQLVALASEKRDVMTRMALE
                     ADVRLVRIDDGRLELALERTASRSLINDLGRKLEQWTGRRWTVIVSNEPGQPTLRSQS
                     EAQKNERERAAESDPRVREVLAKFPGAKFEVRRLATDLAEADAGIEDPAEPVDDDDES
                     "
     gene            complement(103759..103861)
                     /gene="ffs"
                     /locus_tag="RPD_R0002"
     misc_RNA        complement(103759..103861)
                     /gene="ffs"
                     /locus_tag="RPD_R0002"
                     /product="SRP RNA; RNA component of signal recognition
                     particle"
     gene            103996..104481
                     /locus_tag="RPD_0088"
     CDS             103996..104481
                     /locus_tag="RPD_0088"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine triad (HIT) protein"
                     /protein_id="ABE37328.1"
                     /db_xref="InterPro:IPR001310"
                     /translation="MDVSGSVPATTQEPACQRADGIDMPSDWSLSSQLEKDTINIGDL
                     PLSRVLVIKDAHYPWLLLVPRRADAVEIIDLDEVEQAQLMTEISRVGRALKEITKCDK
                     LNIAALGNMVPQLHVHIIARRSSDAAWPRPVWGVMPPLPHDPEEVQQFISALRRKIWL
                     G"
     gene            104486..105418
                     /locus_tag="RPD_0089"
     CDS             104486..105418
                     /locus_tag="RPD_0089"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="ABE37329.1"
                     /db_xref="InterPro:IPR000086"
                     /translation="MSSAFPLGQPAFVSNILDRAAHLRADDARLMAMEDRSDTRAYVV
                     HRDSLVVKHEDGGPRALLSIKEALALGANPGTIFLGLRDGAAVFGMGIGAAAIETLVT
                     RSDAGIAELRGMAMQGMLPEEQLSAIAMAKSMVNWHQRHGYCANCGQRTAMAQGGWKR
                     DCPACKAEHFPRTDPVVIMLVTSGDKCLLGRQKQFPVGMYSCLAGFVEAAETIEDAVC
                     REILEESGIRCADVRYYMTQPWPYPSSLMIGCTAIATTEDITIDFTELEDARWFSRDE
                     AAQMLNRQHPDGLVGPHPFAIAHHLVGRWLEQDT"
     gene            105415..106344
                     /locus_tag="RPD_0090"
     CDS             105415..106344
                     /locus_tag="RPD_0090"
                     /codon_start=1
                     /transl_table=11
                     /product="PfkB"
                     /protein_id="ABE37330.1"
                     /db_xref="InterPro:IPR002139"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /translation="MTDKAKRKPRILCIGIPVRDLTFRVEAVPGRGNKVPASAYKEIA
                     GGNALNAGIGIARLGGAATMCGPMGDAGETAATFMFDKLGEEGIATDRLIHMPGLVTP
                     ISAVLVDPTGERTIVTFRDPKLWNVGLPSAETLLADCDAIMIESRCAGFATALCAEAI
                     RRGIPVVVDIDSAMSLNEGLLTASSHLIFSAEALHATAGINDDAEALKKIATLTHAFV
                     AVTRGPKGTLWLDADQNFQETPAFPVHSVDTLGAGDIFHGGFAVAFSEGQDIPSALRF
                     ASAAAALKCTRPGGAFACPDRAEVEAFLAAQPR"
     gene            complement(106399..107100)
                     /locus_tag="RPD_0091"
     CDS             complement(106399..107100)
                     /locus_tag="RPD_0091"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37331.1"
                     /translation="MTLAARKDLRLSSQIIDPAILYFGTPVVLIGSCNDDDSFNLAPM
                     SSAWWVGQRCMLGLASNSKTTGNILRSGECVLNLPSSDLVGAVDRLARTTGSDPVPQG
                     KLHRGYRFEADKFGVSRLTSQKGDAVAAPRALECPVQIEARLMQAHPMAEEDVVWRGH
                     LVALELSVVRIHVHPSIMMDGQDDRIDPDKWRPLIMSFQQYYGLALGRLQHSVLGEIP
                     EAYYRPPSRPSQPAG"
     gene            complement(107176..107604)
                     /locus_tag="RPD_0092"
     CDS             complement(107176..107604)
                     /locus_tag="RPD_0092"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF985"
                     /protein_id="ABE37332.1"
                     /db_xref="InterPro:IPR009327"
                     /translation="MPSAAEMIARLKLQPHPEGGHFRETFRDPRCDASGRSFSTAIYF
                     LLASGERSHWHRIDAIEVWHYYAGAALALEIADADGHRAIRLGPDVAAGEQPQAIVPP
                     HAWQAAVTTGDWTLVGCTVAPGFAFEHFELAPPDWSPLRR"
     gene            complement(107613..108380)
                     /locus_tag="RPD_0093"
     CDS             complement(107613..108380)
                     /locus_tag="RPD_0093"
                     /EC_number="3.1.2.6"
                     /codon_start=1
                     /transl_table=11
                     /product="Hydroxyacylglutathione hydrolase"
                     /protein_id="ABE37333.1"
                     /db_xref="InterPro:IPR001279"
                     /translation="MAADIRIVPCLTDNFGYLIHDPSSGATASIDAPEAAPLIAALEK
                     EGWKLTDILVTHHHGDHVGGVAELKKKYQCRVVAPHDANAKIADIDLRVEEGDVVRVG
                     GLSARVLETPGHTLDHISYVFDDDRALFAADTLFSIGCGRVFEGTYPMMWESLLKLRE
                     LPDDFKLYCGHEYTASNVKFALTIEPDNAALQARAKQVEQQRAAGQPTIPVTLGEEKQ
                     ANLFLRADVPSVAAAVGLPGESAADVFGELRERKNNS"
     gene            108557..109321
                     /locus_tag="RPD_0094"
     CDS             108557..109321
                     /locus_tag="RPD_0094"
                     /codon_start=1
                     /transl_table=11
                     /product="Methyltransferase type 11"
                     /protein_id="ABE37334.1"
                     /db_xref="InterPro:IPR013216"
                     /translation="MTIDVVNLRDFYSNRLGLVARRLINRGIQTRWPDARGQRVLGLG
                     YPTPYLGLFRDDCERCIAFMPAAQGVLKWPTARATLSTLVEERALPLPDAAVDRILLV
                     HSLEMSEDPDALLREVWRVLAPSGRLLAVVPNRRGVWARSDNTPFGHGRPYSRSQISD
                     LLRRTWFTPVGWSEALFMPPLEQSWLLRSAPAWERVGAAASLPFAGVHVVEATKQVVR
                     PIQAKRERTRLIPALGPSLVPSPMQADDADLPARPR"
     gene            complement(109382..110107)
                     /locus_tag="RPD_0095"
     CDS             complement(109382..110107)
                     /locus_tag="RPD_0095"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37335.1"
                     /translation="MRNGQNNKRLRNRNSGSNNNNNNNNNRRGQNPMTRVFESNGPDI
                     KIRGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQNQPQQQ
                     QRVDNDMSDNDDEGEADYSNFGAEPGLVPVQQQPYQPREQPRAEQPQFAPREQPQPRE
                     HRPQPQFTPRAEQPQPSVEAVDRLPSFITGPQPQISPAAFEGAGGAERFPPRRRRRPH
                     VPRGEGAAAAAPVPAEDATPGNE"
     gene            complement(110600..111478)
                     /locus_tag="RPD_0096"
     CDS             complement(110600..111478)
                     /locus_tag="RPD_0096"
                     /codon_start=1
                     /transl_table=11
                     /product="modification methylase, HemK family"
                     /protein_id="ABE37336.1"
                     /db_xref="InterPro:IPR000051"
                     /db_xref="InterPro:IPR001091"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR002296"
                     /db_xref="InterPro:IPR004556"
                     /db_xref="InterPro:IPR007848"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /translation="MTESPAAKTIAAARRAIGRRLKDAGIESAELDARLLIGEVTGLD
                     LTGLIVQAERLLAPDQAELLDGFVARRLAGEPVARILGAREFWGLPLTLSADTLVPRP
                     DTETVVEVALEYLRAEAPARPLILDIGAGSGAILLALLSECPAAFGVATDISLGALRA
                     AQSNAIRLGLSNRAGFAVCDYASALIGPFDLIVSNPPYIPARDIAALDREVRDHDPRR
                     ALDGGDDGLDAYRRIVPESMRLLRPGGALVVEFGQGQSDEVAALMRAAGLTVSGPPRR
                     DLGGIFRALMGRNLIG"
     gene            complement(111521..112606)
                     /locus_tag="RPD_0097"
     CDS             complement(111521..112606)
                     /locus_tag="RPD_0097"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterial peptide chain release factor 1
                     (bRF-1)"
                     /protein_id="ABE37337.1"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR004373"
                     /db_xref="InterPro:IPR005139"
                     /translation="MSKLPEAKLDVLLAHHASLEAQLLGEVGASEYVRITRELSELNP
                     LVEAVKAYREVRDELGDVDALLEDPDTDSEMRAMAEAERDALDAHRAELIQEIRVALL
                     PKDAMDERNVMLEIRAGTGGDEASLFAGDLFRMYEKFAALQGWSVEVISASEGSMGGF
                     KEIIAEVKGRGAFAKLKFESGVHRVQRVPDTETQGRIHTSAATVAVLPEVEEVDVDIK
                     ADDLKIDTMRAQGAGGQHVNKTESAIRITHLPTGIVVMMQDSRSQHKNRASAMNILRS
                     RIYDAEQQRLDAARSAERKEKVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLPQVIA
                     GEALGELIDALTTEHQAAQLAAQGHAA"
     gene            complement(112658..114925)
                     /locus_tag="RPD_0098"
     CDS             complement(112658..114925)
                     /locus_tag="RPD_0098"
                     /codon_start=1
                     /transl_table=11
                     /product="PTSINtr with GAF domain, PtsP"
                     /protein_id="ABE37338.1"
                     /db_xref="InterPro:IPR000121"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR006318"
                     /db_xref="InterPro:IPR008279"
                     /db_xref="InterPro:IPR008731"
                     /translation="MRSTSGGPRVLLRRLRETMAEQVSAQERLDKIVVLIAANMVAEV
                     CSTYVLRVDNTLELYATEGLNREAVHQTVLNAHEGLVGLVASEATPLNLSDAQSHPAF
                     SFRPETGEEIYHSFLGVPILRAGNTLGVLVVQNRAKRTYVEEEVEALQTTAMVLAEMI
                     ASGELSALAQPGAEPAARHSIHKTGAILSDGIALGHVVLHEPRVVITNYIAEDLPKEI
                     KRLDAALAKLRADLDRLLERGDVADGGEHREVLEAYRMFANDHGWSHRLHEAVATGLT
                     AEAAVERVQSDTRARMLRSTDPYLRDRLHDLEDLGHRLMRQLVGQNHAPSREQLPDNA
                     ILIARSMGPAALLDYDRTRLRGLVLEEGTANSHVSIVARALGIAAVGEVPNAPGIADP
                     GDAIIVDATSGSIYVRPSAEVEAAYGERVRFRARRQAQYSALRDLACVTKDGQPIDLM
                     INAGLAIDLPHIDDTGSSGIGLFRTELQFMIGQSLPRSSDQLALYRTVLDAAGSKPVT
                     FRTLDIGGDKALPYMETVVEENPALGWRAIRLGLDRPGLLRSQIRALLRAGGGRSLRI
                     MFPMISEVAEFDAAKAIVERELTYLRQHGHTLPERVDVGTMVEVPALLYQLDELLKKV
                     DFISVGSNDLFQFLYAVDRGNSKVSDRFDTLSTPILRALRHIVRKAKAANRSVSLCGE
                     MASQPLSALALIAIGYRALSVSAVSHGPIKAMILEVDAAKAEAAILPLLDAPAGSVSI
                     RHKLAEFAEAHGLSL"
     gene            complement(115231..116484)
                     /locus_tag="RPD_0099"
     CDS             complement(115231..116484)
                     /locus_tag="RPD_0099"
                     /EC_number="2.7.2.4"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate kinase"
                     /protein_id="ABE37339.1"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR001341"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR005260"
                     /translation="MGRLVMKFGGTSVANIERIQNVARHVKREVDAGHEVAVVVSAMS
                     GKTNELVAWCREASPMHDAREYDAVVASGEQVTSGLLAIALQAVGIQARSWQGWQLPI
                     STSDAHASARITDIDGSEIIKRFGDRKEVAVIAGFQGINPETGRITTLGRGGSDTSAV
                     AIAAALKADRCDIYTDVDGVYTTDPRVVPKAKRLDKVAFEEMLELASQGAKVLQVRSV
                     ELGMVHNMPIFVRSSFDKPEDIDPHGTPPGTLICSEEIIMENHVVTGIAFSKDEAQIS
                     VRRIEDKPGVAASIFGPLADANINVDMIVQNVSEDGKTTDLTFTVPAADFARAKQTIT
                     SAQEEIGYARFDSETDVAKVSVIGSGMRSHAGVAAQAFAALAARNINIRAITTSEIKF
                     SVLIDAAYTELAVRTLHTLYGLDQV"
     gene            116843..117604
                     /locus_tag="RPD_0100"
     CDS             116843..117604
                     /locus_tag="RPD_0100"
                     /EC_number="2.1.1.64"
                     /codon_start=1
                     /transl_table=11
                     /product="3-demethylubiquinone-9 3-methyltransferase"
                     /protein_id="ABE37340.1"
                     /db_xref="InterPro:IPR000051"
                     /db_xref="InterPro:IPR001601"
                     /db_xref="InterPro:IPR003333"
                     /db_xref="InterPro:IPR010233"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /translation="MALQSESTGPVSPSVDPAEIAKFSRLSAEWWDPTGKMAPLHRIN
                     PLRISFIRDAACRKFERNAKSLSCLSGLRMLDIGCGAGLLCEPFTRLGAQVIGIDPSA
                     TNIAAAKLHADKSHLAIDYRCTTVEEIDPRERFDIVMAMEVIEHVNDVPAFLGRCAAL
                     MKPTGIMLVATLNRNWKSFALAIVGAEYVMRWLPRGTHQWDKFVTPDELEQHLQGLGL
                     VVTEQSGLVFNPLADRWRLSPDMDVNYMVVAETAP"
     gene            complement(117713..118528)
                     /locus_tag="RPD_0101"
     CDS             complement(117713..118528)
                     /locus_tag="RPD_0101"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37341.1"
                     /translation="MLRCLAAFTALCAALMSPASAEDGFRGSECLAMAQAPPRVMPAS
                     LRRLAAADQVLITYRGHSTYTIESPGGVMIATDYSGTYDTGRAPDVVTMNRAHATHYT
                     LSPDRNIAHVLHGWGEDGQPARVRLQFGDVLIRNVTTDIRRTIFGDGAGGMIKDGNSI
                     FIFEVAGLCIGHLGHLHTMLDDSHFAAIGRIDILMVPIDGSYTMSLDGISEITKRLRA
                     SVVLPMHRFMTPLDEFMQRIGKSFAIDQRGERSLRISRDTLPSAPTVIILRGV"
     gene            118681..119580
                     /locus_tag="RPD_0102"
     CDS             118681..119580
                     /locus_tag="RPD_0102"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF6, transmembrane"
                     /protein_id="ABE37342.1"
                     /db_xref="InterPro:IPR000620"
                     /translation="MLSLASLWIPFTLVAAIGQVARNAMQRSLTGPLGTWGATNIRFL
                     FGFPFSIVFFVVVIVATGDTVAWPGLAFWPWLLLGALSQIAATGLMLAAMNERSFVVT
                     TAYLKTEAIQTAIFGFVFLGDHLGVLKVVAILIATIGVVITALRPGAARNLASLRPTL
                     LGLTAAAAFALSAVGFRGAIIVVPGVSFVTAATLTLVFALGVQTLVLTIYLLARAPQV
                     LRDILQLWKPSMLAGFTGALASQFWFLAFALTAAANVRTLALVEVLFAQAVAYYSFKQ
                     PLSGRELGGIALIVLGVALLVAA"
     gene            complement(119581..120015)
                     /locus_tag="RPD_0103"
     CDS             complement(119581..120015)
                     /locus_tag="RPD_0103"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF6, transmembrane"
                     /protein_id="ABE37343.1"
                     /db_xref="InterPro:IPR000620"
                     /translation="MSATIWPWQVWALLSAVFAALTAIFAKVGVADINSDLATFIRTV
                     VVLVALAMVLSATGQFSVSGTITAKTWLFLVLSGLCTGASWLCYFRALTLGPASLVAP
                     IDKLSVVLVALFAFAFLGERPSGVHWLGIALIAAGAVIIAVK"
     gene            complement(120224..120727)
                     /locus_tag="RPD_0104"
     CDS             complement(120224..120727)
                     /locus_tag="RPD_0104"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF1178"
                     /protein_id="ABE37344.1"
                     /db_xref="InterPro:IPR009562"
                     /translation="MIRYNLRCECGHSFESWFQSSSAYDSQVRRKLVNCPACDSVKVE
                     KAIMAPQIVGKKGRGRAPEPAHEVAAGTAVAPQAAESPVAESATPLLLAQERELRTKL
                     KELRDYIVKTADNVGDSFPNEARKMHYGDIEHRPIFGEASPAEAKALIDEGIEVAPLP
                     VLPEDRN"
     gene            complement(120724..121599)
                     /locus_tag="RPD_0105"
     CDS             complement(120724..121599)
                     /locus_tag="RPD_0105"
                     /codon_start=1
                     /transl_table=11
                     /product="Nitrilase/cyanide hydratase and apolipoprotein
                     N-acyltransferase"
                     /protein_id="ABE37345.1"
                     /db_xref="InterPro:IPR001110"
                     /db_xref="InterPro:IPR003010"
                     /translation="MTEVPFNAAMVQMRTGLLPGPSLEQATKLIREAAAAGADYVLTP
                     EVSNMMQLNREALFEHLADEADDASLKAYRDLARELNIHLHIGSLALRATPDRAVNRS
                     FLIDPSGAVLASYDKIHMFDIDLGNGESYRESTNYQPGESAVISDLPWGRIGLTICYD
                     VRFPALYRALAEAGASFLTVPSAFTRPTGEAHWHVLLRARAIENGCFVFAAAQCGLHE
                     NRRETYGHSLIVDPWGVVLAEGGVDPGFVMARIDPAAVAKARGKVPSLQHGRRFTVVD
                     AKHSPEHLHLVRGQT"
     gene            complement(121596..121886)
                     /locus_tag="RPD_0106"
     CDS             complement(121596..121886)
                     /locus_tag="RPD_0106"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutaredoxin, GrxC"
                     /protein_id="ABE37346.1"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR011900"
                     /translation="MSAAIEIFTRPGCGYCGAAKSLLNRKKAAFTEYDVSVDPGFRVK
                     MDERAGPGATYPQIFIGSFHVGGCDDLYALDREGKLDALLAGELAAGEKAIS"
     gene            complement(121938..122756)
                     /locus_tag="RPD_0107"
     CDS             complement(121938..122756)
                     /locus_tag="RPD_0107"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyltransferase"
                     /protein_id="ABE37347.1"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR002375"
                     /translation="MQAEAITASGAKADGGVLFKAFGAVRRVWTRAAHLALDVALPTL
                     CVACREPVAGDGLCAPCWSQLSFIAPPYCEKLGIPFVYDPGPGLLSMQAIADPPAYAR
                     ARAAVRYDEVAKTLVHALKFHDRVDLAPTMGRWMAHAGQPLLADADLLIPVPLHWRRG
                     FSRRYNQSGALARAIGRQAGLPLAIEALKRIRPTAHQIGLSRAERAANVQGAFKVPPE
                     CKAEVQGRRIVLVDDVLTSGATVDACARALLRAKARSVDVLVFARVVDTLKSPI"
     gene            122868..123170
                     /locus_tag="RPD_0108"
     CDS             122868..123170
                     /locus_tag="RPD_0108"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37348.1"
                     /translation="MSEPDDKSADSITYVDIPTAPHVYFDIAPAHGVMANGVEIELAA
                     RTLNPLADGTVEVKFVTTARLRCSQAGAQHLRNALDAVLKMIEAAQQSPAAASKLN"
     gene            123232..124065
                     /locus_tag="RPD_0109"
     CDS             123232..124065
                     /locus_tag="RPD_0109"
                     /codon_start=1
                     /transl_table=11
                     /product="Methyltransferase type 11"
                     /protein_id="ABE37349.1"
                     /db_xref="InterPro:IPR013216"
                     /translation="MTDVAPLLFDRSLLAARLARARTLGPASFLLDRVADEMGERLHA
                     VLRDFKAIADIWTPGDALPAERFPGITRVAIDRSGDEALRLPPGSLDLAVSALALQFA
                     NDLPGVLAQIRRALKPDGLLLAALTGGDTLTELRQAFAAAEAEIEGGVSPRVAPTADL
                     RDLGALLQRAGFALPVTDIDRVVVRYDHAFALMQDLRRMGATNVLVERRRTPLRRATL
                     LRMADIYAERFADPDGRIRATFEIVWLSGWSPHESQQQPLKPGSAKASLEQAVRGNQP
                     K"
     gene            complement(124127..124528)
                     /locus_tag="RPD_0110"
     CDS             complement(124127..124528)
                     /locus_tag="RPD_0110"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="ABE37350.1"
                     /db_xref="InterPro:IPR000086"
                     /translation="MKLLLVVAVALIDADNRVLIAQRPKHKQLGGLWEFPGGKLDPGE
                     RPEAALIRELDEELGITVKEACLAPLTFASHAYEDFHLLMPLYVCRRWEGLVMPREGQ
                     ELAWVRPNKLRDYPMPPADIPLIPPLIELLM"
     gene            complement(124701..125942)
                     /locus_tag="RPD_0111"
     CDS             complement(124701..125942)
                     /locus_tag="RPD_0111"
                     /EC_number="2.3.1.35"
                     /EC_number="2.3.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate N-acetyltransferase /
                     N-acetylglutamate synthase"
                     /protein_id="ABE37351.1"
                     /db_xref="InterPro:IPR002813"
                     /translation="MSSSVSPLAPTNVPTLPDLAGVRLATAAAGIRYKGRTDVLLVAL
                     DPGTAVAGVFTKSKCPSAPVEWCRDKLKGGSARVLVVNSGNANAFTGKTGRQATTLTA
                     SIASKAIGCKPAEVFLASTGVIGEPLDATKFDGVLGKLAETAQPGGWMEAARAIMTTD
                     TFPKVATATVKIGKTKVTINGMAKGAGMIAPDMATMLSFVFTDAPLSASCLQALLKAG
                     VADTFNAVTIDGDTSTSDTLLAFATGAAAKAGAPKISRASDPRLKAFVKAFNAVLADL
                     AEQVARDGEGARKLVEIIVDGAKTPASARKIAMSIANSPLVKTAIAGEDANWGRVVMA
                     VGKAGEPADRDKLSISFNGIRVAKSGARDPSYNEAEVSAAMKKPEIQIKVSLGLGKGR
                     DRVLTCDLTKAYVEINGDYRS"
     gene            complement(126213..126722)
                     /locus_tag="RPD_0112"
     CDS             complement(126213..126722)
                     /locus_tag="RPD_0112"
                     /codon_start=1
                     /transl_table=11
                     /product="OsmC-like protein"
                     /protein_id="ABE37352.1"
                     /db_xref="InterPro:IPR003718"
                     /translation="MDAATLRATQAPIKERYKSDPDAALITLTAKGSVDSDGLTCKVE
                     TGRALATAGLHPATGGSGLELCSGDMLLEALVACAGVTLKSVATAIEVPLTRGDVVAE
                     GDLDFRGTLGIDKETPVGFREIRLRFDVGTDAPQDKLDLLLKLTERYCVVYQTIKNGP
                     KVSVSLERV"
     gene            complement(126781..127566)
                     /locus_tag="RPD_0113"
     CDS             complement(126781..127566)
                     /locus_tag="RPD_0113"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related"
                     /protein_id="ABE37353.1"
                     /db_xref="InterPro:IPR001687"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MLVLDGLDKTYPNGVHALERFSAQIQLGEIIAIIGGSGCGKSTL
                     LRAIAGLDRASAGAITLDGETIAAPHPKIGIIFQEPRLLPWLSVADNIGFGLDGVPRR
                     QRAGRVAAALSRVGLSDKAKAWPRELSGGQAQRVAIVRALVPQPEVLLLDEPFSALDA
                     FTRRDLQDHLLDLWADTRPTLILVTHDVEEAVVLADRVLVMRPRPGRLFEEIAVDLAR
                     PRDRNSPLFETLRHRVYSSLDRSLDLAQPGAEAKVNVGDAMWW"
     gene            complement(127566..128426)
                     /locus_tag="RPD_0114"
     CDS             complement(127566..128426)
                     /locus_tag="RPD_0114"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ABE37354.1"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR001958"
                     /translation="MAMTLETPVLQRSDAIEPADGARAPRRAPRWRGPLLGLLLPLTI
                     ALGWELLVHFGYSNGRLVPPPSKVFAIIAELAKSGELSRHIVATVGRVASGFGLGVLA
                     GTVLGAVSGYWGLARQLLDPTVQALRAIPSIAWVPLFILWLGIFETSKVALIAVGVFF
                     PVYLGVMGAIRSVDRKIVEVGRAFRLSGPAMIRRILLPAVLPAYVVALRVGLGLGWMF
                     VVAAEFMGASEGLGFLLIDGQQLGKPAQIVAAIVIFALLGKTTDWLIEIASAPLLRWQ
                     DAFGRHEGEA"
     gene            complement(128620..129606)
                     /locus_tag="RPD_0115"
     CDS             complement(128620..129606)
                     /locus_tag="RPD_0115"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, substrate-binding protein,
                     aliphatic sulphonates"
                     /protein_id="ABE37355.1"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="InterPro:IPR010067"
                     /translation="MSNISRRAITALIAAAAFLPGVLPVVASAADKPKEIRIDWATYN
                     PVSIVLKQQGLLEKEFAKDGISVVWVQSAGSNKALEFLNAGSIDFGSTAGSAALVARI
                     NGNPIKSVYVYSRPEWTALVTAKDSKIASVADLKGKRVAVTRGTDPHIFLVRALLDAG
                     LSQNDITPVLLQHADGKAALIRGDVDAWAGLDPMMAQAEVEEGAKLFFRKPEANTWGI
                     LNVREQFLKDNPDLVRRVLAVYEDARKYAVANTDEVKKAFIGVTKLPETVVDKQLKER
                     TELTHSRIGAPQRDSILAAGLALQQAGVIQSSVDVKATLDQLIDDQVPLPTN"
     gene            129849..132650
                     /locus_tag="RPD_0116"
     CDS             129849..132650
                     /locus_tag="RPD_0116"
                     /EC_number="2.7.7.59"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-P-II uridylyltransferase"
                     /protein_id="ABE37356.1"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="InterPro:IPR010043"
                     /translation="MDKVATPPHRPAGDERFDTQRITAEIAVLAAQHGGNDQAFRNAL
                     AQLMKAELAKARAEAEAQLLRDRHGRRCAERLCFVKDEIIRLLFMAATKYLYNSPTPS
                     SSERMSVVATGGYGRGLMAPESDIDLLFILPYKQTAWGEQVAEVVLYSLWDIGLKVGH
                     ATRSVDECIRQARADMTIRTAILETRFLTGDKALYAELVERFDKEVVEGTAAEFVTAK
                     LAEREERHRRSGQSRYLVEPNVKDGKGGLRDLHTLFWIAKYVYRVRETSELLERGVFD
                     AIEFRTFRRCEDFLWSVRCNLHFLTRRAEERLSFDLQREIGVRLGYTSHPGMQDVERF
                     MKHYFLIAKEVGNLTAILCAKLEDQQAKPAPALSRMMARLRPGATRRRVPESDDFVID
                     NNRINLAAPDVFKHDPVNLIRIFRLAQKNSLAFHPDAMRTVTRSLALINAQLRDDPEA
                     NRLFIEILTSDNSEPVLRRMNETGVLGRFIRAFGRIVSMMQFNMYHSYTVDEHLLRCV
                     GNLQEIERGGNDEFMLSSDLTRRIRPDHRAVLYVAVLLHDIAKGQPEDHSTAGAKVAR
                     RLCPRFGFNAADTELIAWLIEKHLVMSTVAQSRDLSDRKTIENFAAVVESVEQMKLLT
                     ILTTADIRGVGPGVWNGWKAQLLRTLYYETEPVLTGGFSEVNRAERIRAAQAEFRAAF
                     TEWPEAELDAYVARHYPAYWLKVELARKLRHARFLRASEQAGNKLAVNVGFDEARGVT
                     ELTILAVDHPWLLSIIAGACASAGANIVDAQIYTTTDGRALDTISIRREYDRDEDEGR
                     RATRIGEIIEEVLEGKLRLPEAVARRATSSKTKLRAFVVEPEISINNNWSDRYTVIEV
                     SGLDRPGLLYQLTTAISKLNLNIASAHVATFGERARDVFYVTDLLGAQITAPTRQAAI
                     KRALVHLLANGDAEQKPAA"
     gene            132778..133347
                     /locus_tag="RPD_0117"
     CDS             132778..133347
                     /locus_tag="RPD_0117"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative threonine efflux protein-like"
                     /protein_id="ABE37357.1"
                     /db_xref="InterPro:IPR001123"
                     /translation="MTTQMSYEAFVLTSLLILLTPGPTNTLLAASGAAMGVRKALWLA
                     LAEALGYSIAISLFVAAAGALEDVPIALPLLKAVAAGWLLFSAVQLWTRPATPDRADQ
                     RGAFSRVCVTTMLNPKAMLVGTVIIPDVTIGQAQAVLTFVVLSSVAGAGWIVSGAALP
                     AGLRRYSFKSAAVIIAAFSFAAAASAVQG"
     gene            complement(133645..135261)
                     /locus_tag="RPD_0118"
     CDS             complement(133645..135261)
                     /locus_tag="RPD_0118"
                     /codon_start=1
                     /transl_table=11
                     /product="HWE histidine kinase"
                     /protein_id="ABE37358.1"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR011102"
                     /translation="MQPPDYTFDRERLAALSRFGILDTPPERGFDDVVELTTLICETP
                     VALVSFVTDDRQWFKARVGFDACQTDLNSSVCAHALIEPDLLVVPDLTIDERTKYNPL
                     VTGQPFIRFYAGAPLRTAGGHVLGSLCAIDTKARPGGLTAAQTSALRNLGRQVVAQLE
                     LRHAVAQRDALLTEQKEAEIRRNGLLEIGDRLRDATSVSEMTRAAAAVVGETLGVSRA
                     AFGRFDEAGEYVEVEPDWTADGVVSAAGRHRLADYGPNLLRGVLNGQALVVTDVTTDP
                     ATAGHTEALLRLDIRALVNIPVVEHGRAVAMLIVHARQPRSWSPETLTYLRNIADRIE
                     MGVSRLRAEAQQRILNSELSHRMKNTMALVQAVASQTLKSVPDKAPVKAFSDRLLALS
                     MAHDVLLQQDWRSAQVRNIVDAAICTFNEVGRFDISGEQVTLGSRAALSLALLLHELT
                     TNAVKYGALSNELGRVQIAWRVETTDGDAGFRLRWNETGGPRIDPPSRRGFGSRLLGM
                     GLSGTGDAALNYHRSGLEVEFTASLAELQA"
     gene            complement(135398..138127)
                     /locus_tag="RPD_0119"
     CDS             complement(135398..138127)
                     /locus_tag="RPD_0119"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase with PAS/PAC"
                     /protein_id="ABE37359.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /translation="MRLSMRLTLVMTTLVLCAVAAVGILTYYNVGRAVVPAGLTRLAD
                     RAEARLGAFDGILRLLQLEILAARTFPPHQGLVRARINGGLDPQDDLTEARWLRRLGD
                     AYLGQMSVKSDIVRFSLVSADGGRELLRVDRSGPGGDIRVVPDDKLERVGQELFDRTI
                     ALSEGEVYTSPIHAGPGNSGDDDLAPMVSIATPLRMPEGEPFGMLVLDFDLRPTFERI
                     RASPDNNTKAYFVDAGGPYLLDLLDGRVIPSRPRGQWQDDYPDLAKALGDKPGAATVL
                     TAPDGARVAAAIAIAPLVGRLRVGVIETEAFERIIAPATALRQTVVTVALFAAGVAVL
                     LSALLSRSLAKPLVQITAAVDDFASTGRVAMPRGLSGETKTLAAAFEHMAAEIDTTTT
                     ALRAKSEALDKIVASMADAVLMLDAEGRRVFANPTFFALFGDIAEIGSERWRQHYQGL
                     RPDGVTPIPDDETPSARARRGESFDNLDVVLRRVGHSQLVHLAASGRPIETASGAFDG
                     AVVVYRNVTALKETERQLRQAQKMQAIGQLTGGVAHDLNNILTVLTGGIEILADGVSD
                     RPALKDVAVMVDQAVSRASDLTNGLLSFARKQPLQPRSIDVNALMQETARLLRATFGS
                     HIEIAFEPTPGLRSALADPSQLSGALINLAINARDAMPGGGKLLLEAGNIDLDQAYAD
                     HNDEVAAGRYVVLMVTDTGTGIPAAIRDRVFEPFFTTKALGEGTGLGLSMVYGFVKQS
                     GGHIAIYSEEGVGTTIRLYLPSADPKNSPGDAAAPQQAQGGRESILLIEDDVLVRSYV
                     VTDLAALGYTVHAAATAAQAMAMVYDELEFDLLFTDVMLAGSINGYQLADELRKYRPD
                     LKVLLTSGYTGNMLRLQGGHEDGTPFLEKPYRRAELARMLRLALDGKAPSSPT"
     gene            complement(138274..138702)
                     /locus_tag="RPD_0120"
     CDS             complement(138274..138702)
                     /locus_tag="RPD_0120"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37360.1"
                     /translation="MTGYIDPTKEVFAQFRENDRDGPIHMLNLVRLKPRASYPDGREA
                     TGAEAYAAYGRDSLSVFSRLGGRVVWQGAFELMLIGPQQERWDHVFIAEYPGVSAFVE
                     MIRDPVYREAVKHRQAAVEDSRLIRLKPIPAGEGFGQIPE"
     gene            138971..140191
                     /locus_tag="RPD_0121"
     CDS             138971..140191
                     /locus_tag="RPD_0121"
                     /codon_start=1
                     /transl_table=11
                     /product="Extracellular ligand-binding receptor"
                     /protein_id="ABE37361.1"
                     /db_xref="InterPro:IPR001828"
                     /translation="MKSLYRAAAAAVAAIALTAAPAAAQKKYDTGATDTEIKIGQTVP
                     FSGPASAYAGIGKTQAAYMRMINDSGGINGRKINLIQYDDAYSPPKAVEQVRKLVEGD
                     EVLLTFQIIGTPSNAAVQKYLNGKKVPQLLASTGATRFTDPKSFPWTMGYNPNYQTEA
                     RIYARYILKNHPNAKIGIMYQNDDLGRDYLAGLKAGLGDKAAAMIVAETSYELSDPTV
                     DSQIVKLKAAGVDLFFNASTPKFAAQAIKKVADLDWRPIHILDINASPVSSTLKPAGL
                     DISKGIISVNYGKDPADPQWKDDPGVAKYLAFMDKYYPEGDKMSTINTYGYSTAQLLV
                     TILKQCGDDLTRDNVMKQAANLKNVTGDLSLPGMVINTSPTDYRINKQLQMMKFNGER
                     WELFGQIIEDDQAM"
     gene            140396..140815
                     /locus_tag="RPD_0122"
     CDS             140396..140815
                     /locus_tag="RPD_0122"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37362.1"
                     /translation="MHLVVCTGCREDVAQLIGNQIGSVDRWFEQRARHFVQNATDRLQ
                     RIGVEWRGGEYDRMRVTSGAPQRGESTMRTESNRYFTIEQLEELAVAKYIEAALMPEG
                     GEREELLQEAKRFASRARMKSWLMGEIGITPPRREYH"
     gene            complement(140960..141211)
                     /locus_tag="RPD_0123"
     CDS             complement(140960..141211)
                     /locus_tag="RPD_0123"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37363.1"
                     /translation="MNRMQKTAEEIEALLLQDVRQQRHCGKVEAIRIRPCEPDEDTNG
                     ANWKVASVDPGQASREFAGAAVMIAMDRLQREVSAFPWD"
     gene            141403..143565
                     /locus_tag="RPD_0124"
     CDS             141403..143565
                     /locus_tag="RPD_0124"
                     /EC_number="2.4.1.129"
                     /codon_start=1
                     /transl_table=11
                     /product="Penicillin-binding protein 1A"
                     /protein_id="ABE37364.1"
                     /db_xref="InterPro:IPR001264"
                     /db_xref="InterPro:IPR001460"
                     /db_xref="InterPro:IPR011816"
                     /translation="MALGKKKAGERREPKFGFAESLAHLRLGPQDRVSVADDDRPKKP
                     KAQAGKSGGGGRGKSRGKSRKKGGLRSLVTRTVYWTAVAGIWAVLAVVGIMVWVGAHL
                     PPIQSLEIPKRPPTITIVGADGSQLAVRGEMAGTNVSLKDLPPYLPKAFIAIEDRRFY
                     SHFGVDPMGIARAAVANVMHRGVSQGGSTLTQQLAKNLFLTQDRTLTRKLQEVELALW
                     LERKHAKAEILELYLNRVYFGSGAYGVEAAARKYFGKSAKEVSLVEAAMLAGLVKSPS
                     RLAPNRNPEGAEKRAQLVLAAMAEADFITDKQARAAIANPVYTVAPTGAGTLNYVADW
                     IGEVLDDLVGQIDQSIVVETSIDPKLQTEAEAAIIDELAAKSVKFKVSQGALVAMTPD
                     GAVRAMIGGRNYADSQFNRAVTAKRQPGSAFKPFVYLTAIEAGLTPDTIRQDAPLDLK
                     GWRPENYTHEYFGAVTLTQGLAMSLNTVAVRLGLEVGPKNVVRTAHRLGIASKLDANP
                     SIALGTSEVSLAELVGAYAPFANGGLMASPHVVTRIRTASGNKLLYARPSDPPSRVVD
                     ARAVAMMNTMMQETLQSGTGRKADLPGWSAAGKTGTSQDFRDAWFIGYTSTLITGVWL
                     GNDDNSPTKKATGGGLPVDVWTRFMRAALQGAAPQPLPGGWVEAPATIAQSGPRGETQ
                     VMNVAPPSGRAPQPTRANVRPEADTGLDGWLMDRLFGR"
     gene            complement(143897..144667)
                     /locus_tag="RPD_0125"
     CDS             complement(143897..144667)
                     /locus_tag="RPD_0125"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF45"
                     /protein_id="ABE37365.1"
                     /db_xref="InterPro:IPR002725"
                     /db_xref="InterPro:IPR006025"
                     /translation="MSGSAEMAFRALLYRRPTEPSTIAVRHGSQFFAVRIRRHRRATR
                     YTLRIHPSDREAILTMPPRGTLVDAKDFAQRHGAWIAARLGRLPKAAPFQPGTLVPLR
                     GHDHKIVHRTGRGTVWTETRDSGERIICVAGDAEHIDRRVHDFLKREARHDLQKACDR
                     YAPELGVKVTRLSIRDQSSRWGSCTSAGSLSFSWRLILAPPYVLDYLAAHEVAHLVEM
                     NHSARFWRVVGKVCPHMERAKTWLDTHGNDLHRYGISD"
     gene            complement(144990..146315)
                     /locus_tag="RPD_0126"
     CDS             complement(144990..146315)
                     /locus_tag="RPD_0126"
                     /codon_start=1
                     /transl_table=11
                     /product="polyhydroxyalkanoate depolymerase,
                     intracellular"
                     /protein_id="ABE37366.1"
                     /db_xref="InterPro:IPR009656"
                     /db_xref="InterPro:IPR010915"
                     /translation="MPVIGEFGRPPEMPAEVSPAMTTPMYWFYELAHASLNPARAMSD
                     AARLMFKNPLNPWSHTDLGKSIAAACEVFERTTRRYGKPEWGLDDTEVNGMRVPIEIH
                     NVWEKPFCRLLYFERKLEHPLRHPQPRVLIVAPMSGHYATLLRGTVEAFLPTHEVYIA
                     DWTDARMVPVAAGRFDLDDYVDYVIEMLQTLGGNVHVVAVCQPSVPVLAAVSVMEAND
                     DPFVPLSMTLMGGPIDTRRNPTSVNNLAAEKGIDWFRSHVITKVPFPHPGVMRDVYPG
                     FLQLNGFISMNLDRHMDAHKNLFNHLVQGDGDLADKHREFYDEYLAVMDLTAEFYLQT
                     VDLVFVKHALPKGEMTHRGKLVEPSKIKRVALMTVEGENDDISGLGQTEATHTLCTSI
                     PDERRVHYVQKGVGHYGVFNGSRFRSEIVPRISDFMLSSASGARATAAE"
     gene            146905..147660
                     /locus_tag="RPD_0127"
     CDS             146905..147660
                     /locus_tag="RPD_0127"
                     /codon_start=1
                     /transl_table=11
                     /product="Methyltransferase type 12"
                     /protein_id="ABE37367.1"
                     /db_xref="InterPro:IPR000051"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /translation="MHNRYGKLASWVYNLDKPVGRSFGDVEFYRQRLKDVDGPILEPA
                     AGNGRILVPLLEAGLRIEGFDASDEMLGYCRDECGKRHLSAGLTRQRFDDFSYDTRFA
                     SIIMPAGSFQLITDAASAAAVLKRFHDHLAPQGRLIIDLDPISGFLGASRSIRSWATD
                     DGDMLTLTDHRVETDFIAQTTLSHLRYEHWQDGSLTRTELDLFKLRWWGVNEFSLALQ
                     AAGFSDVEVSGNYQHGRAPQPGDDIISFEARRA"
     gene            complement(147710..148540)
                     /locus_tag="RPD_0128"
     CDS             complement(147710..148540)
                     /locus_tag="RPD_0128"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-2"
                     /protein_id="ABE37368.1"
                     /db_xref="InterPro:IPR000412"
                     /translation="MRSLINSLELGHGIAWHRIEAMVLRYWYLLLSSWPRLLELVYWP
                     ALQIITWGFLQSYIAQNAGFFARAGGTLIGAVILWDILFRGQLGFSISFLEEMWARNL
                     GNLMMSPLKPIEFLASLMIMSLIRLAIGIVPMTLLAMIFFDFNLLGFGLPLIAFFCNL
                     IFTSWALGIFVSGLVLRNGLGAESIVWTLMFGVMPLACVYYPVSVLPHWLQLVAWTLP
                     PTYVFEGMRALLMEHQFRVDLMLWSLGLNAVLFAAAFISFLVMLNSARRHGSLIQTGE
                     "
     gene            complement(148537..149331)
                     /locus_tag="RPD_0129"
     CDS             complement(148537..149331)
                     /locus_tag="RPD_0129"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related"
                     /protein_id="ABE37369.1"
                     /db_xref="InterPro:IPR001687"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MTLEIASRPAPSATDAPAAAAIEVAHLVKVYKTTRAVDDISFRV
                     PRGSITGLLGGNGAGKTTTISMIMGLVLPTSGRVRVLGHEMPERRADVLGRINFESPY
                     VDMPSRLTVRQNLIVFGKLYAVKDLPGRIAELAADLDLGEFLDRASGKLSAGQKTRVA
                     LAKALINRPELLLLDEPTASLDPDTADWIRSHLETYRKQHGASILLASHNMLEVERLC
                     DRVVIMKRGRIEDDDSPAAIMARYNRATLEEVFLDVARGRAAGSGR"
     gene            149441..150763
                     /locus_tag="RPD_0130"
     CDS             149441..150763
                     /locus_tag="RPD_0130"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding region, ATPase-like"
                     /protein_id="ABE37370.1"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /translation="MSDDQNSSDFRHPRRHVRLDTILRLRWLAALGQISAIFIVAQGL
                     EFDFAVLPCLAIVAASAVVNLGLQIAFNPMQRMEPIYAALLLALNIAELAGLLYFTGG
                     LQNPFAFLFLGPVLIAATALPTRFTISLGILAASCAALLGYAHQPLPWAGEEAVQLPE
                     IYLIGVWLSILLAIGVTSVYTFQVTEEARKLADALSATELVLEREQHLTQIDGMAAAA
                     AHELGTPLSTIFLISRELEKSAPPEMVGDLRTLREQAQRCREILAKISHLNAAGAPFD
                     QMPLSTLIEEAVAPHRDFGVAIKIRVAVSGVSEPVVMRNPAILYGIGNILENAVDFAR
                     ETVEVNAWWNADTVQIMISDDGPGIKPDLLKRIGEPYLSRRRHPDDAHTERSGLGLGV
                     FIARTLLERTGAKVSFRNKLFPDHGAVVQLTWPRNRFENSEIPAVAEA"
     gene            150866..151420
                     /locus_tag="RPD_0131"
     CDS             150866..151420
                     /locus_tag="RPD_0131"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver"
                     /protein_id="ABE37371.1"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002197"
                     /translation="MNAIPELNDLTDRSLLIVEDDKPFLERLSRAMETRGFAVTSCDS
                     VSSGLAQIGKAAPAFAVVDLRLGDGNGLDVVSALKRERPDARAIVLTGYGNIATAVTA
                     VKMGAVDYLSKPADADDVVAALLASGTEKSELPNNPMSADRVRWEHIQRIYEMCNRNV
                     SETARRLNMHRRTLQRILAKRAPR"
     gene            complement(151611..152090)
                     /locus_tag="RPD_0132"
     CDS             complement(151611..152090)
                     /locus_tag="RPD_0132"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF1052"
                     /protein_id="ABE37372.1"
                     /db_xref="InterPro:IPR009394"
                     /translation="MESNAVHMVLPPDLRQSETALKVARGASRLLRSLGFACVSELPL
                     PSGRRADLVALNERGEIWIVEIKSSVEDLRADQKWPDYRAHCDRLFFAFTQDLPCEIF
                     PADTGLIVADGYGAHMHCEAPEHKLPAPTRKLMMLRFALAAAQRLNRLSDPQGFGDG"
     gene            152241..153359
                     /locus_tag="RPD_0133"
     CDS             152241..153359
                     /locus_tag="RPD_0133"
                     /codon_start=1
                     /transl_table=11
                     /product="von Willebrand factor, type A"
                     /protein_id="ABE37373.1"
                     /db_xref="InterPro:IPR002035"
                     /translation="MKRITMLRALAFAALIAPLAIPSAARARPAVEVAFVLDTTGSMS
                     GLIEGAKRKIWSIATAIVDSNPGADIRMGLVAYRDIGDDYVTRNVELTPDIQDLYARL
                     LELQARGGGDWPESVNEALDVAVNKLRWSKDGDTRRIVFLVGDAPPHMDYAQDTKYPT
                     TLSVARQKDIIVNAVQAGAARDTERVWHEIADGGRGRYIPIPQDGGQIVVIETPYDQD
                     IIILQNRINGTVIPYGPAPLQKRTEEQTRQLSKVAAAAPAAASDMASYINKRARTSSE
                     AVTGGGDLVSDVMAGRQKLDQVKDEELPDSLRALPAEQRTAKIEAEMNQRKALNEKLA
                     TLVKQRDAYLFAQRDKQPEQASSFDREVEATLKAQLKR"
     gene            153579..154247
                     /locus_tag="RPD_0134"
     CDS             153579..154247
                     /locus_tag="RPD_0134"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase-like"
                     /protein_id="ABE37374.1"
                     /db_xref="InterPro:IPR001279"
                     /translation="MSTQSDTKTKAGAAIIPVTPFQQNCTLLWCEATRKAVVVDPGGD
                     VPEILAAIEKTGVSVEKIWLTHGHIDHVGGAAELRDALGVQIEGPHRDDLFLLENVVN
                     SGRSFGIGGVRDVTPDRWLDHGDSVSVGELTFQILHCPGHSPGSVVFFNDAMRFALVG
                     DVLFAGSVGRTDLPGGNHATLISSITDRLLPLGDDVGFICGHGAGSSFGQERLTNPFL
                     NGAM"
     gene            154717..155706
                     /locus_tag="RPD_0135"
     CDS             154717..155706
                     /locus_tag="RPD_0135"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AraC family"
                     /protein_id="ABE37375.1"
                     /db_xref="InterPro:IPR000005"
                     /translation="MTVELLSEPLSEFRALDTSDPVELAQALWTVYGVRHFEAPPAGH
                     FRIRGNFIQLQDIALGFTSGHAPLTVDFPEADFARLQIGLAGQASTRSAGVTTAVDSR
                     QGCITSPGRTARTEFGETYEQLLLRVKNGALERKLSALLGTKPKRTIEFEPAATNDLP
                     QAANLRRMIAFVSSQINSPSAPLPALVLAELQDAITLLLLSTYRHNFSRFLEADSPTA
                     APKHVRKIEEYIEANWMKPITIETLVDLTGISARGVFKTFQRNRGYSPMAFAKQVRLQ
                     HARAMLTQGRTQTTVTAAAFACGFANLGHFAKDYRELFGERPSETLGRSSTSL"
     gene            complement(155814..156233)
                     /locus_tag="RPD_0136"
     CDS             complement(155814..156233)
                     /locus_tag="RPD_0136"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF1236"
                     /protein_id="ABE37376.1"
                     /db_xref="InterPro:IPR009642"
                     /translation="MMNRFAGAAVVVLSLATPSIVNAQGVPGGVERGAREGERAAGPV
                     GAVVGGTIGGVVGGVAGILGVDDRPRFRSYVVDQRRPSYSYREDVRVGAVLPADGVTY
                     YEVPDQFSAARDYRYTVVNGRTVLVEPRTRRIVEIIE"
     gene            complement(156463..157641)
                     /locus_tag="RPD_0137"
     CDS             complement(156463..157641)
                     /locus_tag="RPD_0137"
                     /codon_start=1
                     /transl_table=11
                     /product="Esterase, PHB depolymerase"
                     /protein_id="ABE37377.1"
                     /db_xref="InterPro:IPR000379"
                     /db_xref="InterPro:IPR010126"
                     /translation="MSLKNTIDFLAHLRKFNGLSSLGAVSGGAGDASPLTETTDFGDN
                     PGQLRMLSFIPEGLSQRIPLVVVLHGCTQTATGYDVGAGWSTLAERYGFALLMPEQTR
                     ANNPNLCFNWFVPDDIRRGHGEAGSIRQMVEHLARTHQIDRARIFVTGLSAGGAMTAA
                     MLATYPDVFAGGAVIAGLPYAVAGTVRQALKEMRHASPHSAHQLGDLVRRASSHRGPW
                     PKLSVWHGSADRTVDSGNADALVKQWLDLHGLPEAPMAQRKIDGFPHRIWWNSSGETA
                     VESYTITDMAHGTPLGRANDEHFGVAGAYLLETGISSSFHIAEFFGLTAQVHQPKSVR
                     QTSARPDRAAVATESKASQSKPRAAAGARRTQEPPRDRRGFDVNAVITRALTAAGLMK
                     "
     gene            complement(157856..158101)
                     /locus_tag="RPD_0138"
     CDS             complement(157856..158101)
                     /locus_tag="RPD_0138"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37378.1"
                     /translation="MKKIVLAAICSAAIGGLSIGQAAAQTTGPAPQDSMKMNDGMSKG
                     GMSDPGMKKTTTGMSKSSKAKATKKSMKSDKMNNMEK"
     gene            complement(158217..159605)
                     /locus_tag="RPD_0139"
     CDS             complement(158217..159605)
                     /locus_tag="RPD_0139"
                     /codon_start=1
                     /transl_table=11
                     /product="Chromate transporter"
                     /protein_id="ABE37379.1"
                     /db_xref="InterPro:IPR003370"
                     /translation="MSSSASQPRTTDSAAPGVSLAEATSAWAKIALLSFGGPAGQIAV
                     MHRIVVDEKRWVSEERFLHALNYCMLLPGPEAQQLATYLGWLMHGTRGGLIAGGLFIL
                     PGALAIMVLSVIYVSFGQLGIVAALFFGLKAAVLAIVLQAVSRVGARALKTSATRALA
                     ALALLAIFVFDVPFPLIVLGAGLIGWLGSRAGLAGFSPPTSSTAVVATNEDGARVDAV
                     TAAGGTPGEALRVALVWLVLWLTPVAALLIGLGPDNVFSQLAVFFSKMALVTFGGAYA
                     VLAYVAQLAVDHYGWLKPGEMLDGLGMAETTPGPLIMVLQFVGFVAAFRTPGALPPLV
                     AGALGGLLTTWVTFAPCFLWIFLGAPYVERLRGNAALSAALAAITAAVVGVMLNLALW
                     FAIHTIFREVRKLSVAGLTLELPVLSSINPSAALLSALAIVAVFGFRMGTATVLLICA
                     SAGFALHFLGAL"
     gene            complement(159602..160213)
                     /locus_tag="RPD_0140"
     CDS             complement(159602..160213)
                     /locus_tag="RPD_0140"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37380.1"
                     /translation="MSRPQLLPESPSEQDTAKFLRRFSELVAVGQSASYLRHAAGLID
                     ELIDRVRQTEALLHQQTADNADNLALRRRAEAEAMAARQELAPHAEALADLQDKFVCA
                     QHSFAAERADLTGRIARAESRLAEADAELRRLRARLAAIGPTHAIVPMQTLRLLQTQL
                     AALAGEFQRGGDLVSVAMCEVSICVIDQTLAAEPGRRSTATSA"
     gene            complement(160419..160742)
                     /locus_tag="RPD_0141"
     CDS             complement(160419..160742)
                     /locus_tag="RPD_0141"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37381.1"
                     /translation="MASRSAPDRAGLPGLISRSRLIAVACLVIAGAGVTTSPVSAQSC
                     QALWVERNSYYKEAGYCFKTSRAIGYFGNRGCSYDYEGDVPLSVNIRDRIAEIKAMER
                     RFGCN"
     gene            160993..161466
                     /locus_tag="RPD_0142"
     CDS             160993..161466
                     /locus_tag="RPD_0142"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37382.1"
                     /translation="MSDTMYDVFKFLHVVGVVVLVGNVTITAFWKAFSDLTRDPKIVA
                     HAQRGVTVSDLIFTLLGIVLVMVGGYGAAIVKDVPLFSSFWLVAGQILFAISGMMWLG
                     ILVPLQIRQARLARSFADGSDIPERYWRDTRTWLIWGIIATVPLVAAIFVMVVKF"
     gene            161499..161972
                     /locus_tag="RPD_0143"
     CDS             161499..161972
                     /locus_tag="RPD_0143"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37383.1"
                     /translation="MTVEQIAPVVDREALLPGAQFIDAYSVTIGDNALDAREAATRMV
                     EHGPRWIGTLMRLRNIVVTPFGLKTPAPGGSARGDRIGSFPVLSETPTRIVAGFDDSH
                     LDFRIVVDVVDGAAGRRVIASTLVLTHNRLGRTYLAAIMPFHRLVVRAMLGRVAQ"
     gene            161969..162517
                     /locus_tag="RPD_0144"
     CDS             161969..162517
                     /locus_tag="RPD_0144"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37384.1"
                     /translation="MKRRRNFGGRRRLPKVDGETNHNGGLSAPDEKTAALARAFDSAW
                     ERFIATEGAEADTDANRKRLASKIVALSRAGEADEDRLAQSGLIHLSVLAEAARLGSQ
                     PPAPTNGIGTSQQATHAQAFSPQTVAAMSAALEQCVETLPLQTPSSALQFLSARILEQ
                     ASRGEHDPERLSRHALEALRNR"
     gene            complement(162595..163710)
                     /locus_tag="RPD_0145"
     CDS             complement(162595..163710)
                     /locus_tag="RPD_0145"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37385.1"
                     /translation="MKRFWSRYPAHWRPRRPQWGLALRITLGALLALAAAQALHLRLP
                     LWAVLTAIIVTQLSVGRSVKIAFDYLVGTIGGAIYGGAITILVPHSSELALLGVLALA
                     VAPLALLSAIKPNLNVATVTAIIVLLVPTMTQVSPLDSAIDRVLEVTVGALVGLLVSF
                     LVLPSRAQAQALGAAAQALDLMAVALGELLAGLIRGLDNDALHRLQDGIGAALVTLNE
                     IGDEAEHERATGLSRGPQMAPLIRTLLRLRHDLVMVGRAVAAPLPPPLQQRLGPCLDS
                     FRAAATLHLAASASALRDRRAPPPLRAVSSALDAYAAEVQTVRQDGLTRDLSGEQAER
                     FFALGFAMEQLTQNFRDLEMRVAEWAARPVVETPAAV"
     gene            163879..165252
                     /locus_tag="RPD_0146"
     CDS             163879..165252
                     /locus_tag="RPD_0146"
                     /codon_start=1
                     /transl_table=11
                     /product="MmgE/PrpD"
                     /protein_id="ABE37386.1"
                     /db_xref="InterPro:IPR005656"
                     /translation="MANETATLAGYVAALRFEDIPQDVLARAKVLTLDFLGSAIRARR
                     EAESTPSLLAMLQALSLDGDGAATVFGDAKRWTPAMAALLNGALGHSLDFDDTHADSS
                     LHPSAPVVPAAFAVGELVGASGREVLTAIVAGYEVCCRLGNALDPTSHYARGFHPTAT
                     AGAYGAAAAAAKLFGLTQDQIVAAFGVSGSQAAGSLQFLVNGAWNKRYQVGAAAMNGV
                     IAATLAKNDFIGATESVEGIHGLLVGYTDTPHHDKAVADLGRVYETMKIGVKPYPSCR
                     YTHAAIDALIAMRREHNLTPDQVKRVEIGLHRNGITLTGDAATKRHPSSIVGGQFSMF
                     FTGALALEQGSFGWDDYTRLGDPAIDALADRFDVVQDARLEGKTHPFGARVSITTDDG
                     VHERIYADPSGEPNAFPTDQAMAQKFLQLARPVLDGRAQQFADAILTLERFDRVATAT
                     ALGQPAS"
     gene            165321..165929
                     /locus_tag="RPD_0147"
     CDS             165321..165929
                     /locus_tag="RPD_0147"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37387.1"
                     /translation="MQRFVCEQNILHFQKLLDGPTDATLRRTLLTLLSSAKRELALLN
                     SHTSGADLSPALSRRKHTGDLESVLRQLRPGFETSAHPYMLIHPGPGLKIIDINAAFS
                     RATFSDRRDIVGRQLFEVFPDNPAIGTADGVSNLYASLRTVVETGQPHAMIVQRYDVR
                     DRTGGFIERYWQPINTPVHDSGERLICLLHHVEDVTAEVLAN"
     gene            166201..167619
                     /locus_tag="RPD_0148"
     CDS             166201..167619
                     /locus_tag="RPD_0148"
                     /EC_number="4.1.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="Malonyl-CoA decarboxylase"
                     /protein_id="ABE37388.1"
                     /db_xref="InterPro:IPR007956"
                     /translation="MPSASVDRASEILGGLLTSLTERGRNLFRSSGDQPKTKEELIAL
                     GEALLSRRGEATGVAMASSLLSGYDGATDEDQLGFLDALAEHFGPDLAQLTAAVEAFH
                     VSGASADAAGQLLKAAEPRRQELIRRLNLAPGGTASLVQMRETVLSHLRDHPQLKHVD
                     DDFVHLFTSWFNRGFLVLQRIDWNTPANILEKIIRYEQVHAIHNWDDLRARLAPADRR
                     CYGFFHPQLVDEPLIFVEVALTLDRPAAIAPLLDLGREPIAARSATTAVFYSISNTQK
                     GLAGISFGNFLIKQVVEEIKRELPNVQSFVTLSPVPGFAKWLKRERAADESALLDDTA
                     RAALDVLDTPDWFDQPELAEQIRPIMLPLAAAYFLQAKNPRGQPQDPVARFHLGNGAR
                     LESLNFLGDRSPNGMRQSHGLMVNYLYALGEIEDNHEAFVERGQVAAASAVRRQLPSK
                     PLSSEPRKSNGAARRDGAQSPA"
     gene            167670..168587
                     /locus_tag="RPD_0149"
     CDS             167670..168587
                     /locus_tag="RPD_0149"
                     /codon_start=1
                     /transl_table=11
                     /product="Pirin-like"
                     /protein_id="ABE37389.1"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR008778"
                     /translation="MSWMPTDDPLLGDPKTCDALELIIVPRTRDLGDGFAVRRALPHG
                     KRQMVGPFIFFDHFGPVQFIPGKGMDVRPHPHIGLSTVTYLFDGTIMHRDSEGNIQEI
                     APGAMNLMTAGRGIAHSERTPEMQRRDGQSMLGLQSWIALPAGSEEIAPSFQHFAAAT
                     LPTVTDTGFTARVIAGSAFGEASPVTMVSPWFYVEVNARAGATVPLDPDHEERAIYLV
                     DGEIEIAGDRHSGPSLLIFRPGDRITVRVMTDTRMMFLGGDALEGPRHIWWNFVSSSK
                     ERIEQAKQDWKTGRFAAVPDESEFIPLPE"
     gene            168656..169573
                     /locus_tag="RPD_0150"
     CDS             168656..169573
                     /locus_tag="RPD_0150"
                     /EC_number="6.3.2.6"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase"
                     /protein_id="ABE37390.1"
                     /db_xref="InterPro:IPR001636"
                     /translation="MTTMLTSDLPLNKIGRGKVRDIYAVDDERLLLVTTDRISAFDVV
                     MAETIPMKGAVLTQISAWWFDQLGGVVPHHMISADAAEIIDAVPALKDHRAALAGRAM
                     LCRRTTVFPIECVIRGYITGSAWKEYAASGTLAGETLPAGLQESERLAPPIFSPATKA
                     ETGHDENITIARMREIVGDETAYTLESMTRAVYTQGEAIAREQGIIIADTKFEFGRDA
                     NGRIILIDEVMTPDSSRFWAADSYAPGRSQPSFDKQPLRDYLDAERRAGRWNGEAPPP
                     KLPAEVVAATSARYLDAYRRLTGTDLVVK"
     gene            169820..170602
                     /locus_tag="RPD_0151"
     CDS             169820..170602
                     /locus_tag="RPD_0151"
                     /codon_start=1
                     /transl_table=11
                     /product="Enoyl-CoA hydratase/isomerase"
                     /protein_id="ABE37391.1"
                     /db_xref="InterPro:IPR001753"
                     /translation="MPQNTVLIERDGPVTIISINRPERRNAVDGATAQKLFDAFLAFD
                     ADETASVAVFTGTGGSFCAGADLKAVAAGDIEKKREIAGHNTIAPMGPSRLRLSKPVI
                     AAIEGYAVAGGLELALWADMRVAAEDATFGVFCRRFGVPLIDLGTIRLPRLIGHSQAM
                     DMILTGRPVSGIEAHRMGLANRLVHRGEAALHAITLAKEIAKFPQACMRADRLSALQQ
                     WDMPEEDAIMNEMRGGLQVIASGETLSGAERFTAGEGRHGKF"
     gene            complement(170705..171424)
                     /locus_tag="RPD_0152"
     CDS             complement(170705..171424)
                     /locus_tag="RPD_0152"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadC"
                     /protein_id="ABE37392.1"
                     /db_xref="InterPro:IPR001405"
                     /translation="MPANSDEQLSQSGFAEAPHYHGHRERLRERFREAGADALSDYEL
                     LEMVLFRALPRRDVKPLAKALIARFGSFAETMHAPEPRLREVSGLGEAAITEIKLVAA
                     AAARVTKGQVKSRTVLSSWSAVIDYCRTTMAFADKEQFRILFLDKRNQLIADELQQVG
                     TVDHTPVYPREIVKRALELSATAVIMVHNHPSGDPTPSQADIQMTRTIVAIAEPLGVS
                     VHDHIIVGKNGHASLKGLKLI"
     gene            complement(171562..173370)
                     /locus_tag="RPD_0153"
     CDS             complement(171562..173370)
                     /locus_tag="RPD_0153"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis sensory transducer"
                     /protein_id="ABE37393.1"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /translation="MARVSIRALSVAVFLGLALIVFLNLSSFFLYQGAQGEISEAQTS
                     RYQSYLLADELRQSSDDLTRLVRTYVVTGDAKFEQQYWDVLAIRNGEKPRPDQYQRIY
                     WDFMAADGRKPRPDGVNASLQQLMERGGFSAEEFGKLKQAQNNSNELIKLETIAMNAV
                     KGRFEDRDGKFTKTGAPDTALARELVHSADYHKYKAQIMAPIDEFFVLLDRRTGANVA
                     IAEAKAALYRTVSIVFLGLLLVSALVIGWVMLRGIARPLRSLSVSMNKLAEGDFNVAL
                     PGLDARNELGEVARAVERFKVKAEEKGQAEAEALLKQDQIAASQRRKDTHKLADDFEG
                     AVGRIIDTVSSASSELESSAGKLTSTATRAQQLATLVAGASEEASTNVQSVASATEEL
                     SASVNEISRQVQDSARMASEAVDQARRTNDRVGELSKAAARIGDVVELINTIAGQTNL
                     LALNATIEAARAGEAGRGFAVVASEVKALAEQTAKATGDIGQQISGIQAATQESVGAI
                     KEISGTIERLSEISATIASAVEEQGAATLEISRNVQQAAQGTQRVSSNIADVQNGASE
                     TGSASSHVLSAAQSLSNDSNRLKQEVGRFLDSVRAA"
     gene            173763..174749
                     /locus_tag="RPD_0154"
     CDS             173763..174749
                     /locus_tag="RPD_0154"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37394.1"
                     /db_xref="InterPro:IPR006164"
                     /translation="MAPRANWKGFLRLSLVTCPVALFPATSDAEKISFNQINRKTGNR
                     IKYTKVDADTGEEVSSDDIMKGYKVDTDSYIEITKDELDAIALESTRTIEIDQFVPKS
                     EIDDLYLVRPYYIVPDGKVGHDAYAVIRETIRTMDRVALARVVLTNREHVIALEARDN
                     GLMGMLLRYPYEVRDASEYFDDIQDVKITKDMLDLARHIVEQRSGHFEPDKFEDHYEA
                     ALTELINQKRNGQPIAPKARPRGDNVVDLMDALRKSLGGAKPAPAAGKAASAEKPAAK
                     PARTKKRKTAPGQKEMLLPISGAKSAAAKQDAGKAKKPARSSTASSKARKTG"
     gene            complement(175023..175847)
                     /locus_tag="RPD_0155"
     CDS             complement(175023..175847)
                     /locus_tag="RPD_0155"
                     /EC_number="3.4.11.18"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase, type I"
                     /protein_id="ABE37395.1"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002467"
                     /translation="MSYVDASETSLRKTGQIKLHGAAGFAGMRKAGQIVAQCLDELVD
                     IVKPGVPTSLIDDFVRDFAFSHGAFPATLMYRGYRYSTCTSINHVVCHGLPGDRPLKE
                     GDIVNVDVTMIVDGWYGDSSRMYPIGPIARKAERLIEVTYESLMRGIAAVKPGATTGD
                     IGHAIQSFVEPQQMSVVRDFCGHGLGRLFHDEPNIIHVGSPGQGAVLKPGMFFTIEPM
                     INLGKPYVKILSDGWTAVTRDRSLSAQFEHSIGVTADGCEIFTLSPKGLDKPPLQG"
     gene            complement(175945..177258)
                     /locus_tag="RPD_0156"
     CDS             complement(175945..177258)
                     /locus_tag="RPD_0156"
                     /codon_start=1
                     /transl_table=11
                     /product="MscS Mechanosensitive ion channel"
                     /protein_id="ABE37396.1"
                     /db_xref="InterPro:IPR006685"
                     /translation="MIDLTQAYEALLAAASSVGAEITSPWFYAQLGMILAALGIGLGG
                     GALIKARVDMTTLTMGWPAPLRMFLRVVIDSAWTAIFALVVIAVRLAMLQMTWPSRSY
                     LIGVSAKLALAWLMIRLVTSILRNPFLIRVVSLSAWCVAALSIIGQLFPVLDALDSVA
                     IEIGELRLSPFLILKLGVLLAIALWLASIASNFFEGRINQSRDLTPSIQVLLIKLMRI
                     GLMAAAIALTMSAVGINLQALAVFSGAVGVGIGFGLQKIFANFISGVILLVDKSVKPG
                     DLVTIGDNSGRISAMNTRYISVAAGDGREFLIPNEDLITQKVVNWTYTDKNTLVKVAF
                     ATNYDADPRTVCRLAIDVAAAVPRASKAKSPGCILTEFTETGMKFALTFWIGEPDGMD
                     GVKSEAMLGLWDAFRREGIGVPYPVREIRVRNGALPAETIVEVPQ"
     gene            177483..179273
                     /locus_tag="RPD_0157"
     CDS             177483..179273
                     /locus_tag="RPD_0157"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/hydrogen exchanger"
                     /protein_id="ABE37397.1"
                     /db_xref="InterPro:IPR005170"
                     /db_xref="InterPro:IPR006153"
                     /translation="MDSLDTVSITILLGAILVMAGILSSLLALRFGAPLLLVFLVLGM
                     LAGEAGPGGLRFDDLSTTYLVGSVALALILFDGGLRTRFQTIKAVLAPSMGLATAGVL
                     LTALITAPVAHYALDLSWTEALLAGAVVASTDAAAVFLLVHSQGLRLRPRVGATLEVE
                     SGTNDPFAVFLTLMLVELITRGGSTIWYVIFEFVREAALGTVIGVVGGRAVVMALNRV
                     ALPQGLHAPFVTTAALVVFGAAQMLHASGFLAVYLAGMIIGNQPTRAHNSVVAFLDAA
                     TWLAQIVMFVLLGLLVSPQRLMMSIGPAVLVALALMLVARPVAVFLCLAPFRFNWRER
                     LFIAWVGLRGAVAIFLASIPMMVGLPKAHLYFDVAFVVVIISLLLQGWTLGPAARKLH
                     IALQRTDRGPRRIELDLPGQLEQQLVGYAVRPKSLFLRRGLVPSWSKPTLVIRDERIL
                     TPEEADPVAAGDYVYLLAPPEKAEALDRFFVDMPPSTAPDPHLLGDFVVPGETSLGDL
                     AAAYGVSVQAGEEALTLADYFDIHLDRAPTVNATVALDSIVLVARSLGGGRVNVVGLR
                     LPEDDDAPPPTRVQKARRKLSKVWSTLSGV"
     gene            complement(179274..180227)
                     /locus_tag="RPD_0158"
     CDS             complement(179274..180227)
                     /locus_tag="RPD_0158"
                     /codon_start=1
                     /transl_table=11
                     /product="murein endopeptidase. Metallo peptidase. MEROPS
                     family M74"
                     /protein_id="ABE37398.1"
                     /db_xref="InterPro:IPR005073"
                     /translation="MRRRSIPARWLLAAALLSASAAAAWAQDKGTVNPKPLPPLANPN
                     DPELAARELFARRYLPAALPARPIGFYARGCLAGGEALPLTGATWQVMRLSRNRYWAY
                     PPLVALVERLSKRANSEAGWPGILVGDMSQPRGGPMLTGHASHQVGLDADIWLTPMPN
                     RQLSRNEREEMSAVMMVRRDRLDIDPAAWTPTHHRVIRAAAQEPAVERIFVNAAIKKA
                     LCREAKGDRGWLNKVRPMYGHDYHFHIRIKCPPGAIGCEAQPEPPQGEGCGADLDYWF
                     SDAVLHPKPPKEPPKPKKPMTLADLPAECRAVLNAPDQKPD"
     gene            180631..182859
                     /locus_tag="RPD_0159"
     CDS             180631..182859
                     /locus_tag="RPD_0159"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase/phosphodiesterase"
                     /protein_id="ABE37399.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001633"
                     /translation="MPQIRLKANKTSKRCAGAALRKRRRAVRKGPGPSTVPKRPVRAG
                     LAAERERAVAQALAEARKSHERLREAIDLVPQGIVFLDSEGRYILWNKRYAEIYKASA
                     DMFKPGARFQDTLRVGIARGDYPEAIGREDDWIAERMQRMFHPSHSHEQILADGRCIQ
                     IEECTTSDGGVIGLRVDITELKQREASFRLMFDSNPVPMIVCALRDERILAVNDAAVA
                     HYGYSSVEFAQLTLRRLQAFESDLPWAGDHTDDERAARTWKHVKADGSLIDLAIYSRQ
                     LTYNGEPAVLLALMDITERKRAEMRLAFMTHHDGLTGLPNRNLLRKRLDELLVHTRRA
                     SDKIAVLFIGIDHFKAVNDTLGHAIGDKLLRGVARRLRSTLREEDLLARLNSDEFAVV
                     QTGIRRPQEITLLAKRLLNAIAEPYLLDGHSVVAGASIGIAVAPVDGDDSEKLLMNAD
                     MALSRAKNDSRGSFSFFEPGMDARAQARRKIETELRTALRNEVLRPYYQPLVELSSGR
                     ISGCEALVRWPHPDRGMISPAEFIPVAEDTGLINAIGAQVLRQACLDASRWPGDIRVA
                     VNLSPLQFRVGNLMATVMDALKYAGLPPHRLEIEITETLLLEKSSQVIATLHALRALG
                     VRISMDDFGTGYSSLSYLRSFPFDKIKIDQSFVRDLCNNREAQAIVRAIISLGMGLGV
                     TITAEGVETEAELSWLRAEGCHEAQGFLFSAARPNEEIKGLLDLQQSAAPDQQFPAAR
                     VA"
     gene            complement(183064..184008)
                     /locus_tag="RPD_0160"
     CDS             complement(183064..184008)
                     /locus_tag="RPD_0160"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37400.1"
                     /translation="MGVVLDAIGKVIANYLQKEEPGYEPFTPSDPDHLRSIMQPGDVL
                     LVEGNARISGIIKYLTQSTWSHAALYVGPIDGATEPDGEPHVLIEANIGEGVSSSPLS
                     RHLSYHTRICRPVGLSHEDRHTVCRYAINRIGFGYDTKNIIDLMRYLVPLPVPQRWRR
                     RMIALGSGDPTKIICSALIAQAFDSVRYPILPKITRAGSRKARREILHIRDSSLYMPR
                     DFDISPYFEVVKPTIINGFDYTALHWADKQKPLAEVAGPFNTFQDDLENASSFAPETI
                     DAEAPAMGGANQAPAVILSRTHWQHPEPRTLAPLEASS"
     gene            184346..185770
                     /locus_tag="RPD_0161"
     CDS             184346..185770
                     /locus_tag="RPD_0161"
                     /codon_start=1
                     /transl_table=11
                     /product="Twin-arginine translocation pathway signal"
                     /protein_id="ABE37401.1"
                     /db_xref="InterPro:IPR000205"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR013027"
                     /translation="MTISRRSLLGAAAGLVVLPAFASRAFAALPREVDVVVVGAGAAG
                     IAAARRIVAAGRKVIVVEASAQAGGRCLTDADGFDAPFDRGARWLHNPDSNPIIRLAR
                     SVGVDIVPAPPGQKIRIGRRNARARETEDYLATLVRASRAIDDAARGKVDVASAAALP
                     NDLGDWGATIAFVLGPHVSGKDLKELSALDESRAPDRNALSGARQGLGTLLSRLAAPL
                     PLALSTPVTRIVWNGRDTGVETASGRITARAVIVTASTNVLASGAIKFTPELPKRQLD
                     AAAKLGLGSYDRIALQFKGNPLGLSRDEVIVEQSNSARTAALYANINGSSLCTVDIGG
                     AFGRDLSAQGEAAMQAFALEWLGKLFGSDITAAVERKAATRWNASPFVLGAMSAAAPG
                     GQPSRKVLAEPLGNLFIAGEATSETLWGTVQGAWESGDRAAEAALKRIGALKSDEPAK
                     PERKPKKRRTYEATGAAEQWPGLR"
     gene            complement(185997..188471)
                     /locus_tag="RPD_0162"
     CDS             complement(185997..188471)
                     /locus_tag="RPD_0162"
                     /EC_number="6.1.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase beta subunit"
                     /protein_id="ABE37402.1"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR004532"
                     /db_xref="InterPro:IPR005121"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /translation="MSQLQHSARRQHSARRKSQPMKLTLSWLKDHLDTDETLTALADK
                     LTMIGLEVEDITDKAKALAPFTIARVLSAEKHPNADKLQVCSVDTGDGGAPVQVVCGA
                     PNARAGLITVFSPPGTFIPGKNITLGVGNIRGVESRGMLCSAAELQISEDHDGIMELP
                     ADAPIGKAYAEWAGLGDPVLDINLTPNRQDCAGVHGIARDLAAADMGKLKESGIKPIK
                     GEFPCPVQVSVEDDKLCPGFALRLVRGVKNGPSPEWLQKRLTAIGLRPINALVDITNF
                     LTFDRSRPLHVFDAAKVKGNLVVRRARDGETLLALDGRNYNLDPGVCVIADDHGVESL
                     AGIMGGEASGCSAETTDVLIESALWNEINIAQSGRKLGINTDARYRFERGVDPAFMVP
                     GLDLATRLVIEFCGGTPSEMVVVGRTFGDDRIIDFPLSEVKRLAGIDVPLAEARRILT
                     HLGFMVAGQGAVVKVAAPSWRSDVHGKADIVEEIVRIVGVDKVPMTPFERGDAPRKPV
                     LTPIQTRTRRAKRALAARGLTEAVTWSFIAKPSAEAFGGGQPELALANPIASDLSDMR
                     PSLLPGLVAAAQANADRGTPDLALFEVGQIFKGDRPQDQFVAASGVRRGVASSNGLGR
                     HWSGSAPASALDAKADAFAVLAAAGAPMAGLQIATGKALPAWLHPGRSGAIQIGPQNV
                     LGYFGELHPRVLEQLHADGPLVGFEVILDNIPAAKQRPTRAKPSLELSAFQPVSRDFA
                     FIVDRKVQAADIVRAAQSIDKKLISSVVVFDVYEGKGVDPDKKSVAIAVSLQPRDKTM
                     TDQEIDAVGAKIVAEVTKKTGGVLRG"
     gene            complement(188553..189137)
                     /locus_tag="RPD_0163"
     CDS             complement(188553..189137)
                     /locus_tag="RPD_0163"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF559"
                     /protein_id="ABE37403.1"
                     /db_xref="InterPro:IPR007569"
                     /translation="MMKALSSPHDALPRPLAGEGWGEGDTGTELAMDDPKQPSWNVSP
                     SLRRHARELRKTSTDAERLMWSALRDKQLNGFSFRRQVPIGPFIADFACHSVKLVVEI
                     DGGQHFSDDAERADASRTALIEARGFRIVRFSNAEVMSNRDGVLQSIAAELAASAPTP
                     TLPRKRERERAKRAAKQRPEQIDSKQRPAAGDAD"
     gene            complement(189275..190357)
                     /locus_tag="RPD_0164"
     CDS             complement(189275..190357)
                     /locus_tag="RPD_0164"
                     /EC_number="6.1.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase, alpha subunit"
                     /protein_id="ABE37404.1"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004188"
                     /db_xref="InterPro:IPR004529"
                     /db_xref="InterPro:IPR006195"
                     /translation="MSNLENLQTQILADIAASSDEAALEAVRVGALGKKGSISALLAT
                     LGKMDPEQRKTEGAAINLAKEAVTQALTARRDLLKAAALDAKLAAETIDVTLPLREPL
                     AEQGRIHPLSQVWDELTAIFADMGFAIAEGPDIETDDNNFTRLNFPEGHPAREMHDTF
                     YFNPKEDGSRLLLRTHTSPVQVRTMLSQRPPIRVICPGRTYRSDSDQTHTPMFHQVEG
                     LVIDKGSHLGHLKWILAEFCKAFFEVDNVNMRFRPSFFPFTEPSLEVDIQCRRGNGEI
                     RFGEGEDWLEILGCGMVHPNVLTACGIDPEVYQGFAWGMGIDRIAMLKYGMADLRQLF
                     EADSRWLNHYGFKPLDIPSLAGGLSS"
     gene            complement(190501..190860)
                     /locus_tag="RPD_0165"
     CDS             complement(190501..190860)
                     /locus_tag="RPD_0165"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L20P"
                     /protein_id="ABE37405.1"
                     /db_xref="InterPro:IPR005812"
                     /db_xref="InterPro:IPR005813"
                     /translation="MARVKRGVTAHAKHKKVYKLAKGFRGRRKNTIRAAKAAVDKAGQ
                     YAFRDRKRKKRTFRALWIQRINAAVRPLGMTYSVFINGLAKSGVIVDRKVLSDLAITE
                     PAAFQAIAEKAKAALAA"
     gene            complement(190948..191148)
                     /locus_tag="RPD_0166"
     CDS             complement(190948..191148)
                     /locus_tag="RPD_0166"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L35P"
                     /protein_id="ABE37406.1"
                     /db_xref="InterPro:IPR001706"
                     /translation="MPKLKTKSGAKKRFKVTATGKVMSAQRGKRHGMIKRTKKQIRQL
                     RGTRVIFKTDGDNIKKYFLPNA"
     gene            191512..191937
                     /locus_tag="RPD_0167"
     CDS             191512..191937
                     /locus_tag="RPD_0167"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37407.1"
                     /translation="MNAPARSHARRFFPGITRTGLLAAAALLAALVAASGDAEAAKRR
                     AGGNFDGVWNVVFATRAGNCGPTYNAPFAVQGRRVSSAGGGKVTGGITGGGNVAVRLS
                     VGASVANGRGRLAGNSGTGTWSGLIEGDRCSGTWQATRG"
     gene            complement(192320..192718)
                     /locus_tag="RPD_0168"
     CDS             complement(192320..192718)
                     /locus_tag="RPD_0168"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterial translation initiation factor 3
                     (bIF-3)"
                     /protein_id="ABE37408.1"
                     /db_xref="InterPro:IPR001288"
                     /translation="MAMEAGMDLVEISPNVSPPVCKIMDYGKFKYSAQKKAAEARKKQ
                     KIVEIKEIKLRPMIDDHDYDVKMKAMQRFFEEGDKVKITLRYRGREMAHQEIGTKLLE
                     KVKADVAEIAKVEQDARFEGRQVVMVLAPR"
     gene            193195..193992
                     /locus_tag="RPD_0169"
     CDS             193195..193992
                     /locus_tag="RPD_0169"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37409.1"
                     /db_xref="InterPro:IPR000379"
                     /translation="MTNSAAAPKGSDPAFISVGEGAAERRIAVRARAGHAPGLFWLGG
                     FNSDMTGTKAVALDGWAAERGRACVRFDYSGHGSSSGAFADGTISRWLEDSLAVFDRF
                     ATGPQVVIGSSMGGWMALLLARELIRRGGEGQTKLAGLVLIAPAPDFTEALMWKGFSP
                     EIRRQIETEGVWMRPSDYGDAYPITRALIEDGRNHLLLGGAISVGCPVRILQGKQDPD
                     VPWTHAFALTERLPCEDVVLTLIQDGDHRLSRPQDIARMLAAVEEIG"
     gene            complement(194098..195240)
                     /locus_tag="RPD_0170"
     CDS             complement(194098..195240)
                     /locus_tag="RPD_0170"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin, iron-sulfur binding"
                     /protein_id="ABE37410.1"
                     /db_xref="InterPro:IPR001450"
                     /translation="MAKQGQALGFDAIGICAPDSIPFALDRLRDYLASGFHGEMAWLA
                     DRPERRTDPRVMWSEVRSVVMLGVNYGPQSDPRHILGAKDRGAISVYAQGDDYHDVIK
                     ARLKQLARWLVATAGGEVKVFVDTAAVMEKPLAQAAGLGWQGKHSNLVSRELGSWLFL
                     GAIFTTLELPRDAAERDHCGSCRACLDSCPTAAFPEPYRLDARRCISYLTIEHKGPIP
                     HEFRQPIGNHIYGCDDCLAACPWNKFAQVGREAKLAARDALRAPALGELVRLDDAAFR
                     ALFTKSPVKRIGRDRFIRNVLIAIGNSGDAELAGEAERLLVDAHPVVRGAAVWALAQL
                     LPGDQFAALKAARLGDEPDESVRAEWVGALPSPLVGEGGTDAVRAG"
     gene            complement(195300..195992)
                     /locus_tag="RPD_0171"
     CDS             complement(195300..195992)
                     /locus_tag="RPD_0171"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase-like"
                     /protein_id="ABE37411.1"
                     /db_xref="InterPro:IPR004046"
                     /translation="MYTLFHHPFCPQSRFVRLALGEHGLDLRLVEERSWERRTAFLAL
                     NPAGTTPVLVAEGQPPIPGAGVIAEFLDESHGAALGDRRLLPHGTAERIEVRRLLAWF
                     NEKFFEEASGPLVTERIYKRFMSEEDGGGPPAMDVIRAATANVRYHLAYIGWLARTRN
                     FLAGDRMTYADLAAAAHLSAIDYLGDVPWIEDEAAKAWYARIKSRPSFRPLLSEWLAG
                     VPASRTYVDLDF"
     gene            196204..197010
                     /locus_tag="RPD_0172"
     CDS             196204..197010
                     /locus_tag="RPD_0172"
                     /EC_number="3.6.1.27"
                     /codon_start=1
                     /transl_table=11
                     /product="Undecaprenyl-diphosphatase"
                     /protein_id="ABE37412.1"
                     /db_xref="InterPro:IPR003824"
                     /translation="MLFDIFRAVILGVVEGVTEFLPVSSTGHLLLVGRFFNLGEDSFW
                     KSFAVLIQLGAILAILSIYFAKLWRIALGMFSDPAARRFVIGVLVAFLPAAMIGAVAG
                     SYIKLYLFNPWVVCFSLIVGGAILLWVDQLDLNPQQHDATAFPLPMYFYIGCAQCLAM
                     IPGVSRSGASIVAAMLFGADKRSAAEFSFFLAIPTMVGAFVYDFYKNRGEMTTDHLTI
                     VAIGFVVSFITAVIVVKTFLGYVTRHGFELFAWWRVIVGTLGLIALAMGR"
     gene            complement(197071..198036)
                     /locus_tag="RPD_0173"
     CDS             complement(197071..198036)
                     /locus_tag="RPD_0173"
                     /codon_start=1
                     /transl_table=11
                     /product="3-beta hydroxysteroid dehydrogenase/isomerase"
                     /protein_id="ABE37413.1"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR005913"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="InterPro:IPR013120"
                     /translation="MNTNIDTLVTVFGGSGFIGRHVVSALARRDYRIRVAVRRPELAG
                     HLQPLGRVGQIHAVQANLRHPASVAAAMRGAHVAINLVGILAEGGAQKFDAVQAEGAA
                     AIAKAAAAVGARMVHVSAIGADANSPAGYARSKAAGEQAVLSAVPQATILRPSVVFGP
                     EDQFTNRFAALARISPVVPLVGADTKLQPVYVGDVATAVAEAVDGNTRPGATYELGGP
                     EQLTMREIIEIILETIDRKRMLLPLPFGLARMQAMLLQFAPGDLKLTPDQVELLKVDN
                     VVSDAAKSAGLTLQGLGVTPDSMQAIVPSYLWRFRKTGQFARKGA"
     gene            198196..198282
                     /locus_tag="RPD_R0003"
                     /note="tRNA-Leu1"
     tRNA            198196..198282
                     /locus_tag="RPD_R0003"
                     /product="tRNA-Leu"
     gene            198454..199068
                     /locus_tag="RPD_0174"
     CDS             198454..199068
                     /locus_tag="RPD_0174"
                     /codon_start=1
                     /transl_table=11
                     /product="3'-5' exonuclease"
                     /protein_id="ABE37414.1"
                     /db_xref="InterPro:IPR002562"
                     /translation="MTIRLHRGDLPDLSRYTNSVAIDTETMGLHPHRDRLCVVQLSNG
                     DGSADVVQIPQGHSDAPNLKKLLGDPTVVKIFHFARFDLAALYNAFGVMPQPVYCTKI
                     ASRLTRTYTDRHGLKDLVRELLNVDLSKQQQSSDWGAETLSDAQLAYAASDVLHLHGL
                     REKLDAMLARENRTDLAQACFGFLPHRSRLDLDGWSEEDIFAHS"
     gene            199311..200081
                     /locus_tag="RPD_0175"
     CDS             199311..200081
                     /locus_tag="RPD_0175"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37415.1"
                     /translation="MASVQTAAYHTSMEARFAAAARHSRLVRTLRVAVPLVVALSLAA
                     ILAISIFNPFRLLSKLPIDIGDLVVSGTKITMESPHLAGFTNDGRPYEMWARSATQDL
                     TSQDHVDLHTLRAKVVSDDQSTVLIQARDGKFNTKAQLLNLQKDVYLRTSTGSEAWMT
                     QADIDMGKGNVSSDEPVDVKWLGGTLRGQRLRITEKGDVIRFEGGVVMNLDNANLPEP
                     AEETDTRAQPAPAAVPNADAAAKSKSSQPGQRREVNRP"
     gene            200078..200743
                     /locus_tag="RPD_0176"
     CDS             200078..200743
                     /locus_tag="RPD_0176"
                     /codon_start=1
                     /transl_table=11
                     /product="OstA-like protein"
                     /protein_id="ABE37416.1"
                     /db_xref="InterPro:IPR005653"
                     /translation="MTNARCLLARRKLLAIAGAAFLAGSANLSGALAQSAVQGVPNAM
                     QGFSQNRDQPIQIESDTLEVRDKKKEATFTGSVKVVQGDTTMTSKTLVVFYDQDQSET
                     SAKQAKRKAMPAAAPGPGGTSSIRRLEAKGNVVVTQKDQVVTGDSAVFDTKTNLVTML
                     GSVVLTQGKNVVRGDRLLVDMTTGVSRVESNSGRVQGLFQSSGSGSGAPLGIGPPPAG
                     QKK"
     gene            200801..201754
                     /locus_tag="RPD_0177"
     CDS             200801..201754
                     /locus_tag="RPD_0177"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related"
                     /protein_id="ABE37417.1"
                     /db_xref="InterPro:IPR001687"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MVDLLGMFRRRAAKPSGFGRTRMDITALQGEVGDMLTAPVRDAP
                     PVAHAGATEPTQTPTPAPARPRRPAATQPRESHTGYLAVHRVEKSFGTRKIVRGVSIY
                     VRRGEAVGLLGPNGAGKTTVFYMITGLIKADRGAIELDGHDVTKLPMYQRARLGIGYL
                     PQEASIFRGLNVEQNIRAVLEAVEPDKRKREAELDNLLHEFNIERLRKSPSIALSGGE
                     RRRVEIARALASRPNYMLLDEPFAGIDPIAVGDIQDLVRHLTNRGIGVLITDHNVRET
                     LGLTDRAYIVYAGEILTEGSPEEIVNNPDVRRLYLGEEFRL"
     gene            201922..203562
                     /locus_tag="RPD_0178"
     CDS             201922..203562
                     /locus_tag="RPD_0178"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54 factor, core-binding region"
                     /protein_id="ABE37418.1"
                     /db_xref="InterPro:IPR000394"
                     /db_xref="InterPro:IPR007046"
                     /db_xref="InterPro:IPR007634"
                     /translation="MALTQRLEFRQSQSLVMTPQLMQAIKLLQLSNLDLAVFVEDELE
                     KNPLLDRASDNAEPLVAGEASMDRAENAGDEFGGSEAGGEASDFADNAGGDSFEPGSE
                     EWMHRDLGSRSEIEQTLDTGMENVFPEEPAEAAARAAQDAAPASYTEWGGGASSDEGY
                     NLEAFVAAETSLADHLSEQLAVALSSPSERMIGQYLIDLVDDAGYLPADLGEAAERLG
                     TTQTEVEAVVGVLQTFDPPGICARSLAECLAIQLRELDRFDPAMQALIEHLDLLAKRD
                     VVSLRKICGVDDEDLADMIGEIRHLDPKPGLKFNSSRVQTVVPDVFVRPGPDGGWLVE
                     LNSDTLPKVLVNQSYYSELSKTIRKDGDKSYFSDCLQTATWLVRALDQRARTILKVAT
                     EIVRQQDGFFTHGVAHLRPLNLKAVADAIQMHESTVSRVTANKYMATNRGTFELKYFF
                     TASIASADGGEAHSAEAVRHHIRQLIDGEDPSAILSDDTIVERLRGAGIDIARRTVAK
                     YREAMRIPSSVQRRRDKHSMLGTALTAPADRSRDTAPA"
     gene            203618..204226
                     /locus_tag="RPD_0179"
     CDS             203618..204226
                     /locus_tag="RPD_0179"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma 54 modulation protein / SSU ribosomal
                     protein S30P"
                     /protein_id="ABE37419.1"
                     /db_xref="InterPro:IPR003489"
                     /translation="MTIRVSGKSISVGEALRGRVSERTEEVLRKYFDGNYSGHITLSK
                     DGFGFRTDCSLHLDSGITLEAESNAADAYVSADQALLQIEKRLRRYKSRLKDRSSRKA
                     HAEATALAELTAPVDMPSYVIEAPGDEEHHEDAYNPVIIAEATTAMKRLSVSEAVVEL
                     DLTGAPVLIFLHGGSGRVNIIYRRADGNIGWIDPPSLNGAAA"
     gene            204510..204971
                     /locus_tag="RPD_0180"
     CDS             204510..204971
                     /locus_tag="RPD_0180"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS IIA-like nitrogen-regulatory protein PtsN"
                     /protein_id="ABE37420.1"
                     /db_xref="InterPro:IPR002178"
                     /db_xref="InterPro:IPR006320"
                     /translation="MTITDLVAPEAVIPALKVISKKQALQELSARAAELSGQNERAVF
                     EVLLQREKLGTTAVGYGVAIPHGKLPKLERLFGLFARLERPIDFEAMDGQPVDLIFLL
                     LAPEGAGADHLKALARIARLLRDQDVAKKLRASRDAQAIYSVLALPPATVA"
     gene            complement(205475..205741)
                     /locus_tag="RPD_0181"
     CDS             complement(205475..205741)
                     /locus_tag="RPD_0181"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF1150"
                     /protein_id="ABE37421.1"
                     /db_xref="InterPro:IPR009531"
                     /translation="MAELGTNHENVRVTPEALAHLGEGHIAYVKQIRSEDVPGLFPQA
                     PQIAPGLKLFALHSADGTPIMLTDSREAAVANAWSQELQAVSVH"
     gene            complement(205792..206217)
                     /locus_tag="RPD_0182"
     CDS             complement(205792..206217)
                     /locus_tag="RPD_0182"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein Hsp20"
                     /protein_id="ABE37422.1"
                     /db_xref="InterPro:IPR002068"
                     /translation="MSRVPTLSSPFLLGFDEIERALDRVVKGADGYPPYNIERCERGN
                     GDPEKLRITLAVAGFTRDQLDVTIEENQLVIRGRQQDDKTRQYIHRGIAARHFQRTFV
                     LAEGMQVLGADLKNGLLSIDLVRPEPERVIKTIAITEHE"
     gene            complement(206368..207462)
                     /locus_tag="RPD_0183"
     CDS             complement(206368..207462)
                     /locus_tag="RPD_0183"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related"
                     /protein_id="ABE37423.1"
                     /db_xref="InterPro:IPR001687"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MANVVLRNVRKTYPGGFEAIKGVDLEVGDGQFCVLVGPSGCGKS
                     TLLRMVAGLETITAGEIDIGGRVVNDVEPADRDIAMVFQNYALYPHMSVYNNMAYGLR
                     NRGMAKPEIEARVQEAARILEIGAMLDRKPRQLSGGQRQRVAMGRAIVRQPKVFLFDE
                     PLSNLDAKLRVAMRVEIRKLQRRLSTTAIYVTHDQLEAMTLADILVVMNAGQVEQIGS
                     PLDVYAKPATTFVASFIGAPPMNLIPLDAEGVRARFGGAVTEAGVLGVRPEDLAISSE
                     PPAPGGLTLDLAVEAIERVGPETFVYGTRSPGGDLAAISSKPGELPPDEIIIRIPGQE
                     APAIGQRISVVALRHNLHLFSADGRRRIAV"
     gene            complement(207468..208316)
                     /locus_tag="RPD_0184"
     CDS             complement(207468..208316)
                     /locus_tag="RPD_0184"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ABE37424.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MVEHRKFGNLLPHLVLWTGVLIVAFPVYIAFVASTQDNATIANG
                     QMSLLPGGHFLETYYKTLFVGTSGTTREPVGTMLFNSFVMAMMIAVGKIAISLISAYA
                     IVYFRFPFRMTIFWLIFITLMLPVEVRIYPTYKIVADLHLLDSYAGLTLPLIASATAT
                     LLFRQFFMTVPDELLEASRIDGAGPFRFFWDTLLPLSRTNMAALFVILFILGWNQYLW
                     PLLITTRDDMQTIQIGIRKMIVTSDALTEWPVVMATAILAMLPPVAVVVLMQKLFVRG
                     LVETEK"
     gene            complement(208316..209230)
                     /locus_tag="RPD_0185"
     CDS             complement(208316..209230)
                     /locus_tag="RPD_0185"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ABE37425.1"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR000515"
                     /translation="MTAVRAGRSRIMQKQSVFHSKFLPYMLVLPQLAVVLVFFYWPAV
                     QAVIQSFLLQDAFGLSTTFVWFDNYRELLSDPDYFSAILRTFLFSVAIALSSLSLALL
                     LAVMADRPLRGSTFYRTLLIWPYAVAPPVVGVLWVFMLNPSLGVIAHGLRAIGIDWNP
                     LLDGNQAATLIILAAAWKQISYNFLFFLAGLQAIPSSVIEAAAIDGARPMRRFWTIIF
                     PLLSPTIFFLIVVNIVYAFFETFGIIDTMTRGGPAKATETLVYKVYSDGLLGGNLGSS
                     AAQSVILMGIVIALTAFQFRFVERKVNY"
     gene            complement(209323..210648)
                     /locus_tag="RPD_0186"
     CDS             complement(209323..210648)
                     /locus_tag="RPD_0186"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein, family 1"
                     /protein_id="ABE37426.1"
                     /db_xref="InterPro:IPR006059"
                     /translation="MAFRFFGPTAAATAIAATLAIATPAHAATEIQWWHAMTGGNNDV
                     VVKLANDFNAAQSDYKVVPSYKGGYADTMNAGIAAFRAGNAPHIMQVFEVGTATMMAA
                     TGAVKPVYKLMQETGEPFDAKAYLPAITGYYSTSKGEMLSFPFNSSSMVMWVNLDALK
                     KADIAEIPKTWPEVFEGAKKLKAAGYATCGFSTAWVTWAHVEQLSAWHNVPLASKANG
                     LDGFDTKLEFNGPVQVKHLDKLIELQKDKTFDYSGRTNTGEGRFTSGECPLFLTSSGF
                     FGNVKSQAKFNWTSAPMPYYPDVKGAPQNSIIGGASLWVMGGKTPEEYKGVAKFLAFL
                     SDTDRQVAVHKASGYLPITMAAYEKAKAEGFYKEAPYLETPIKELTNKPPTENSRGLR
                     LGNMVQLRDLWAEEIEQALAGKKTAKEALDAAVTRGNTMLRQFEKTAVK"
     gene            complement(210854..212059)
                     /locus_tag="RPD_0187"
     CDS             complement(210854..212059)
                     /locus_tag="RPD_0187"
                     /EC_number="2.8.3.16"
                     /codon_start=1
                     /transl_table=11
                     /product="L-carnitine dehydratase/bile acid-inducible
                     protein F"
                     /protein_id="ABE37427.1"
                     /db_xref="InterPro:IPR003673"
                     /translation="MTAALMPGAMAGLRVIDLTRVLGGPYCTQILADHGADVIKVEPP
                     AGDEVRDWGPPFHDDDAAYFIGINRNKRSIGLDLASPGGRDVLLEMLKDADVLIENFK
                     PGTLDKWGLGNDIVREKFPRLVHCRISGFGADGPRGGNPGYDAIIQAMTGMIAATGSP
                     ESGPMRIGVPLVDITTGLYAAIGILMALSERQRSGKGQFLETTLYETGLAIMHPHTAN
                     YFLHGKPPALTGNEHPNLVPYAIFEARDGKIFTGVGNDGTFRKLCKEIGKPELGTDPR
                     FARNKDRIANRAALRTELEAVFRQHDAAPLCDRLLDAGLPAGPVQSIDKALTSPHTTH
                     RGDVIEQDWYKGVASPIRFERTKASLRGLPPKFSQHAGEVLGEFGYSPDEISKLVADG
                     VVSGPERKR"
     gene            complement(212220..212295)
                     /locus_tag="RPD_R0004"
                     /note="tRNA-Ala4"
     tRNA            complement(212220..212295)
                     /locus_tag="RPD_R0004"
                     /product="tRNA-Ala"
     gene            complement(212363..212821)
                     /locus_tag="RPD_0188"
     CDS             complement(212363..212821)
                     /locus_tag="RPD_0188"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37428.1"
                     /db_xref="InterPro:IPR012644"
                     /translation="MATSQVKHRFSRNPKVAQVAKSDLGTKRICPTTGKKFYDLNKNP
                     VISPYTGEVVPIAPVVAPRTRADSRSAAAPAAAEAPEAMEAEELVSLEEADAEEKTGK
                     VKAIVPESEDDIEIDESIEDDDDSTFIADEEEGDEDVTDIIGDVSGDEET"
     gene            212916..214253
                     /locus_tag="RPD_0189"
     CDS             212916..214253
                     /locus_tag="RPD_0189"
                     /EC_number="2.5.1.19"
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="ABE37429.1"
                     /db_xref="InterPro:IPR001986"
                     /db_xref="InterPro:IPR006264"
                     /translation="MSHSDQTSPLEARKSAALSGTARVPGDKSISHRALILGALAVGE
                     TRISGLLEGQDVIDTGKAMRALGARVERTGEFAWTVRGVGVAGFAQPEAPLDFGNSGT
                     GCRLAMGAVAGSPITATFDGDASLRSRPMRRIVDPLEQMGARVIQSHEGGRLPLTLQG
                     ARDPLPITYRTPVPSAQIKSAVLLAGLSAPGVTTVIEAEASRDHTELMLQHFGATLVT
                     EPEGAHGRKISLTGQPELRGARVVVPADPSSAAFPMVAALLVPGSDIVLTEVMTNPLR
                     TGLITTLREMGGAIEESETRDDTGEPMAQFRIRGSRLRGVEVPPERAPSMIDEYLVLA
                     VAAAFAEGTTVMRGLHELRVKESDRLEATADMLRVNGVKVEIVGDDLIVEGKGHVPGG
                     GLVATHMDHRIAMSALVMGLAADRPVKVDDTAFIATSFPDFVPMMRRLGGELA"
     gene            complement(214271..214945)
                     /locus_tag="RPD_0190"
     CDS             complement(214271..214945)
                     /locus_tag="RPD_0190"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF374"
                     /protein_id="ABE37430.1"
                     /db_xref="InterPro:IPR007172"
                     /translation="MATPAFVKRILRSDAFQWTAVIPAAIYFQFVMWTGRFDRAPFPI
                     AEPYILAMWHGRLNMLPMLRNGSKPLVALISGHRDGQIISKAGTVFGIQTAVGSSSKG
                     GMRAAREMLRLARDGHSLFVTPDGPRGPRMHINNDGILDLARLTGLPILPVAVSLQRG
                     KLLRSWDRLMLPGLFSRVAIRFGEPVIVDADADRAEIRARLSASLTAAQQETDRLVGR
                     IPVEPA"
     gene            215116..215754
                     /locus_tag="RPD_0191"
     CDS             215116..215754
                     /locus_tag="RPD_0191"
                     /EC_number="2.7.4.14"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidylate kinase"
                     /protein_id="ABE37431.1"
                     /db_xref="InterPro:IPR003136"
                     /db_xref="InterPro:IPR011769"
                     /db_xref="InterPro:IPR011994"
                     /translation="MIIAIDGPAASGKGTLGKRLAAHYGFRHLDTGVIYRAVAKALLD
                     GGADLTDEARAVAAARKLDPGIFGDPALKSQTVGDAASVISAYAPLREALVSFQRQFA
                     ADPPGAVLDGRDIGTVICPDADVKIFVIADPVVRARRRTLEALARGEAADEARVLADI
                     LKRDERDRNRSAAPLTQAPDAVLLDNSNLDIEGGVRAAIDIVEAVRAGRRRV"
     gene            216049..217746
                     /locus_tag="RPD_0192"
     CDS             216049..217746
                     /locus_tag="RPD_0192"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S1P"
                     /protein_id="ABE37432.1"
                     /db_xref="InterPro:IPR000110"
                     /db_xref="InterPro:IPR003029"
                     /translation="MASTDTYNPTRDDFAAMLDESFAGGNLQESSVIKGIVVAIEKDM
                     AVIDVGLKTEGRVALREFAGPGRESELKVGDTVEVFLDRIENALGEAVLSRDKARREE
                     SWGKLEKAFQGNEKVFGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVAPLMNNS
                     QPFQILKMDRRRGNIVVSRRTVLEETRAEQRQELVQNLEEGQVIDGVVKNITDYGAFV
                     DLGGIDGLLHVTDIAWRRVNHPTEVLTIGQTVKVKIIKINHETHRISLGMKQLLDDPW
                     QGIEAKYPLNARFTGRVTNITDYGAFVELEPGIEGLIHVSEMSWTKKNMHPGKIVSTS
                     QEVDVQVLEVDSVKRRISLGLKQTMRNPWEVFVEKYPVGSTVEGEVKNKTEFGLFLGL
                     DGDVDGMVHLSDLDWKQPGEQVIDNFKKGDMVKAVVLDVDVEKERISLGVKQLEGDPF
                     AEPGDVKKGAIVTCEVLDVKESGIDVQIVGTDFATFIKRSELARDRNDQRSDRFAVGE
                     KVDARVIQFDKKARKVQVSIKALEVAEEKEAIAQYGSSDSGATLGDILGTALKQRDK"
     gene            217997..218977
                     /locus_tag="RPD_0193"
     CDS             217997..218977
                     /locus_tag="RPD_0193"
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide peptidase A. Serine peptidase.
                     MEROPS family S49"
                     /protein_id="ABE37433.1"
                     /db_xref="InterPro:IPR002142"
                     /db_xref="InterPro:IPR004635"
                     /translation="MSLDSDVIVDRRRIRRKLTFWRVAAVLVAIVAVVAVGAMVSPAG
                     QGGLATSSSIARIKIDGLIRSNSERVEALERLEKSQSAAVIVHINSPGGTTAGSEELY
                     NALMRLKAKKPMVVVVEGLAASGGYIAALASDHIIAQQSSLVGSIGVLFQYPNVSELM
                     KTVGVKVEEVKSSPLKAAPNGFEPTSPEARAALESLVRDSYAWFRDMVKQRRSMDDNQ
                     LGVVADGRVFTGRQALGLKLIDELGDEKTAVAWLETEKKIKSGLPVRDFKLSPQFGDL
                     AFLRVAASVTLDALGLGAIARQIEQSGAVQSVERLGLDGMLALWAPGGSR"
     gene            219124..219429
                     /locus_tag="RPD_0194"
     CDS             219124..219429
                     /locus_tag="RPD_0194"
                     /codon_start=1
                     /transl_table=11
                     /product="integration host factor, beta subunit"
                     /protein_id="ABE37434.1"
                     /db_xref="InterPro:IPR000119"
                     /db_xref="InterPro:IPR005685"
                     /translation="MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVDALARGDRVE
                     LRGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNREPGNTDTGA"
     gene            219442..219855
                     /locus_tag="RPD_0195"
     CDS             219442..219855
                     /locus_tag="RPD_0195"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37435.1"
                     /db_xref="InterPro:IPR001356"
                     /translation="MRGKASENDMQKFLTALVLIPLGLIFIVFAVANRHLVTVSFDPL
                     EPLNPMGTVQMPLFVLIIGVAILGVIAGGVATWVRQRHWRRAARRHQAEAIQAQTQLA
                     NLRASVVTPAQSEPKRLLLGQGSAAGRRDKTSAAL"
     gene            219911..220567
                     /locus_tag="RPD_0196"
     CDS             219911..220567
                     /locus_tag="RPD_0196"
                     /EC_number="5.3.1.24"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylanthranilate isomerase"
                     /protein_id="ABE37436.1"
                     /db_xref="InterPro:IPR001240"
                     /db_xref="InterPro:IPR003009"
                     /translation="MSVVVKICGLSTCDTLEAAVAAGADMVGFVFFPASPRHVGLDVA
                     RELSDQVGSRAAKVALTVDASDALIRDIVEILKPDLLQLHGSESPERVRALKQAFGLP
                     VMKAIAVATAADLAMLPAYAETADRILFDARPPKDATRPGGLGMTFDWELLRDLDLSL
                     PFMVSGGVNPGNVAAALRVTGAGGVDVSSGVERAPGAKDPELIRSFIRAARASEELMT
                     "
     gene            220569..221783
                     /locus_tag="RPD_0197"
     CDS             220569..221783
                     /locus_tag="RPD_0197"
                     /EC_number="4.2.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase, beta chain"
                     /protein_id="ABE37437.1"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR006653"
                     /db_xref="InterPro:IPR006654"
                     /translation="MNQILPNSFRSGPDERGHFGIFGGRFVAETLMPLILELEKAYAE
                     AKDDPAFRTEMDGYLKHYVGRPSPLYFAERLTEHFGGAKIYFKREDLNHTGAHKVNNV
                     LGQIMLARRMGKQRIIAETGAGMHGVATATMCAKFGLQCVVYMGAVDVERQQPNVLRM
                     KALGAEVRPVTSGANTLKDAMNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQEV
                     IGQEVREQILETEGRLPDSLIACIGGGSNAMGLFHPFLDDAGVVIYGVEAAGHGLSKL
                     HAASIAGGKPGVLHGNRTYLLMDDDGQIQEAHSISAGLDYPGIGPEHAWLHDVGRVNF
                     LSATDAEALDAFKLCCRLEGIIPALEPAHALAKVADLAPILPKDHLMVLNMSGRGDKD
                     LASVAEHLGGKF"
     gene            221783..222619
                     /locus_tag="RPD_0198"
     CDS             221783..222619
                     /locus_tag="RPD_0198"
                     /EC_number="4.2.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase, alpha chain"
                     /protein_id="ABE37438.1"
                     /db_xref="InterPro:IPR002028"
                     /db_xref="InterPro:IPR003009"
                     /translation="MTTRIDTRFAELKKQGRSAFVTFVMAGDPDLATSLQVLKALPAA
                     GADIIEIGMPFTDPMADGPAIQAAGLRALHSGATLSHTLGLVRDFRKDDDTTPMVLMG
                     YYNPIYIYGVDAFLADAKAAGVDGLIIVDLPPEEDSELCLPAMKAGLNFIRLATPTTD
                     EKRLPAVLANTSGFVYYVSITGITGSASADSAAVGDAVARIKRHTDLPVCVGFGIRTP
                     EAARAIAAEADGAVVGSALIDALQKSLDADNRATKATVGAVADLVASLAAGVRGAKQA
                     AE"
     gene            222727..223695
                     /locus_tag="RPD_0199"
     CDS             222727..223695
                     /locus_tag="RPD_0199"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-coenzyme A carboxylase carboxyl
                     transferase subunit alpha"
                     /protein_id="ABE37439.1"
                     /db_xref="InterPro:IPR000438"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR011762"
                     /translation="MNWLTNVVRPKIRNILRRETPENLWIKCPDTGQLVFYKDVEQNQ
                     FVIPGSNYHMRMGALARLRSVFDNETWYDVALPEVTADPLKFRDERKYADRIKDARTK
                     TGAHDAVKVGYGKLEGLGVVAAVQDFDFMGGSLGMAAGEAIIRGLELAVEKHAPFIMF
                     AASGGARMQEGILSLMQMPRTTVAVQMLREAGLPYIVVLTNPTTGGVTASYAMLGDIQ
                     LAEPGALIGFAGARVIEQTIREKLPDGFQRAEYLRDHGMVDMVVHRHELRPTLARLCR
                     ILTKTPLPAVEEIAASDDAAQDAEAAAATEIVVTPPEAPSPTAPQA"
     gene            223692..225038
                     /locus_tag="RPD_0200"
     CDS             223692..225038
                     /locus_tag="RPD_0200"
                     /EC_number="6.3.2.17"
                     /codon_start=1
                     /transl_table=11
                     /product="FolC bifunctional protein"
                     /protein_id="ABE37440.1"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR013221"
                     /translation="MSAATAPQPSALVGELRARLAQLHPAQIDLTLGRIERLLAALDH
                     PQRRLPPVIHIAGTNGKGSTLAFLRAILEAAGLSVHAYTSPHLVRVNETVRLGRPGGG
                     ALVSDDEFAAALAHCERVNQGAPITLFEIETAAALWLFAQHPADVTLLEVGLGGRLDA
                     TNVIDQPLACVLTPIGIDHTEFLGPTLADIAAEKAGIIRRGVPVIVAGQQNDAMDVIE
                     REAERLRAPLHARGQQWHVEVEHGRLAYQDDRGLMDLTAPKLFGRHQIDNAWLAIATL
                     RAQQRFTFDQAAYQAGLLSADWPARMQRLTTGRLIDEAPPGSELWLDGGHNADGGRVA
                     AAALGDLEERVSRPLVIIAGMMANKDASAFLTNFTGLTRHVIAVPIPDRDGAMPPEKL
                     ADAGRALGLRVELADSVEAALSRIAGLAYELPPRILITGSLYLAGHVLRLNGTMPS"
     gene            complement(225390..225710)
                     /locus_tag="RPD_0201"
     CDS             complement(225390..225710)
                     /locus_tag="RPD_0201"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="ABE37441.1"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="InterPro:IPR006663"
                     /translation="MSVGKVSDADFETEVLKAQGPVVVDFWAEWCGPCRMIAPALDEI
                     SGAMGDKVKIVKLNVDESPVTASKYGVMSIPTLMIFKGGEMASRQVGAAPKAKLQQWI
                     SSAV"
     gene            complement(225807..229286)
                     /locus_tag="RPD_0202"
     CDS             complement(225807..229286)
                     /locus_tag="RPD_0202"
                     /EC_number="3.1.11.5"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase/exodeoxyribonuclease V, subunit A"
                     /protein_id="ABE37442.1"
                     /db_xref="InterPro:IPR000212"
                     /translation="MSAPRSIPDQARERQILASDPSASVFVSANAGSGKTHVLVQRVI
                     RLLLDGVPPERILCITFTKAAAANMAERVFTTLGRWVTLDDEALTAAIKATGIKSVGP
                     SLLAQARKLFACALETPGGLKVQTIHALCTRLLQQFPFEANVPARFSVLDDRDQAELM
                     QRASLAVLLQAAAAPDSAAGRALTLAMTSAADVTFREVVQEACTRRDRFLAWITQAGG
                     VDGAMAQLSATLGVAPQDRCEDVERDILDGPNLPRAQWSTAAAMFESGSANDQAQAKR
                     LRAALALSDVAQLDKYCEVFFTKDGPRKSLATKKIADAAPGFVEDLKREGARLEDLLE
                     RRRALLMRERTRALLVIAADVAERIRREKQERGLLDYDDLIDKTLAMLDSGASSWVHF
                     KLDRGVDHVLIDEAQDTSPKQWDIVAHLIAEFTAGEGARDGVRRTVFAVGDEKQSIFS
                     FQGAVPKEFAERRDLLQRRFHGAGLNFEKVSFNYSFRSGATILQSVDHVFRDPDIYRS
                     IHADAAYPLHQSLADAGPSVIDLWPLELPDDKQNIEGWRAPFDAVSETSPEVRLAQKV
                     QAEIASLIAGGTMTGSLGDRRRLRFGDVLVLVRRRGSAFDAVIQALKRGGIPVAGADR
                     LKLTEHIAIIDLMNLADALLLPQDDLALAVALKSPLFGLDDDDLFRLAWRRKGSLRHA
                     LREKAAGDAKLATALQRLDACAERSQTDTPFGFYAWLLGGVGGRARILRRLGPEANDA
                     LDEFLELALSYEQKAAPSLQGFMAWLRAADTEIKRDMEISRDEVRVMTVHGAKGLEAP
                     VVFLVDTTSSPSDTQRLNLIRLPGGNAQPGSVGAMVWAGRKSNDPRVVEQARAEMVSE
                     TEDEYRRLLYVAMTRAADRLIVGGCMPGNRNEVRALSWYDLISKGLENSGLTMRTAPP
                     DGAVKRYCRPEDEVTEIAPSEQAPAAPPLVMPDWLHKAAPALRRPDNLLRPSDPDDAD
                     HRRIRRGETEAQRQRALQRGTLVHRLLQSLPDLPADIRANAADRFLLRNADDWSPQER
                     DALAARVLEVISDDRFAAVFAPGSRAEVPIVGRLQRHGEPVLISGQIDRLVVTDAEVL
                     IVDYKTNHAPPRSLAETPPAYVRQLALYRAVLSLLYPQRIVRAALLWTEAPEIMEISA
                     PALDAEQAALTVA"
     gene            complement(229283..232432)
                     /locus_tag="RPD_0203"
     CDS             complement(229283..232432)
                     /locus_tag="RPD_0203"
                     /EC_number="3.1.11.5"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase/exodeoxyribonuclease V, subunit B"
                     /protein_id="ABE37443.1"
                     /translation="MRVFSVPPSAPFLRTTIKALVDGELIAGFDARAKPERLAEATLY
                     LPTRRAGRLARDIFLDVLGADAVLLPRIVPLGDVDEDELAFAQAATGAADLDIPPALE
                     GLPRRLQLAQLIAVWAKGLRSGDPQQSPLVVGGPASTLALADDLARLIDDMATRGVDW
                     AALDSLVPDAFDRYWRLTLDFLKIAGQWWPQHLRESDQIEPAARRDLLIEAEAARLAA
                     HRGGPVIAAGSTGSMPATAKLLHAIARLPNGAVILPGLDTELDEQAWRLIGAVRDKQG
                     QLISPPSPNHPQFAMHGLLTRMGLERREIVRLGEAVRHGREVLASEAMRPSAATASWH
                     ERLADPEVDRLIEQGVNGLTVIEAPNSEIEALAIAVALREARERGQSAALVTPDRALA
                     RRVVAALGRWNLPVDDSGGDSLMETQAGIFARLAAEAALHGCEPATLLALLKHPLLRL
                     GRAAGGWRHAIETLELALLRGTRPAAGSEGLVKEFAKYRAELTRLKRGELSALHPSEP
                     RARLGDESLDAAQELIEALRAALAPLETVGAEPLDLCAFGRRHRDVLIALSIDHDEIA
                     VAFEGSQGSALLKAFDDLAAVEPLSGVLVPPHDYADVFETAFSDRIVRRPELAGAALR
                     IYGPLEARLTQHDRVILGGLVEGVWPPAPRIDPWLSRPMRHDLGLDLPERRIGLSAHD
                     FAQLLGADEVILTYANKVGGAPAVVSRFLHRLEAVTGKARWSAVKARGQSYLDYAQAL
                     DRPEQVTPIAQPAPRPPREARPLKLSVTAIEDWLRDPYTIYAKFILGLSAIDPVDMPL
                     SAADRGSAIHEALGEFTELFPDELPDDPAQVLREIGEKHFAPLMAHPEARALWWPRFA
                     RIAAWFGNWEQARRADGLRVFAERDGSLSIPLDGGRNFILSARADRIEHRADGSFAIL
                     DYKTGNPPTGKQVRMGLSPQLTLEAAILRDGGFEGIDAGSSVSELTYVKLSGNSPPGD
                     ECVLELRIERKDERQSPDDAAAEARSKLETLIRRFDDEAQPYHALVLSMWSRRYGRYD
                     DLARIKEWSAAGGGAEDRL"
     gene            complement(232504..233277)
                     /locus_tag="RPD_0204"
     CDS             complement(232504..233277)
                     /locus_tag="RPD_0204"
                     /codon_start=1
                     /transl_table=11
                     /product="Nucleotidyl transferase"
                     /protein_id="ABE37444.1"
                     /db_xref="InterPro:IPR005835"
                     /translation="MIQCARTNPVRSEQRATMSVQPSRAMILAAGFGVRMRPLTDHKP
                     KPLVAVAGKPLLDHVLDRLAEAGVAEAVVNVHYLPDQIIDHVAARSRPRVIISDERDA
                     VLGTGGAVVKALPLLGDQPFYHLNADTLWIDGVQPNLARLAEAFDPARMDILLLMAPT
                     ANSIGYAGKGDFAMAADGSLRKRKETEVTPFVYAGVAIMQPAIFKDAPQGEFSLTTMF
                     DRAAEQHRLFGLRLDGVWMHVGTPDAVAAAERAYLASVA"
     gene            complement(233402..233716)
                     /locus_tag="RPD_0205"
     CDS             complement(233402..233716)
                     /locus_tag="RPD_0205"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37445.1"
                     /translation="MVAERNKDGRVVFERGIRAQMMAIDGTWRRPCQLEDVSEAGAKL
                     TVVGAVEGLNLKEFFLLLSSTGLAYRRCELSWVNGDQIGVSFLRNDKKKKPGSRTSAT
                     AA"
     gene            complement(233930..235447)
                     /locus_tag="RPD_0206"
     CDS             complement(233930..235447)
                     /locus_tag="RPD_0206"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function UPF0079"
                     /protein_id="ABE37446.1"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR003442"
                     /translation="MSGSATFSVALANETATARLMAEIALLIGPGDVVTLSGDLGAGK
                     TSAARAMIRYLAGDDDLEVPSPTFTLVQSYELPPFPLLHADLYRVNDPSELEEIGLSP
                     LPDGAVALIEWPERAPGAMPSDRIDIALSHRPALGSMARAAEITGHGAAAARVERLAA
                     LRSFIEMSGYADADRRHMPGDASTRSYARLVKDGASLILMNAPRRPDGPALYGGKSYS
                     AAVHLAEDVRPFVAIAGGLRARGFSAPAIHYADLDSGFLITEDLGASGFISGTPPAPI
                     ADRYQAAADMLAALHGQTLPDTLPLPDEDYAIPVFDPAAMLIEVGLMPEWYLPDRGAP
                     ASDALRGEFIAMWRGLLGGLTDEAPTWVLRDFHSPNLIWLEQRSEIARVGVIDFQDTV
                     LGPAAYDLVSLLQDARVDVPEALELALFGRYIKTRRAAEPGFDPVAFARLYAVMSAQR
                     NTRLLGTFARLNRRDGKPQYLRHQPRIWTYLGRSLAHQSLAEVRAWYQANVPAPL"
     gene            complement(235444..237957)
                     /locus_tag="RPD_0207"
     CDS             complement(235444..237957)
                     /locus_tag="RPD_0207"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor signal transduction histidine
                     kinase"
                     /protein_id="ABE37447.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /translation="MSDVLGSMRRTCLSCTSLVRGLAGAGLLAASSPAWAADDPLATL
                     TSRFMFDFNRHELVTLAMAASVLGFSVVSAILLMRTRQRAAAQEAQLRADVQTLQAES
                     DRFRALLFAEPQVLISWSAGDDRPQISGDTALLLPQEVANAQPQRVLAFGTWLPPEPA
                     LQMDHAVDALLDKGEAFLLHLTTSTGRSIEAMGRAIGGQAILRIRELSGIRRELADMS
                     RRFKSLQDESEMLRGFANAAPWPIWTRRASGELSFANAAYARATDAGSAADAVNRNLE
                     LLDSNDRGNLARALNDNAQFAARLPIVVSGERRYFDVRALRLSGGSAGIAVDASEAAA
                     LGAALVRMAEAHRRTLDQLSSGVAVFDAQRRLAFYNDSYRRLWDLDRAFLDSNPDDSS
                     VIDRLRAARKLPEERDFREWKKKLHEAYRAVEPEKAIWYLPDGRAISIVTTPNQEGGV
                     TYLFDDVTESLELQRRYGGLIDVQRETLDNLTEAVAVFGSNGCAQLFNPAFTRMWNLS
                     PEALNNRPHIETVEEWCRPLFDDAVSWQALRSAITGIDDRKHVLLKLERKDGTVLSCK
                     TMPLPDGATMLTFLDISDTENVERALRERNEALETADRIKVDFVHHVSYELRSPLTTI
                     IGFAHLLGDPSTGPLNDKQSEYIAYITSSTNALMAIINNILDLASIDAGAMTLNLGPI
                     DIGRAIDAAAEGIQDRLARDQITLDVEIDPAVGEFVGDERRVVQVLYNLLANAVGFSP
                     NQATVTLVVHKIGAKVVFTVTDAGPGIAPELKDKVFDWFESHSQGSRHRGPGLGLALV
                     RSFVELHGGKVQVDSVVGRGTSVICEFPIEPSAQRNAAE"
     gene            complement(238137..238595)
                     /locus_tag="RPD_0208"
     CDS             complement(238137..238595)
                     /locus_tag="RPD_0208"
                     /EC_number="3.6.1.23"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="ABE37448.1"
                     /db_xref="InterPro:IPR003232"
                     /db_xref="InterPro:IPR008180"
                     /db_xref="InterPro:IPR008181"
                     /translation="MSDTIAVEIKQLPHAEGLPLPAYQSAHAAGLDLCAANSADAPLL
                     LAPGSYVLVPTGLTIALPENYEAQVRPRSGLAAKHGVTVLNAPGTIDADYRGEIGVLL
                     INHGDAPFTIRRGERIAQMVIAPVVRAELIGVETLSETARGVGGFGSTGR"
     gene            complement(238592..240127)
                     /locus_tag="RPD_0209"
     CDS             complement(238592..240127)
                     /locus_tag="RPD_0209"
                     /EC_number="6.3.2.5"
                     /EC_number="4.1.1.36"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphopantothenate-cysteine ligase /
                     Phosphopantothenoylcysteine decarboxylase"
                     /protein_id="ABE37449.1"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="InterPro:IPR005252"
                     /db_xref="InterPro:IPR007085"
                     /translation="MQCDRAARWHCIHGLLALPASVNLRVMANLTIRKLDDALKAELR
                     QRAAANGRSMEDEVRVILRDVCHKRHGFAASFPQPGEDPAAPGKIEPSPGKDEGFPSE
                     PAASVRITLIVGGGIAAYKAMDLIRRLKERGAEVRVVLTRAAQQFVTPLTASALSHQR
                     CYTDLFDPQSEFDAGHIRLARDCDLIVVAPATADLMAKIAGGHADDLATAILLATNRQ
                     ILLAPAMNPLMWNNAATRRNVDQLKRDGVALVGPNAGEMAERGEAGTGRMAEPIEIAA
                     AAQAFWTPQPQRPLRGRRVLITAGPTHEAIDPVRYIANRSSGKQGYAIAAAAAAAGAE
                     VVLISGPVDLRAPDGVTLTRVESAREMLDAVQAALPTDIAIFAAAVADWRVESEGGQK
                     IKKGAGGPPPLQLTENPDILATISKRGENRPNLVIGFAAETENLLDNARAKLARKGCD
                     WIVANDVSPATGVMGGDRNTVHLLMNTTDAVDVESWPLMTKDEVASALVARIAQTMEV
                     HAP"
     gene            complement(240150..241724)
                     /locus_tag="RPD_0210"
     CDS             complement(240150..241724)
                     /locus_tag="RPD_0210"
                     /EC_number="1.14.13.-"
                     /codon_start=1
                     /transl_table=11
                     /product="2-octaprenylphenol hydroxylase"
                     /protein_id="ABE37450.1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR010232"
                     /translation="MIAGLSHAARLVRAAYVFAREGVFGVVDPSLIPPAGQLPVRLAR
                     LIERPGAKSGARLSRALTRLGPAYLKLGQFLATRPDVVGAAMARDLEALQDRLPPFAQ
                     EEAEAVIAASLERPVAQAFVSLSPPVAAASIAQVHRGEVEIGGVRKQVAVKVLRPNVA
                     SRFRRDLSDFFFVADKAEQYSSEARRLRLVEVINTMSRSVAMEMDLRLEAAAASEMAE
                     NTKDDPDFRVPTVDWDRTTHNVLTMEWIDGIPLNDHKRLAEANVDTVELGRKVIQSFL
                     RHALRDGFFHADMHPGNLFLDPEGRLVAVDFGIMGRLLPKERRFLAEILLGFITRNYR
                     RVAEVHFEAGYVPAHHSVENFAQAIRAIGEPIHNRLAEEISMAKLLTLLLEVTGLFDM
                     RTRPELILLQKTMVVVEGVARSFDPRLDIWKVADPVVREWIQRNLGPIGKVEGALTGA
                     GELGHTLSSLPTIVSRAVTVLNQLEVMTKDGLVLAPETIAAIGRTERGRTRGRTAALW
                     IIAVTFIGVLIAMSRL"
     gene            complement(241721..242482)
                     /locus_tag="RPD_0211"
     CDS             complement(241721..242482)
                     /locus_tag="RPD_0211"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="demethylmenaquinone methyltransferase"
                     /protein_id="ABE37451.1"
                     /db_xref="InterPro:IPR000051"
                     /db_xref="InterPro:IPR004033"
                     /db_xref="InterPro:IPR004034"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /translation="MNQPGETTHFGFRDVPLNDKQTMVNDVFHSVASRYDLMNDLMSG
                     GMHRLWKDVMITTLNPPRDDAPFRLLDVAGGTGDISFRAAKASGAGFQATVCDINTDM
                     LEVGRQRAVQRHLDGQVDFVEGNAEALQFPDRSYDAYTIAFGIRNVPRIDLALKEAYR
                     VLKPGSRFLCLEFSSVDVPGLNKIYDLFSFKVIPEIGRVVTGDAESYQYLVESIRKFP
                     KPYDFAEMMRDAGFARVNWQMMSGGIVALHSGWRL"
     gene            242693..243574
                     /locus_tag="RPD_0212"
     CDS             242693..243574
                     /locus_tag="RPD_0212"
                     /EC_number="3.2.2.23"
                     /EC_number="4.2.99.18"
                     /codon_start=1
                     /transl_table=11
                     /product="Formamidopyrimidine-DNA glycosylase /
                     DNA-(apurinic or apyrimidinic site) lyase"
                     /protein_id="ABE37452.1"
                     /db_xref="InterPro:IPR000191"
                     /db_xref="InterPro:IPR000214"
                     /db_xref="InterPro:IPR012319"
                     /translation="MPELPEVETVRLGLTPAMEGFRIARAVTNRDDLRFPLQKDFVAR
                     LTGQIVTGLGRRAKYLLADLASGDVLLMHLGMSGSFRVVAADGAHTPGEFHHPRSEDR
                     THDHVVFDMSSGARVIFNDPRRFGFMKIFPRAAIDDEPHLKGLGPEPLGNAFDAVMLA
                     RACAGKQTSLKAALLDQRVVAGLGNIYVCEALWRAHLSPKRKAATLANRKNEPTDHAL
                     RLTDAIRAVLGDAIKAGGSSLRDHRQTSGELGYFQHSFAAYDREGERCRTDGCGGAVK
                     RFVQNGRSTFWCSGCQK"
     gene            complement(243743..244705)
                     /locus_tag="RPD_0213"
     CDS             complement(243743..244705)
                     /locus_tag="RPD_0213"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family"
                     /protein_id="ABE37453.1"
                     /db_xref="InterPro:IPR002559"
                     /translation="MAQDSFIEALLPAGFGRNERLERISGLIDWDRLAVLIRKVRPGE
                     TGRPPYAPLAMFKALLLQQWYGLSDPGLEEALLDRVSFRRFCGFALDAQTPDETTLCR
                     FRNALQQAGLGDALFQEVLRQLEAAGYVLKTGTLIDATLVQSSGRTPPSGSTPREVES
                     RSSHDPQADWTRHGAGRRLFFGYKAHIAIDQGSGLIRARKLTGAKTYESEVADDLVLG
                     DEKAVYADKAYEKRARRQALKARGIKDRIQHRRNKHQKALPRWQAVRNKLIGRVRQAI
                     ERTFAQLKGRYGFTRMRYAGITANAFHLDLISIAYNLRTAAAIR"
     gene            complement(245415..246779)
                     /locus_tag="RPD_0214"
     CDS             complement(245415..246779)
                     /locus_tag="RPD_0214"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidoglycan-binding domain 1"
                     /protein_id="ABE37454.1"
                     /db_xref="InterPro:IPR002477"
                     /translation="MRSMLAATLMIVSATGLAAAQTPSGTVQGVKPKPVATTPIRPAL
                     QTPAETAKSMAQGEREAIQSDLAWTGDYNGVINGEASDRMVAAIKAFQNNHGAKPTGV
                     LNPQERAQLAEAARKLQGNVGWKLISDPVTGARLGVPGKLVPQQTSDANGSKWASSTG
                     TIQIVLARRKEAGASIAKLADQEKKEPGRKVTYSAVRPDFFVLSGTQGLKKFYTRGAF
                     KDAEIRILTVLYDQATEGTMEPVVIAMSSAFNPFPSGAPAGPPPRKKVEYATGVIVSD
                     DGAILTDRDAVDGCQTIVVVGHGNADLAATDKEHDLALLRIYGARGLKPLALGSGAAK
                     ASVDLTGIADPQSQGGGAAVSVSKASVTPTGSAGGLALSPAPGLGFSGAPARDADRKF
                     AGIALLRPPVMAGAVNGAAAPQATLVDADIVRKFLATNKIQPATDAAADARASVVRVI
                     CVRK"
     gene            246901..247701
                     /locus_tag="RPD_0215"
     CDS             246901..247701
                     /locus_tag="RPD_0215"
                     /codon_start=1
                     /transl_table=11
                     /product="UBA/THIF-type NAD/FAD binding fold"
                     /protein_id="ABE37455.1"
                     /db_xref="InterPro:IPR000205"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR007901"
                     /translation="MLSADELERYARHIVLREVGGPGQAALRRARVLVVGAGGLGAPV
                     LMYLAAAGIGTLDIVDNDEVSLSNLQRQVIHATPDIGKRKVDSAAARIKALNPHVEVR
                     PHALRLTPANALDLIDGCDLVLDGSDNFATRYLVSDACFIARTPLITAALGPFDGSLT
                     TIRAHEKNPAGEFNPTYRCLFPEAPPPGTVPACEEAGVMGALAGMLGSMMALEAIREI
                     VGFGEGLVGRLLMIDARAMRFETLRYSRDPANPLNGDAPRVTDLSGHP"
     gene            complement(247862..248824)
                     /locus_tag="RPD_0216"
     CDS             complement(247862..248824)
                     /locus_tag="RPD_0216"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family"
                     /protein_id="ABE37456.1"
                     /db_xref="InterPro:IPR002559"
                     /translation="MAQDSFIEALLPAGFGRNERLERISGLIDWDRLAVLIRKVRPGE
                     TGRPPYAPLAMFKALLLQQWYGLSDPGLEEALLDRVSFRRFCGFALDAQTPDETTLCR
                     FRNALQQAGLGDALFQEVLRQLEAAGYVLKTGTLIDATLVQSSGRTPPSGSTPREVES
                     RSSHDPQADWTRHGAGRRLFFGYKAHIAIDQGSGLIRARKLTGAKTYESEVADDLVLG
                     DEKAVYADKAYEKRARRQALKARGIKDRIQHRRNKHQKALPRWQAVRNKLIGRVRQAI
                     ERTFAQLKGRYGFTRMRYAGITANAFHLDLISIAYNLRTAAAIR"
     gene            complement(249040..250041)
                     /locus_tag="RPD_0217"
     CDS             complement(249040..250041)
                     /locus_tag="RPD_0217"
                     /codon_start=1
                     /transl_table=11
                     /product="D-isomer specific 2-hydroxyacid dehydrogenase,
                     NAD-binding"
                     /protein_id="ABE37457.1"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /translation="MSVKKKPLVVVTRKLPDSIETRMRELFDARLNLDDVPMSADQLA
                     EAARTADVLVPTVTDTITSAMLNQPDCTLRLIAHFGNGIDNLDVAAAHARGITVTNTP
                     KVLTEDTADMTMALILAVPRRLIEGAALLTDGGEWPGWSPTWMLGRRLGGKRLGIIGM
                     GRIGQAVARRARAFGLQIHYHNRKPVAPRIADELGATYWDSLDQMLARMDIISVNCPH
                     TPATFHLLSARRLKLIRKDAFIVNTARGEVIDEETLTRLIETGDIAGAGLDVYEHEPV
                     VNPKLVRLAKAGKVVLLPHMGSATIEGRVEMGEKVIINIRTFLDNHKPPDRVLPAML"
     gene            250275..250799
                     /locus_tag="RPD_0218"
     CDS             250275..250799
                     /locus_tag="RPD_0218"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF1058"
                     /protein_id="ABE37458.1"
                     /db_xref="InterPro:IPR010466"
                     /translation="MKLKRPIAAVLFAGAITGAAAPALAAKDSPLSASGLPVPRYVSL
                     KSDHVNVRIGPTKDNDVAWVYTRAGLPVEITAEFENWRRVRDSEGAEGWVYHSLLSGR
                     RTAVITMKDKDELATLYEAASTGSAVAARLQAGVVAQIKRCDPNWCRIIGSGFDGWIE
                     KQRLWGVYADEQVK"
     gene            complement(251081..251569)
                     /locus_tag="RPD_0219"
     CDS             complement(251081..251569)
                     /locus_tag="RPD_0219"
                     /codon_start=1
                     /transl_table=11
                     /product="ferric uptake regulator, Fur family"
                     /protein_id="ABE37459.1"
                     /db_xref="InterPro:IPR002481"
                     /translation="MDIGDRATYSREESVTLAHAVEPHLNGCPWHDVNEMLQSVGLRP
                     TRQRMALGWLLFSKGDRHLTAEMLYEEASQAKVPVSLATVYNTLNQLTDVGLLRQVSV
                     DGTKTYFDTNVTAHQHFYLENNHELIDIPDQHVALRSTPQVPDGYEIARVDVVVRLRK
                     KS"
     gene            251784..252347
                     /locus_tag="RPD_0220"
     CDS             251784..252347
                     /locus_tag="RPD_0220"
                     /EC_number="4.2.1.59"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxydecanoyl-[acyl-carrier-protein]
                     dehydratase"
                     /protein_id="ABE37460.1"
                     /db_xref="InterPro:IPR010083"
                     /db_xref="InterPro:IPR013114"
                     /translation="MAEFRELKRQSRMRDRRSSYEYEDLLACGRGELFGPGNAQLPLP
                     PMLMFDRITEISETGGAHGKGLIRAELDVNPDLWFFACHFKGDPVMPGCLGLDALWQM
                     LGFFLGWSGGEGPGRALGSGELKFTGQVLPHVRKVVYNVDIKRVMRSKLWLGIADGWL
                     SADDEIIYRAQDLKVGLFKQTAAKPAA"
     gene            252427..253653
                     /locus_tag="RPD_0221"
     CDS             252427..253653
                     /locus_tag="RPD_0221"
                     /EC_number="2.3.1.41"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-[acyl-carrier-protein] synthase I"
                     /protein_id="ABE37461.1"
                     /db_xref="InterPro:IPR000794"
                     /translation="MRRVVVTGMGIVSSIGNNTQEVLASLHDAKSGISRAEKHAELGF
                     RSQVQGLPSLNPADVVDRRAMRFLGEGAAWNHVAMEQALADSGLEESDISNPRTGIVM
                     GSGGPSARTIVEAADITRTKGPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSA
                     CATSNHCIGNAYELIQWGKQDVVFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASR
                     PYDVSRDGFVIAGGAGVLVLEELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAE
                     RCMKMALSTTGGIKIDYINPHATSTPAGDPPEINALRNVFGAGDKCPPISATKALTGH
                     SLGATGVQEAIYSLLMMQNGFICESANITELDPAFADMPIVRKRIDNAKIGAVLSNSF
                     GFGGTNATLVFKRLDA"
     gene            253850..254695
                     /locus_tag="RPD_0222"
     CDS             253850..254695
                     /locus_tag="RPD_0222"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-(acyl carrier protein) reductase"
                     /protein_id="ABE37462.1"
                     /db_xref="InterPro:IPR002347"
                     /translation="MQALMQGKRGLIMGVANNHSLAWGIAKTLSAHGAELAFTYQGDA
                     LGKRVKPLAQSLNAELVLPCDVEDLDSVDAVFATLKEKWGGLDFVVHAIGFSDKNELK
                     GRYADTTRENFSRTMVISCFSFTEIAKRAAELMPPTGGSMITLTYGGSTRVMPNYNVM
                     GVAKAALEASTRYLASDYGPRNIRVNAISAGPVRTLAGAGIADARIMFNYQLRHAPLR
                     RTVSIEDVGGSALYLLSDLSNGVTGEVHFVDSGYNIISMPEPDALKTVDEAETAAEQR
                     AAKEK"
     gene            complement(255039..257237)
                     /locus_tag="RPD_0223"
     CDS             complement(255039..257237)
                     /locus_tag="RPD_0223"
                     /EC_number="1.11.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="catalase/peroxidase HPI"
                     /protein_id="ABE37463.1"
                     /db_xref="InterPro:IPR000763"
                     /db_xref="InterPro:IPR002016"
                     /translation="MDAKTDDQGGKCPFPHGGGSRGHRNRDWWPEQLDINMLHRNSTL
                     SDPLGKAFDYAKEFESLDLDAVIKDLHALMTDSQDWWPADFGHYGGLMIRMAWHSAGT
                     YRTTDGRGGAGAGQQRFAPLNSWPDNANLDKARRLLWPIKQKYGNKISWADLYVLTGN
                     VALESMGFKTFGFAGGRADTWEPEELFWGPEGSWLGDERYSGERQLHDALGAVQMGLI
                     YVNPEGPNGNPDPVAAAKDIRETFARMAMNDEETVALIAGGHTFGKTHGAGDPSLIGA
                     EPEGGALEDQGLGWKSKFGTGFGADAITGGPEVIWTQTPTQWSNFFFENLFGFEWELD
                     KSPAGAKQWKAKGAEATVPDPFDPTKKRVPTMLTTDLSLRFDPAYEKISRRFFENPDQ
                     FADAFARAWFKLTHRDMGPKVRYRGKLVPKEDLIWQDPIPPVDHELVSAKDIADLKAR
                     ILASGLSVSQLVSTAFASASTYRHSDKRGGANGARIRFAPQKDWEVNQPADLAQVLGK
                     LEAIQKAFNDAQSGGKKVSLADLIVLGGSAAVEKAAKDAGTEVEVPFTPGRMDALEEQ
                     TDGDSFKVLEPRADGFRNFIGKRHQFMQPEEALVDRAQLLNLTAPEMTVLLGGLRVLG
                     GNVGHDSHGVFTDRPEKLTNDFFVNLLDMKTAWSLSATAEGVYEGRDRKTGDLRWTGT
                     RVDLIFGSHSQLRALAEVYGQSDAQTKFAQDFVAAWTKVMNADRFDLAAK"
     gene            257482..258420
                     /locus_tag="RPD_0224"
     CDS             257482..258420
                     /locus_tag="RPD_0224"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="ABE37464.1"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /translation="MVTLRQLRYLSALARHGHFGRAAESCAVTQPALSMQIAELERTL
                     GVKVVERRPGEVFLTEIGREIARRGDDLLTASRDLVDFARHRAQPLTGRLTLGVIPSL
                     APYLLPKVLPLLQRRFPELRLELRESQTRQLVTDIGSGALDAALLALPAGNRDLDAIA
                     LFDDVFLLAVPADDPRPESATVTVDEIDQSRLILLEDGHCLRDQALAFCATGRNRAIN
                     LGGAGTATFGASSLTTVIQMVAAGYGVTLIPQIAAEIERRDARVKFLQLRRPQPGRSI
                     GLAFRKTSPRRSDFEALGDVVTEGVSGKAAREEASA"
     gene            complement(258512..260194)
                     /locus_tag="RPD_0225"
     CDS             complement(258512..260194)
                     /locus_tag="RPD_0225"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="ABE37465.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /translation="MLSFLRSAAHDHAMAMLDAINRSQAVIEFDLEGNIRCANDNFLA
                     TTGYSLDEIKGKHHRIFVDPAERDSAAYRDFWASLRSGKQQSGEFERVAKGGRPLWLQ
                     ASYSPIVDKSGKPGGFVKFAADVTAAKNRSMEDAGKILAISRAQAVIEFDLDGHIITA
                     NDRFLKAMGYELTDIQGKHHSIFVDPSERASSEYCNFWARLGRGEYVSGEFKRFGKGQ
                     TEIWILATYNPILDVKGKPLKVVKFASDITQQKLSAADTAGQIAAIGKSQAVIEFDTQ
                     GIILDANDNFLAAVGFTLPEIKGRHHRIFVDPAERDGVAYQDFWAALARGQYQSAEYK
                     RIGKGGKEIWIQASYNPIIGLDGKPYKIVKYATDITRQVLTRIGNERVRGMMESVAAG
                     AEELNASVREISEAMTKSRQTTLDAVNEVDSVDGQANRLNEAAQAMSGIVELISNITG
                     QINLLALNATIESARAGEAGRGFAVVAGEVKNLANQAKQATDRIGAEIENLNGISGDV
                     VGALGKIKAAIQNVSEYVTSTAAAVEEQSTVTGEMSSGMQRAATEAAAIAAA"
     gene            complement(260510..262195)
                     /locus_tag="RPD_0226"
     CDS             complement(260510..262195)
                     /locus_tag="RPD_0226"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer
                     with Pas/Pac sensor"
                     /protein_id="ABE37466.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /translation="MFSFFRRAGSSPSSTAIMEAMNRSQAMIEFNLDGTVLGANEKFL
                     EALGYSLAEIKGKHHRMFVDPEETRTDAYRRFWADLQAGTYQAGEFKRIAKGAREIWI
                     QASYNPVLGNDGKPLCVVKYATDITAAKRRSMEDFGKMQAIGRSQAVIEFAMDGTILT
                     ANKNFLQALGYELDEIKGKHHSMFVEPAFCDSPAYREFWASLNRGDYLAAEYKRIGKG
                     GREIWILASYNPILDDKGKPFKVVKFATDVTGQKLKTADLAGQIDAIGKSQAVIEFGI
                     DGTILDANANFLKVLGYNLADIKGKHHSMFVEPAERDAAAYRTFWAELAAGKYQAAEY
                     KRIGKGGREVWIQASYNPILDLNGKPFKVVKYATDTTRQVLVRIGNERVRAMMESVAA
                     GAEELNASVREISEAMTKSRETALTAVSEVDAADGQAHRLNEAAQAMSGIVELISNIT
                     GQINLLALNATIESARAGEAGRGFAVVAGEVKNLANQAKQATDRIGAEIENLNGISGD
                     VVGALGKIKAAIQNVSEYVTSTAAAVEEQSTVTGEMSSGMQRAATEAAAIAAA"
     gene            complement(262822..264990)
                     /locus_tag="RPD_0227"
     CDS             complement(262822..264990)
                     /locus_tag="RPD_0227"
                     /EC_number="2.7.7.8"
                     /codon_start=1
                     /transl_table=11
                     /product="Polyribonucleotide nucleotidyltransferase"
                     /protein_id="ABE37467.1"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /translation="MFNKHSVEIDWGGRPLRLETGKVARQADGAVVATYGETVVLATV
                     VAAKTPREGVDFLPLTVDYQEKTYAAGRIPGGYFKREGRPTEKETLVSRLIDRPIRPL
                     FADGWRNETQVIVTVLSHDMENDPDILALVASSAALTLSGAPFKGPIGAARVGFINDE
                     YVLNPVLDEMPETQLDLVVAGTSDAVLMVESEAKELSEEIMLGAVMFGHRHFQPVIDA
                     IIALAEKAAKEPRELTVIDDSAIEKEMLGLVEQELRAAYAIAVKQERYAAVGKVKEKA
                     IAHFFPEGQEPKYDKLRIAGVFKELEAKIVRWNILDTGKRIDGRDSKTVRSIIAEAGV
                     LPRAHGSALFTRGETQALVVTTLGTGEDEQYVDSLAGTYKETFLLHYNFPPYSVGETG
                     RLGGTKRREIGHGKLAWRAIRPVLPPHHEFPYTIRVVSEITESNGSSSMASVCGASLA
                     LMDAGVPLKRPTAGIAMGLILEGERFAVLSDILGDEDHLGDMDFKVAGTEQGVTSLQM
                     DIKIAGITEEIMKVALGQAKDGRIHILGEMSKALDRARAELGEHAPRIETFKIPTDKI
                     REVIGTGGKVIREIVEKTGAKVNIEDDGTVKVASSDGESIKAAIKWIKSIASDPEVGE
                     IYEGTVVKVMEFGAFVNFFGAKDGLVHISQLAAGRVQKTSDVVKEGDKVKVKLLGFDD
                     RGKTRLSMKVVDQDTGEDLEAKQKAEAKAEDEAPAQAAGE"
     gene            complement(265334..265603)
                     /locus_tag="RPD_0228"
     CDS             complement(265334..265603)
                     /locus_tag="RPD_0228"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S15P"
                     /protein_id="ABE37468.1"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR005290"
                     /translation="MSITAERKAEVIQGNANKAGDTGSPEVQVAILSERIVNLTAHFK
                     THTKDNHSRRGLLKLVSTRRSLLDYVKKKDEARYKALLEKHNIRR"
     gene            complement(265606..266712)
                     /locus_tag="RPD_0229"
     CDS             complement(265606..266712)
                     /locus_tag="RPD_0229"
                     /EC_number="4.2.1.70"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="ABE37469.1"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR004510"
                     /translation="MTMTTSADTLAPQDVQHAGDDAPSSAQLRKPRDNNDPRNTARGK
                     DGNNKQPRRDKRDVHGWVVLDKPIGMTSTHAVAVVKRLFSAKRAGHAGTLDPLASGGL
                     PIAMGEATKTVPFVMDGRKRYRFTVAWGEERDTDDTEGKVTQASDLRPTPEAIRALLP
                     QFTGLIEQTPPQYSAIKIAGERAYDMARDGEIVPLVPRPVEIHELSLVEHDDSGKSVF
                     EAECGKGTYVRALARDMGRLLGCYGHICALRRTLVGPFDEADMIPLEQLQALCDRAAS
                     GEGSLADALLPVETALDDIPALAVTRADAARLHRGQAVLLRGRDAPISSGTVYVTVAG
                     RLLALAELGNGELIPKRVFNLSGLTASSARKESL"
     gene            complement(266712..267122)
                     /locus_tag="RPD_0230"
     CDS             complement(266712..267122)
                     /locus_tag="RPD_0230"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="ABE37470.1"
                     /db_xref="InterPro:IPR000238"
                     /translation="MSRHQKPTGQSESPRKLRVGELVRHAVAEILAQGGVHDPVLETH
                     LITVPEVRMSPDLKLATVYVMPLGGRDEKLVIAALEQHKRFLRGEVARRVNLKYAPEI
                     RFRIDERFAEAERIEKLLRTPAVQKDLEPDSDQD"
     gene            complement(267294..269945)
                     /locus_tag="RPD_0231"
     CDS             complement(267294..269945)
                     /locus_tag="RPD_0231"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterial translation initiation factor 2
                     (bIF-2)"
                     /protein_id="ABE37471.1"
                     /db_xref="InterPro:IPR000178"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006847"
                     /translation="MVDTKTPGDKTLSMPTKTLTLKPRVEQGVVRQSFSHGRSKQVVV
                     EKRGKRRVGGDGPAEPAAAAPEVVKKPTPAPPAVSPRQQPRPSPQQQARSGMVLRTLT
                     EDERSARATALADARVREVEERRLAEIEAQRRAAQELVDKAEREAAEVRRKAEEERHR
                     HEEETKRKAETEAKKRFGEAEPAKKPADGRPASTSTTTTAPRAPVTTTTRPPAVAAEA
                     GDDDEAPRMVRRGPGGGPARPAPPPKQPAAKPGASKQRGRLTLVTALTADDVRERSIA
                     SFRRRTQRLKGHASNEPKEKLVREVIVPEAISIQELANRMSERAVDVIRMLMKQGAMH
                     KINDVIDADTAQLIAEELGHTVKRVAASDVEEGLFDVVDNSTDTEPRSPVVTVMGHVD
                     HGKTSLLDALRHANVVSGEAGGITQHIGAYQVTSPETGTKITFIDTPGHAAFTAMRAR
                     GAKVTDIVILVVAADDGVMPQTVEAINHAKAAGVPIIVAINKIDKPDAKPERVRTELL
                     QYNVQVESLGGDVVDVEVSAKNKTNLDKLLEMIALQAELLDLKTNESRPAEGTVIEAK
                     LDRGRGPVATVLVQRGTLKVGDIIVAGAEMGRVRALISDQGDNVDFAGPSVPVEVLGF
                     NGPPEAGDRLAVVENEARARQVTSYRAHQKREKAASIVGMRGSLEQMMSQLKTTGRKD
                     FPLIVKADVQGSLEAILGSLEKLGTDEVAARILHAGVGGISESDVTLAEGFSAVILGF
                     SVRANKEAAAAAKRNGIEIRYYNIIYDLVDDVKKAMSGLLAPTLRETMLGNAQILEIF
                     NISKVGKVAGCRVTDGTVERGANVRLIRDNVVVHEGKLSTLKRFKDEVKEVQSGQECG
                     MAFENYTDMRAGDVIECYRVETIQRSL"
     gene            complement(269938..270732)
                     /locus_tag="RPD_0232"
     CDS             complement(269938..270732)
                     /locus_tag="RPD_0232"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF448"
                     /protein_id="ABE37472.1"
                     /db_xref="InterPro:IPR007393"
                     /translation="MFAAADAADLDDGPRTKKSATERMCAVSRQVRPTGELIRFVVAP
                     TGEVVADLKRKLPGRGLWVTASRAMVEQAVRRKLFARGFKRDVKAGPTLAADIERLLV
                     QSACDALAIAAKARQVVSGFGKVSSALKSREAVAMIHAADGAADGIRKLDAVSRQIDG
                     NETGSRDFPVITVLNSEELDLALGRSNVIHAAVLAGPAGQTFLSRCQILVRYRLVDDG
                     DAAEAIAGTPINTPKDAADVDAADEEAADEVCANAHNVERLGRLNG"
     gene            complement(270895..272517)
                     /locus_tag="RPD_0233"
     CDS             complement(270895..272517)
                     /locus_tag="RPD_0233"
                     /codon_start=1
                     /transl_table=11
                     /product="NusA antitermination factor"
                     /protein_id="ABE37473.1"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR010213"
                     /db_xref="InterPro:IPR010214"
                     /translation="MAVSANKLELLQIADAVAREKSIDRGIVIAAMEDAIAKAARARY
                     GSETDVHAEIDAKKGELRLSRHMLVVDKVENAANQISLKDAQRANPGAQIGDTIADTL
                     PPLEYGRIAAQSAKQVIVQKVREAERDRQYMEFKDRIGDVVNGVVKRVEYGSVIVDLG
                     RGEAIVRRDEMLPRESFRNGDRVRAYIFDVRRETRGPQIFLSRTHPQFMAKLFQQEVP
                     EIYDGIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKID
                     IIPWSPDIATFVVNALAPAEVSKVVIDEDRERIEVVVPDTNNQLSLAIGRRGQNVRLA
                     SQLTGWDIDILTETEESERRQADFENSTRVFMEALNVDEVVGQLLASEGFTSVEELAM
                     VDIRELASIEGFDEETATELQARAAEYLDRVETELEARRQELGVEDALKDVPGVTSKM
                     LVKLGEGDVKTVEDLAGCATDDLVGWTERKEGAEPVKYAGILDGVEMTRDDAEHLIMQ
                     ARVKAGWITEEELAQTADKGEDAGAETEGAAE"
     gene            complement(272520..273308)
                     /locus_tag="RPD_0234"
     CDS             complement(272520..273308)
                     /locus_tag="RPD_0234"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF150"
                     /protein_id="ABE37474.1"
                     /db_xref="InterPro:IPR003728"
                     /translation="MTDPIADPVVPDTLAEPRLVVEPGVAARFAAVAEPVLQAMGYRL
                     VRIKVSGEAGCTVQIMAERPDGTMLIDDCEAVSRALSPVLDVTDPIDRAYRLEISSPG
                     IDRPLVRSSDFARYSGHLVKIEMAVPHQGRKRYRGLLDGVEGDAIRIQREGVTKDEDP
                     LVLLPMHDIGDARLVLTDELVAESMRRGKQAERELKQSLGLAPPPPPHAKRSDPKKSS
                     APKPKPLTKPVVKPDAKPKPKNTKQHRLAADRLRRGDTDLSEGD"
     gene            273587..274672
                     /locus_tag="RPD_0235"
     CDS             273587..274672
                     /locus_tag="RPD_0235"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37475.1"
                     /translation="MSAALLLAPELDDVVGHGDAARRADAVRRIADLFVQGAMNFNAE
                     HVAVFDGVLVRLIPDTDGDLRGELARRFCSLGNAPPTLIEQLAQDEDIGVAGPLLRRS
                     TQITDDTLVELAEVRGQTHLMAISERPAISPPVTDVIVRRGDRDVLRMVAVNAGAAFS
                     AFGFSGLIRRAAQDGVLAVAVGVRDDLSLPRLKDLLASSSEPVRRKLFETASPSARIA
                     INRALRELTGEPMQPSVKRDFAPAQRAIVALHNAGGLTEQALLSFARAFQYEETVAAL
                     SAMSGVRITTLDPLMAGERHDPMLMLGKALGLDWTTVRAMIGLRRGPDRMPSSPDVEE
                     ARQNFERLAPSTAHQVVGFWKMRQAMN"
     gene            complement(274805..275575)
                     /locus_tag="RPD_0236"
     CDS             complement(274805..275575)
                     /locus_tag="RPD_0236"
                     /EC_number="2.1.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N(7)-)-methyltransferase"
                     /protein_id="ABE37476.1"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR003358"
                     /db_xref="InterPro:IPR004395"
                     /translation="MITIDRRVQTKCSVLGRHKQVFIDMNETVHHQGSFFGRRKGHKL
                     RAHQADLVDNLLPHLALDIELPAPDALAELFDAPVEAVRLEIGFGGGEHLIAEALAHP
                     EIGFIGAEPYVNGMAKILARIEDQNIRNVRLFAGDAAELMAWLPARALKRIDLIHPDP
                     WPKRRHWKRRFVQDSMIGAMARALIDGGEFRFVSDIDSYNAWTLAHLLRAPEFDWTAE
                     RADDWRKPWSGYTMTRYGRKAEREGRRASYLRFRRIAA"
     gene            complement(275694..276113)
                     /locus_tag="RPD_0237"
     CDS             complement(275694..276113)
                     /locus_tag="RPD_0237"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ABE37477.1"
                     /db_xref="InterPro:IPR001387"
                     /translation="MSTKAPNPVDKYVGSRVRMRRIMLGMSQEKLGEALGLTFQQVQK
                     YEKGTNRVGASRIQQISEILQVPVSFLFEGGPSGGLANANGFSEAPSPSYVSDFLATS
                     EGLALTRAFTKISDAKLRRSIVDLVEQIAAREPADDR"
     gene            complement(276304..277914)
                     /locus_tag="RPD_0238"
     CDS             complement(276304..277914)
                     /locus_tag="RPD_0238"
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="ABE37478.1"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="InterPro:IPR004563"
                     /translation="MKLPNLPSLVASSIILAWGWKRAAIAFVAGALSSLAMAPFNAWP
                     ILFVTFPVAVWLIDGAGAGRWRGVPAAALSGWWFGFGYFVPGLYWIGYAFLVDAQTFA
                     WLLPVAICGLPAYLALFTALGFALARLLWARGAMRVLALAVSLTIGEWLRGHLLTGFP
                     WNAFGYALTEPLALAQSVSLIGIWGLTLLAVAIFASPATLFDDGADTRRRWLAPTAAL
                     GLLIAMAVYGSVRLQITPTQLVEGVRLRIMQPDVQQDRRFNYAAKAEVMQKYLTLSDR
                     STGPGSTGVRDATLLIWPESAFPFFLTREADAMAQIAELLPKGTILLTGAVRPPEMPP
                     GRRITRAYNSIYAIDHDGSILAVYDKLHLVPFGEFLPFQNLMEKIGFVQLTKVQGGFL
                     PGVKRQNIDLPKAPPLLPLICYEAIFPDEIEIRGSRPGWILNLTNDGWFGVSTGPYQH
                     LQQARMRAVEQGLPLVRAANTGISAVIDPVGRIVGRLDLGVEGVLDASLPSQIAPTVY
                     ARVGDVPAAVLVALSMTLVLLRRRAPPR"
     gene            complement(277926..279053)
                     /locus_tag="RPD_0239"
     CDS             complement(277926..279053)
                     /locus_tag="RPD_0239"
                     /codon_start=1
                     /transl_table=11
                     /product="putative HlyC/CorC family of transporters"
                     /protein_id="ABE37479.1"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR005170"
                     /translation="MPDGDSTQNAAQPAEQDLSRQQLPAVVHQGEVLRPVAGAWLIRA
                     IRSLFGWKPGSVRDDLQVVLDTSPPDDTGFTALERTMLRNILGLHERRIADVMVHRAD
                     IVAIKQEIPLGELMSLFEGAAHSRLVVYNETLDDPVGLVHIRDLVAFMTSKAKVAPQT
                     VAKRKKTLPAGLDLRAIDLKMPLTETGIIRKLLYVPPSMRAIDLLAQMQAARIHLALV
                     VDEYGGTDGLVSIEDIVEQIVGEIDDEHDSAEPPSIVRQPDGSFIADARTSLEDASVM
                     IGDDFVTGEAGEDVETLGGYLVNHVGRLPVRGEVISGPGNFEIEVLDADPRRVKRLRI
                     GIRKERAVARPRETRRREPASDQPATAPTDTTNPNPSPPGE"
     gene            complement(279055..279642)
                     /locus_tag="RPD_0240"
     CDS             complement(279055..279642)
                     /locus_tag="RPD_0240"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function UPF0054"
                     /protein_id="ABE37480.1"
                     /db_xref="InterPro:IPR002036"
                     /translation="MPQSNAGGRSDCIGAARDSSFGPMSSSAIPATEVVIAADCWQAE
                     ASAESVVLRAIEAAATMIDADTGDAELAVMLTDDDGVRALNASYRGIDKPTNVLSFPA
                     PQPDYQDACQDSGGAPQMLGDIAIAYQTVRREADDEGKPFAHHLSHLAVHGFLHLVGY
                     DHETDAEAETMESTERSILAGLGIPDPYADQDRVS"
     gene            complement(279642..280697)
                     /locus_tag="RPD_0241"
     CDS             complement(279642..280697)
                     /locus_tag="RPD_0241"
                     /codon_start=1
                     /transl_table=11
                     /product="PhoH-like protein"
                     /protein_id="ABE37481.1"
                     /db_xref="InterPro:IPR003714"
                     /db_xref="InterPro:IPR004088"
                     /translation="MAKSASDSSSLISRRKLERDSQTPPETQVVVAFDDNRAASALVG
                     PYGQHLAQIERRLAVVVDSRGNHITIAGARESCDSARRVLETLYAQAVSGSDISQGDV
                     DGAIRAVIAQGSLFEFDSKPAAGVFEAINLRKRPVRARTAAQDSYIRALKRHELVFGV
                     GPAGTGKTWLAVAHAAQLFERKEVDKIILTRPAVEAGERLGFLPGDLREKVDPYLRPI
                     YDALYDLMDSRIVERALQTNEIEIAPLAFMRGRTLTNAAIILDEAQNTTSMQMKMFLT
                     RLGENSRMIVTGDPSQVDLPNGQTSGLSEAVRLLSGVEGIAQVKFTAEDVIRHELVAR
                     IVAAYEGAPPKPAGGAA"
     gene            complement(280703..282124)
                     /locus_tag="RPD_0242"
     CDS             complement(280703..282124)
                     /locus_tag="RPD_0242"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
                     /protein_id="ABE37482.1"
                     /db_xref="InterPro:IPR002792"
                     /db_xref="InterPro:IPR005839"
                     /db_xref="InterPro:IPR006463"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /translation="MAPPRKLHIKSYGCQMNVYDAQRMVDVLAPEGFVETATVDDADL
                     VILNTCHIREKASEKVYSELGRLRLARDEAASSGRRMQIAVAGCVAQAEGEEIVRRAP
                     VVDVVVGPQSYHHLPQLLARADQAGRALETEFPVEDKFGFLPQPRPETIRARGISAFV
                     TVQEGCDKFCTFCVVPYTRGAEVSRPVSAIIDDVKRLADNGVREITLIGQNVNAYHGE
                     GPDSRAWTLGRLLRRLAAVPGIVRLRYSTSHPNDVDDELIEAHRDLDALMPFVHLPVQ
                     SGSDPILAAMNRKHTAADYRRVIDRFRAVRPQIAFSSDFIVGFPGETEADFAATLALV
                     TQIGYAGAYSFKYSPRPGTPAADMQEMVPAAVMDERLERLQQLIDSQQSAFNKAAIGQ
                     TVDVLFERAGRKPGQIVGRTAYLQPAHVFPGPMFLGPGMAPDSLVGQILPVRVDSLER
                     YSLLGELAAKPPQHARPLAATGA"
     gene            complement(282222..282875)
                     /locus_tag="RPD_0243"
     CDS             complement(282222..282875)
                     /locus_tag="RPD_0243"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-superfamily hydrolase subfamily IA, variant
                     3"
                     /protein_id="ABE37483.1"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006402"
                     /db_xref="InterPro:IPR006439"
                     /translation="MRPDLVIFDCDGVLVDSEVISCRVHAETLTRHGYPITTEQVAER
                     FLGRSGREARREIEAELGRVFSDDLEAQLVADVLRSFAESLEPIPHIIAALDALTQPV
                     CVASSGTLERIAFALNRTGLYRRFAPNLFSAEQVANGKPAPDLFLHAARQMGVPPSRC
                     VVIEDSVPGILGARAAGMTALGFVGGSHCLPGMDARLRAAGASAIFDDMRQLYDFII"
     gene            complement(282970..283401)
                     /locus_tag="RPD_0244"
     CDS             complement(282970..283401)
                     /locus_tag="RPD_0244"
                     /codon_start=1
                     /transl_table=11
                     /product="ferric uptake regulator, Fur family"
                     /protein_id="ABE37484.1"
                     /db_xref="InterPro:IPR002481"
                     /translation="MSELKATEIEARCAATGMRMTEQRRVIARVLAEAVDHPDVEELY
                     TRCVAVDDKISISTVYRTVKLFEDAGIIERHDFREGRARYEQMRDSHHDHLINLRDGK
                     VIEFTNEEIEKLQAEIARKLGYRLVDHRLELYCVPLDDDKT"
     gene            complement(283463..283948)
                     /locus_tag="RPD_0245"
     CDS             complement(283463..283948)
                     /locus_tag="RPD_0245"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal-protein-alanine acetyltransferase"
                     /protein_id="ABE37485.1"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR006464"
                     /translation="MMTWLAEFWGYADALVEPATLSDSPKLAQLHAASFHSGWSEEEF
                     ADLLSQRNTLVHRLRMGRRIIGFIASRFGADEAEILSVAVASGYRGRGLSRELLLTHL
                     GHLAGRGVAKVFLEVEENNQPARRLYQRSGFEIVGRRERYYRQPDGEQLNALIMRRDL
                     S"
     gene            complement(283959..284654)
                     /locus_tag="RPD_0246"
     CDS             complement(283959..284654)
                     /locus_tag="RPD_0246"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M22, glycoprotease"
                     /protein_id="ABE37486.1"
                     /db_xref="InterPro:IPR000905"
                     /translation="MLILAIDTALDACAAAVLDTDVNRLLARESQPMQRGHAEALMPL
                     LGRVMQSSGIGFADLDRIAVTTGPGSFTGLRVGLSAARGIALAAGKPVVGLTTLSAFA
                     APLVSERDDTPILSAIDARHDQVYYQLVSGNGTRLVRPRVAPIAEALEAVRHGAPRLV
                     GNAAGLLAARWPALTPPAPLIDQQPAPDILWVAWLGAAANPETAPARPFYLRAPDARP
                     QADALARSQQPAA"
     gene            complement(284798..285364)
                     /locus_tag="RPD_0247"
     CDS             complement(284798..285364)
                     /locus_tag="RPD_0247"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen-fixing NifU-like"
                     /protein_id="ABE37487.1"
                     /db_xref="InterPro:IPR001075"
                     /translation="MFIQTEPTPNPATLKFIPGRVVLDSGTMEFTDRKQAARSPLAER
                     LFEVEGVSGVFYGSDFVTVTKDGAGDWQHLKPAILGAIMEHYMSGAPIMADGRVDGDE
                     TDEDEFFAERDAETVEIIKDLIETRVRPAVANDGGDITFRGFKDGVVYLAMKGACSGC
                     PSSTATLQHGIQNLLKHFVPEVVEVRPV"
     gene            complement(285516..286010)
                     /locus_tag="RPD_0248"
     CDS             complement(285516..286010)
                     /locus_tag="RPD_0248"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37488.1"
                     /translation="MSTQRQSYRPDHRPKCLVIVDDTAEWDRAVYYASRWAVRVGGGV
                     VMLRVIEILDQNQQWLGVADVMRAEAIEIAEQALDRASGRANGVAGITPERVIREGDT
                     IAQVRKVIESDVDITTLVLAAGDGPEGPGPIVTAMVRHLGSFPVPVVMVASGLTDDDI
                     DALS"
     gene            complement(286169..287278)
                     /locus_tag="RPD_0249"
     CDS             complement(286169..287278)
                     /locus_tag="RPD_0249"
                     /EC_number="6.1.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="ABE37489.1"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /translation="MDGAPNSAIGAAPFDHAQELNMTTQRVFSGVQPTGNLHLGNYLG
                     AIVNFVKLQETHNCIYCVVDLHAITVPVTVWGGPDELRRNTREVTAAFIAAGIDPNKH
                     IIFNQSQVAEHAELAWVFNCVARLGWLNRMTQFKEKAGKDRENASIGLYDYPVLMASD
                     ILVYRATHVPVGEDQKQHLELTRDIAQKFNNDFAESIAAQGLGDSYFPMPEPVITGPA
                     TRVMSLRDGTKKMSKSDPSDYSRINLTDDADAIAQKIRKAKTDPEPLPSEEKGLETRP
                     EADNLVGIYAALAGKPKTDVLAEFGGAQFSAFKSSLVDLAVEKLSPIAGEMKRLSADH
                     GYVDSVLASGSDRARVIAAETMVGVKDIMGMVRKR"
     gene            complement(287292..288848)
                     /locus_tag="RPD_0250"
     CDS             complement(287292..288848)
                     /locus_tag="RPD_0250"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein MviN"
                     /protein_id="ABE37490.1"
                     /db_xref="InterPro:IPR004268"
                     /translation="MIRPILTVSAGTLSSRLLGFVRDALVAALLGAGVVADAFLLAFQ
                     LVNVARRLLTEGALNAALVPAWLRVREHNGAVAAAAYAGRLLGTVALATLLLALLLGV
                     FMPLLIALLAPGFVGHPTLLMATRDARLMLPYLAFAGPVAVMMGLFNAQGKVGLTAFS
                     PLLFNVALIVVTAALLLWHANDTQAALILSATIGVAGLMQLGIVVFNGRGERLATPLR
                     ASFDPSMRAFFAKAIPGMIANSGPQLLIVIGAIVASSKPSAVSWLYFANRLIELPLGI
                     VGVAMGAVLVPELARAVRGDDRAALSDAASRGLELAIGVALPAMLGLIVLREPIVRVL
                     FEHGAFTASDTAATALALGLLALGLPAQVLAKTWSAAFFAREDTSTPLFATLVALGVA
                     LAAALLLGRTYGASGVAAAIALGAWSNAALLLGRGLARFGVAIDPAARRRVALIVLAA
                     GAMGGLLWLKAGFVLPLVAEASTLAQAAVLGVLIAGGLIIYAALLILFGVVRPAAALG
                     ALRRPRGLRG"
     gene            289114..290115
                     /locus_tag="RPD_0251"
     CDS             289114..290115
                     /locus_tag="RPD_0251"
                     /codon_start=1
                     /transl_table=11
                     /product="PfkB"
                     /protein_id="ABE37491.1"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR011611"
                     /translation="MSSAQYDVLGIGNAIFDVLVRTEDDFLVRHGMAKGGMALIDEAR
                     AAAIYADMGMATEISGGSAANTIVGLASFGARAVYVGKVKDDQIGKLYSHDIRAAGVT
                     FDTRPASDGPATGCSYILVTPDGERTMNTYLGAAQDLGPADIDEAQIAAAAITYLEGY
                     LWDPPQAKEAFLKASKIAHGAGRKVALTLSDSFCVDRYRGEFIELMRSRTVDLIFANE
                     SELHSLYQTSDFDTALKQLALDVPLGVVTRSEKGCAVVEENNITLVPAAKIDTLVDTT
                     GAGDLFAAGFLFGLVRNAGYENAGRLAALAAAEVIQHIGARPQVSLKELAQQHGLPV"
     gene            complement(290262..291956)
                     /locus_tag="RPD_0252"
     CDS             complement(290262..291956)
                     /locus_tag="RPD_0252"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase and ligase"
                     /protein_id="ABE37492.1"
                     /db_xref="InterPro:IPR000873"
                     /translation="MTDKAPSYVCGVSDAPLLGITIGQALDLAAQRWPDREALVSPSH
                     DTRWTWREFAACVDALAAGFLALGLERGARIGIWSMNRPEWTLTQFAAAKAGLILVTI
                     NPAYRLSELEFALAKVGCAALVTATAFKTSAYMEMLNTLIPELSQSQPGALQSSKLPH
                     LRAVIQIGGPKCPGTVAFDDLAQMGGARHREALAALAGRLQFDDAVNIQFTSGTTGSP
                     KGVTLTHHNILNNGYFVGRAMKLTEQDRICIPVPLYHCFGMVMGNLAAVTSGATMVYP
                     GEGFDPLATLQTASREKCTALYGVPTMFIAELDHPEFASFDLSSLRTGIMAGAPCPVE
                     VMRRVNDQMNMREVTIAYGMTETSPVSFQSAVDDPEQRRVSTVGRIHPHVEVKVVDLE
                     GRIVPRGQRGELCTRGYSIMLGYWDEAEKTADVLDRTGWMHTGDLAVIDDEGFCNIVG
                     RIKDMVIRGGENLYPREIEEFLYRHPKIQDVQIFGVADNRYGEELCAWVRVRSGEKLT
                     ADDIRAFCQGQIAHNKIPRYIEFVDEFPMTVTGKIQKFVMREKVESKLGLVAAKTA"
     gene            complement(292089..293276)
                     /locus_tag="RPD_0253"
     CDS             complement(292089..293276)
                     /locus_tag="RPD_0253"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="ABE37493.1"
                     /db_xref="InterPro:IPR001466"
                     /translation="MQSRANIDQLLQQSCERGDIPGVVAVAGSSTEVLYEGAFGKRDL
                     SKPQPMTTDSVFWIASMTKAITSAAAMQLVEQGKLSLDEPIGKVLPDLAEPLVLDGFD
                     ASGNPITRPANAPITLRQLLTHTAGFCYDMWNGDMVKYMERYDIPGVLRCREAALKVP
                     IMSDPGARWEYGISIDFVGRVVEAASGERLDAYLRDDILAPLGMSDTGFRITDAQRER
                     LVAVHSRGADGTLAPIEFEVEQEPEFIMGGGGLYGTAADYLKFTRMILNKGRGNGNQV
                     LKPETVALMGQNHIGDLNVTRLNSVIPFATNDVDLYPGMDNKWGLSFLINTATTPEGR
                     SAGSLAWAGLANTYYWIDPTRDVCGVILMQVLPFADGKCLEAFAGFERGVYAGLDAGK
                     KAA"
     gene            293543..293869
                     /locus_tag="RPD_0254"
     CDS             293543..293869
                     /locus_tag="RPD_0254"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37494.1"
                     /translation="MIPSWSAWKRYPQAGRGNIEAPISPGVYEIRNANDGSLVGFEAV
                     DNLAMALARLQVGPKRLGGWFGRRAPAAAPELEYRVCATTTRAHARAAAEHMINRRET
                     WFSRAA"
     gene            294048..295541
                     /locus_tag="RPD_0255"
     CDS             294048..295541
                     /locus_tag="RPD_0255"
                     /EC_number="1.2.1.16"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate semialdehyde dehydrogenase"
                     /protein_id="ABE37495.1"
                     /db_xref="InterPro:IPR002086"
                     /db_xref="InterPro:IPR010102"
                     /translation="MSPTTAARKSDAASSLRDRLKDPSLLREQCFIDGAWIGTGATVV
                     TNPANGQELGKVPKMGADETTQAVEAAARAFPAWAKLTAKQRSNILRKWFELIVAHRE
                     DLALILTSEQGKPLAEALGEVDIGAAYVEFFAEEARRVYGETIPTQRADARLIAIKQP
                     IGVCGAITPWNFPNSMITRKVSPALAAGCPVVLKPANETPFSALALAALAEKAGVPKG
                     VFNVVTGHASAIGKVLCEHPAVRFVGFTGSTEVGKILYQQAAVGVKKLGLELGGNAPF
                     IVFDDADIDAAVEGAMVSKYRNMGQTCVCANRIYVQDSVYDAFVDKLAAKVSAMKIGD
                     GAEPGVTQGPLINEAAVEKTENHIADAVAHGAKVIVGGKRHALGGTFFEPTVLANVRP
                     DALVAHEETFGPLAPVFRFKDEAEVIRLANNSPFGLASYFYARDIGRVWRVAEALESG
                     MVGVNSGLITTEVAPFGGVKESGLGREGSHHGMEEYVEIKYVMMAGI"
     gene            complement(295704..296390)
                     /locus_tag="RPD_0256"
     CDS             complement(295704..296390)
                     /locus_tag="RPD_0256"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37496.1"
                     /translation="MRRAVGLALGLLLTAAPAHAQDSATLKKDMVGQWELSTTERSKT
                     CVVTLKPDAAPRGMKLELEPGCAAALPFTRDIAAWTVKGLDIVRLETAAGDPVIDFTE
                     VESGIFEGLRANEGVYILQNLAAARSLAKSMEQMIGDWSMVRGSGRPICSLTLTNNEA
                     STPDNFQAFLKPRCEPPVAGFGPTMWRLERGALLLTAPSGEIWRFEADDNAQWRKTPD
                     TADPLIMLRQ"
     gene            complement(296392..297378)
                     /locus_tag="RPD_0257"
     CDS             complement(296392..297378)
                     /locus_tag="RPD_0257"
                     /codon_start=1
                     /transl_table=11
                     /product="D-isomer specific 2-hydroxyacid dehydrogenase,
                     NAD-binding"
                     /protein_id="ABE37497.1"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /translation="MAGEAGATDKIDLLIYGPSKPVINDGFPEQYALHKCEQPGDLDR
                     LTDDIRARIRGVAVTGLVPTNSSVLARYPKLEIVSSFGVGYDHIDSGWAAEHDVVVTN
                     TPDVLTEEVADTALGLLIATLREFVRADKYVRSGSWLTQPYPLSVGSLRDRKVGLIGM
                     GRIGQAIARRLDASRVPVVYHARNPAAGVSYQHYPDLIAMAKDVDTLIVIIPGGASTA
                     RLINAEVLQALGPRGVLINVARGSVVDEPALIAALKSGAILAAGLDVFADEPKVPDEL
                     RMMQNVILLPHIGSASVVTRNAMDQLVVDNIKAWFDGKPPLTPIPETPVRGR"
     gene            complement(297378..298202)
                     /locus_tag="RPD_0258"
     CDS             complement(297378..298202)
                     /locus_tag="RPD_0258"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ABE37498.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MSGRAPTGPRPSRISAASWLRVLLPFVVLAAGVAVWDLVVRINQ
                     IPPYVLPGPGLVWQTLVADWPILSVSLLATLWTTLKGFLAAAIGGVALALLFNQSRWV
                     EYSLFPYAVVLQVTPVIAIAPLLLIYLPQETAVVVCAWIVAFFPVLANTTLGLNSVDR
                     NLAGLFRLYGASPLQTLLRLKLPAALPYILGGLRIAGGLSLIGAVVAEIAAGSAGAGS
                     GLAYRIAESGYRLNIPRMFAALLLLSAAGIVIYLLLALVSHLLLRRWHESALGKDN"
     gene            complement(298199..299011)
                     /locus_tag="RPD_0259"
     CDS             complement(298199..299011)
                     /locus_tag="RPD_0259"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related"
                     /protein_id="ABE37499.1"
                     /db_xref="InterPro:IPR001687"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MALSSSPDLDGPAAACAIRLRAATKVYRGGVEALGPIDLDIGRG
                     EFVSLLGSSGCGKSTALRLIAGLAKPSSGSVRVAGEATRRRGGHAIGFVFQEPTLMPW
                     SSVRANVGLPLKIAHAPAAEIARHVDAALARVELSDFAEAYPRELSGGMKMRVSLARA
                     LVTDPDILLMDEPFAALDEITRFRLNDDLLALWRDLGKTILFVTHSVFESVYLSQRVV
                     VMSPRPGRIAAEFRIEAPEPRGDEFRTSTGYAAQCRDVSRALADASAAQVRA"
     gene            complement(299022..300143)
                     /locus_tag="RPD_0260"
     CDS             complement(299022..300143)
                     /locus_tag="RPD_0260"
                     /codon_start=1
                     /transl_table=11
                     /product="perplasmic binding protein of ABC transporter"
                     /protein_id="ABE37500.1"
                     /translation="MTPAFLLRALTGAVAVALLAVPVHASPPPAPEKPVEKPAPPPPP
                     KKPPPPVVQPVRKVPEGGFDKVSFGTNWVAEGEHGGFFQAVADDTYKSYGLNVTIVPG
                     GPNVNNRALLLAGKLDFFMTANTLQSFDAVANNVPVVAIAAVFQKDPQVFLTHPESKV
                     GQLDDLKRLTLFVSKEGIASYFQWLKSEYGFNEAKVKPYTSNPQPFIVDRNAAMQGYV
                     TSEPFVIEQKAKFKPSVLLLADYGLDGYSTLIETRRDLIDKNPDMIQRFVDASMIGWY
                     NYLYGDNAAGNALIKSLNPEMTDEMLAYSVAKMKEYGIVDSGDTLRNGIGAMSDERYA
                     SFFDKMSRAGVVKRDLDFRQAYTLQFTNKGVGVDLRPSR"
     gene            300297..301109
                     /locus_tag="RPD_0261"
     CDS             300297..301109
                     /locus_tag="RPD_0261"
                     /codon_start=1
                     /transl_table=11
                     /product="Creatininase"
                     /protein_id="ABE37501.1"
                     /db_xref="InterPro:IPR003785"
                     /translation="MTRLPPRDWTEIRWPEIGDADPARWIAVLPLAATEQHGPHLPLG
                     TDVMIARAYLARVHELLPAELPVSFLPLQPIGLSTEHLAFPGTLTLGTETALRLWTEI
                     GDSVARAGVRKLVMVTSHGGNSAAMSLVAQELRARHAMLAVTTGWARFGLPDGLFADD
                     ELRHGIHGGAVETSIMLAHAPQQVRTDRIADFRPATAAMEHEFRWLSAQRPAPFAWAA
                     QDLHPSGAIGDATAASADKGRKALDHGARAFCELLADVDRFDLATLRPAPRP"
     gene            complement(301191..302822)
                     /locus_tag="RPD_0262"
     CDS             complement(301191..302822)
                     /locus_tag="RPD_0262"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-dependent glutamate synthase"
                     /protein_id="ABE37502.1"
                     /db_xref="InterPro:IPR002932"
                     /translation="METILLPFSPRYIALTICAVLTALFASIAITDYHTSLFGVMLTL
                     ALVFGALTLLGVRDLLQKNHAVLRNYPISAHLRFLLEEIRPEMRQYFFESEKDGKPFS
                     RDTRALIYQRAKMVLDKRPFGTQEDVYGDGYEWMHHSVAPRPHAEERFRITIGGPDCA
                     KPYSASVFNISAMSFGALSPNAVRALNAGAKKGGFAHDTGEGGVSPYHREHGGDLIWE
                     IGSGYFGCRTRDGQFDPDAFARLATDDQIKMVELKVSQGAKPGHGGVLPAAKVSEEIS
                     RIRGVAMDEDCISPPFHKAFSTPVEMLRFIAEMRRLSGGKPTGFKLCIGHPWEFLAIC
                     KAMLATGITPDFIVVDGNEGGTGAAPLEFMDHLGMPMREGVNFVHNALIGIGMRDRIK
                     IGAAGKVATAFDMARAMALGADWCNSARGFMFALGCIQSLSCHTDRCPTGVTTQEPSR
                     YRALVVTQKIDRVFNYHHATLHALAELVAAAGLDHPQEIGPHHFSQRTSSSVVVSFAQ
                     LYPTLRPGELLDGTDDPRFKQAWAMARAETFAAAL"
     gene            303023..304009
                     /locus_tag="RPD_0263"
     CDS             303023..304009
                     /locus_tag="RPD_0263"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37503.1"
                     /db_xref="InterPro:IPR011761"
                     /translation="MPQLQDFRTGKPAFYPDQAIYAEYACARLGLRFSERDGGTGLLF
                     AVASGTKEICFGGGRCSYYPQNNATAASLATDKYLANALLERAGVATLGGRYFFLHDR
                     HRALRPPGHERKDALDYLAAQGGHAFAKPLTGSRGDFARPIESAAALASYLDDVARYY
                     DSVLIQPYASGHEYRVFVVDGEALYTARKLPPAVIGDGVRSLRELLHEHDRALRDRGL
                     SGASGDDPSLDQVPAAGERRDIAGRMNLSVGGAMVMEEAGAPAIAGARAATRALGLRL
                     GAVDLFVDPDARDDVRVIEVNSNPAIRFLESCGRDDLIVAIWRHSLTAAGLL"
     gene            304010..305326
                     /locus_tag="RPD_0264"
     CDS             304010..305326
                     /locus_tag="RPD_0264"
                     /codon_start=1
                     /transl_table=11
                     /product="FolC bifunctional protein"
                     /protein_id="ABE37504.1"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /translation="MFDLPKYGEGICLARLAVLLDRLGVDRARLQRIAVAVCGSNGKG
                     STAAFTAGIGRAHGLRTGLFTSPHLYRFNERFQIDGAPIPDDALRRLLERVTKAIAEV
                     GEARGEQFGAFEAQFALACLYFQDNACDFAVFEAGIGGRYDPVRLLGARVSCVTSVDL
                     EHVALLGHSIELIASDKSDACAAGGVIVYGENCRPLRDHLAEYNRNREVAALFIGDEI
                     GIGSASIADARQRFDLRIEDHTYVALETSLLGPFQVNNAAIAASLFALWLRQSGTDHD
                     PARLDAAIRHGLRDARWPGRLETISTEPLTVIDVGHTPDGIRQALAGLRAAHGESGWI
                     LVLGASRDKNAAEIVAALAPSFDAIVCSSAHHKGAPAEVIAEAARAANPRAEIVTAAT
                     VADAVGEARMLAERLDARIYVAGGLFLAIEFAAVTRGGRAEDLRFF"
     gene            305411..306409
                     /locus_tag="RPD_0265"
     CDS             305411..306409
                     /locus_tag="RPD_0265"
                     /codon_start=1
                     /transl_table=11
                     /product="Alcohol dehydrogenase, zinc-binding"
                     /protein_id="ABE37505.1"
                     /db_xref="InterPro:IPR000585"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /translation="MTAVNRQVLLIAKPKEKLGPEHFRMAEAAVPEPKDGEALVKVRY
                     ISLDAANRAWMQGATYRAAVETDSVMPGGGIAEVVSSKAEGLSPGDIVFADTGWQDYA
                     ALPAKHLTKLPKVEPLTHLLSVYGIAGLTAYFGLLDVGKPVAGETVVVSAAAGSVGSI
                     VGQIAKIKGCRVVGIAGGRAKCDWLVNELGFDAAVDYKDGALFKALRAAAPNGIDVYF
                     DNVGGDILEACLPQMNLRGRIACCGAVSQYDRTPSATGPRGVPGLIVVKRLIMQGFIV
                     MDYMDRRDAAVAELQGWVASGRLKVQEDVIDGLENTPQALIGLLAGENRGKRMVKV"
     gene            complement(306439..306675)
                     /locus_tag="RPD_0266"
     CDS             complement(306439..306675)
                     /locus_tag="RPD_0266"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37506.1"
                     /translation="MVSIPRGERLQIMLTEDEYHALDLWRFSRHMPSRAAAVRELLRR
                     GLSAEGFAVSDGTRKSSDFGLIGKSSAETDGRQP"
     gene            complement(307559..307635)
                     /locus_tag="RPD_R0006"
                     /note="tRNA-Arg4"
     tRNA            complement(307559..307635)
                     /locus_tag="RPD_R0006"
                     /product="tRNA-Arg"
     gene            307917..308537
                     /locus_tag="RPD_0267"
     CDS             307917..308537
                     /locus_tag="RPD_0267"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF937"
                     /protein_id="ABE37507.1"
                     /db_xref="InterPro:IPR009282"
                     /translation="MQTVHTEVTMGLLDILNGMQNGPRGPADPNDKSGGMSKFTMAIL
                     ALLAYKAYKHVTAPDAPASVGHGRPTSVPQSPNTMPSRNTINAGMPGGGLSDMLKGGL
                     GGLLAGGAAGTILSGGLGDLMKQFQTNGLGDAADSWVGRGENKQIGPNDLANALGADR
                     LEMLTQQTGMSREELLDGLSQQLPGVIDQLTPDGRLPTEDEASRWI"
     gene            308588..308866
                     /locus_tag="RPD_0268"
     CDS             308588..308866
                     /locus_tag="RPD_0268"
                     /codon_start=1
                     /transl_table=11
                     /product="Transglycosylase-associated protein"
                     /protein_id="ABE37508.1"
                     /db_xref="InterPro:IPR007341"
                     /translation="MTGILWIILVGFIAGIIARFLSPGPNNPQGFLLTTVLGIVGAFL
                     ATAIGQAIGHYGPNQGAGFITATIGAVLVLFIWNRLVARRVLSDPGNR"
     gene            complement(309048..309830)
                     /locus_tag="RPD_0269"
     CDS             complement(309048..309830)
                     /locus_tag="RPD_0269"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="ABE37509.1"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR013120"
                     /translation="MAKAGLNVIVTGSASGLGAATAKILARDGARLVINYSSSQKDAE
                     TTAEDCRKAGAAEVVVVQGDVAKDDDCKRIVEAAAHWGGLDALINNAGITKHVAHHLL
                     DQLSAEDFQRIYAVNTIGPYQMVRAARALLVAGAKAAGRSSAVVNVSSVAGTSGIGSS
                     IAYAASKGALNTMTLSLSRALAPSIRVNAICPGYIDTPWFTKGRGADAAQQVRDMVVA
                     KVPLKIASSPEDIAELVCFLASPKSSSMTGELVRMDAGMHLG"
     gene            310089..311156
                     /locus_tag="RPD_0270"
     CDS             310089..311156
                     /locus_tag="RPD_0270"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase-like"
                     /protein_id="ABE37510.1"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR013107"
                     /translation="MTETTDNIVVETAEKIFADLADAQTINASKDGSWRAPLWRALSE
                     SGLPLSWVPEACDGSGASLAEGFAVLNAAGRAGLAAPLAETMLAGWLLAQANIASPEG
                     AMTIAPVHPKDRITLGPDGTLSGRARGVPFARDAKFIAVLAQRSDGASVALVDASTCR
                     IDHGLGLGGDPSDTVTFDKVSPLKLAAAPQGFDATALLLIGSVARSLQIAGALETMLE
                     ISVRYSNERVAFEKKISKFQAVQHNLAKLAGETSAALAAATSAADTLANATAFDDAVM
                     LEAAAAKIRCAEAAEKGAAIAHQVFGAIGFTSEHILHRYSLRALAWRDDFGNESHWAV
                     ELGRMVARRGADDLWPLVASR"
     gene            311182..312342
                     /locus_tag="RPD_0271"
     CDS             311182..312342
                     /locus_tag="RPD_0271"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase-like"
                     /protein_id="ABE37511.1"
                     /db_xref="InterPro:IPR006089"
                     /db_xref="InterPro:IPR006091"
                     /translation="MTAALRFDPIRLPPVCEELRREVRAFLAEEIAAGTFDPHKPQRE
                     DSDAPEFSRRVGARGWLGMTWPKQYGGHERTFLERYVVTEEMRVANAPTRRFFVADRQ
                     SGPVLLKYAPEHIKMDILPRICRGELCFAIGMSEPNSGSDLFAAKTKATKTDGGYLIN
                     GSKIWTTSAHIADYMIAIFRTSPSTKENRRHGLTQFLVNMKTPGIKVNPIAQITGQHE
                     FNEVVFTDAFVPDDHVLGEIDGAWKQATSELAFERSGPERFLETYYVLTELVRALGPD
                     PDTRGAEGIGRLVAQLHTMRRMSVSVAGMLQAGKEPVVEASIVKDIGTMWEQQLPHRV
                     RELAAFVDSEASNHATLDELTAFATKVAPKLTIQGGTTEVLRGIIARGLGLR"
     gene            312486..313292
                     /locus_tag="RPD_0272"
     CDS             312486..313292
                     /locus_tag="RPD_0272"
                     /codon_start=1
                     /transl_table=11
                     /product="Enoyl-CoA hydratase/isomerase"
                     /protein_id="ABE37512.1"
                     /db_xref="InterPro:IPR001753"
                     /translation="MTNYTDIAVETNGHVALIEIRRPPLNFFDISLIQQIADALDAID
                     ADPEMRATVLAAQGKAFCAGANFGDSAQQAGDPQAAKGDPADSLGQIGHLYYEAVRIF
                     RAKKPIVAAVHGAAIGGGLGLAVSADFRVTCPEARFAANFTKLGFHPGFGLTVTLPEL
                     IGRNNAELMFYTSRRVTGEDAVKMGLANELVPLNEVRSAALKLAREIAECAPLGLLST
                     RATMRATLADRVMEATKHELAEQTRLRATEDFREGIKATEERRIAHFKGR"
     gene            complement(313355..314119)
                     /locus_tag="RPD_0273"
     CDS             complement(313355..314119)
                     /locus_tag="RPD_0273"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37513.1"
                     /translation="MAPFLRLRQICLVADSLEPATSRLAAIMGLEVCYRDPHVGKYGL
                     ENVLLPVDATLLEIVAPTRAGTAAGRFLEKTGGHGGYMAIFCCDDPDARGRHAATLGV
                     RTANVIDHAPYHGVQLHPRDCRAAFIELNHTAGSDNVRGPYPPAGPDWHKAIRTEVTQ
                     ALTAVELQSPDPDDLAAHWGRILELPVTKGAEGVAELQVPNATLRFVKGDSEALTALT
                     FKVADPTKIREAAQSQGVATTGDGFTLAGVAFRLSN"
     gene            complement(314122..314910)
                     /locus_tag="RPD_0274"
     CDS             complement(314122..314910)
                     /locus_tag="RPD_0274"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="Enoyl-CoA hydratase"
                     /protein_id="ABE37514.1"
                     /db_xref="InterPro:IPR001753"
                     /translation="MTDIVLQQLDQGLLTITMNRPDRRNALNQELIRGLVDAARRAAD
                     DPEVRAVLLKGAGGTFCVGGDVKSMAAAGAPPPLEAKVANLRRGMEVSRILHQMPKPV
                     VAQIDGAAAGAGLSIALACDLRVVGASAKITTAFAKVGLSGDFGGTYFLTHLIGAAKA
                     RELYLTSPVLTAQEAHALGIVSCVVPDADVESAARELALSLAQGPSVTLGYIKTNINN
                     AEHLSLEACFDAEALHHSRCAETADHKEAASAFVEKRAPSFQGR"
     gene            complement(315107..316312)
                     /locus_tag="RPD_0275"
     CDS             complement(315107..316312)
                     /locus_tag="RPD_0275"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ureA/short-chain amide ABC transporter"
                     /protein_id="ABE37515.1"
                     /translation="MKAIRIALFACLSITAISAAQAQSQPPLKLGAILDMSGLYADIT
                     GPGSEAAAKMAVEDFGGTVLGRKIEIVVADHLNKADLSANIARDMLDNQGVEAIIDVA
                     ASATALAAAEIAKARGKIIMFSGPGSIRLSNEACGPYTVHYVFDTFAQANTTGLAAVK
                     QGLDSWFFLSADYAFGQDLERDTSNVIKASGGKVLGNVKHPINTSDFSSFLLQAQSSK
                     AKVVGLANAGGDTINAIKQAAEFGIAKGGQKLSPLLAFISDIDSVGLDTAQGLILAEA
                     FYWDLNDDTRAFSKRFMERTKRVPTSVQAGLYSETMHYLQAVKAAGTTDAAAVMKKMK
                     ETPINDFFAKNGRIREDGRMVHDMYLFEIKKPSESKGRWDNYKLLATVPGDQAFQPLS
                     ESRCPLVKK"
     gene            316528..317322
                     /locus_tag="RPD_0276"
     CDS             316528..317322
                     /locus_tag="RPD_0276"
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease (SNase-like)"
                     /protein_id="ABE37516.1"
                     /db_xref="InterPro:IPR006021"
                     /translation="MTATTNNARARGRLAAMISGGVLLFVPGVLFAGCPDLPRQGEGV
                     VAAIDDGRSLRLQDGREIRLAGIELELSRQAEAKAALASLASGRVITLRGVDDAPDRY
                     GRQPAFVFTDDETRPLQSRLLDAGHALVGTGIAQADCRGELLAAESSARIARRGLWAA
                     PSALKNAGNPGDIMSRVGRFTVIEGRVLSVREAGGTIYLNFGRRWTRDFAVTISRRIL
                     GSFEAAGIAPKSLENKRIRVRGWVERRSGPQIRIREVGQIEVPGAP"
     gene            317343..318836
                     /locus_tag="RPD_0277"
     CDS             317343..318836
                     /locus_tag="RPD_0277"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M48, Ste24p"
                     /protein_id="ABE37517.1"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="InterPro:IPR006025"
                     /translation="MIGSEGRRSIWRSRHWLAVPLLGSALALAGCGDFRRFETASAPA
                     SAPAVKPARPAAQSPTAEREHERILATYGGAYDDPRLEALIGSTVNRLVAASDRPDLT
                     YKVTILNSGAVNAFALPTGQLYVTRGLVALASDTSELSSVLSHEMAHVLAKHAAIRED
                     QARQAALVTRVVTDMGNDPDMTALALAKTKLSLASFSRQQELEADGIGVGISARAQFD
                     PYGASRFLTAMERNAALKASRGDPRSQDFLSSHPATPERVRNAQNNARQYASPEQNAK
                     GERDRETYLNAIDNLVYGEDPSEGFVRGRRFLHPKLGFTFQVPETFTLDNTAQAVIGV
                     REGGSQAMRFDVVRVPAEQSLGDYLNSGWMENVDKSSTEELSISGFPTASVMARGDQW
                     QFKVYALRFGSDVYRFIFATRQKSAESERNARDTVNSFRRLTLDEIQAARPLRIKVIT
                     VQPGDTVESLSHRMAGVDRPLERFRVLNGLDASATVKPRDLVKIVVD"
     gene            complement(319035..320333)
                     /locus_tag="RPD_0278"
     CDS             complement(319035..320333)
                     /locus_tag="RPD_0278"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, CarD family"
                     /protein_id="ABE37518.1"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR003711"
                     /translation="MCYIWHILETRHAVFAAGKGSRQKQRTGAWRFHAQAVSQKTRKM
                     SVSSKRAKHAAAANRSATKSQSRISAKDTRSVKSPASKASGSKASSSKSPVSKASATK
                     ASATKAVGSKSSVSKASASKASTSKASAGKAAAAKVTAGKASAAKVTTAKGSAAKASA
                     SKASALKSSKNKRSEMPSKTAKTAAPADASKTASAKSTAKPVAKAPEAPKAAVAKPEG
                     KPVAAKPAAPPKVEEPKKAVTQRQGFKAGEFVVYPAHGVGQILAIEEQEIAGAKLELF
                     VINFIKDKMTLRVPTAKVANVGMRKLSDPALVKKALETLKGRARVKRTMWSRRAQEYE
                     AKINSGDIVAIAEVVRDLFRSESQPEQSYSERQLYEAALDRLSREIAVVQQVTETEAV
                     KEVEGQLAKSPRRGAKAEVDAEGDADGDVDTDDAVTDEAA"
     gene            complement(320466..320804)
                     /locus_tag="RPD_0279"
     CDS             complement(320466..320804)
                     /locus_tag="RPD_0279"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin, iron-sulfur binding"
                     /protein_id="ABE37519.1"
                     /db_xref="InterPro:IPR000813"
                     /db_xref="InterPro:IPR001450"
                     /translation="MTYVVTENCIKCKYTDCVEVCPVDCFYEGDNMLVIHPDECIDCG
                     VCEPECPADAIKPDTEPGLEKWLELNTEYAKSWPNLTQKKEAPGDAKQYEGMEGKFEK
                     FFSPEPGTGD"
     gene            complement(320879..321148)
                     /locus_tag="RPD_0280"
     CDS             complement(320879..321148)
                     /locus_tag="RPD_0280"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding S4"
                     /protein_id="ABE37520.1"
                     /db_xref="InterPro:IPR002942"
                     /translation="MERQRLDKWLWHARVVRARSAAAALVESGHVRINGAREKSPGHA
                     IKAGDVVTIALDRGVRVLKVVGFTERRGDAASVTGLYADLSVPRD"
     gene            complement(321188..324547)
                     /locus_tag="RPD_0281"
     CDS             complement(321188..324547)
                     /locus_tag="RPD_0281"
                     /codon_start=1
                     /transl_table=11
                     /product="helicase-like"
                     /protein_id="ABE37521.1"
                     /db_xref="InterPro:IPR001410"
                     /db_xref="InterPro:IPR001650"
                     /translation="MPRSFSAPFTNDRAPGAGVTAVLGPTNTGKTHLAIERMVAHPSG
                     LIGLPLRLLAREVYNKIVDRVGPDAVALVTGEEKIKPPKARFWVSTVEAMPRDLDVSF
                     LAVDEVQIAADLERGHVFTDRLLRRRGRDETLLLGAATMRPIIERLLPGASIVTRPRL
                     SQLEFAGDRKLTRQPRRTAIVAFSADEVYAIAELIKRQHGGAAVVLGSLSPRTRNAQV
                     AMFQSGDVDYLVATDAIGMGLNLDVDHVAFASDRKFDGYQFRRLNPSEFAQIAGRAGR
                     ATRDGTFGTTGRCAPFEPELVNALQNHTFDAVKTLQWRNSELDFASIAALQVSLAETP
                     RHDALTRAPAAEDLRVLDHAARDGDVRDMAHGAAAVERLWEVCQVPDYRKIAPAAHAE
                     LVTTLYRFLMQKGRIPDDWFGAQVEQADRIDGGIDTLSARIAQIRTWTFVANRVDWLA
                     DPEHWQGISRDIENKLSDALHERLTERFVDRRTSVLMRRLRENTMLNTEIGKTGEVIV
                     EGHVIGRLDGFTFAPDAAEAGSDAKALQATAQKALAGEIDSRAEKLSGAPDEQFLLTS
                     DGTVRWTGDAVGRLVGSDEVLRPRLRIIADDRLAGASREAVQTRLDLWLKTHIEKILG
                     PLFELSKAEDITGIGRGIAFQLIESLGVIERAKIAAEMKDLDQPSRATLRKYGVRFGA
                     YHIYVPSLLKPAARALASLLWAQKLDDVDMSALSSAQHLASSGRTSFPADKALDRDAY
                     RTLGYRLCGERAVRVDILERLADLIRPALAWREGAQGEKPAGAFDGRSFVVTQSMTSL
                     TGSAGEDFASILRALGYRMEKRPALPPSTTAPAKLPDAAPEAPSADSAETGLSAEDHA
                     ILAGAIAFEPAVAAETDDVADLTNDAPQPVAASEQAAPEPAADASESSPVESQPDSAA
                     VPEAELAATDTAQEATAEAAASDAPAVDATTDNTDGAAPAVESAAPAQPEMVEVWRPG
                     GRSDEHRARPDRNRQRHRPPQAGQAAAPEGEAGEAKRGDRPDRGGRRGDRKGADVRRD
                     RREGEGQGAPRSEAAGEGRPSRERFKGRDKSQDKFKGGPKGGRDNQGGGSHRQVHSSA
                     PPRERDRPIDPNSPFAKLAALKEQLSAGRKD"
     gene            complement(324975..325856)
                     /locus_tag="RPD_0282"
     CDS             complement(324975..325856)
                     /locus_tag="RPD_0282"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37522.1"
                     /translation="MNIPVSRPSRRQAHASLMPGLIAGLLTIGLASIAPLDRAAAQGK
                     LDARYEATLAGIEVGKGGWVIEITDDGYAAAANGATSGVLQAFSRGNGSGEAQGRLVN
                     GQFSPMNYMATTTSAKKTETIRITLANGNVKESSIEPEQPHDADRIPVTEAHRRGVVD
                     PMTGSILRVPGVGDLISPDSCRVSTPIFDGRMRYDLRMDYKRIETVKAEKGYQGPVLV
                     CGIYFTPVSGYIPDRAAIKYLVEQRGMEVWLAPIAGTRMLVPFRLKIPTPLGNAVLQA
                     TQFVTKATPPKSVSRTQ"
     gene            326169..326474
                     /locus_tag="RPD_0283"
     CDS             326169..326474
                     /locus_tag="RPD_0283"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L28P"
                     /protein_id="ABE37523.1"
                     /db_xref="InterPro:IPR001383"
                     /translation="MSRRCELTAKGVQTGHKVSHSNIKTKRRFLPNLVNVTFLSDALG
                     RPVRLRVSTNALKSVDHRGGLDAFLAKASIAELSPKAAELKRAIAKKKAGEPAAAAS"
     gene            326692..330009
                     /locus_tag="RPD_0284"
     CDS             326692..330009
                     /locus_tag="RPD_0284"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor hybrid histidine kinase"
                     /protein_id="ABE37524.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /translation="MNRPIGQNNYAPDTAPDLDSLGPRCPRIEAGAMKLSTRLTLAMV
                     ALVLVTTAVLGFLNYRSIVELVMPRALKQLQTHAQLNALLMDAHLRGARADAVGAQAS
                     STLRDLLLSRLKTTETPGEPAPEWRRRIEARFAAELVAKPTYAILRIIGPEDGGRELV
                     RVDRLGPNGGIRAVPVSQLTRRGDRSYVREGLALPRNEVAVSKIELNRNETGLEIPYV
                     ATMRTMAPIDAPDGTRLGVLVINTNLSENLERVRDSVTRGNLIYIVNAAGDYLLHPDR
                     SREFGFDRGTPSRIQDDFPAFAALLDGKDEAPRVMESSTGQRFGVGWDWVRLADGPRV
                     GVIEMRSYASLTSVPRAVRDATLTGGAAAILVAMLMAVPLARSLTRPLVRITRSVQAF
                     ARGEKFELTPGGSQEINLLADAFSQMTHEANRKAIALAAEVEERTRIAGVLQNTIDIM
                     VDPVLVVDARGTVILTNPAACEMFGSLAGISILNTTRSFDRFSPDGKPLTPDKSALLR
                     AFLGETIENFEFIVQPIGSARRSYLTANGRPLRGETGQIQGAVMVYHDITKTKKAEEA
                     LRRSEQMARAIVDTALDAFVQVDALGTITEWSPHAELVLGWRRSEAIGRNVFQLLIPA
                     DQLERRTEEFKRFASSLGRDSSGFRVEIEVLHQDGTPTPIEVAMTALYRDGSFVINAF
                     LRNLTEQIAFEEQLRQSQKMESIGQLTGGIAHDFNNMLTVITGTIDIISDGVADQPHL
                     ATIAKLISEAADRGAELTRLLLAFARKQPLRPDETDVNALVAGLQSLLRPTLGEQIEI
                     ETSFDDGAWPIYVDRGQLESALVNLAVNARDAMPNGGKLTIETCNIVVDQELAKRFGN
                     VESGSYVMIAISDSGCGIPDAIRGKVFDPFFTTKEVGKGTGLGLSMVYGFIKQSGGHI
                     TLYSEVGLGTTFRLYLPRASTENEREAATSSEQGAVGGTETILVVEDDAMVRSYVNAQ
                     LKSLGYTALSVGNATAALSISDSGAEFDLLFTDVVMPGPYNGVQLAAEMSKRRPGLKV
                     LFTSGYSENALIYNDRLDPDILLLSKPYRRADLARMIRLALNSTVESEVIQNAADEHL
                     KNERVDDNVERSSVRPL"
     gene            complement(330097..331176)
                     /locus_tag="RPD_0285"
     CDS             complement(330097..331176)
                     /locus_tag="RPD_0285"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37525.1"
                     /translation="MTTGDGGAAAGRLLSRRRVVALAAGLAFAAHPALAQSQAQRFDP
                     EEFSTPAPERIEVRARPIESFDLRDRASRRFGALQFRSGLVLTSPFRGFGGLSGLKLD
                     PKGERFVAINDRGAWITGRIVYSGAEMTGLADVEAAPLLGPDGQPLTRRKWYDSESLA
                     FDGGTAYVGFERVNQIVKFDFGRDGVRALGQPIAVPPALRKLPNNKGIESLVAVPKGQ
                     PLAGTLIAISERGLDADRNVIGFLIGGKTPGQFAVRRTEDFDISDAMLLPSGQLLILE
                     RKFSWIHGVHIRIRRIALSTLTPGAIVDGPALFNADLGHEIDNMEGIDAHLDASGATV
                     LTLVSDDNFSMLQRTLLLQFTLVED"
     gene            complement(331173..333068)
                     /locus_tag="RPD_0286"
     CDS             complement(331173..333068)
                     /locus_tag="RPD_0286"
                     /EC_number="6.6.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt chelatase, pCobT subunit"
                     /protein_id="ABE37526.1"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006538"
                     /translation="MTTNSKFRTGSKEAPTEPFKRAVTSCLRAIAKSPELEVTFAAER
                     PGLAPGKARLPEPARKMSKRDAAIVRGHADSIALKLACHDPKVHRKLMPGNPQARGVF
                     EAVEQARVEALGARRMAGVAKNLTAMLDDHFHRGKFDEITERADAPLADALAMLVRER
                     LTGLAPPPAARKLVDLWRPVLDDKIGPRLDQLERFAENQSKFGDAIHDLLEALELGDD
                     RDTESEEDENQDDKQEGENDQSGAEGTPESEAAQEMSAEQAEATSDEMSDSAMESAQA
                     SASDTFDDSEVGEDDTPGEATRPNNRGANEPRGPEYHAFAPKFDEVIAAEDLCDHDEL
                     ERLRSYLDKQLAHLQGIVARLANRLQRRLMAQQNRAWDFDLEEGILDPARLSRVVTDP
                     FHPLSFMSEKEATFRDTVVTLLLDNSGSMRGRPITVAATCADILARTLERCGVKVEIL
                     GFTTRAWKGGQSREAWLAAGKPATPGRLNDLRHIIYKSADAPWRRARKNLGLMMREGL
                     LKENIDGEALDWAHKRLLGRSEQRKILMMISDGAPVDDSTLSVNPGNYLERHLRHIIE
                     EIETRSPVELIAIGIGHDVTRYYRRAVTIVDAEELGGAITEKLAELFSETADAPAGPG
                     RRRRLHS"
     gene            complement(333223..334218)
                     /locus_tag="RPD_0287"
     CDS             complement(333223..334218)
                     /locus_tag="RPD_0287"
                     /EC_number="6.6.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenobyrinic acid a,c-diamide
                     cobaltochelatase"
                     /protein_id="ABE37527.1"
                     /db_xref="InterPro:IPR006537"
                     /db_xref="InterPro:IPR011704"
                     /translation="MTAATTRAQEITGLPDMKVSVRQVFGIDSDLEVPAFSEADPHVP
                     DVDSDYRFDRATTLAILAGFARNRRVMVTGFHGTGKSTHIEQVAARLNWPCVRVNLDS
                     HISRIDLVGKDSIVVRDGKQVTEFRDGILPWALQHNVALVFDEYDAGRPDVMFVIQRV
                     LEVSGRLTLLDQNKVIKPHPAFRLFSTANTIGLGDTSGLYHGTQQINQGQMDRWSIVT
                     TLNYLPHDEEVEIVLAKARHYRNAEGREIVNKMVRLADLTRNAFANGDLSTVMSPRTV
                     ITWSENAEIFGDIGFAFRVTFLNKCDELERPLVAEFYQRCFNAELPESSVNVAMS"
     gene            334517..334657
                     /locus_tag="RPD_0288"
                     /pseudo
     gene            334720..334860
                     /locus_tag="RPD_0289"
                     /pseudo
     gene            complement(334887..335534)
                     /locus_tag="RPD_0290"
     CDS             complement(334887..335534)
                     /locus_tag="RPD_0290"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein DnaJ-like"
                     /protein_id="ABE37528.1"
                     /db_xref="InterPro:IPR001623"
                     /translation="MAIDSSKFFDKIRVKPTKAEAAREAAREQVIMCDAPGCANRGAH
                     RAPKGRGLEKDYWHFCLNHVREYNQGYNFFEGMNADAVARYQKDALTGHRPTWKMGQN
                     GAKSRTKNPEDLAGAADPFEVINEFNGRSRWRRGPDPSAEQTKSEPRKVFNAERKALQ
                     VMGLDGDATLDIVKAKYKALVKQHHPDANGGDRSTEDRLIEIIKAYNYLKTVVRA"
     gene            335604..335909
                     /locus_tag="RPD_0291"
     CDS             335604..335909
                     /locus_tag="RPD_0291"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator BolA"
                     /protein_id="ABE37529.1"
                     /db_xref="InterPro:IPR002634"
                     /translation="MQRDRKRTNGRDMGVKDTLTQKLREAFTPESLDVIDESNLHEGH
                     AGHSGRGESHFRVNIVSDAFAGKSRIDRHRMINELLAAELKGGLHALAVKAKAPGEA"
     gene            complement(335951..337273)
                     /locus_tag="RPD_0292"
     CDS             complement(335951..337273)
                     /locus_tag="RPD_0292"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF21"
                     /protein_id="ABE37530.1"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="InterPro:IPR005170"
                     /translation="MDWLTFGIVIACLFGSAFFSASETALTAASRANMMRLAKQGSRN
                     AGIVGRLLAVRERMIGALLLGNNIFNIGASALATGLFTAWFGELGVLYATAVMTVLVV
                     IFAEVLPKTIAINAPDRFALLVAKPMRAMVLVLGPLLTVIEALVRVLMRLMGVKVGAH
                     QSLLTATERLRGAVELIHHEGGVAKHDRDMFGGLLDLSELQVSDVMVHRTEMVMVNAD
                     LPPEELVREVLATEYTRIPLWREKPENIIGVLHAKDLLRAMRAAEGDASNIDVTKIAL
                     PPWFVPEMRLVSEQLKAFRSRKTHFALVVDEYGEVEGMVTLEDILEEIVGDISDEHDI
                     VVAGVRTQPDGSVVVDGSVPIRDLNRAMDWNLPDEEATTIAGLVIHEARSIPDRGQSF
                     TFHGFRFRVLRRERNRITALRIVPVPRETEAEAADKKKGKIARIGPVP"
     gene            complement(337288..338436)
                     /locus_tag="RPD_0293"
     CDS             complement(337288..338436)
                     /locus_tag="RPD_0293"
                     /EC_number="4.2.3.4"
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate synthase"
                     /protein_id="ABE37531.1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002658"
                     /translation="MTAPLNHSAPITVDVALGDRAYDIVIGRDVLGTLGERIAKLRPG
                     ARTAIVTDRTVAQHWLAQAEAVLDKAGVAHQRIVVGEGESSKTYAGLEQVAEALIAAK
                     IERNDLVIALGGGVVGDLAGFASAIVRRGVDFVQVPTSLLAQVDSSVGGKTGINSPQG
                     KNLLGAFHQPVLVIADTAVLDTLSPRQFRAGYAEVAKYGALGDEAFFAWLEANHAEIV
                     SGGPAREHAIATSCRAKAAIVARDERENGERALLNLGHTFGHALEAATGFSDRLFHGE
                     GVAIGMVLAAQFSAERGMMPEADALRLQHHLAEVGLPTRLQDIAGFAQEGLADADALL
                     ALMTQDKKVKRGQLTFILMEGIGRAVIANDVEPAPVRDFLARQLARAS"
     gene            complement(338433..339047)
                     /locus_tag="RPD_0294"
     CDS             complement(338433..339047)
                     /locus_tag="RPD_0294"
                     /EC_number="2.7.1.71"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="ABE37532.1"
                     /db_xref="InterPro:IPR000623"
                     /translation="MSEIAPPADAARSQEAEIVAALGERAVVLIGMMGAGKSTVGRRL
                     ALRLGLPFLDADTEIESAAAMTIPEIFDTHGEPHFRDGEARVIARLLDGGAKVLATGG
                     GAFMREETRDRIRDKAVSLWLEADADVILRRVKRRADRPLLKTPDPAGTIARLIDERY
                     PVYRSADLTIASRDVPHEKIVDECVAALHGYLCCAAAPTLSETP"
     gene            339225..339371
                     /locus_tag="RPD_0295"
     CDS             339225..339371
                     /locus_tag="RPD_0295"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37533.1"
                     /translation="MPTLFRFLSVVAVIGGIIYGTIFALANFVSPKSREMTVVVPADK
                     FLKK"
     gene            339389..340444
                     /locus_tag="RPD_0296"
     CDS             339389..340444
                     /locus_tag="RPD_0296"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine recombinase XerD subunit"
                     /protein_id="ABE37534.1"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR004107"
                     /db_xref="InterPro:IPR011932"
                     /translation="MRRPRSNPSSSVQSSVQALAAEPANRETAPLRPASYSDAGLSEL
                     FLDMIAAEQGASANTIDAYRRDLADLSHYLTRSRKSIASADTEALRGYLADLDARGFK
                     SSSVARRLSALRHLFRFLLSERIRVDDPAAILSGPKRGRGLPKVLSIADVDRLLGYAR
                     QQAEAADGAGGVRAARLYCLLEVLYATGLRVSELVSLPSSAARGDARMIVVRGKGDKE
                     RLVPLNHSAKQAMTRYLATAAAAEKAAATATKAGSKGSKWLFPSFGESGHLTRQHFAR
                     DLKDLAGRAGLSPRLVSPHVLRHAFASHLLHNGADLRIVQTLLGHSDISTTQIYTHVV
                     EDRLKSLVRDLHPLAEG"
     gene            340595..341569
                     /locus_tag="RPD_0297"
     CDS             340595..341569
                     /locus_tag="RPD_0297"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-coenzyme A carboxylase carboxyl
                     transferase subunit alpha"
                     /protein_id="ABE37535.1"
                     /db_xref="InterPro:IPR001095"
                     /db_xref="InterPro:IPR011763"
                     /translation="MSLVMSEPMRSYLDFEKPVAELDSKIDELRTLAASGSDIHEEVS
                     RIEEKAAQALNELYAALTPWQKTQVARHPQRPHCVDYIQGLITEFTPLAGDRKFGEDE
                     ALIGGFGRFRGESICVLGQEKGSSTETRLKHNFGMARPEGYRKAVRLMEMADRFGIPV
                     LSLVDTAGAYPGIGAEERGQAEAIARSTDACLQLGVPNVAVVIGEGGSGGAIAIATAN
                     KVLMLEHAIYSVISPEAASSILWRDGTKAQEAANSMKITAQDLLRFGVIDQILAEPKG
                     GAHRDPEAMIATTGDAIAAAFAELNGLDSSTVRNKRRQKFLEIGRKLG"
     gene            341987..343450
                     /locus_tag="RPD_0298"
     CDS             341987..343450
                     /locus_tag="RPD_0298"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF949"
                     /protein_id="ABE37536.1"
                     /db_xref="InterPro:IPR010355"
                     /translation="MTRTPLLRALLASAAIAASSLLAGCNSDQMSLATNAKANQPVPP
                     KLVAEMQAKNMDLQSPILVRLFKQEAELEVWKQDRTGVFALLKSYPICRWSGDLGPKV
                     REGDRQAPEGFYAISPGQMNPQSSYYLSFNTGYPNAFDKSLGRTGSQLMVHGDCSSRG
                     CYAMTDEQIAEIYSLGRESFFGGQRAFQLQAYPFKMTPVNFAKHRNNPNMPFWKMLKE
                     GYDHFEVTRQEPKVDFCEHKYVFDAAPPPGSSKPLAFNASAKCPAYSVPADIADAVRE
                     KDQKDQTKLAELISKGTPVARLRTGIDGGMHQVFAAKIPDGSTGLSEVDDSSSVALAS
                     FDRAPGTIPPTVNPPRRPSDDLLQKATETTSVAAAPATSTSNPPARVASASKDDIGGL
                     LSGLSRRGGSGEITSSTAPTQATARRNEPTPAPPRPHATVPKSADTKQAAAKPQLKPA
                     VELNGATAAKPTTTGTISGAAPVVSSNNFEGRFSAFR"
     gene            complement(343844..346684)
                     /locus_tag="RPD_0299"
     CDS             complement(343844..346684)
                     /locus_tag="RPD_0299"
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase subunit secA"
                     /protein_id="ABE37537.1"
                     /db_xref="InterPro:IPR000185"
                     /db_xref="InterPro:IPR004027"
                     /db_xref="InterPro:IPR011115"
                     /db_xref="InterPro:IPR011116"
                     /db_xref="InterPro:IPR011130"
                     /translation="MIGAFARKLFGSSNDRRIKAYQARVAAINALEPDVAALSDEALR
                     ARTDQFRAELAAGKTLDDLLIPAFATVREAAKRTLGQRHFDVQLIGGMVLHEGDIAEM
                     KTGEGKTLVATLACYLNALAGKGVHVVTVNDYLASRDAGWMGQIYAFLGMSTGVIVHG
                     LDDSQRQKAYACDITYGTNNEYGFDYLRDNMKYRLEDMAQRGHFFAIVDEVDSILIDE
                     ARTPLIISGPLDDRSEFYNTIDTFIPRLDKSDYDVDEKQRSVALTEAGMEKIETLLRD
                     AGQLKGESLYDIENVSVVHHINQALRAHTLFQRDKDYIVRNDEVVIIDEFTGRMMQGR
                     RYSEGLHQALEAKEHVTVQPENQTLASITFQNYFRMYGKLAGMTGTAATEADEFYDIY
                     KLEVVEIPTNVTIARLDEDDEVYRTQTEKYAAILAEVERANKRLQPVLVGTASIEKSE
                     VLADVLLKSGYKQIDFGDPKALEKLYAAARAGKPAKLFAVLNARFHEQEAYIVAEAGV
                     PGAITIATNMAGRGTDIKLGGSLEMRIQQETADITDEAEKAARIEQIKADIERFRQIV
                     LNAEDEVEIEPAKGNKPAKTAKRPGGLYIIGSERHESRRIDNQLRGRSGRQGDPGRSK
                     FFLSLEDDLMRIFGSGKLDTMLTRLGLKEGEAIIHPWINKALEKAQQKVEARNFDIRK
                     NLLKFDDVQNDQRKVIFDQRIELMKEDSVVETVTDMRHTFIEDLVSKHVPEHAYAEQW
                     DVAGLKEELNRVVGLDIPVDEWAKEEGIADEELLVRLEKVFDEHMAAKVAQWGPDVMR
                     YAEKSILLQTLDHLWREHLVMLDHLRQVIGLRGYGQRDPLQEYKSEAFNLFQEMSAHL
                     REAVTAQLMRVEIIPPEQPRELPPMEVHKMDPNTGEDEMQFANVSLAPADTVEKSERD
                     PNRPESWGKVGRNEDCPCGSGKKYKHCHGRYA"
     gene            347027..347944
                     /locus_tag="RPD_0300"
     CDS             347027..347944
                     /locus_tag="RPD_0300"
                     /codon_start=1
                     /transl_table=11
                     /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="ABE37538.1"
                     /db_xref="InterPro:IPR000297"
                     /translation="MTPASSAAISALRSGFISAAATGCLAFALLASPMAHAEDANPVL
                     AKVNGAEIRQSDVALAEEELGPSLAQMDPATKKENVLAFLIDMKIVAKAAEDKKIADR
                     AEFKKRLEFARNRLLMDDLLAVEGKNATTNDAMKKVYEDAAKQISGEQEVHARHILVE
                     SEDDAKAVAEELKKGADFAELAKKKSKDPGASDGGDLGFFTKEQMVPEFSAVAFAMEP
                     GKISDPVKSQFGWHIIKVEEKRSRKPPTFDQVKPQIEQYVTRKAQADYVAQLRQAAKV
                     ERLDKPAEPAAAPADAAKPADPAKAPAKK"
     gene            complement(348152..349207)
                     /locus_tag="RPD_0301"
     CDS             complement(348152..349207)
                     /locus_tag="RPD_0301"
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase 3"
                     /protein_id="ABE37539.1"
                     /db_xref="InterPro:IPR002656"
                     /translation="MTANGTHVPARMHGDRVDWVDYAKGICIIMVVMMHSVLGVEAAA
                     GETGFMHLVVEFAKPFRMPDFFLLSGLFLAVVIDRDWRTYLDRKVVHFAYFYVLWVTI
                     QFAFKAPSFAAEIGWAGVVKLYALSFIDPFGTLWFIYLLPIFFVVTKATRRAPPLLIW
                     AIAALLESLHVATGWMVIDEFCARFFYFYTGYLFASRVFAFSDAARARPALALIGLAL
                     WAAINAALVHTGVSEWPLLSLLLGLAGACAIIAAGTLLAEKRWLDGLRFCGEHSIVIY
                     LAFFLPMAVSRTLLLKFAGFLGTGMIALLVTIIGVVGALVIWRLAMLSGATFLFERPN
                     AFWIAPRKKSARLQAAE"
     gene            349371..351848
                     /locus_tag="RPD_0302"
     CDS             349371..351848
                     /locus_tag="RPD_0302"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase HrpB"
                     /protein_id="ABE37540.1"
                     /db_xref="InterPro:IPR001410"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR010225"
                     /db_xref="InterPro:IPR011545"
                     /translation="MHLSRSFDTPLPIDDALADLTSALAGNSTAVLVAPPGAGKTTRV
                     PLALLDQPWLGTKKIIMLEPRRIAARASAERMAKTLGERAGETVGYRVRFGSKISRAT
                     RIEVVTEGIFTRQILDDPELAGIGAVLFDEFHERSLDADLGLALARDAQQGLREDLRI
                     LVMSATIDGARVARLLGDAPVVESLGRAFPVETRYLGRRSDAPMERQMAEAIAAALRS
                     DAGSVLAFLPGAAEIRRTETMLRERVHDAAIEIVPLFGALDAAVQDRAIQPAPKGSRK
                     VVLATSIAETSLTIEGVRIVVDCGLSRVPRYEPDIGLTRLETVRASRAAVDQRRGRAG
                     RIEPGVCYRLWDEPQTASLPAYTQPEILSADLTSLLLDLAQWGVTDPATLAFLDPPPG
                     PALKEARELLAELGALDADGRITDEGRALRAMALPPRLARMIVDAARLDHGEEAAEIA
                     AILTERGLGGDSVDLDHRRDQFRRDRSQRAMSARQMAQRWAGQASSPSPQGGEELSTG
                     VLLAFAFPDRVAKNRGNGSFVLANGRGAAIEQTSALARAPYLAVAELTGTAAQGRILL
                     AAPITLAEIEQHFAGQITDADDVSFDRAAMALRARRRRALHAITLSEAPQALTPSAET
                     AQVLADGLIAAGLDRLPWSKQLQQWRGRVMFLRKAEGEPWPDLSDSALAEQREDWLVP
                     ALFDKAGLKDVSAGDLSDALMNLLPWDLRARLDREAPTHFEAPTGSRLPIDYEAEQGP
                     TIAVRLQELFGLTSHPSVAGGAVPLVLELLSPAHRPVQVTRDLPGFWRGSYAAVRADL
                     RGRYPRHPWPEDPAGAPPTRRAKPKGT"
     gene            351980..352492
                     /locus_tag="RPD_0303"
     CDS             351980..352492
                     /locus_tag="RPD_0303"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37541.1"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR011969"
                     /translation="MRNIMIFAALMVVLGSVMAQLADRMMPAPAQASVAKATTVGMSS
                     NAGARSVAIPRDARGHFQTDGRIDGQRIAFMVDTGASVVALNERSAAQFGLRPRPAEY
                     TARVSTANGTVKAARARLAMLDVGGLIVRDVDAMVLPDEALSENLLGLSFLSKLRRFE
                     YANGQMVLEQ"
     gene            complement(352495..353367)
                     /locus_tag="RPD_0304"
     CDS             complement(352495..353367)
                     /locus_tag="RPD_0304"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF6, transmembrane"
                     /protein_id="ABE37542.1"
                     /db_xref="InterPro:IPR000620"
                     /translation="MMTPRAATLIGLSAILMWSLLAVLTVATGTIPPFQLAAMTFAIG
                     ALAAATGWILRPGAIRALRQPPLVWAVGVGGLFGYHALYFLALRLAPPAEAGLLNYLW
                     PLLIVLFSSLLPGERLRPHHIAGALLGLVGTALLFTGNGAALEPAYLPGLAAAFVAAF
                     VWAAYSVLSRRLKAVPTDAVAGFCFVTALLAALVHGVIESTVWPQGAAQWLAIVALGI
                     GPVGAAFYAWDIGMKRGDIRVLGAASYATPLLSTGFLIIAGYAQPTATLALAALLIAG
                     GGLLAARDMLRGGK"
     gene            complement(353514..354239)
                     /locus_tag="RPD_0305"
     CDS             complement(353514..354239)
                     /locus_tag="RPD_0305"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-[acyl-carrier-protein] reductase"
                     /protein_id="ABE37543.1"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR002424"
                     /db_xref="InterPro:IPR011283"
                     /translation="MARVALVTGGTRGIGAAISKALKAAGYAVAASYAGNDSAAEKFK
                     SETGIPVYKWDVSSFEACAAGVKQVEADLGPVDILVNNAGITRDGAFHKMTLEQWNAV
                     INTNLGSLFNMTRQVIEGMRARKFGRIVNISSVNGQKGQFGQVNYSAAKAGDIGFTKA
                     LALENARGGITVNAICPGYINTEMVQAVPKEVLEKAILPLIPCNRLGEADEIARAVVF
                     LAAEDSGFITGSTLSINGGQVMT"
     gene            complement(354417..355595)
                     /locus_tag="RPD_0306"
     CDS             complement(354417..355595)
                     /locus_tag="RPD_0306"
                     /EC_number="2.3.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="ABE37544.1"
                     /db_xref="InterPro:IPR002155"
                     /translation="MSDDVVIVSAARTAVGSFNGAFATTPAHELGAVAIKAALERGGI
                     EPARVSEVIMGQILTAAQGQNPARQASIAAGLPVESPAWGVNQLCGSGLRTVALGYQA
                     LLNGDSEIVVAGGQESMSMAPHAQYLRGGVKMGAVEFVDTMIKDGLWDAFNGYHMGNT
                     AENVARQYQITRQQQDEFAVASQLKAEAAQKAGKFKDEIVPVTIKTRKGDIIVDTDEY
                     PRHGATIEAMAKLKPAFEKDGTVTAGSASGINDGAAVVVLMTAKQAAKEGKTPLARIV
                     SWAHAGVDPKIMGTGPIPASRAALKKAGWTINDLDLIEANEAFAAQACAVNKDLGWDV
                     SKVNVNGGAIAIGHPVGASGARVLVTLLHEMQKRDAKKGLATLCIGGGMGIAMCLARD
                     "
     gene            355878..356486
                     /locus_tag="RPD_0307"
     CDS             355878..356486
                     /locus_tag="RPD_0307"
                     /codon_start=1
                     /transl_table=11
                     /product="Polyhydroxyalkanoate synthesis repressor PhaR"
                     /protein_id="ABE37545.1"
                     /db_xref="InterPro:IPR007897"
                     /db_xref="InterPro:IPR010134"
                     /db_xref="InterPro:IPR012909"
                     /translation="MRVGAMAKSDQPTTIKKYANRRLYNTGTSTYVTLEDLASMVKDG
                     EDFLVYDAKTGDDITRSVLAQIIFEQENKAGQNLLPTTFLRQLIRFYGDSMQMVVPKY
                     LEQSIDSLTRDQEKFRKQLTSTFSLTPFGPLEETVRRNMELFQQTFSMFVPIKPSHGP
                     QTDEVAVEVTSGTDNIDDLRRQMKDMQERLDRMSLDHPKKEE"
     gene            complement(356488..358239)
                     /locus_tag="RPD_0308"
     CDS             complement(356488..358239)
                     /locus_tag="RPD_0308"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase/phosphodiesterase"
                     /protein_id="ABE37546.1"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001633"
                     /translation="MPSADPASDHASAPPRSVGPDPSAILAALGQAAFVWDLATDAII
                     WTGRASDLFQDIPAETLSTGAGYASLLEPSRAIRADALLNGAAAAGENCVPYRIEYGV
                     RAATSAPIIWIEESGFWYPGADGRPASVEGIVRINNERHAREQQLLQLSQHDPLTGEL
                     NRTYLVAALAESIEEAARFRSSLCFMLIGLDHLARINDSFGFDVADELICTIAQRIRA
                     RLRSGDQLGRFSGNKFGLILKNCTVDDAQVAAERFLIAVRDEIVPTRSGPVSVTASIG
                     AVSSPRHARTAEEAINRAQEALSAAKHRRCGAFSMWRPNVERDAQRRVNIRVTDEIVT
                     ALNERRIVLAYEPVVDVATRAPAFHECLVRMMQDDGQVLLAPDIVPVAERLGLIRLVD
                     HRVLELVVAELAASPQMTLSLNISPDTTMDADWWAGIESLMLAHPGVAERLIVEITET
                     VAIQDIDEVRGFVTRLKKFGSKIAIDDFGAGYTSFRNLRNLGVDIVKIDGAFVQNIAR
                     SVDDRAFVQTLIDLARRLGIKTVAEWVQDEESALLLRDWGCDYIQGRLIGLASQQRPS
                     DVPAAAIAAAVRERVAN"
     gene            358341..358739
                     /locus_tag="RPD_0309"
     CDS             358341..358739
                     /locus_tag="RPD_0309"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37547.1"
                     /translation="MRGGARNEALRGGIFLAMIPLRRCERLEMVQVQTMTKIWIDQGD
                     DDIRDFGADHDAEPELIETLPAPVTPVQPRMRYTDRPVRPSSNFIAQLMAIDRGNPHP
                     REAPRAEQNQATAAYRSAKTYAAGRTRRVS"
     gene            complement(358756..359406)
                     /locus_tag="RPD_0310"
     CDS             complement(358756..359406)
                     /locus_tag="RPD_0310"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37548.1"
                     /translation="MSIIGFPLLLIPLAICNIVVFLMPGVGFDAPLTRIPLPSGTIWT
                     ISAGEMLVALGVLMLLFEVIKAARPGAKYLTDHLLSLLVLGGTVAEFVMLPQFGNATV
                     FLLATLMLVDFLAGIALRHQPQPRTAGHARSRSVAKVDLPQQEPAVAAAPAAETPVAP
                     FPTATAASISAASIAEAVLLDRPQPVASPKASASSPRIQSPGLQPADAAAGVQPPR"
     gene            complement(359642..359824)
                     /locus_tag="RPD_0311"
     CDS             complement(359642..359824)
                     /locus_tag="RPD_0311"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L32P"
                     /protein_id="ABE37549.1"
                     /db_xref="InterPro:IPR002677"
                     /translation="MAVPRRKTSPSRRGMRRSADALKRPTYAEDKDSGELRRPHHLDL
                     KTGMYKGRQVIKKKDA"
     gene            complement(360016..360705)
                     /locus_tag="RPD_0312"
     CDS             complement(360016..360705)
                     /locus_tag="RPD_0312"
                     /codon_start=1
                     /transl_table=11
                     /product="Monofunctional biosynthetic peptidoglycan
                     transglycosylase"
                     /protein_id="ABE37550.1"
                     /db_xref="InterPro:IPR001264"
                     /db_xref="InterPro:IPR011812"
                     /translation="MKRAIRAAILTVLVLLAAPYVLTLLYGAGQPVSTLMIWRWLTGA
                     TVTREWVDIERISPALPRTVVASEDAKFCSHRGIDWDSVRDVIDDMQDGEATRGGSTI
                     TQQVAKNLFLWPGRSMVRKALEFPLALWIDLVLSKQRVLELYLNIAEWGPDGQFGAEA
                     GAQYAFGRSAGQLTAQEAALMASILPNPRTRSARKPGRGVRRLAATYVARARSAELQQ
                     CWRENSALSGN"
     gene            360822..361787
                     /locus_tag="RPD_0313"
     CDS             360822..361787
                     /locus_tag="RPD_0313"
                     /EC_number="2.5.1.10"
                     /codon_start=1
                     /transl_table=11
                     /product="farnesyl-diphosphate synthase"
                     /protein_id="ABE37551.1"
                     /db_xref="InterPro:IPR000092"
                     /translation="MNGPAEFYLEHFRMATGTSTIDFAKRLDTTAEDTEALLGRLLSD
                     DLLPDEITRPRRLMEAIRYATLGGGKRLRPFLAVESAAVFGVERASALLVGAALECIH
                     CYSLIHDDLPAMDNSDLRRGRPTLHKAYDDATAILAGDALLTFAFDIITRDEVHRDPQ
                     VRLDLNRVLARCAGLGGMVGGQILDLAGEGRFGDREPVDVARLQQMKTGALLRYGCVA
                     GAILGEAPPEHYRALDDYGRALGEAFQIADDLLDVEGDAAALGKPAGADAALGKTTFV
                     TQLGIDGAKQRVRDLLVRADEALAPFGAKGDVLRAAARFVAERKS"
     gene            361795..362481
                     /locus_tag="RPD_0314"
     CDS             361795..362481
                     /locus_tag="RPD_0314"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF1345"
                     /protein_id="ABE37552.1"
                     /db_xref="InterPro:IPR009781"
                     /translation="MSREAPDDPRLLRFRKLPRAVRVVVSRPRLFISVAVGVIAALLL
                     PASLRPVTRALIGWDVSIVVYLALAFSMMARCDIDYIRRNAVLQDDGRFLILMVTATG
                     AFASIAAIVAELGSGHRGAAELALATVTIALSWAAVHTTFALHYAHEYYRGAQVGGLQ
                     FPSGDTHEDADYWDFVYFSFVIGMTAQVSDVGITDKTIRRTATAHGVVSFVFNTALVA
                     LMVNIAAGAI"
     gene            362564..364216
                     /locus_tag="RPD_0315"
     CDS             362564..364216
                     /locus_tag="RPD_0315"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ antiporter"
                     /protein_id="ABE37553.1"
                     /db_xref="InterPro:IPR004705"
                     /db_xref="InterPro:IPR006153"
                     /translation="MQVVAGPFHQRHCGFVEAKFLIFLILLAVLAGTALLARRFHVAP
                     AILLLLAGIVLAFIPGMPAIQLPPDLILLLVLPPLIYSASVAMSWREFRSNLRPIGLL
                     AIGCVIFTACAVAVATHYLLGLSWSVGFLLGAIVAPPDVVAPLAIARKLGLPRRIIVV
                     LEGEGLANDATALILYRFALAAIMTGVFSLPKASGTFAAIMVGELAFGVAVGWLSLRA
                     RHYARDPQIEITLSLLTPYIAYWIPEHLGGSGVIATVACGLYISWNGPLLIPAATRLQ
                     GIFFWDLVIYLIEGLLFLLTGFQMRAILERSKAFPLDDIVAATLLVAAIVIVARFLWV
                     FPASYLPRILSKRLRISDPSPPWRAVFVVAFTGVRGAVSLATALALPFTLPDGSGFPD
                     RDLILFVAFGVILITVVGLGSTLPAVVMALGVARDGQSEHIAEHENEIAARREALSAA
                     LASLDAMTNDRELSDEVVTLLRARHDIRANQLPASLDDEAYAVTADERALVRELIAAE
                     RRFIHAQLRDGKITDEARRRIERDLDLEEASLANREFRKGAQ"
     gene            complement(364246..365580)
                     /locus_tag="RPD_0316"
     CDS             complement(364246..365580)
                     /locus_tag="RPD_0316"
                     /codon_start=1
                     /transl_table=11
                     /product="Ferric reductase-like transmembrane
                     component-like"
                     /protein_id="ABE37554.1"
                     /db_xref="InterPro:IPR000951"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013130"
                     /translation="MQFMRLTATFALVVLGLAALWALSLAPGALSQGFWATRTTLVYG
                     TGVMALGLMSVGIILAARPVWFETPLGGLDKFYRLHKWLGLSALGFALAHWVLRKGPS
                     WITELGLFAIPPKPPHAKDVPTGFDVFRDLRDFAAEIGEWALYLLVALVALALWKRFP
                     YKYFFKTHRLMPMVYLVLVFHAFILIDRSYWTQPLGPVLALLLAAGTLAALIALFRKI
                     GSGRQASGKIATLRLYEGNQVLDVGVRLETAWRGHEAGQFAFVNFDDIEDAHPFTISS
                     TWQNDGMLLFTIKGLGDYTRSLAGSLRLGQGVVVEGPYGRFDFHGDAGRQIWIGGGVG
                     VTPFIARLRDLARVGRSEPVDLFYATNVPDTAFIAPIRQLALQTGISFHLVDGSQDGR
                     LTLESLAATVPDWKQADIWFCGPSGFGDAMRGAMIAQGLPKARFHQELFEMR"
     gene            complement(365780..367105)
                     /locus_tag="RPD_0317"
     CDS             complement(365780..367105)
                     /locus_tag="RPD_0317"
                     /EC_number="1.17.7.1"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase"
                     /protein_id="ABE37555.1"
                     /db_xref="InterPro:IPR004588"
                     /translation="MSQKPDIPDAMNKLENPLQNDVAGPAPRRQTTQVMVGDVAVGGG
                     APIVVQSMTNTDTADVEGTIKQVAALARAGSEMVRITVDREEAAAAVPHIRDGLRKLG
                     LTTPLIGDFHYIGHKLLADYPACAEALDKYRINPGNVGFKNKRDSQFTDIVEIAIKNN
                     KAVRIGANWGSLDQELLTKLMDENAASAQPRDVRAVTREAMVQSALLSAARAEEIGLP
                     KTKMILSAKVSAVQDLIAVYQDLASRSDYAIHLGLTEAGMGSKGIVASSAALGILLQQ
                     GIGDTIRISLTPEPGGDRTLEVQVAQELLQTMGFRTFVPLVAACPGCGRTTSTTFQEL
                     ARSIQDFIRLEMPSWKTRYPGVENLNVAVMGCIVNGPGESKHANIGISLPGTGESPAA
                     PVFVDGQKFRTLRGPSIATDFKALVIDYIEQRYGAGTKPGAPQMVPAAE"
     gene            complement(367135..368049)
                     /locus_tag="RPD_0318"
     CDS             complement(367135..368049)
                     /locus_tag="RPD_0318"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF6, transmembrane"
                     /protein_id="ABE37556.1"
                     /db_xref="InterPro:IPR000620"
                     /translation="MSSISSAVARPLSAGAIALMLLCCFSWGFNQIAVKLVLPEIPPF
                     LQAAMRSIAGLIVILIIAWARGVKLFQRDGTLKAGLLAGVLFGIEFVLIYRGLLLTTA
                     SRGVVFLYTAPFIVALGSYHFLGERLRTLQWAGLALSFAGVALAIGVPQPDVDATVLI
                     GDLMLVGGGAMWGATTLIVKASRLQQAPAEKGLAYQVAISIPILLLAALISGETIDKM
                     PGPLSLTLMAYQSIWVVGLTFLLWFGLVKTYSASKLSAFTFITPLFGVAAGYLIMHDP
                     LNPAFGVAALLVIAGLYLVNRPAKAVPA"
     gene            complement(368182..368670)
                     /locus_tag="RPD_0319"
     CDS             complement(368182..368670)
                     /locus_tag="RPD_0319"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc uptake regulator ZUR"
                     /protein_id="ABE37557.1"
                     /db_xref="InterPro:IPR002481"
                     /translation="MTALKPAFPAPNHDHERCAADGIEHAERICADRSQNLTPIRKQV
                     LRALLSSHRPLGAYEVIDELARDMPRPAPITVYRALDFLMQNGLVHRIESRNAFLACG
                     RDHDDASAVAFLICECCGSVGEIPAAAVAQSLSDAARGSGFTPKLSVVEITGVCGHCQ
                     SD"
     gene            complement(368865..370073)
                     /locus_tag="RPD_0320"
     CDS             complement(368865..370073)
                     /locus_tag="RPD_0320"
                     /EC_number="2.3.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-ketoadipyl CoA thiolase"
                     /protein_id="ABE37558.1"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR012793"
                     /translation="MADVFVCDAVRTPIGRFGGSLARVRADDLAAVPIKALIARHPNL
                     DWSAVDEVFFGCANQAGEDNRNVARMAALLAGLPDSVPGQTLNRLCASGLDAVGAAGR
                     AIRSGEIDLAIAGGVESMTRAPFVQGKATEAFSRQAEIFDTTIGWRFINPLMKAQYGV
                     DAMPETGENVAEEFQISRADQDAFAIRSQQRAGAAIAAGYFAEEIAPVSAPGGKAGPI
                     IVDKDEHPRPETTLEGLAKLKPIVRNPGTVTAGNASGVNDGAAAIIVASEAAVKKHGL
                     TPRARILGLASAAVPPRIMGIGPVPATRKLMDRLGLKISDFDLIELNEAFASQGIACL
                     RQLGVADDADFVNPHGGAIALGHPLGMSGARLALTAVHGMEKRGGRLALATMCVGVGQ
                     GVAMAIEKLN"
     gene            370238..373009
                     /locus_tag="RPD_0321"
     CDS             370238..373009
                     /locus_tag="RPD_0321"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="ABE37559.1"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="InterPro:IPR005748"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /translation="MHRVMTIRPDIPPQPDIAAPAEPPARVSPMMEQYHEIKAANPGL
                     LLFYRMGDFYELFFEDAEIASRALGITLTKRGKHLGADIPMCGVPVERSDDYLHRLIA
                     LGHRVAVCEQTEDPAAARARKSVVRRDVVRLITPGTLTEDTLLDARANNYLMAIARTR
                     GSAGVDRIGLAWIDISTGEFCVTECATGELSATLARINPNEAIVSDALYSDAELGPSL
                     RELAAVTPLTRDVFDSATAERRLCDYFAVATMDGLAALSRLEAAAAAACVTYVDRTQL
                     GKRPPLSPPAREAAGATMAIDPATRANLELTRTLGGERRGSLLDAIDCTVTAAGSRLL
                     AQRLAAPLTDEAAIARRLDAVAAFVADSALREQIRSALRAAPDMARALARLSLGRGGP
                     RDLASLRDGVSAADKVLAQLSQLAQPPHDIAAAMAALRRPSRDLCQELARALADDLPL
                     LKRDGGFVRDGYEAALDETRKLRDASRLVVAAMQARYADETGVKGLKIRHNNVLGYFV
                     EVTAQHGDRLMAPPLNATFIHRQTLAGQVRFTTAELGEIEAKIANAGDRALGLELDIF
                     DRLAAMIDTAGDDLRAAAHAFALLDVATALAKLAVSDNYVRPEVDGSLAFAIEGGRHP
                     VVEQALKRAGEPFIANACDLSPVPPPFPPPLAGEGRVGAGQIWLLTGPNMAGKSTFLR
                     QNALIALLAQTGSFVPASRARIGIVDRLFSRVGAADDLARGRSTFMVEMVETATILNQ
                     ATERALVILDEIGRGTATFDGLSIAWAAIEHLHEQNRCRALFATHYHELTALSAKLPR
                     LFNATVRVKEWRGEVVFLHEVLPGSADRSYGIQVAKLAGLPPSVVARAKSVLAKLEAN
                     DRGQSARTLADDLPLFAMTARAPVEPPPPSEAEQLIEAVRALHPDELSPREALDALYA
                     LKAKLPKAD"
     gene            complement(373035..374597)
                     /locus_tag="RPD_0322"
     CDS             complement(373035..374597)
                     /locus_tag="RPD_0322"
                     /EC_number="3.1.2.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Acetyl-CoA hydrolase"
                     /protein_id="ABE37560.1"
                     /db_xref="InterPro:IPR003702"
                     /translation="MVASASRVLDPHLRSRIMTAADAAALIPSGANVGMSGFTGSGYP
                     KLLPLALAERINAHHARGQKFKVSVWTGASTAPELDGALAKVDGIEMRLPYQSDPTCR
                     KRINAGRMEYIDIHLSHVAQHVWFGFLGKLDVAIVEVAGIREDGSLIPSSSIGNNKTW
                     LDLADKVILEVNAWQDIRLEGMHDVYYGTQLPPHRKPIPIVASGDRIGEQYLRCDPSK
                     IVAIVETNLPDRNSAFSAPDEASQAIAEHILEFLGHEVKKGRLPPNLLPLQSGVGNVA
                     NAVMAGLEDGPFDNMTAYTEVLQDGMLSLLRKGKLAHASATALSLSPDGYDEFLRNLD
                     FYRERILLRPQEISNHPEVIRRLGVIAMNGLIEADIYGNVNSTHITGTSIMNGIGGSG
                     DFARNSYLSFFMTPSAAKGGKISCIVPMASHVDHTEHDVQVIVTEQGLADLRGLSPKQ
                     RAKVIIQNCAHPTFKPALKEYYKRALEYSPGLHTPHILDEALTFLPNWMANKAAREAW
                     REDAVVQADVWR"
     gene            complement(375533..376999)
                     /locus_tag="RPD_0323"
     CDS             complement(375533..376999)
                     /locus_tag="RPD_0323"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Omp2b porin"
                     /protein_id="ABE37561.1"
                     /translation="MNSIKRLALGSAAALFAIGSAQAADLPLKAKAVEYVKICSIYGA
                     GFYYIPGTDTCIKLGGYVRADVTFNGSNAYDAPAWNGASGAKNRNANSYIFRSRQDIN
                     VDTRTATEYGVVRTYFDAVFSWTTGGANSGIAGGELGVYYAFVQFAGFTFGKAVSQFD
                     TPWTGYPGNNTSYLIGGYDNVTGINQVAYTSEFGNGVSASVSLEDQSAYLQSNLYNTN
                     VGGTVLGYGANSYAGTSVPDIVGKIRVDQAWGLFQVSAAAHQVRASYYTPALETSGHP
                     GDTWGYAVQGALSLKNLPTGPGDSINITATYSNGATRYVIGGVTTPASFLIYDNGSIP
                     GTYQSVAFAHAADGVFAGANNVFGTGIEKTNAWGVRGAFNHNWSPYWSSSLFGSYTSI
                     DYNGNASALICAGLGAPVAGFNCNPDFRIAQVGTVTRWTPVKNLTFSGEVLYTYLDQS
                     HTGVVNVSAIPALGKPTANYELKDQGVWTGSLRVQRTF"
     gene            377484..377993
                     /locus_tag="RPD_0324"
     CDS             377484..377993
                     /locus_tag="RPD_0324"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, MarR family"
                     /protein_id="ABE37562.1"
                     /db_xref="InterPro:IPR000835"
                     /translation="MPRKAKLGLAVQSIAVDPSTVGEFVTAIGSIAVYLDEIRQFRAK
                     SLGISGPQFAMLTTIRGLDEGDGISVRHVAKAIHVDSSFITTQSKILEKKGLLRRQTD
                     ETDARVVNLSLTDKAYKQIAGLAADEQSLNEFIFADLSRDAFEGVTAQLTGLKARLEK
                     ACLKIAGGF"
     gene            complement(378222..379013)
                     /locus_tag="RPD_0325"
     CDS             complement(378222..379013)
                     /locus_tag="RPD_0325"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37563.1"
                     /translation="MLGGLPDWHRLDPSAEPEAIRRCLESFDPPVEAVAIPWREDLFL
                     DSYYLPFERSGTDRAPIAVCIGEMRSKEELLIVMARPARERRLALLCVDSGSDDVEAP
                     RRSVRPESCVTAVIDYLVELPGIDPNRIALIADGSPSSLIAKGVVMDGRVAAAVCDGG
                     LWELWEHAQTASLPGYLGAIAPTPIVAAIRCPTLIPLLPGSGIDPVYAKDLLSSHQAR
                     DRRIAIADLAPQQSEMAPADSRIWAETTLNWVSRQLDGIQKIAER"
     gene            complement(379446..379530)
                     /locus_tag="RPD_R0007"
                     /note="tRNA-Leu5"
     tRNA            complement(379446..379530)
                     /locus_tag="RPD_R0007"
                     /product="tRNA-Leu"
     gene            379721..380266
                     /locus_tag="RPD_0326"
     CDS             379721..380266
                     /locus_tag="RPD_0326"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37564.1"
                     /translation="MTANLLHHTGLGFRPARAARIARNVALTYAVIAAAALGAAWFFQ
                     LALDLTPCPLCLEQRYAYYAAIPLAGLIALGAWREAPISLLIAGLAVLAVLALGNAGL
                     GAYHAGVEWKFWTGPTDCAGPVLDFGKAGSLLDQLDKVKVMRCDEVQWRFLGLSLAGY
                     NVLVSLALAALAAWGIARIRR"
     gene            380435..381637
                     /locus_tag="RPD_0327"
     CDS             380435..381637
                     /locus_tag="RPD_0327"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="ABE37565.1"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR011495"
                     /translation="MPSEHRPAPATAPEASLNRLEELPYRRRQQALLREFGTAALQTR
                     DFRQILQQAVDLSARGLGCSFAKVLEYVAVEKRLIVRAGIGWPAGTVDHVSLGADIES
                     PAGFAFQTGQSVVSNHLQDETRFRTPKLLADHGIKRAINVLIRRGGEGDTAFGVLEAD
                     SPDPGQFDDADADFLAGFAGLLGIAIERQHADAKLQEALDHEALLTREMSHRVKNSLT
                     SVVGLLRVQARGSESADVKNALEDAAMRVASIAGVHDHLWRGSKVGFVDLSDFVSHLC
                     ETLQGSAPEHVIQCRSDDIILSADKAIPLGLLVNELVTNAIKYAYVDGHGVIRLDARE
                     INGHLLVEISDEGAGLPDGFDINQPRKSLGFRVILGLVRQLLGELTISKNLPRGALFT
                     IKFPVDPP"
     gene            381649..382092
                     /locus_tag="RPD_0328"
     CDS             381649..382092
                     /locus_tag="RPD_0328"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver"
                     /protein_id="ABE37566.1"
                     /db_xref="InterPro:IPR001789"
                     /translation="MREKQASHGGRETNAILVSPFYMPSILSPIRILVVENETFIRLD
                     VVEVLRVAGFNVAEAVNADEGIKMLEADPDIRLMFTDIEMPGAMNGLELAATVRERWP
                     PIKIIAASGRFKLQASDLPAGALFFLKPYETSQIIDAVRGLTAVA"
     gene            382089..382913
                     /locus_tag="RPD_0329"
     CDS             382089..382913
                     /locus_tag="RPD_0329"
                     /codon_start=1
                     /transl_table=11
                     /product="PRC-barrel"
                     /protein_id="ABE37567.1"
                     /db_xref="InterPro:IPR007903"
                     /translation="MSAGPNSSNAVSSQRLHIPIASVGPHTGKSQMTPVKILLMAAVI
                     STVGMTHALAECEIADAKLEEAIQENPRFRGPANSQSVRDLRSLRDAAFTLRSYGRHE
                     DCERLLANIRELIAGPPMGSLGDNDEEQADIQNSAREPKVRRGAAAGNRGKKDAKPLI
                     RIDQLTPGLRTDEMIGAEVRSSDDKIVGEVRNIVFGTKDGRDYAIIASGGFFTTGKDS
                     IVVPIRSLQVTQDRSSFFLPIAKDVMRTVPVMPDQDYNWLSDQAWRTQNDALFEQP"
     gene            complement(383067..384146)
                     /locus_tag="RPD_0330"
     CDS             complement(383067..384146)
                     /locus_tag="RPD_0330"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ammonia monooxygenase"
                     /protein_id="ABE37568.1"
                     /db_xref="InterPro:IPR007820"
                     /translation="MSQNSALTAPSLRSRTLNVLETIAIGAAGGGLSYWVQLPGGLIT
                     GAMVAVAAAGLAGRNMGLPPPLSHIVLMALGVSLGSMVSPAMIHNLSSYPVTIGLLAI
                     ATFFATFGSAIYLQRIHGWDRTSALLAGSPGALSQIIMLATERKANVPGIAVVQIMRV
                     IILTSAVPMLLAMTGMMAHGPLPVRGPEATPLVLAAVVAVAVAAALLLRLINFPASWM
                     FGAMLGSSVLHGSGLVEGTLPEWAYLSALVGIGTLIGSRFGAIKLRTILSYLGAALGS
                     FAVAIAISGVFVVTIILTTPVRLSDVVVAFSPGAMDAMMALALTLNIDPVFVGAHHLS
                     RFIYVSIVTPGIVHWFGRSPDDLDD"
     gene            384313..384822
                     /locus_tag="RPD_0331"
     CDS             384313..384822
                     /locus_tag="RPD_0331"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37569.1"
                     /translation="MRAPQIVTIASALMGTALLTLASAAPGHALTAQECSAKYQAAKT
                     AGTLNGQGWNDFRKAQCASDSAAEADSKAVEAKDKPEAKSAAKSEAKSEAKPKAKPAE
                     PAAASAGPPTFPTAVDAKFAKEPAARARLHTCAEQWKANKAANTTGGLKWIQKGGGYW
                     SECNKRLKA"
     gene            384922..385305
                     /locus_tag="RPD_0332"
     CDS             384922..385305
                     /locus_tag="RPD_0332"
                     /codon_start=1
                     /transl_table=11
                     /product="LrgA"
                     /protein_id="ABE37570.1"
                     /db_xref="InterPro:IPR005538"
                     /translation="MIASLGLILLCQLTAEAAVRALAVPLPGPVIGLLLLLGLLLARD
                     RLGWLARGPLRNDGVENASKGMLAHLSLLFVPAGVGAIQQLDLIATHGVVIVLVLAGS
                     VLITLLVTVATFLVTARLLSMWSSR"
     gene            385302..386024
                     /locus_tag="RPD_0333"
     CDS             385302..386024
                     /locus_tag="RPD_0333"
                     /codon_start=1
                     /transl_table=11
                     /product="LrgB-like protein"
                     /protein_id="ABE37571.1"
                     /db_xref="InterPro:IPR007300"
                     /translation="MSATPFSLWVYLSQTPLLWLTVTLLVYAATDAVSQATERSPLAN
                     PVLHAIWIIGAFLWLTGTSYTTYFSGAQFVHFLLGPATVALAVPLYENRRQVIAAIVP
                     MALALVVGCIVAIVSVMVLAQLAGLPETVVLSLASKSVTAGVAMGISESLNADPSLTA
                     VAVVLTGVMGAIMVTPLMNALGIRDFRARGFSVGLASHGIGTARAFQVDAIAGVFAGI
                     AMSLNALITAMLVPVAVTLLVK"
     gene            386266..386733
                     /locus_tag="RPD_0334"
     CDS             386266..386733
                     /locus_tag="RPD_0334"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37572.1"
                     /translation="MTDASALPTSAAATHRVHGSAPRRAIALLAAVSAIAIALLVSSP
                     EASTLAVASSDAELVMLLRFMAAVKALLALVALGVSVWRLGFPASPVLKVAYTLAPAL
                     MCAAPVVIWQMADVAFGAGLFHAGFVLLLLALYADRGQAVELAKSAALKLRRA"
     gene            complement(386777..387850)
                     /locus_tag="RPD_0335"
     CDS             complement(386777..387850)
                     /locus_tag="RPD_0335"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase/Carboxylesterase"
                     /protein_id="ABE37573.1"
                     /db_xref="InterPro:IPR000379"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR003140"
                     /translation="MSDAVVDDIVALLPPLLQSIEALGFIARYLHPPEFGEVMRLAGA
                     PDAQLRSELPRVAKWPDQFAHLREPLRMAGDHALAAFDGLRTVDSGAGDLGAVFRALR
                     HLPQALEALYPLAATLPPVSGLYLDPALQQDEALHARLAQPKHPDSGVFHYANEPGSR
                     GGFSFYVPEYYTPDRAWPLVVALHGGSGNGRLFLWNWLRDARSRGAIVVAPTATGRTW
                     ALMGDDADTPNLARIVDFIRSRWSIDPERLLVTGLSDGGTFCYVTGLDDASPFTHLAP
                     IAASFHPLLAGMASVDRLRGLPIQIVHGRHDWMFPVELARQAQQALFKAGADVSYREI
                     ADLSHTYPRELNAALLDWLNGAG"
     gene            complement(388007..389698)
                     /locus_tag="RPD_0336"
     CDS             complement(388007..389698)
                     /locus_tag="RPD_0336"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis sensory transducer"
                     /protein_id="ABE37574.1"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /translation="MFATLSIRAKITTLVAALLIAMTCLGGLGILKVRSMNFAALDLA
                     TNWLPTIKMLGNLRYNVLNYRTAIRDHLITTTAEGMATVEKRLEAIEGTIQKDLQTYE
                     KMITTPEERQLYDAWLSEWAKYKPLAAKMIDASRKSVGQSSEEATDLLYKVAGPVASR
                     MDEILQKDIDLNDRGADGSTALAASTYSSAIYLIVTILGVAIVVGIVASVMVIRDVAQ
                     GIASIVKPMQSLGQGDLSADVPHRGEKTEIGSMADALQIFKDALISKKAADEDAAREA
                     EAKIARGQRVDSATRQFETSIGEIVETVSSASTELEASAATLTATAGHAQELTTAVAA
                     ASEEASTNVQSVASATEEMSSSITEISRQVQESARIASEAVDQARKTNDSVGMLSAAA
                     ARIGDVVELINTIAGQTNLLALNATIEAARAGEAGRGFAVVASEVKALAEQTAKATGE
                     IGQQITGIQSATVQSVSAIKEIGQTIDRMSEIASTIASAVEEQGAATQEISRNVQQAA
                     QGTQQVSANITDVQRGATETGSASTQVLSAAKSLSQDSNRLKQEVARFLETVRAA"
     gene            complement(390010..391701)
                     /locus_tag="RPD_0337"
     CDS             complement(390010..391701)
                     /locus_tag="RPD_0337"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="ABE37575.1"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /translation="MFAKLSIRAKVTALVAALLIAMTGLGGLGILKVRSMNFAALDLA
                     TNWLPSIKVLGELRFNVLNYRTMIRNHMLDVTPEGKARFEQRLASIDATIKKDQETYA
                     AMIASPEERQLYDSWVVQWNDYKSVTTKMLEMSRKDIGKVSAESTDFLFKNLNPIGVR
                     MDEILQKDIDMNDKGADGATALAASTYSSAIYLVLTILGVAMVVGIVASVMVIRDVAQ
                     GIASIVKPMQSLGQGDLSADVPHRGEKTEVGSMADALQIFKDALIAKKAADEDAAREA
                     EAKIARGQRIDAATRQFETSIGEIVETVSSASTELEASAGTLTATAGHAQELTTAVAA
                     ASEEASTNVQSVASATEEMSSSITEISRQVQESARIATEAVDQARKTNDSVGMLSAAA
                     ARIGDVVELINTIAGQTNLLALNATIEAARAGEAGRGFAVVASEVKALAEQTAKATGE
                     IGQQITGIQAATDQSVSAIKEIGQTIGRMSEIASTIASAVEEQGAATQEISRNVQQAA
                     QGTQQVSANITDVQRGATETGSASTQVLSAAKSLSQDSNRLKEEVARFLETVRAA"
     gene            392283..393380
                     /locus_tag="RPD_0338"
     CDS             392283..393380
                     /locus_tag="RPD_0338"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function UPF0118"
                     /protein_id="ABE37576.1"
                     /db_xref="InterPro:IPR002549"
                     /translation="MRASENRFFILLLLVASIGFGWILLPLYSAVLWGVVIAILFAPL
                     YRQLNRAFGFRRNLAALTTVAIIVTMVILPISLIGAALAQEARAMFLRIESGNLDMLQ
                     YLKQVLAEPPAWISGVLERFSIGNLSDLQERLSAVLMRGSQYLAGQAIGIGQGTVEIV
                     INLGVMVYLLFFLLRDGDLLAARIRRAVPLSVEQESQLLRKFTVVIRATVKGNMLIAL
                     IQGALGGVMFYILGVNGALLWGVVMAFLSLLPAVGAGLVWLPVALYLLGTGSIWQGVA
                     LIAFGTMVIGTVDNVLRPVLVGKDTRMPDYVVLISTLGGIQVFGLNGFVIGPVIAAIF
                     IAAWDIYSASREAAAGIGETTTGGVPTSDAP"
     gene            complement(393530..394186)
                     /locus_tag="RPD_0339"
     CDS             complement(393530..394186)
                     /locus_tag="RPD_0339"
                     /codon_start=1
                     /transl_table=11
                     /product="Anti-sigma factor ChrR, putative"
                     /protein_id="ABE37577.1"
                     /db_xref="InterPro:IPR012807"
                     /db_xref="InterPro:IPR013096"
                     /translation="MTVRHHIGDDLLLSYAAGTLDEASSLLVATHLALCPHCRARAAA
                     ADDLGGALFEDLPVAELSPGLRDAVLARLRSESVAAPATRPHRPRSDIVIPEPLRSYL
                     GGDLDTLRWTSVAPRVQQIAIDIANCGPRARMLRFQPGTHVPAHGHAGRELTLVLSGS
                     LCDRDAVLARGDVAETDEHTEHQPYAGPDKDCICLAVTDAPLRFKGMFARMLQPWFGI
                     "
     gene            complement(394183..394770)
                     /locus_tag="RPD_0340"
     CDS             complement(394183..394770)
                     /locus_tag="RPD_0340"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 region 2"
                     /protein_id="ABE37578.1"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR007630"
                     /db_xref="InterPro:IPR013249"
                     /translation="MDHPRRDPRESAHDLSDCIVRIATDQDEAAFDTLFRHFAPRLKS
                     YFTRRGGDPAMAEEITQETMVLLWKNAAQFDPSKASPATWIFTIARNLGIDRLRRAKR
                     PSFDPNDPAFIPDAEEPPDRQFERAEAERRVRDVMDTLSANEKSVLMLSFYENQSHGE
                     IAERLGLPVGTVKSRIRLAFGKLRAALDAQTGAAQ"
     gene            395002..395274
                     /locus_tag="RPD_0341"
     CDS             395002..395274
                     /locus_tag="RPD_0341"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37579.1"
                     /translation="MPERDLDHPAPKKSRRRRSTAPRRRSRTDSRGCDVVVVIQRATC
                     FVNRSLTTKQEDTMSVLRKLNGMEAAVIGGALLMTLAPLVPYALLG"
     gene            complement(395596..396153)
                     /locus_tag="RPD_0342"
     CDS             complement(395596..396153)
                     /locus_tag="RPD_0342"
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="ABE37580.1"
                     /db_xref="InterPro:IPR002711"
                     /db_xref="InterPro:IPR003615"
                     /translation="MNAHVSQGGWPVLVLNADFRPLSYYPLSLWSWQDAVKAVFLDRV
                     NIVEHYDRAVHSPTMEFRLPSVVSLKSFVKPSTHPAFTRFNVFLRDRFACQYCGAPED
                     LTFDHIIPRSKGGQTTWENVVAACSPCNLRKGNLTPIQAKMFPRQTPFAPTVHHLHRN
                     GRMFPPNYLHESWLDYLYWDTELDP"
     gene            396439..397437
                     /locus_tag="RPD_0343"
     CDS             396439..397437
                     /locus_tag="RPD_0343"
                     /EC_number="2.5.1.47"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase"
                     /protein_id="ABE37581.1"
                     /db_xref="InterPro:IPR001216"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005856"
                     /db_xref="InterPro:IPR005859"
                     /translation="MSSAATASIKSSAAAPAQQPGRGRVYDSIADAYGDTPLVRLNRL
                     PEQNGVKATILAKLEYFNPASSVKDRIGAAMIAAMEREGIIKPDTILIEPTSGNTGIA
                     LAFVAAAKGYRLKLVMPESMSIERRKMLAFLGAELVLTEAAKGMKGAIAKAEELIAST
                     PNAVMPQQFKNLANPEVHRRTTAEEIWNDTHGGIDIFVAGVGTGGTITGVGQVLKPRK
                     PSLKIVAVEPEESPVLSGGAPGPHKIQGIGAGFVPDILDRAVIDEVIKIAGPTAIATS
                     RALARHEGIAGGISSGAAIAAAIELGKRPENAGKTIVAIVPSFSERYLSTALFEGV"
     gene            complement(397736..399184)
                     /locus_tag="RPD_0344"
     CDS             complement(397736..399184)
                     /locus_tag="RPD_0344"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycogen/starch synthases, ADP-glucose type"
                     /protein_id="ABE37582.1"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR011835"
                     /translation="MTTLTALSVASEIFPLIKTGGLADVTGALPAAVKAHGVAMRTLV
                     PGYPAVLGGIEDPQQVHSFTEFFGGSARLLAARCDELELLVLDAPHLYVRPGNPYVGP
                     DAKDWPDNALRFAALAQAGAWIGQGLLPGYAPDILHAHDWQTGLLPAYLRYSGRPAPK
                     CVFTIHNLAYQGQFPSELLARIGLPERAFSLDGVEYYGGIGYLKAGLQLADRITTVSP
                     SYALEIQGSEAGMGLEGLLRLRAGQLSGILNGVDTKVWDPSADQLIPATYDVETIGAR
                     ARNKQALQARFGLRAESGALLFGVISRLSWQKGLDMLLEVLPGMLADGAQLALLGAGD
                     APLEAGFRDAALKYPGQVGAVIGYDEALAHQIQAGADALLVPSRFEPCGLTQLCALRY
                     GAVPVVARVGGLADTVVDANEMAIATGVATGVQFSPVTADMLTAALTKTRALYADHAT
                     WRNLQINGMTTDVSWKNPAQHYAKLYRELVDA"
     gene            complement(399181..400455)
                     /locus_tag="RPD_0345"
     CDS             complement(399181..400455)
                     /locus_tag="RPD_0345"
                     /EC_number="2.7.7.27"
                     /codon_start=1
                     /transl_table=11
                     /product="Glucose-1-phosphate adenylyltransferase"
                     /protein_id="ABE37583.1"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR005836"
                     /db_xref="InterPro:IPR011831"
                     /translation="MRGFMSQGVPAPLARHAMAYVLAGGRGSRLMELTDRRAKPAVYF
                     GGKSRIIDFALSNALNSGIRRIAVATQYKAHSLIRHLQRGWNFFRPERNESFDILPAS
                     QRVSDDMWYRGTADAVYQNIDIIESYDPKFIVLLAGDHVYKMDYEKMLQQHVEQGADV
                     TVGCLEVARSEASAFGVMDVDAKDVIRSFLEKPADPPAMPGKPDKSLVSMGIYVFDTK
                     FLIEELHRDAANPDSSHDFGKDIIPYIVKHGKAVAHHFDKSCRRSHAEDTSYWRDVGT
                     VDAYWAANIDLTDIVPQLDLYDREWPIWTYGEITPPAKFVHDKDGRRGEAVSSLVSGG
                     CIISGASLRHTLLFTGVRAHSYTHIEGAVILPYADIGRSCRLTNVVVDAEVRIPDGLV
                     VGEDPELDAKRFRRSENGTCLITQPMIDRLGT"
     gene            complement(400757..403072)
                     /locus_tag="RPD_0346"
     CDS             complement(400757..403072)
                     /locus_tag="RPD_0346"
                     /codon_start=1
                     /transl_table=11
                     /product="Oxidoreductase alpha (molybdopterin) subunit"
                     /protein_id="ABE37584.1"
                     /db_xref="InterPro:IPR006657"
                     /db_xref="InterPro:IPR010046"
                     /translation="MAQDDTRLHEADLPDATQQTVEYDGPAGGWGSLQGIAQIFGREW
                     NTPTVIETLMRQNKPKGFMCVSCSWAKPADHHAFEFCENGAKATLWELTSKRCTPEFF
                     AAHSVAELRGWADYDLEMQGRLTSPMRYDAATDHYVPCSWDEAFQGIGEHLRALDPKS
                     VIFYASGRASLETSYLYALFARLYGHNNLPDSSNMCHETTSVALKKLIGVGVGTVVFD
                     DLAKCDAMFVFGQNTGSNSPRFLHPLQEAAQRGVKIITFNPVRERGLESFVNPQSPTQ
                     MLTGKETAISSQYHQVKVGGDIAVLLGICKHVFAADDAAKASGGTRVLDVNFIAAHTH
                     GLDAFEAKVRATSWEQIETESGLTRTAIEGAAQVYVEAERVIGVFGMGLTQHVHGFDN
                     IAMLLNLLLLRGNIGRPGAGISPVRGHSNVQGQRTVGISEKPELVPLDKMAQQFGFAP
                     PRDKGMNTVEACHGLLEGKVKAFIGLGGNFIRAIPDQGVLEEAWTRMQLTVQIATKLN
                     RSHLVNGESAYLLPCLGRTEQDVQASGPQAVTIEDTFSCIQGSIGLRQPASEQLLSEL
                     AIVAGIAKATLPSNPKVKWDEWVGDYGLVRDLIEDSYPDMFHDFNARMFTPGGFYKGN
                     EARERIWKTETGKAEFTTPEILSSIGFDDAPGRYRLLTMRSNDQFNTTIYGMSDRLRG
                     IEGRRDVLLINPDDIARAGLTDGQMVWLESDAADGLQREVGPLKVTPFKLPDGCLGGY
                     YPEMNPLIALTHHDKQSKTPANKSVPVRIRA"
     gene            complement(403348..403467)
                     /locus_tag="RPD_R0008"
     rRNA            complement(403348..403467)
                     /locus_tag="RPD_R0008"
                     /product="5S ribosomal RNA"
     gene            complement(403572..406403)
                     /locus_tag="RPD_R0009"
     rRNA            complement(403572..406403)
                     /locus_tag="RPD_R0009"
                     /product="23S ribosomal RNA"
     gene            complement(406806..406881)
                     /locus_tag="RPD_R0010"
                     /note="tRNA-Ala3"
     tRNA            complement(406806..406881)
                     /locus_tag="RPD_R0010"
                     /product="tRNA-Ala"
     gene            complement(406915..406991)
                     /locus_tag="RPD_R0011"
                     /note="tRNA-Ile2"
     tRNA            complement(406915..406991)
                     /locus_tag="RPD_R0011"
                     /product="tRNA-Ile"
     gene            complement(407217..408691)
                     /locus_tag="RPD_R0012"
     rRNA            complement(407217..408691)
                     /locus_tag="RPD_R0012"
                     /product="16S ribosomal RNA"
     gene            complement(409676..410614)
                     /locus_tag="RPD_0347"
     CDS             complement(409676..410614)
                     /locus_tag="RPD_0347"
                     /EC_number="2.7.1.11"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphofructokinase"
                     /protein_id="ABE37585.1"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /translation="MVELVTLTPNPAIDLSTSVERMVPSRKLRCAAQQRDPGGGGINV
                     ARVVKRFGGDVEAIFPAGGFTGQLLRSLLDREHIPSRVVDAVAETREDFSVTEAATGQ
                     QFRFVLPGLPLAEGEWRGLLELLAGTTPAPKIVVGSGSLPPGVPHDFYAQAAAVAKRI
                     GAQFFLDTSGASLVAALDQGVTLIKPNLREMQELAGRPLDGEKDWIEAARQPIAAGKV
                     EIVALSLGHLGALLVTKDLALRSPALPVNQVSTVGAGDSFLGAIAFSLAKGRPIEDAF
                     RLALASGSASLTMQGTELCRPADVERLCAQVVIEAL"
     gene            complement(410826..411650)
                     /locus_tag="RPD_0348"
     CDS             complement(410826..411650)
                     /locus_tag="RPD_0348"
                     /codon_start=1
                     /transl_table=11
                     /product="UspA"
                     /protein_id="ABE37586.1"
                     /db_xref="InterPro:IPR006015"
                     /db_xref="InterPro:IPR006016"
                     /translation="MIKDLIVNLERNPARDQIADVAVAIAQTFDAHVSGVCFAYESLP
                     SFAMPDFPSDLLTKMLAESETSARAAVERFEAACKREGVSAEHHLLETPYGTAGRFPR
                     MARRFDLSVIMQSDPDNVDNDILIEQVLFDSGRPVLIVPYIQKAPLKLDRVICGWDGS
                     RAATRAINDAMPFLRRAGAVELLIVRDHKVRDEKELRGIEMANHLARHGIKLDIKMIT
                     APDVGVAATILSHVADCSADLLVMGGYGHSRLREFVLGGVTREMLSSMTVPVLMSH"
     gene            411884..412120
                     /locus_tag="RPD_0349"
     CDS             411884..412120
                     /locus_tag="RPD_0349"
                     /codon_start=1
                     /transl_table=11
                     /product="ChaB"
                     /protein_id="ABE37587.1"
                     /db_xref="InterPro:IPR009317"
                     /translation="MPYSSIDDLPPSLQVRLPLHAQSIYLAAFNNAFADNADRSPEEQ
                     ESDAHRVAWAAVKKQYRKQDERWVARDPLRSAGS"
     gene            complement(412315..414354)
                     /locus_tag="RPD_0350"
     CDS             complement(412315..414354)
                     /locus_tag="RPD_0350"
                     /EC_number="6.4.1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="3-methylcrotonoyl-CoA carboxylase, alpha
                     subunit"
                     /protein_id="ABE37588.1"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR003135"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /translation="MMATTALYRRFRTLLIANRGEIACRVIRTARAMGLRTVAVYSEA
                     DADALHVSEADEAVLLGPARARDSYLSIERIIAAAKQTGAEAVHPGYGFLSESAEFAQ
                     ACADAGLIFVGPTPQMITAMGSKSGSKALMEKAGVPLVPGYHGEAQDDATLAAAADKI
                     GFPVLVKASAGGGGRGMRVVRAANELGEAIVSAKREAKAAFGDDRLLIEKYVDNPRHI
                     EVQIVGDSHGNLVSLFERECTLQRRHQKVIEEAPSPTLDAAQRETVCEAARRAAGAVN
                     YVGAGTIEFVSDGKDVFFIEMNTRLQVEHPVTELISGVDLVEWQLRVAFGEALPLRQD
                     QLTLNGHAIEARVYAENPAKNFMPSVGRISTWRTPAETDGLRIDAGYRAGDSVSPYYD
                     AMLAKVIAFAPTRAAAIDRLNRGLEETDVRGVVTNIPFLSALVTHPEVRANAIDTGFI
                     ERHLAALTAAPAPVSDLELATAVAAILRAETDAARAEAPTPWRSSGWMPVGRRKRGFV
                     FRHGRGHDHTDYKVQLAYGTGLATLTIDGRDLAFASLANGDGLDVLLDGARSRVNAVV
                     EGHELYLRTRNGRFELHWVDPFGGESEESVGEDKIVAPLPGTVVALLAEQGAKLEKGA
                     AILTLEVMKMEQTLRAPFAGTLKAIKCKVGDIVQEGVELAEIESAQDATEAQCPS"
     gene            complement(414354..415961)
                     /locus_tag="RPD_0351"
     CDS             complement(414354..415961)
                     /locus_tag="RPD_0351"
                     /EC_number="6.4.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Propionyl-CoA carboxylase"
                     /protein_id="ABE37589.1"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR011763"
                     /translation="MMKSASEIRPIVPDVARNAETMRALVGELKDKLDNVAGAGGEAS
                     RAKHTARGKLLARDRVDLLLDPGTAFLELSPLAAYGLYGGDVHSASVVTGVGRVAGRE
                     CMIVANDATVKGGTYYPMTVKKHLRAQDIARQNNLPCIYMVDSGGAFLPQQDEVFPDE
                     RHFGRIFYNQAQMSAQGIPQIAIVMGSCTAGGAYVPAMSDESIIVRNQGTIFLGGPPL
                     VKAATGEVVSAEELGGADVHSRQSGVTDHYAQNDAHAIGIARKIVGTLKPPQRAVLNM
                     RAPREPLYPAEQLYGIVPAEQRKPFDVRDIITRIVDGSEFDEFKKLYGQTLVCGFAHI
                     WGYPVGIIANNGILFSESSLKGAHFIELCCQRGIPLVFLQNITGFMVGKKYEAGGIAR
                     DGAKLVTAVATANVPKFTVVIGGSYGAGNYGMCGRAYSPRFLWMWPNARISVMGGEQA
                     AMVLSSLRRDNIEAKGGSWSAEEEEEFRSPIRAQYETQGSPYYATARLWDDGVIDPAD
                     TRLVLGLGLAASANAPIEPTKFGLFRM"
     gene            complement(416057..416791)
                     /locus_tag="RPD_0352"
     CDS             complement(416057..416791)
                     /locus_tag="RPD_0352"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="ABE37590.1"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /translation="MSAPVVVITGAARGIGSAAASTFLDHGWRVHGLDRRAPLIKGAI
                     GHECDVTSEEQLLSVAERIGPIDALVPGAGINLRPHDNAAEKLTLEAWNRTIAVNLTG
                     VMLTVRAFRPRIRADGAIVLISSVAALRAMPHSDAYTASKGAIVALTRSWAVDYSRDG
                     IRVNCVAPGPTDTEMMSGLRDGYAVERQVQLPQQRMATAGEVAQVIRFLASDQASYVS
                     GAIVPVDGGAVAHSAGVPFPRRRPKP"
     gene            complement(417000..418610)
                     /locus_tag="RPD_0353"
     CDS             complement(417000..418610)
                     /locus_tag="RPD_0353"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase and ligase"
                     /protein_id="ABE37591.1"
                     /db_xref="InterPro:IPR000873"
                     /translation="MSDAEDIKLATISDQATNLARRVNVGDITRRGARRHRDKIAVIM
                     GETRLTYGELDARANRIAHGLLAMGLGNGARIGGLARNSIDFLTLYFAAAKAGAIFCP
                     SNPAIPDADLVHILGHAEVSAIFIDPDRHQQFTAVASQVPSIRKIFSVGGNGQADSQL
                     DSLAVIAEGQPAIDPETATGDRDVAMIMYTSGTTSAPKGAMLSHINVTTGAVHNAFAG
                     EVDENTIATAILPLFHCGQLSISSGTLMRGGTVVVFDGFEPAALLDAIARERITWLFA
                     LPAMYRALLAHKDLDNTDVSSLAFCLYAMAPMDPSTLREASRRLKARFALTSGQTEAY
                     PPTVVFAPEFQLTKHGAFWGRAMPLVDLAIMDDDGRLVEDGSVGEIVYRGPMVMEGYL
                     KDPEATARAFEGGWFHSGDLGRFDEDSLLLFVDRKKDIIKSGGENVSSVKVESCLLAH
                     PAVRAAAIVGVPHSRWSEAVVAAVCLLPGSVEDEGQLIAHCKQTLAPFEVPKKIVFYR
                     ELPQTATGKLQKYQIRGELENLFRDQTN"
     gene            complement(418647..419438)
                     /locus_tag="RPD_0354"
     CDS             complement(418647..419438)
                     /locus_tag="RPD_0354"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="Enoyl-CoA hydratase"
                     /protein_id="ABE37592.1"
                     /db_xref="InterPro:IPR001753"
                     /translation="MTDWKTKYKLITFDNDKGVLTVSFSREAKLNAVDARMHTEMSWL
                     WGDVARDEATRAVLLTGAGAAFSAGGDLDWFKTMTPDALDRLFIEARRIIVDMLEVPQ
                     PIIAAVNGAATGLGATLALMSDIIYASEKATIADTHVLAGIGAGDGGVVIWPWLCGMA
                     RAKEYLMTGQKLNAREAHSIGLVNHVVAHDELLDTATRMARRLADGPQLAIRGTKFSL
                     NKILREAVNLTLDTSLSLEKECFHSADHRECIDAFLEKRKPQFNR"
     gene            complement(419471..420262)
                     /locus_tag="RPD_0355"
     CDS             complement(419471..420262)
                     /locus_tag="RPD_0355"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="ABE37593.1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR002424"
                     /translation="MTLVSAATEQTRDCVTGGDARVVLVTGGASGIGRAAALAWARQG
                     CSVLVADIDDRGGAETVEAIERLGSRARYQRNDVTDERECASLVEQAVLHFGRLDVAF
                     NNAGITGPSAYIANYPGADWRHVINVNLLGIFNSMQPQLRLFESQGAGVIVNTASVIG
                     LRGVAGGSAYAAAKHGVIGLTKCAALEYGRSGIRINAVCPGYIETPLVAAVPDRILTE
                     KINRTGARRLGRPDEVAALVLWLASPAASYVNGAAVAVDGGFLAS"
     gene            complement(420259..421437)
                     /locus_tag="RPD_0356"
     CDS             complement(420259..421437)
                     /locus_tag="RPD_0356"
                     /EC_number="1.3.8.4"
                     /codon_start=1
                     /transl_table=11
                     /product="Isovaleryl-CoA dehydrogenase"
                     /protein_id="ABE37594.1"
                     /db_xref="InterPro:IPR006089"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR006092"
                     /db_xref="InterPro:IPR013107"
                     /translation="MIELASFDFDLDEPTRMLRDTVRSFVQAELAPRAYAIEQANDFP
                     ADIWRKFGSMGLLGITVDEAYGGSGLGYFAHIIAMEEISRASAAVGMSYGAHSNLCVN
                     QIHRNGTEAQKQRYLPKLVSGENVGALAMSEAGAGSDVVSMKLRADKVGSNFVLNGTK
                     MWITNGPNADTLVVYAKTDPAAKSKGITAFIVERDFKGFSTSPKLDKLGMRGSNTCEL
                     VFDNCEVPEANVLGEVGQGVRVLMSGLDYERAVMAAGPVGIMAACLDLVVPYARDRKQ
                     FGQPIGEFQFIQGKLADMYTAQMTARAYLYGVARAIDGKVLQGQAARKDCAAVILYAA
                     EQATKVAAEAIQIMGGNGYVNECPAGRYWRDAKIFEIGAGTSEIRRMLIGREIVRSSA
                     "
     gene            complement(421620..422846)
                     /locus_tag="RPD_0357"
     CDS             complement(421620..422846)
                     /locus_tag="RPD_0357"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular ligand-binding receptor"
                     /protein_id="ABE37595.1"
                     /translation="MKFYGVTSLSGAVRLAFFASAVCGPGAFNGAAAQEPVRIGVITD
                     MTGPYSSLSGPGVVVGMKMAVDEFGGKVLGQPIEVLSADSGLKADIALSRAREWYDRQ
                     NVHMIVESSDSGSAVALQKLGADKKKITMFHSGTTALTNLECSPYGVHYAWDTYSMAS
                     GAARAAVQAGGNSWYFITADYVFGKSLEADASKIIRQLGGDIIGGVRHPLNVPDFASF
                     LLSAQQSKAKVVGLANAGSDTQNAVKQAAEFGLGGGQKVVPLLMFDTDVKGLGLKVAQ
                     GMEFATAFYWDYDDKSREFANKFFAIHKSMPTMNHAGSYSATLQYLKAVQATGSLDAD
                     KVMKYLKSAKIEDAFARNGRIRVDGRMVHDIYQVRVKTPEESTGPSDILKVILTIKGD
                     DAFMPLADSTCPLVKK"
     gene            423299..424021
                     /locus_tag="RPD_0358"
     CDS             423299..424021
                     /locus_tag="RPD_0358"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein, TetR"
                     /protein_id="ABE37596.1"
                     /db_xref="InterPro:IPR001647"
                     /translation="MPEPPARNRSNVSARIDVSLIAMTKNSADSARPRGLVQVRSSRA
                     DKQERTRRALLQAAIDIVGDEGYAAATVGKITSRAKVANGTFYNYFDSQQSIFDQLLP
                     FLGDRLTAHIKAQVDESLTGVARDRARFVAYFDFCRKNPAFLRVLNEAEVFAATAYRQ
                     HVVAMYEGYLHALERSAAKHEITGYDREELPPVVFMLMGIRSYMTMLYQHNYVERSAL
                     SIEAMADIYEKLLTLGLFNDRR"
     gene            complement(424369..424443)
                     /locus_tag="RPD_R0013"
                     /note="tRNA-Glu2"
     tRNA            complement(424369..424443)
                     /locus_tag="RPD_R0013"
                     /product="tRNA-Glu"
     gene            424666..425946
                     /locus_tag="RPD_0359"
     CDS             424666..425946
                     /locus_tag="RPD_0359"
                     /EC_number="5.4.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal large subunit pseudouridine synthase
                     D"
                     /protein_id="ABE37597.1"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR006225"
                     /translation="MVAGGGGGDDARPLRQPQRGLGGDRNASLGAEKLIADGDENRRE
                     RQRRGQARDHHHPPHPRKQRGLFGGRFGQGGFGHAMLGFGSVFLEGSIVNDSSGHLLE
                     VVVAGDEGSPRLDRVLATRCPALSRSRLKALILDGRVAIRGAPVRDPAYHAASGETIT
                     IDVPPPVAPEPAGEAIALEIVHEDDDIIVIDKPRGLVVHPAAGHETGTLVNALIAHCG
                     ESLSGIGGVRRPGIVHRLDKDTTGLMVAAKNDRAHQSLSAQFADHGRTGELRRGYYAF
                     VWGAPNRIRGTIDAPIDRHPHAREKMAVRDGGREAITHWEVLETFTGRSGGEIVSLIA
                     CQLETGRTHQIRVHLAHIGHPLLGDDVYGPHFKTKASQLRPDARAALTDLGRQALHAY
                     LLVLEHPSTGEVVAWESGLPADLKRLKAALTATE"
     gene            426165..427064
                     /locus_tag="RPD_0360"
     CDS             426165..427064
                     /locus_tag="RPD_0360"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoH"
                     /protein_id="ABE37598.1"
                     /db_xref="InterPro:IPR000943"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR007630"
                     /db_xref="InterPro:IPR012759"
                     /translation="MARAATLPVLNGESGLARYLAEIRKFPMLEPQQEYMFAKRWREH
                     DDRDAAHHLVTSHLRLVAKIAMGYRGYGLPISEVVSEGNVGLMQAVKRFEPDKGFRLA
                     TYAMWWIKASIQEYILRSWSLVKMGTTANQKKLFFNLRKAKSKISALDEGDMHPDQVK
                     LIATRLGVTEQDVIDMNRRLGGDASLNAPIRDDGEPGEWQDWLVDQSPSQEAVMAEHE
                     ELDHRRAALNGAIGVLNPRERRIFEARRLADEPMTLEDLAAEFGVSRERVRQIEVRAF
                     EKVQSAVKGTIARQEQAALEAAH"
     gene            complement(427197..427559)
                     /locus_tag="RPD_0361"
     CDS             complement(427197..427559)
                     /locus_tag="RPD_0361"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37599.1"
                     /db_xref="InterPro:IPR002198"
                     /translation="MGDIMGVLASGYTSAALQNPSRTPYKNVDEKLYEGTWSGTYSNT
                     KKFSITVSDVQGFRAQVRYQSEGSIKFQSVLIKDGSFRVGDTKFTLGANGSASIRTAV
                     SDPVTGQVNLVKGTAKLG"
     gene            complement(427695..428594)
                     /locus_tag="RPD_0362"
     CDS             complement(427695..428594)
                     /locus_tag="RPD_0362"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase-like"
                     /protein_id="ABE37600.1"
                     /db_xref="InterPro:IPR001279"
                     /translation="MTSSARPEIRAFFDEPTNTISYLVSDPATRRAAVIDPVLDYDHS
                     DGSVDIRSADAILKAANDGGLTIEWVLETHAHADHLSGAPYIKRNTGARIGIGEHIKD
                     VQRIFRPMFNADDLRTDGSDFDHLFKDGERFAIGDLAVEVMHTPGHTPADIAYRIGDD
                     AVFVGDTLFMPDYGTARADFPGGDAHQLYRSIQKLLALPPRTRLFMCHDYKAPGRDEY
                     AWETTVQAQREGNVHLRGGVSEDEFVDMRNARDATLKAPTLLLPSIQVNIRAGRFPKA
                     QHNGVHYLLLPVRARPGAEAGVN"
     gene            428704..429039
                     /locus_tag="RPD_0363"
     CDS             428704..429039
                     /locus_tag="RPD_0363"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, ArsR family"
                     /protein_id="ABE37601.1"
                     /db_xref="InterPro:IPR001845"
                     /translation="MSLSPTFEADDFAANAARVATVLRALGNTRRLMILCRLIETGEM
                     TVGALADSIGISQSALSQHLARLRDDGIVTYRRDSQSVWYRIAEPRIEQLIAELHRLF
                     CRNAAALQR"
     gene            429057..429875
                     /locus_tag="RPD_0364"
     CDS             429057..429875
                     /locus_tag="RPD_0364"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF81"
                     /protein_id="ABE37602.1"
                     /db_xref="InterPro:IPR002781"
                     /translation="MAITSADLITVASGGLVGFILALIGGGGSVLAVPLLVYVVGIRS
                     PHVAIGTSSIAVAISALANLLGHWAAGNVRWNCALVFSAAGIGGAFAGSFIAKQIDGQ
                     KLLLLFGMLMVVIGVLMSRRQSGGGDPTIRLTIATAKTMLPKLIGTGFGVGALAGFFG
                     IGGGFLIVPGLILATGMPLTSAIGSSLVAVFAFGASTAASYALSGLIDWRLAGLFISG
                     GLIGGLIGIGAGKLIGAHDKVLRGVFSAVVVVVGLYVCYRGVAYFLVAQHPMSL"
     gene            complement(429936..431549)
                     /locus_tag="RPD_0365"
     CDS             complement(429936..431549)
                     /locus_tag="RPD_0365"
                     /EC_number="4.1.1.49"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoenolpyruvate carboxykinase (ATP)"
                     /protein_id="ABE37603.1"
                     /db_xref="InterPro:IPR001272"
                     /db_xref="InterPro:IPR008210"
                     /translation="MQETGVHNGAHGADKFGLKNLKGIYWNFGAPQLYEHALRNGEAV
                     LSADGALVADTGVFTGRSPKDKFTVRDATTETTMWWGGNQSITAEQFETLYQDFIKHA
                     EGMTLFAQDLYGGADPSFQIKTRVFTELAWHSLFIRTLLRRPDRADLAAFVPELTLID
                     LPSFRADPKRHGCRSENVVAIDFARKIVLIGGTQYAGEMKKSVFTTLNYYLPERGVLP
                     MHCSANVGPAGDTAIFFGLSGTGKTTLSADPNRTLIGDDEHGWGKDGVFNFEGGCYAK
                     CIKLSPEAEPEIFAASSRFGAVLENVVLDEITRKPDFDNGSKTENTRSAYPLESIPNA
                     SPTGRAGQPKNVVMLAADAFGVMPPIAKLTPAQAMYHFLSGYTAKVAGTERGVTEPTP
                     EFSTCFGSPFLPRDPSVYGNMLRDLIHNHNVDCWLVNTGWTGGKYGTGHRMPIKVTRA
                     LLTAALDGSLRNAEFRTDPYFGFAVPTALPGVPSDILEPAKTWADKAEFDKTARALVG
                     MFQKNFAKFEAQVDADVRAAAPDVKIAAE"
     gene            complement(431739..432473)
                     /locus_tag="RPD_0366"
     CDS             complement(431739..432473)
                     /locus_tag="RPD_0366"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase-related,
                     FMN-binding"
                     /protein_id="ABE37604.1"
                     /db_xref="InterPro:IPR011576"
                     /translation="MQPTADFNPTRVAKSLLRRRREGALATLLRGSGGPFCSLVNLAT
                     APDGAPILLISRLAVHTKNLLADPRMSLMLDERAEGDPLEGARIMLLGTALEARPADV
                     QLLRRRYLAAHPGAEAYIDFTDFSLFTIETSAAHLVAGFGRIVDLAPADFLTDLGGAA
                     GLLDAEPSAVDHMNVDHLDTLNLYATKLIGAGAADWRCTGVDPEGLDLQAGRTTLRLD
                     FLERVTTAAGLRDMLKRMADIARSAA"
     gene            432687..433388
                     /locus_tag="RPD_0367"
     CDS             432687..433388
                     /locus_tag="RPD_0367"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator, winged
                     helix family"
                     /protein_id="ABE37605.1"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /translation="MPTIALVDDDRNILTSVSIALEAEGYRIMTYTDGASALDGFRTS
                     PPDLAILDIKMPRMDGMETLRRLRQKSDLPVIFLTSKDEEIDELFGLKMGADDFIRKP
                     FSQRLLVERVKAVLRRSAPKDPAAAPKETDAKALDRGLLRMDPERHTCTWKNEPVTLT
                     VTEFLILQALATRPGVVKSRNALMDAAYDDQVYVDDRTIDSHIKRLRKKFKVVDDDFE
                     MIETLYGVGYRFKET"
     gene            433595..435286
                     /locus_tag="RPD_0368"
     CDS             433595..435286
                     /locus_tag="RPD_0368"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="ABE37606.1"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /translation="MRRAGQFFFTLSFSSLTRRILSLNLAGLMALSASILYLSQFRAG
                     LIDARAQSLLVQAEIIAGAIAASATVETNTITVDPDRLLDLKPGETYGPPDEFAVLDF
                     PINPERVAPVLRRLISPTKTRARIYDRDGVLILDSRSLYGRGDVMRFDLPPPTAEKPG
                     LIERATIAVRTWLNRGDLPLYRELGPENGNGYQEVADSLKGQKNSVVRINDRGEVIVS
                     VAVPVQRFRAIHGALMLSTQGDDIDQMVTAERLAILKIFGLAAVVMFVLSVLLASTIA
                     GPVRRLADAAERVRRRIRARVEIPDFTTRRDEIGHLSGALREMTDSLYNRIEAIERFA
                     ADVSHELKNPLTSLRSAVETLPLAKNDKSRARLLAVIEHDVKRLDRLISDISDASRLD
                     AELQRQDAAPVDLRRLLTTLTLVANETRLGNNAVVEVRFEGPASDPFSVPGHDSRLGQ
                     VISNLLSNAQSFSHPGGKVQIVCRRRKTEIEIVVDDDGPGIRDDAFEKIFERFYTDRP
                     HQGFGQNSGLGLSISKQIVEAHGGKIRAENRPGPRDADGEPTSAGARFVVRLPST"
     gene            435283..435744
                     /locus_tag="RPD_0369"
     CDS             435283..435744
                     /locus_tag="RPD_0369"
                     /EC_number="2.7.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Hpr(Ser) kinase/phosphatase"
                     /protein_id="ABE37607.1"
                     /translation="MSAAGSSSVHASAVRVGDHAVLIRGPSGSGKSRLAFGLIVAGRT
                     GQIPDAELIGDDRVFLERRDGRLWVRPAPELAGMIEVRGLGIRRCPNAPEAVIGLIVD
                     LAADDAARLPEAAAMQIRIEGVELPRVPVAAEFDPLPLVVAALTTIDAVGA"
     gene            435884..436342
                     /locus_tag="RPD_0370"
     CDS             435884..436342
                     /locus_tag="RPD_0370"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system fructose subfamily IIA component"
                     /protein_id="ABE37608.1"
                     /db_xref="InterPro:IPR004701"
                     /translation="MVKVTRSRGAPRSAREEFPMIGLVLVTHGRLADEFKAALEHVMG
                     PQKQIEAVTIGAEDDADLCRSDIIEAVNRVDSGDGVAILTDMFGGTPSNLAISCMSRP
                     KVEVLAGINLPMLVKLAKVREERALPDAIALAQEAGRKYVTIASRVLAGK"
     gene            436339..436674
                     /locus_tag="RPD_0371"
     CDS             436339..436674
                     /locus_tag="RPD_0371"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphotransferase system, HPr"
                     /protein_id="ABE37609.1"
                     /db_xref="InterPro:IPR000032"
                     /db_xref="InterPro:IPR001020"
                     /db_xref="InterPro:IPR005698"
                     /translation="MTADASQTAPGGQPDTASGASGKISREIPVINKRGLHARASAKF
                     VQMAEKFHAEVTVTRNGETVGGTSIMGLMMLAAGIGTTVTVSATGPEAREALDALTEL
                     MGSKFGEEE"
     gene            complement(436731..438272)
                     /locus_tag="RPD_0372"
     CDS             complement(436731..438272)
                     /locus_tag="RPD_0372"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37610.1"
                     /translation="MTSIATSRTRLSLIERWIDALLDPKRQERTVVLSLAAYAAIWTA
                     YRTIATWPRDLHADVTELYGWSRNLAFGYDKHPPFSAFVTRAWFSVVPVSDLTFHLLA
                     TANIALTLYIAWRTMRRYMAAEKALFGLALLTLIPFFNFIALKYNANAVLLPLWALTI
                     HCFLRAFEQRSLLWPALAGVFAGCSMLGKYWSVVLIGALGLGALLDPRRARFFGSPAP
                     WLMIVAGALVLAPHLAWLVDHRFPSFTYAAARAGSGFFENALDTLRYLAGCLGYAALA
                     LVATWALLRPSRAALIDSAWPADPQRRLIVTIQFLMIVAPAPVALASGIRIVPLWTMP
                     AWTLLPIVLLSSPLIEVGRAALRRMLIGAAALALAILAAAPGVAVAIHTTSAPEPFEY
                     ASLLADDIARTWQRHSDKPIALVAGETVLAENTAYYLRTDTRAFETADLAALKAEATA
                     RGAVLVCSATDQTCLATAEQIVAGQPQILRSKVWLSRPLFGIAGGTVRDVFLLVPPPA
                     TGAAK"
     gene            438293..440227
                     /locus_tag="RPD_0373"
     CDS             438293..440227
                     /locus_tag="RPD_0373"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein LepA"
                     /protein_id="ABE37611.1"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006297"
                     /translation="MPGGHLPVRPAPSSMPKAAVFRAVVAADRLAGRNRRCYPATMTT
                     VPIDNIRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKEQVLDSMDIERERGITI
                     KAQTVRLNYRAKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQT
                     LANVYHALDAGHEIVPVLNKVDLPAAEPDKVKQQIEDVIGLDASDAVMISAKTGLGVP
                     DVLEAIVTRLPPPKGDRGATLKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGT
                     GAAYDVERVGFFTPKMTAVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPITEMLP
                     GFKPAIPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLG
                     LLHLEIIQERLSREFDLNLIATAPSVIYKMKLNDGSEIEIHNPVDMPDVVKIAEIEEP
                     WIEATILTPDEYLGSVLKLCQDRRGNQKELTYVGARAMVKYDLPLNEVVFDFYDRLKS
                     VSKGYASFDYHLTDYKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKEL
                     IPPHMFVIPIQAAIGGKIIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMR
                     QFGKVDIPQEAFIAALKVDS"
     gene            440240..440926
                     /locus_tag="RPD_0374"
     CDS             440240..440926
                     /locus_tag="RPD_0374"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37612.1"
                     /translation="MDPVLTEIPGRILDLAFGALSQANMHAVFSDAGNEHWDFISVTN
                     TAHAGELFLKAIIAKEHPLLIFKDLFSLDDNRTDSIELVNLIKRGKTHEFERLPQIIW
                     AVTGKRIPNPECYERLRRARNSIQHFCAPEDEDFRDLSLEFIYTIIDPLIFEHFESFA
                     IEYHEDHSAGDDYVVATLLRKQLRFSVPDDFDITEIRIRDEISASSQTYREWITGELN
                     RIGRLDLLNK"
     gene            441249..441485
                     /locus_tag="RPD_0375"
     CDS             441249..441485
                     /locus_tag="RPD_0375"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37613.1"
                     /translation="MPAQPKKPTPKSPRERMAARRERLRAEGLRPVQHWVPDLRDPKV
                     LADIRREGAMMAKHPDNDAIDAWIEEVADLDAWS"
     gene            441476..441811
                     /locus_tag="RPD_0376"
     CDS             441476..441811
                     /locus_tag="RPD_0376"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional modulator of MazE/toxin, MazF"
                     /protein_id="ABE37614.1"
                     /translation="MELKRGDVVLLVAQGEIGKPRPGVVVQADELGNATTSVLICPMS
                     SDLSEFKRTRPWIEPSADNGLRVRSQIMTDKLSPIRRDRVRQVLGVLNAQTQERLDAA
                     LLVVLGLAR"
     gene            441925..443745
                     /locus_tag="RPD_0377"
     CDS             441925..443745
                     /locus_tag="RPD_0377"
                     /EC_number="2.7.11.5"
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate dehydrogenase (NADP+) kinase"
                     /protein_id="ABE37615.1"
                     /db_xref="InterPro:IPR010452"
                     /translation="MTADAHLFSASDLEAATRIAEPDFELLDALIRTDDPDDQAHTLA
                     RVALSAFDNYYAVSRRIPALAKAAFYARDWPATVRLSKIRIGLYTACIDQLVPLLKAG
                     LPELANDEQVWVRAEAELLAAIAGRYEADFAFAFWQSLRRKLVSDEWRPVSYDTGPAA
                     RPPAAIAAVVRTIAATLPIQPEVIRNVLDAAGFTGPWRDLDGDAALAAAAIEAALEPL
                     SPRAGETAKIEIAESGFFRNRGACLVGRIRLRDRGDMPPRNIPLLVALLNEDDGLVVD
                     AVLCDSDELQFAFSSTLANYHATNPRYHELARLLHELMPKRPLGTQYSCIGFHHLGKV
                     AVMNEILTEHRRSKEKLATAPGFKGTVAIAFTMPCSAYVLKIIRDHPTDDYKFDYFDG
                     LDAVLRKYNLVHEIDRAGSMLDNIIYSNVKLARTMFAPDLLDELLEAGIGTVTLERDA
                     LVFRHLIVQIKLTPLPLYLTTAAAADARAAVINLGDCIKNNAAADIFNKDLDGRNYGV
                     SRIRKVYLFDYDAVEQLTEVKVRSTPPMPRAEDEDGVVFRPAQMLEGLRIDDPGLRRA
                     FRDAHPELMQPDYWEGMQHALRAGKVPKVMNYPTSRRLRR"
     gene            443977..444726
                     /locus_tag="RPD_0378"
     CDS             443977..444726
                     /locus_tag="RPD_0378"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF540"
                     /protein_id="ABE37616.1"
                     /db_xref="InterPro:IPR007496"
                     /translation="MLDAAIKALTQILSPPMRSILWRSIGFALALIAVAAIGLQRLLS
                     WLANSSELWAEAALGGFQTPLNILSWVFSIAAGLGIVVGAVFLMPAVTSLVAGIFVDE
                     AAEHVEREYYPSDQSGVALPVGIAMIETVKTALLTILVYLVALPFLFFAGAGVIVFFV
                     ATGWLLGREYFELAAMRFRPAADAKAMRRDNATTVFIGGLVIAAFVSIPIVNLATPLF
                     GMAFMVHLHKRLSGSRPERIAPDRRDRIDAR"
     gene            445371..446354
                     /locus_tag="RPD_0379"
     CDS             445371..446354
                     /locus_tag="RPD_0379"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase fold"
                     /protein_id="ABE37617.1"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR000379"
                     /db_xref="InterPro:IPR003089"
                     /translation="MSAKRDGCMMRALNDNNLPPRTPRTAFHTKPRWDHEGRDWPNQD
                     ASQFVHAAGLRWHVQQMGRGPVLLLIHGTGAATHSWRMLAPLLAEHFTVVAPDLPGHG
                     FTETPPPARMTLDAMAQDIATLLRGLGHQPVLVAGHSAGAAVLARMCLDGSIAPAGLV
                     ALNGALLPIGGAATRLMLPLARVLASSAMVPRLIARFARNKGMVERMIADTGSSVDPA
                     GIDYYRRLVGSPGHVAAAIRMMASWRLDRLAQQLPGLATRLLLIAGSNDKTIASQDSA
                     RVHSMVPGARVEIMQGLGHLAHEERPHDVAGMMIELARNAGLLPRMFAAAE"
     gene            446518..448239
                     /locus_tag="RPD_0380"
     CDS             446518..448239
                     /locus_tag="RPD_0380"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S10, serine carboxypeptidase"
                     /protein_id="ABE37618.1"
                     /db_xref="InterPro:IPR000379"
                     /db_xref="InterPro:IPR001563"
                     /translation="MGFSLSRDDREGVAQALDCRQTDAVLRSALFPEQSTRRPCRPHA
                     PPFVLKETLMALSPWSVCRAAMALMLVTTATLASARAQDAAPASQQPAAAQGGKSETG
                     GSRGKAAAASSDAEQHRLPADSVTRHTLALPGRSLSFAATAGSIRLFNDKAEPQADIA
                     YTAYQLDNAEARTRPVTFLFNGGPGASSAWLQLGAAGPWRLPIFGEAAVASATPALQP
                     NAETWLDFTDLVFIDPVGTGYSRLVASGDDVRKQFYSVDGDVDAIALTIRRWLEKHDR
                     LLSPKYVGGESYGGIRGPRVVRNLQTRQGVGVKGLILVSPLLDFREYSGSSLLQYVAR
                     LPSMAAAARQQKGPVTRTDLTDVEAYARGEFLADLIKGEADQAATNRLADRVATLTGI
                     DPAVSRRLAGRLDTSEFQREFDRANGKVTGRFDASVLGFDPFPDSSDAQFSDPSADSL
                     IAPLTSAAAELTRNPLQWRPDGSYHLLNSSVAQQWDFGRGRNPVESLTQLREILAVDP
                     KLQVLVTHGLFDLATPYFASQIAIDQLPPFASKRIKLVTWPGGHMTYARDDARKALRG
                     EVGAMMK"
     gene            complement(448307..449083)
                     /locus_tag="RPD_0381"
     CDS             complement(448307..449083)
                     /locus_tag="RPD_0381"
                     /EC_number="3.2.2.-"
                     /EC_number="4.2.99.18"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease III / DNA-(apurinic or apyrimidinic
                     site) lyase"
                     /protein_id="ABE37619.1"
                     /db_xref="InterPro:IPR000445"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR003651"
                     /db_xref="InterPro:IPR004035"
                     /db_xref="InterPro:IPR005759"
                     /translation="MQKITRRAPAPAVAKSAKIPASSVAAKPRPQRQKSGKAATKPKR
                     LRRWSPDEVREAFTRFARANPEPKGELEHLNPFTLLVAVVLSAQATDSGVNKATRALF
                     AVADTPQKMLALGEERVRDYIKTIGLFRTKAKNVIALSQKLITDFGGEVPSTRAELET
                     LPGAGRKTANVVLNMAFGQPTMAVDTHVFRVGNRTGLAPGDTPLAVELALERMIPPEF
                     MQHAHHWLILHGRYTCLARKPRCEVCPINDLCRWPEKTVA"
     gene            449106..449621
                     /locus_tag="RPD_0382"
     CDS             449106..449621
                     /locus_tag="RPD_0382"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37620.1"
                     /translation="MALDTDLDPELAQPKLFSALLKPHRALSHKAFLVLMGVLGTISF
                     AVGVGFWTMGAWPVFGFFGLDLLAIYIAFRISFARGRASEEISITISELRVRRISHRG
                     HVAEWVLNPLWVRLEKIVHAEFGIEQLYLVSRGRRVSVASFLGAEEKASFANALTAAL
                     DAARRGPLVRH"
     gene            449638..450570
                     /locus_tag="RPD_0383"
     CDS             449638..450570
                     /locus_tag="RPD_0383"
                     /EC_number="2.1.1.63"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-O6-methylguanine--protein-cysteine
                     S-methyltransferase / Transcriptional regulator Ada"
                     /protein_id="ABE37621.1"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="InterPro:IPR001680"
                     /translation="MVAARRATYIGSMMNLAAADHRLAKPGPRDAALADYDSVRRAIA
                     FISQKWKAQPTVEAIADASGLTPDELHHLFRRWAGLTPKAFMQALTLDHAKNLLRDSA
                     SVLDAALDSGLSGPGRLHDLFVTHEAMSPGEWKSGGAGLTLRYGFHPSPFGAAVVIAS
                     ERGLAGLAFADPGEEQAAFVDLQQRWPRATCIADQEFTAPFAQRVFDPVQWRSEQPLR
                     VVLIGTDFEVRVWETLLKIPLGRAVCYSDIANKIAAPKASRAVGAAVGKNPISFVVPC
                     HRALGKGGALTGYHWGLTRKQAMIGWEAGRLGAG"
     gene            450661..452175
                     /locus_tag="RPD_0384"
     CDS             450661..452175
                     /locus_tag="RPD_0384"
                     /EC_number="5.4.2.1"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase"
                     /protein_id="ABE37622.1"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR005995"
                     /db_xref="InterPro:IPR006124"
                     /db_xref="InterPro:IPR011258"
                     /translation="MQSRRPVMLVILDGWGWREDPADNAVLQADTPTFDALWANGPHA
                     FLRTSGKSVGLPNGQMGNSEVGHLNIGAGRVVMQDLPRISDAIASGEIGQAPELLAFI
                     EKLRASGGTCHLMGLVSPGGVHSLQDHACALAKILAKAGVPTVLHAFTDGRDTPPKSA
                     VDDIARVRAELPPNVPIATVSGRYYAMDRDNRWERVSKAYGVIADADGPRFADADAVV
                     AAGYASGVNDEFIVPAVVGDYQGMRDGDGVLCFNFRADRVREILATLLDPTFTGFPRK
                     RVLKIAAAAGMTQYSTALDALMRTIFPPQSLVNGLGQVVAATGRHQLRMAETEKYPHV
                     TYFLNGGEEVPYPGEDRIMVPSPKVATYDLQPEMSAPELGDKAVQAIESGKYDMIILN
                     FANPDMVGHTGSLPAAIKAVETVDTQLGRIVAAIRQAGGALLVTADHGNCEMLRDPVT
                     GGPHTAHTTNPVPVLLVGHEGPLADGQLSDLAPTLLKLMDLPQPAEMTGQSLIG"
     gene            complement(452216..453031)
                     /locus_tag="RPD_0385"
     CDS             complement(452216..453031)
                     /locus_tag="RPD_0385"
                     /EC_number="1.17.1.8"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate reductase"
                     /protein_id="ABE37623.1"
                     /db_xref="InterPro:IPR000846"
                     /db_xref="InterPro:IPR011770"
                     /translation="MSDMRLIVAGAGGRMGRALTRAISETKGVVLTGALEAPGSELLG
                     QDAGVLAGLPANGVKLSADLWTLSAGADGILDFTVPAATIANVAIAAQRGIVHVIGTT
                     GLSSSDNAVIKSVTDQAIVVKSGNMSLGVNLLAALTRRVAQSLDAGFDIEIVEMHHRA
                     KIDAPSGTALLLGEAAAAGRKVDLDDHSARGRDGVTGARKTGDIGFASLRGGTVTGDH
                     SVIFAGPYERIELAHKAEDRMIFAHGALKAAQWAHGKSPGLYSMMDVLGLAEF"
     gene            complement(453124..453435)
                     /locus_tag="RPD_0386"
     CDS             complement(453124..453435)
                     /locus_tag="RPD_0386"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF1330"
                     /protein_id="ABE37624.1"
                     /db_xref="InterPro:IPR010753"
                     /translation="MAKGYWVARMDVHDLDGYKRDYVAHNGTVFAKYGARFLTRGGTY
                     EAHEGPARSRNVVIEFKDYATALACYHSPEYQALIKARSPFAQGEIVIVEGYDGPQPQ
                     G"
     gene            complement(453455..454162)
                     /locus_tag="RPD_0387"
     CDS             complement(453455..454162)
                     /locus_tag="RPD_0387"
                     /EC_number="4.1.1.23"
                     /codon_start=1
                     /transl_table=11
                     /product="orotidine-5'-phosphate decarboxylase"
                     /protein_id="ABE37625.1"
                     /db_xref="InterPro:IPR001754"
                     /translation="MAQADPADRDRLIVALDVPSVDAANAMIEKLGDSVGFYKIGYQL
                     AYAGGLPLVEKLARAGKKVFVDLKLHDIGNTVARGVESLNSLGATFLTVHAYPQTMKA
                     AVAARGDSGLKILAVTVLTSYDDSDLADAGYRFGVRDLVEARARQALAIGVDGLVCSP
                     EEAANLRGIVGPDMALVTPGIRPAGAAAGDQKRIMTPARAIAAGASHLVVGRPVMEAA
                     DPKQAAEAIVAEIAQAT"
     gene            complement(454169..454750)
                     /locus_tag="RPD_0388"
     CDS             complement(454169..454750)
                     /locus_tag="RPD_0388"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent FMN reductase"
                     /protein_id="ABE37626.1"
                     /db_xref="InterPro:IPR005025"
                     /translation="MSVVKILVIPGSLRTGSHNVRLAAAAAHELARADVDVTRLSLAD
                     YPLPIYDGDFEAKSGVPINAINLKRMIGAHHGVLIVSPEYNSAPPALLKNAIDWVSRV
                     EDSHETQGQVFRERAFALAAASEGKLGGARCLAALRLILSGCRAPVIPNQLALSFAHQ
                     AYDETDRLKLPADIAALQAMVRQLIDFAQHMMR"
     gene            complement(454899..455501)
                     /locus_tag="RPD_0389"
     CDS             complement(454899..455501)
                     /locus_tag="RPD_0389"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phospholipid N-methyltransferase"
                     /protein_id="ABE37627.1"
                     /db_xref="InterPro:IPR000051"
                     /translation="MALQSTVRALKKQPRLDDEVRFLRSWIEKPLHMGAVMPSGKLLA
                     RTMAQYVDIDSTGPVIELGPGTGAITSALVEHGVEQKRLVLVEYNPSFCALLRERYPQ
                     ATVVQGDAYRLRDSLWDVLPEPATAVVSGLPLVTKPMLTRMKLIRDSFNLLEPGAPFV
                     QFTYSVAPPIPKSLPGVSTEASERIWMNIPPARVWVYRKG"
     gene            complement(455595..456755)
                     /locus_tag="RPD_0390"
     CDS             complement(455595..456755)
                     /locus_tag="RPD_0390"
                     /codon_start=1
                     /transl_table=11
                     /product="Chaperone DnaJ"
                     /protein_id="ABE37628.1"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR003095"
                     /db_xref="InterPro:IPR012724"
                     /translation="MTIESVAMSTTKRCYYETLEVERSADESTLKSAFRKLAMKWHPD
                     RNPGDASSEVKFKEINEAYEVLKDGDKRAAYDRYGHAAFEQGMGGGAGFGAGFASSFS
                     DIFEDLFGMAGQRGGRGTGRERGADLRYNMEISLEDAFKGKTAQIEIPVSVTCESCSG
                     IGAKAGTKPKTCSTCGGAGRVRQAQGFFTLERTCPSCQGRGQIIEDPCPSCTGSGRVT
                     RERTLSVNIPQGVEDGTRIRLAGEGEAGVRGGPPGDLYIFLSLASHAIFQRDGADLHC
                     RVPISMVTAALGGEFEVPTIERGKTKVKVPSGTQTGRRFRITGKGMPVLRSRQVGDMY
                     VQVAVETPQNLTKKQQELLAEFEKLSSGATQPEAAGFFTKVKDFFGSRANTP"
     gene            complement(456864..458765)
                     /locus_tag="RPD_0391"
     CDS             complement(456864..458765)
                     /locus_tag="RPD_0391"
                     /codon_start=1
                     /transl_table=11
                     /product="Chaperone DnaK"
                     /protein_id="ABE37629.1"
                     /db_xref="InterPro:IPR001023"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /translation="MGKVIGIDLGTTNSCVAVMDGKNSKVIENAEGMRTTPSIVAISD
                     DGERLVGQPAKRQAVTNPERTFFAVKRLVGRRYDDPMVEKDKKLVPYKIVKASNGDAW
                     VEADGQTYSPSQVSAFILQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQATKDAGKI
                     AGLEVLRIINEPTAAALAYGLDKTKTGTIAVYDLGGGTFDVSILEIGDGVFEVKSTNG
                     DTFLGGEDFDMRLVNYLADEFQKEQGINLRNDKLALQRLKEAAEKAKIELSSTTQTEI
                     NLPFITADQSGPKHLTMKLTRAKFEALVDDLVQKTIEPCRKALKDAGLTAGEIGEVVL
                     VGGMTRMPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPL
                     SLGIETLGGVFTRIIERNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKILG
                     QFDLMGIPPSPRGMPQIEVTFDIDANGIVNVSAKDKATSKEQQIRIQASGGLSDADID
                     KMVKDAEANASEDKRRREAVDAKNHADALVHSTEKALAEHGSKVEDSERRAIEDALSD
                     LRESLKSDDAEAIKTKTNTLAQASMKLGEAMYKQQAESDAAKHAAKDDIVDADFTEVD
                     DDKNNKKSA"
     gene            459160..460104
                     /locus_tag="RPD_0392"
     CDS             459160..460104
                     /locus_tag="RPD_0392"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37630.1"
                     /translation="MRQIARLFAIALVFAAATPAVAADTVYPRGIRVGVTPMPGLTES
                     QAFLGFESAGHGVKVLLAELPGPAFGEVEAAFKAVPEGAMGKVKPESIETAAGKAYYT
                     AEDAVVGTDKVRRYSLIVPGSKMFSGYIAVQVADSEAQTYSDEAVKKMLTSVSVRQQV
                     PIEEQIAQMPFSIRETAGFKTVRTLAPGAALLFADGNEETGVEGAPFMVLGLIGSVPD
                     QTDARARFAQQAAATIPGLREARITTSEPMRIDGSAGFETRIEAVSGKDNTPVTVVQW
                     LRFGSASVAMRVIGSSPRDQWSEAFPRFRKVRDGLKGR"
     gene            complement(460221..460841)
                     /locus_tag="RPD_0393"
     CDS             complement(460221..460841)
                     /locus_tag="RPD_0393"
                     /codon_start=1
                     /transl_table=11
                     /product="GrpE protein"
                     /protein_id="ABE37631.1"
                     /db_xref="InterPro:IPR000740"
                     /translation="MTDSNGQKDNNQDQAQPADPVVSKPYIMPDDPEEGTNEALVREA
                     AEARDKMLRTLAEMENLRRRTAKEVADARTYGVSAFARDVLEIADNLQRALDAVPAEA
                     RANADAGLKGLIEGVELTERSLINALEKNGVKKFDPQGEKFDPNFQQAMYEVPDPSVP
                     AGTVVQVVQAGFMIGERVLRPALVGVSKGGAKPAPAAANGNEGGVA"
     gene            complement(460941..462029)
                     /locus_tag="RPD_0394"
     CDS             complement(460941..462029)
                     /locus_tag="RPD_0394"
                     /codon_start=1
                     /transl_table=11
                     /product="heat-inducible transcription repressor HrcA"
                     /protein_id="ABE37632.1"
                     /db_xref="InterPro:IPR002571"
                     /db_xref="InterPro:IPR006162"
                     /translation="MAHHDPIGLIAPNTGLAQLNERSRDIFRQIVESYLATGEPVGSR
                     NISRLISMPLSPASVRNVMADLEHLGLIYAPHTSAGRLPTELGLRFFVDALMQVGDLT
                     EPERQSIQAQLSSVGQAQTVEAALGEALTRLSGLTRAAAVVLTAKSNVRLKHLEFVRL
                     EPERALVILVAEDGQVENRVLALPPGVPSSALVEASNFLNARIRNRTLAEARLELETL
                     LSQDRTELDQLTQKVISAGIASWSGGDGEDRQLIVRGHANLLEDLHALEDLERVRLLF
                     DELETKRGVVDLLGRAERAEGVRIFIGSENKLFSLSGSSTIIAPYSDGAGHIVGVLGV
                     IGPTRLNYARVIPMVDYTARIVSQMLGG"
     gene            462181..462894
                     /locus_tag="RPD_0395"
     CDS             462181..462894
                     /locus_tag="RPD_0395"
                     /EC_number="2.7.7.56"
                     /codon_start=1
                     /transl_table=11
                     /product="RNAse PH"
                     /protein_id="ABE37633.1"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR002381"
                     /translation="MRPSRRAPDELRAVSLERGVVKYAEGSCLVKFGDTHVLVTATLE
                     ERLPPWLKGQGRGWVTAEYGMLPRATLERTRREAAAGKQNGRTVEIQRLIGRSLRAIV
                     DLQALGERQITVDCDVLQADGGTRTASITGAWVALADCLGWMKTRNMIKGTVLRDNVA
                     AISCGIYNGTPVLDLDYAEDSEAETDANFVMTGDGRIIEVQGTAEKTPFSQDEFLALM
                     ALAQKGVTRLVDLQKMAVA"
     gene            462947..463579
                     /locus_tag="RPD_0396"
     CDS             462947..463579
                     /locus_tag="RPD_0396"
                     /codon_start=1
                     /transl_table=11
                     /product="Ham1-like protein"
                     /protein_id="ABE37634.1"
                     /db_xref="InterPro:IPR002637"
                     /translation="MHRRISGKLVIATHNPGKLAEMRELLAPYGIEAVSAGELGLGEP
                     DETGDSFRANARIKAEAAAQAAKLPAFADDSGLSVDALDGAPGIFSARWAGEGKDFNA
                     AMAQIERLLRERGATAPAQRGAHFVSALCVAWPDGHIEEVEARADGTLVWPPRGDAGF
                     GYDPMFLPDGHDRTFGEMSSIEKHGLPPLGLGLSHRARAFVKLAEICLGR"
     gene            463569..464726
                     /locus_tag="RPD_0397"
     CDS             463569..464726
                     /locus_tag="RPD_0397"
                     /EC_number="1.3.99.22"
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase, anaerobic"
                     /protein_id="ABE37635.1"
                     /db_xref="InterPro:IPR004559"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010723"
                     /translation="MGADPDKAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEARFARA
                     FAREIAATAARIGPRDVSSIFLGGGTPSLMQPSTVGAILDAIGKHWRVTPDAEVSLEA
                     NPTSVEATRFRGYRAAGVNRVSLGVQALDDASLKTLGRLHTAQEAMDAVAIARSAFDR
                     YSFDLIYARPGQTPAMWEAELRRAIGEAAEHLSLYQLTIEAETPFFALHRAGKLQTPD
                     ESASRALYDVTQSVCAELGLPAYEISNHARPGAECKHNLVYWRGQEYAGIGPGAHGRL
                     DIGGTRYAIATEKRPESWMMRVEATGTGVITDDRLNSEERADEFLLMGLRLAEGIDPR
                     RYQALAGRSLDPSRIALLCAEGAIVVDADGRLRVTQAGFPVLDAVVADLAA"
     gene            complement(464836..466035)
                     /locus_tag="RPD_0398"
     CDS             complement(464836..466035)
                     /locus_tag="RPD_0398"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37636.1"
                     /translation="MAGLREPNTKSLRTTRRTAIGLILGTPLLGACSGVQQTLNNQFG
                     QQPPPDAAQQQSQSVGTGRVKVGLVLPLSAAGNAGVAAQSMKNAAEMALAEFNNPDVQ
                     LLVKDDAGNPQGAQSATQQALDEGAEIILGPLFAQSVPAAAQLTRARGISMIAFSTDS
                     SVAGRGVYLLSFLPESDVNRIIGYAASVGKRSYAALLPDNAYGGVVEAAFKQVVGTKG
                     GRIAAFEKYGADRAAAARTIAQALAGADSLLLADDGDALAGVSDALTAAGVDLRRLQL
                     LGTGLWDNPRVFATPALQGGLYAAPDPSGFRSFSGRYRARFGQDPVRTATLAYDAVAL
                     VAALARTQATRRFSSDVLTNPSGFAGIDGLFRFRADGSNERGLAVMRVATGGAQAVAG
                     SPKSFGA"
     gene            466232..467185
                     /locus_tag="RPD_0399"
     CDS             466232..467185
                     /locus_tag="RPD_0399"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function UPF0011"
                     /protein_id="ABE37637.1"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR008189"
                     /translation="MRAKAAPTIPSTTESEPESRAFLVAGQKLIAPRAAPGLHLVATP
                     IGNLGDITLRALETLAGVDVIACEDTRITHRLTERYGISAQLKPYHEHNAAQARPKIL
                     KKLAQGGSVALVSDAGTPLISDPGYKLVREAYDAGHDVVALPGASAVLAALALAALPT
                     DRFFFDGFLPAKQGARRSRLSELAAIDATLVLFEAGSRIHNSLRDLAEVLGGREAAIC
                     RELTKLHQEVRRAPLTTLAETAETLETRGEFVVVIGPPDPGARMMTQDALDTWLRDAL
                     QRDSVKDAVAQAVDISGRPRREIYARALELARQREADDGQD"
     gene            467172..467567
                     /locus_tag="RPD_0400"
     CDS             467172..467567
                     /locus_tag="RPD_0400"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function UPF0102"
                     /protein_id="ABE37638.1"
                     /db_xref="InterPro:IPR003509"
                     /translation="MAKTRSPSTPPAPERVAAFQTGISAETRAAAFLMAKGYRILARR
                     FKTPYGEIDIVAQRRKLIAFVEVKARARLDDAAYALTPRQQQRIIAAAEAWLVANPDH
                     ATYELRFDAMLVAPKRLPQHLPAAFDASP"
     gene            467651..468592
                     /locus_tag="RPD_0401"
     CDS             467651..468592
                     /locus_tag="RPD_0401"
                     /EC_number="6.3.2.3"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione synthase"
                     /protein_id="ABE37639.1"
                     /db_xref="InterPro:IPR004215"
                     /db_xref="InterPro:IPR004218"
                     /db_xref="InterPro:IPR006284"
                     /db_xref="InterPro:IPR011761"
                     /translation="MTLKVAVQMDPIARINIRGDSTFAMLLEAQKRGHAISYYTPDKL
                     SLRGTDVVASVQRLSVRDQEGDHFTLGEPTRVDMRSFDVVLLRQDPPFDLAYITSTHL
                     LERIHPHTLVVNDPISVRNAPEKLFVMDFAELMPPTLISRDLNEINSFRAEHGAVVMK
                     PLHGHGGAAVFRVLPQDINFGSLYDMFAVTFREPWVIQRFLPEVKHGDKRIILVDGEF
                     AGAVNRVPAADDLRSNMVRGGAAAATDLSERERTICATLAPKLRERGLLLVGIDVIDG
                     YLTEINVTSPTGIRAVARLGGPDIAARVWDVIEQKRS"
     gene            468696..469424
                     /locus_tag="RPD_0402"
     CDS             468696..469424
                     /locus_tag="RPD_0402"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LuxR family"
                     /protein_id="ABE37640.1"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR005143"
                     /translation="MSADEGNQWGRRALEFVDAADRLDGPSLIRQFETHIASGGFSAY
                     IMAGLPSPGAGLADLTLANGWPRGWFELYVRENYIAVDPVPRHGATTVQPFEWSEAPY
                     DRKQNRAAHKVMTHATEFGLVRGYCIPLHYDEGGAVISMAGDQPDLDPVAKGAMQLIG
                     VYAHNRIRSLHRPKPQRRLLTSRECEILLWAAHGKTAWEISIILHIAERTVKFHLIEA
                     SKKLNAVNRTAAVAKALAFGLIKL"
     gene            469502..470158
                     /locus_tag="RPD_0403"
     CDS             469502..470158
                     /locus_tag="RPD_0403"
                     /codon_start=1
                     /transl_table=11
                     /product="autoinducer (acylhomoserine lactone) synthase"
                     /protein_id="ABE37641.1"
                     /db_xref="InterPro:IPR001690"
                     /translation="MEVHVVRRENREAYADLIERQFRIRHQIYVVERKWTELDRADGR
                     EIDQFDTDETVYLIGMQNGEIVAGMRMVPTSSPTLLSDIFPQLSLDRPVRRPDVYELS
                     RIYVVPNKRGEHAGPRAEAVIQAAAMEYGLSIGLSAFTIVLETWWLPRLLDQGWRARP
                     LGLPQDIDGMSTTAVLVDVDDDAWLEICARRSVPGPALHWLGLESVNRNPLPNPMELA
                     "
     gene            470155..470379
                     /locus_tag="RPD_0404"
     CDS             470155..470379
                     /locus_tag="RPD_0404"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37642.1"
                     /translation="MTTQENTSLGQTVPPGTSGRAKSVSIETLATTINRAIEQAEELG
                     IPSAAQLLMMARLEVDLTEIALETKLKKSA"
     gene            470489..472027
                     /locus_tag="RPD_0405"
     CDS             470489..472027
                     /locus_tag="RPD_0405"
                     /codon_start=1
                     /transl_table=11
                     /product="Mg chelatase-related protein"
                     /protein_id="ABE37643.1"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR000523"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004482"
                     /translation="MVQHVSTVAFEGIEARAVDVQVQVSPGLPAFAVVGLADKAVSEA
                     RERVRSALIASGLALPARRITVNLAPADLPKEGSHYDLPIALGLMAAIGAIPADALAG
                     FTVLGELGLDGSIAPVAGVLPAAIAANARDEGLICPAACGSEAAWASPDIQIIAARSL
                     IQIANHFKGTQLLSRPQPRVHETESSTLDLRDIKGQESAKRALEIAAAGGHHLLMVGS
                     PGAGKSMLAARLPSILPPLSPGELLEVSMIASVAGEIRDGALTARRPFRAPHHSASMA
                     ALTGGGVKARPGEISLAHQGVLFLDELPEFDPRVLDSLRQPLEIGEVAVSRANHRVTY
                     PARVMLVAAMNPCRCGRAYEPGYACKRGQVDRCSADYQSRISGPLMDRIDLRIEVPAV
                     TAADLILPPAAEGSAEVAARVAAARDLQRERYAAIGLPQIRTNAEAPASTLEATAQPD
                     SAGLKLLRDAAETMRLSARGYHRVLRVARTLADLDGAEIIGRLHLAEALSYRALGEDI
                     KRAA"
     gene            472132..472617
                     /locus_tag="RPD_0406"
     CDS             472132..472617
                     /locus_tag="RPD_0406"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37644.1"
                     /translation="MLRFRVLASTLPLLAMGLFARSELIAGPQPCIAVGDHAVQIAPA
                     SWLAHLRVGFTEDPARATIRVQIVDSPDAADFAVTDDAGNTDSGACALTPETRLVGIA
                     AHPASDEPLIYLTYDAGGGADYRIFVSSNSFTLRQAAALLVGASDRNAPIATASIGSR
                     S"
     gene            472732..474684
                     /locus_tag="RPD_0407"
     CDS             472732..474684
                     /locus_tag="RPD_0407"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="multi-sensor hybrid histidine kinase"
                     /protein_id="ABE37645.1"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /translation="MMRSLRIKSRRRVFARRFPRLVFMLRSLVVFTAAFCGAYGFIVG
                     SRAESSGYNPHTFAIGASFLFALACLGLAVQSMRLRWMRRSLHAVALHNEALADRNWE
                     LKDAEERARTLLESRGELLTLRDDADATTRAKSRLLAMASHEIRTPLNGIIGMSGLLL
                     DTTLTPEQATYVRAVKTSGDALLSLIDELLDYSKIDAGKIELDHRPFALAALIEDIAE
                     LLAPRAQARAIEIAAYVDERLPAQVIGDAARLRQVLLNLAGNAIKFTSSGGVALIAEP
                     GERDGEIDLLIRDTGIGIAPEAQARVFREFEQADDGIARNYGGTGLGLSISERIVSGM
                     GGRIVLHSRPGIGTTFTVSIPLAAADDPAAAMAFKAPDLAGQTILIAAPQTIEAQLVA
                     HRLQRWNAETRVVSDLAAARVLLPDHAWSAILIDAGFGVTEAAALALDAKLHATQRIV
                     MLNPSIRAELLPKLPAAFTGYLVKPLRAASLAARLGGALIDTAAPGIADSDTPGLAAP
                     DQTAQVGRRLSILVAEDNDINALLIRSLLTKLGHDAVIADDGEQALQSWRAASADGAP
                     FDLVLMDVQMPLLDGIAASRQIRTYEAERQSRRTPILALTANSLAEDRAACLAAGMDG
                     FLVKPLDRDRLVGVLADITSSRPVIA"
     gene            474891..475904
                     /locus_tag="RPD_0408"
     CDS             474891..475904
                     /locus_tag="RPD_0408"
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine-acyl[acyl carrier protein]
                     N-acyltransferase"
                     /protein_id="ABE37646.1"
                     /translation="MRTGRASADSVACGREDPMQTDHLARPKKFIKLLRPEMAGAAAQ
                     TAITWFKPALRNGDHGKPIAKPALTPATLGRLGALEVRLAQKKQDIKRAQKLRYRVFY
                     QNGTAIADAATLLARRDKDAFDRICDHLLVVDHAAKPSLSGKQPVVGTYRLLRQEIAD
                     RHGGFYTDSEFNIGGMIARHPELRFLELGRSCVLPPYRNKRTVELLWHGIWSYVRQHR
                     VDVMIGCASFDGTDPDRLALPLSFLHHYASAPEAWHARAHRSRYVEMNRMPKEAVNQK
                     AALRELPPLIKGYLRLGATIGEGAVIDHQFGTTDVLIIMPVSAISARYIEHFGADATR
                     HAA"
     gene            complement(476038..476994)
                     /locus_tag="RPD_0409"
     CDS             complement(476038..476994)
                     /locus_tag="RPD_0409"
                     /EC_number="2.7.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="ABE37647.1"
                     /db_xref="InterPro:IPR004566"
                     /db_xref="InterPro:IPR006083"
                     /translation="MDARSELHHYNPYRVFSRSEWANLRQDTPMTLDLAEVSTLRSLH
                     DRLDITEVEEIYLPMSRLLSIHVGAMQQLYYAQRRFLGVVERKMPYIIGVAGSVAVGK
                     STTARVLQALLARWSPRPKVDLITTDGFLHPNALLERAGLMQKKGFPESYDLPALLAF
                     LSDIKSGRRKVRAPIYSHLTYDIVPNKFAVVDRPDILIVEGVNVLQTGRLPRDGKAVP
                     VVSDFFDFSVYIDADEPVLRDWYIRRFLALRDTAFHDPRSYFHRYAPLSDEEATATAI
                     AIWERTNLANLEDNILPTRPRATLILKKGADHVVDSVALRRL"
     gene            complement(477185..477508)
                     /locus_tag="RPD_0410"
     CDS             complement(477185..477508)
                     /locus_tag="RPD_0410"
                     /EC_number="3.6.1.31"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-ATP pyrophosphatase"
                     /protein_id="ABE37648.1"
                     /db_xref="InterPro:IPR001604"
                     /db_xref="InterPro:IPR008179"
                     /translation="MARFTLHDLAATIDARAASGGEASYTKKLLDKGAEHCAKKFGEE
                     AVELVIATVENDRGHLIAEAADVLFHMLVLLKARGVKLDEVEAALAQRTSMSGLEEKA
                     SRKRD"
     gene            complement(477564..478331)
                     /locus_tag="RPD_0411"
     CDS             complement(477564..478331)
                     /locus_tag="RPD_0411"
                     /EC_number="4.1.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase subunit
                     hisF"
                     /protein_id="ABE37649.1"
                     /db_xref="InterPro:IPR003009"
                     /db_xref="InterPro:IPR004651"
                     /db_xref="InterPro:IPR006062"
                     /translation="MFKVRVIPCLDVKDGRVVKGVNFVDLRDAGDPVEAAIAYDAAGA
                     DELCFLDITATHENRGIMLDVVRRTAEACFMPVTVGGGVRTVDDIKTLLRSGADKVSI
                     NSAAVARREFVKEAAEKFGDQCIVVAIDAKRVPGRDRWEIFTHGGRKGTGIDAIEFAQ
                     EVVSLGAGEILLTSMDRDGTRSGFDIPLTRAIADSVQVPVIASGGVGDLDHLVDGIRE
                     GHATAVLAASIFHFGEYTIREAKDHMVRAGLPMRLDP"
     gene            complement(478339..479076)
                     /locus_tag="RPD_0412"
     CDS             complement(478339..479076)
                     /locus_tag="RPD_0412"
                     /EC_number="5.3.1.16"
                     /codon_start=1
                     /transl_table=11
                     /product="1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]
                     imidazole-4-carboxamide isomerase"
                     /protein_id="ABE37650.1"
                     /db_xref="InterPro:IPR003009"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR006063"
                     /translation="MILFPAIDLKNGQCVRLEQGDMARATVFNLDPAAQARSFAAQGF
                     QYLHVVDLDGAFAGKPVNAQAVESMLKVVSMPVQLGGGIRDLKTVEGWLAKGISRVII
                     GTAAVRDPALVKQAAKKFPGRVAVGLDARDGKVAVEGWAESSQVTALEIAQRFEDAGV
                     AAIIFTDIARDGLLKGINWEATIALAEAVSIPVIASGGLASIDDVKALLSPRANKLEG
                     AIAGRALYDGRLDPAEALALIDAARAA"
     gene            complement(479255..479905)
                     /locus_tag="RPD_0413"
     CDS             complement(479255..479905)
                     /locus_tag="RPD_0413"
                     /EC_number="2.4.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase subunit
                     hisH"
                     /protein_id="ABE37651.1"
                     /db_xref="InterPro:IPR000991"
                     /db_xref="InterPro:IPR010139"
                     /db_xref="InterPro:IPR011702"
                     /db_xref="InterPro:IPR012998"
                     /translation="MSVAIIDYGSGNLHSAAKAFERAARSMEVPEKIIVTRDPEQVFR
                     SDRVVLPGVGAFADCRKGLDAVDGMVEALTETVRVKARPFFGICVGMQLMATRGKEHV
                     TTDGLNWIPGDVVKITPNQEELKIPHMGWNTLDVLREHPVLERLPLGPNGLHAYFVHS
                     FHLAAQSEGDVLARADYGGPVTAVVGRDTAIGTQFHPEKSQRFGLALISNFLKWKP"
     gene            complement(479902..480420)
                     /locus_tag="RPD_0414"
     CDS             complement(479902..480420)
                     /locus_tag="RPD_0414"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37652.1"
                     /translation="MPVFTVHAPPPVDDERRASPDRFVFVRDGFYGWAFVFGPLWLLT
                     RRLWLALFGYLVVAVAVTFALTALRVGAGPRFAVMLLMALLLGLEAASLWRWTLSRRG
                     WRQLDVVVGDDLPGAERRFFDRWSSRQSNPVSFSLPMDRGAPPPTRSVPMPSSSIYGD
                     IVGSFPRPGSSR"
     gene            complement(480449..481042)
                     /locus_tag="RPD_0415"
     CDS             complement(480449..481042)
                     /locus_tag="RPD_0415"
                     /EC_number="4.2.1.19"
                     /codon_start=1
                     /transl_table=11
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="ABE37653.1"
                     /db_xref="InterPro:IPR000807"
                     /translation="MRTATIKRKTKETDIEVTVNLDGAGVSNAATGIGFFDHMLDLLA
                     KHSRIDITVKAVGDLHVDFHHTTEDVGIALGQAVKQALGNMAGINRYASMLMPMDETL
                     TRVVIDVSGRPFLVFKADFPRDKIGEFDTELVREWFQAFAMNAGVTLHVETLYGENSH
                     HIAESCFKGLARALRAAVAIDPQAAGEVPSTKGQLGG"
     gene            481225..481806
                     /locus_tag="RPD_0416"
     CDS             481225..481806
                     /locus_tag="RPD_0416"
                     /codon_start=1
                     /transl_table=11
                     /product="HslV component of HslUV peptidase. Threonine
                     peptidase. MEROPS family T01B"
                     /protein_id="ABE37654.1"
                     /db_xref="InterPro:IPR001353"
                     /translation="MNMYSASGEGSPQGSAQVWHGTTILTVRKGGKVVIGGDGQVSIG
                     QTVIKANAKKVRKLGKGDVIGGFAGATADAFTLFERLEAKLEQYPGQLTRAAVELAKD
                     WRTDRYLRRLEAMMIVADKDVSLVLTGTGDVLEPEYGVMAIGSGGNYALAAARALADT
                     DQDAETIVRKALDIAADICVYTNRNLTLETLSA"
     gene            481803..482288
                     /locus_tag="RPD_0417"
     CDS             481803..482288
                     /locus_tag="RPD_0417"
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5-related N-acetyltransferase"
                     /protein_id="ABE37655.1"
                     /db_xref="InterPro:IPR000182"
                     /translation="MTGIYQFRPFTADDLPLMASWLKRPHMAEWWGDPEEQLAGLRED
                     LDQPAMDQYLVITGGTPFAYMQCYRLTAWNDGFGPQPDGTRGIDQSIGDPEMINRGHG
                     SAFIRQFTDALLAAGTPRIVTDPSPGNGRAIRCYEKAGFRRDRVVDTPDGPALLMVQE
                     T"
     gene            482285..483586
                     /locus_tag="RPD_0418"
     CDS             482285..483586
                     /locus_tag="RPD_0418"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein HslVU, ATPase subunit HslU"
                     /protein_id="ABE37656.1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004491"
                     /db_xref="InterPro:IPR013093"
                     /translation="MTDFSPREIVSELDRFIVGQADAKRAVAIALRNRWRRLQLEGIL
                     REEVLPKNILMIGPTGVGKTEIARRLAKLAGAPFLKVEATKFTEVGYVGRDVEQIIRD
                     LVEVAIAQVRERKRKDVQARAQIAAEERVLDALVGPGSSPATRDSFRRKLRAGDLNDK
                     EIEVETQASSGSPMFEIPGMPGGQIGAISIGDIFGKMGGRTKTRRLTVADSHDILINE
                     EADKLLDNDQLVQEAINVVENNGIVFLDEIDKICVRDGRSGGEVSREGVQRDLLPLIE
                     GTTVATKHGAVKTEHILFIASGAFHIAKPSDLLPELQGRLPIRVELNALTRDDMRRIL
                     TEPEASLIKQYIALLQTEGVTLEFSDDAIDALADVAVGVNSTVENIGARRLQTVMERV
                     LDEISFVAPDRGGETIRIDADYVQKNVGDLAKNTDLSRFIL"
     gene            complement(483691..484287)
                     /locus_tag="RPD_0419"
     CDS             complement(483691..484287)
                     /locus_tag="RPD_0419"
                     /codon_start=1
                     /transl_table=11
                     /product="Smr protein/MutS2"
                     /protein_id="ABE37657.1"
                     /db_xref="InterPro:IPR002625"
                     /translation="MKRFVPSLDPPATPRRKRSLSEEERALWDSVAKQVKPLRGRPRL
                     TRIDVATAPPATPAEKPQTPPSSQQPVKRPVKLATPMSPPPLASLGRRERSHLSRGRK
                     DIDARIDLHGMTQSRAHHALLRFLQRASHDGLSFVLVITGKGSRLGGDPERGVLRRQV
                     PLWLSLPEFRAYVVGFDEAHIGHGGEGALYVRVRRARG"
     gene            complement(484290..485768)
                     /locus_tag="RPD_0420"
     CDS             complement(484290..485768)
                     /locus_tag="RPD_0420"
                     /codon_start=1
                     /transl_table=11
                     /product="MltA"
                     /protein_id="ABE37658.1"
                     /db_xref="InterPro:IPR005300"
                     /db_xref="InterPro:IPR010611"
                     /translation="MLAPAAVEAGHRHHHSKSHHAAAHKRHLQPVWPLEIPGSQYAPI
                     SWDQVAGWDTDDHLAAFKTFQASCRPIVARRNAVAETKPLGASLGEPCQAARVADVSD
                     NAKARAFFETHFLPLQISRVGEEAGFVTGYYEPVVEGSRVQTDVYNVPVYRRPSNLFV
                     RGTKQDAALPNGGPVYRKIGRRKLVPYYDRAGIEDGAVAGRGLEICWLKSQTDLLFSQ
                     IQGSARVKLEDGSVVRINYDAHNGYPYTPVGRILIDRAIIPKEQMSMQRIREWMDANP
                     DGAKELRRANRSYVFFREVKLKDDEEAIGAQGVPLTPGRSIAVDKALHVYGTPFFITG
                     ELPIEAPESKTPFRRLMVAQDTGSAIIGPARADLYFGAGAEAGAIAGRMRHPIRFVML
                     LPNSLDPVARGRTMPLPDPRPSKKIAKQFPQTPAAKDQPASPDNAKPPEPTAAANGKP
                     PSATSAPEVVPTPQARPNAAPAAAPKRAHRRHHRHHDHRRAR"
     gene            complement(485824..486531)
                     /locus_tag="RPD_0421"
     CDS             complement(485824..486531)
                     /locus_tag="RPD_0421"
                     /codon_start=1
                     /transl_table=11
                     /product="import inner membrane translocase, subunit
                     Tim44"
                     /protein_id="ABE37659.1"
                     /db_xref="InterPro:IPR007379"
                     /translation="MDIYTIIFLALAVFIFLRLRNVLGQRTGSERPPFDRAAARDMIP
                     GKQDNNVVPMPGTVIDQSPTAPNADVVPPSDRWKGIAEPDSPLAHGLNAVLVQDSSFD
                     ANHFLTGAKSAYEMIVMAFANGDRRALRDLLSTEVYDSFDAAIKDREKNERKTETRFV
                     AIDKAELLGAEVREHTAQLTVKFVSQMISVTRDKAGAIVDGNPDKVADITDVWTFARD
                     ISSRDPNWKLVGTGSGH"
     gene            486979..487455
                     /locus_tag="RPD_0422"
     CDS             486979..487455
                     /locus_tag="RPD_0422"
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase subunit secB"
                     /protein_id="ABE37660.1"
                     /db_xref="InterPro:IPR003708"
                     /translation="MTNGNGAPPEAVAAPQLNVLAQYTKDLSFENPNAPASLAQQQQQ
                     PAINIQINVGANNLAENEYEVTLSVEGKAESGSTVLFSFELAYAGVFRIVNVPQENLH
                     PLIMIECPRLLFPFAREIIASAVRDGGFPPLMLDPVDFVGLYRQNMERQAQQGQPS"
     gene            complement(487508..488203)
                     /locus_tag="RPD_0423"
     CDS             complement(487508..488203)
                     /locus_tag="RPD_0423"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, epsilon subunit"
                     /protein_id="ABE37661.1"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR006054"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR006309"
                     /translation="MREIVLDTETTGLDPLRGDRLVEIGCVEIYNRMPTGQAFHRYIN
                     PERDMPAEAFAVHGLSAEFLADKPLFAQVVDEFLDFIGDAPLVIHNASFDAGFLNAEL
                     ARLSRAAIPRERLVDTLLLARRKHPGVSNRLDDLCSRYAIDNSRRTKHGALLDAELLA
                     EVYIDLIGARQSQLILAEVPSERAGQGGDKPRRQRSTPLAARVTELDLDAHRAFIATM
                     GDKAIWKEYPAGA"
     gene            complement(488243..488842)
                     /locus_tag="RPD_0424"
     CDS             complement(488243..488842)
                     /locus_tag="RPD_0424"
                     /EC_number="2.7.1.24"
                     /codon_start=1
                     /transl_table=11
                     /product="Dephospho-CoA kinase"
                     /protein_id="ABE37662.1"
                     /db_xref="InterPro:IPR001977"
                     /translation="MLVLGLTGSIGMGKSTTAKLFEEAGVPVYDADATVHKIYEDEAA
                     PAIEAAFPGTTANGKVDRTLLSAKVVHDTEAMKRLEQIVHPMLRSHHQNFLDDAEASG
                     APIAVVDVPLLFETGGEKRVDAVVVVTTSPEIQRERILARDNMTPEKLDAILARQMPD
                     AEKRKRADFIVDTSHGLDPVRAQLDEILAAAARMPRRRP"
     gene            complement(488969..489577)
                     /locus_tag="RPD_0425"
     CDS             complement(488969..489577)
                     /locus_tag="RPD_0425"
                     /codon_start=1
                     /transl_table=11
                     /product="Maf-like protein"
                     /protein_id="ABE37663.1"
                     /db_xref="InterPro:IPR003697"
                     /translation="MTLWLGPQPLVLASQSRARQALLTNAGIPFEAIPAKLDERGIAR
                     VSGLSAPGDIAALLAQEKAAFVSNHHPGRLVLGADQTLALGAREFNKPADRNEAAKQL
                     RELAGRRHELHSAIAVVRNGITLFAEVVIARMTMRPLSDEEIAVYLDEVGDTATCSVG
                     GYQVEGLGVHLFDGIHGDHSTILGLPLLPLLGFLRSQKLLTL"
     gene            complement(489574..490413)
                     /locus_tag="RPD_0426"
     CDS             complement(489574..490413)
                     /locus_tag="RPD_0426"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF299"
                     /protein_id="ABE37664.1"
                     /db_xref="InterPro:IPR005177"
                     /translation="MLTDGSYFHLHLVSDSTGETLITVSRAVAAQYANVSPVEHVYPL
                     VRSQKQLDRVLQEIEESPGIVLFTLLESELVNRLEAKCQQINSPSLSIIGPVMQLFEA
                     YLGASTTGRVGAQHTLNAEYFKRIDALNYSMMHDDGQHVEGLEEADVVLVGVSRTSKT
                     PTSIYLANRGIRTANVPLVAGIPIPHQLETLKKPLVVSLHASPDRLIQVRQNRLLSLG
                     AGAGNDSYIDRQAVTDEVLLARKLSAKYGWSLLDVTRRSIEETAAAIMKLLADRQRQR
                     MSE"
     gene            490867..491307
                     /locus_tag="RPD_0427"
     CDS             490867..491307
                     /locus_tag="RPD_0427"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein 701"
                     /protein_id="ABE37665.1"
                     /db_xref="InterPro:IPR005265"
                     /translation="MFDWSDFYLWVKAFHVIAVISWMAGMLYMPRLFVYHCAAEVGSV
                     QSETFKIMERRLYKAIMNPAMIAAWAAGLVIAWQQSFFASGWFHAKLAAVVLMTVIHL
                     LLGRYVRDFAADRNKRSHKFYRVINEIPTLLMVGAVIVVIVKPF"
     gene            491591..492856
                     /locus_tag="RPD_0428"
     CDS             491591..492856
                     /locus_tag="RPD_0428"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="ABE37666.1"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004665"
                     /db_xref="InterPro:IPR011112"
                     /db_xref="InterPro:IPR011113"
                     /db_xref="InterPro:IPR011129"
                     /db_xref="InterPro:IPR013223"
                     /translation="MREMKLQDLKAKTPAELVSFAEELGVENASTMRKQELMFACLKQ
                     LSAKETDIIGEGVVEVLSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEG
                     HIRSPKEGERYFALLKVNTLNFEDPEKSKHKVNFDNLTPLFPDERFRLEIDDPTRKDL
                     SARVIDIVAPIGKGQRALIVAPPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEE
                     VTDMQRSVKGEVVSSTFDEPAVRHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRA
                     YNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALVDTGSRMDEVI
                     FEEFKGTGNSELILDRKVSDKRTFPAIDISRSGTRKEELITDPQVLKKMYVLRRILNP
                     MGTMDAIDFLLDKLRNTKNNSEFFESMNT"
     gene            492960..494348
                     /locus_tag="RPD_0429"
     CDS             492960..494348
                     /locus_tag="RPD_0429"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA modification GTPase trmE"
                     /protein_id="ABE37667.1"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004520"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005289"
                     /translation="MRMHPSDQTIFALATGQLPSAIAMVRVSGPRAGDLLTALTGSLP
                     PPRTARRVLIRDQNQDLIDDGVALWFAGPASATGEDVAEFHIHGGRAVLAALVRALSA
                     FDGVRPAEPGEFTRRAFENGKLDLTEAEGLDDLIHADTEAQRRQAVRQLGGLLGDRAR
                     RWRAQIIEATALIEAGIDFADEGDVQGELMAPALQTIAALHDEIAEVLAAQGRSERLR
                     DGMVVAIAGPPNVGKSTLINRLARREVAIVSPHAGTTRDVIEVQLDLGGYPVTVIDTA
                     GIRESNDPVEQEGVRRARARAAEADLVLWLGEGEMTGDAVAASAPVWRVRNKIDLRGG
                     EGDGGPVGLPVEPLAAALRQTDGAWGGNAAFEISALRGQGLGELIAAIEDFAAQYFAS
                     GETALISRARHRTLLQDAAAMLQRSLQHDLPAELVAEELRLAGVALGRLLGRVDVEDV
                     LGEIFSRFCIGK"
     gene            494578..496458
                     /locus_tag="RPD_0430"
     CDS             494578..496458
                     /locus_tag="RPD_0430"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose inhibited division protein A"
                     /protein_id="ABE37668.1"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR002218"
                     /db_xref="InterPro:IPR004416"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR013027"
                     /translation="MRNSYDVIVIGGGHAGCEAAAAAARLGATTALVTHRFATIGAMS
                     CNPAIGGLGKGHLVREVDALDGLMGRVADAGGIQFRMLNRRKGPAVRGPRAQADRKLY
                     AAAMQAAIRATVHLSVIEGEADALLSADGRVTGIRLADGREFAAGAVVITTGTFLRGL
                     IHLGEQSWPAGRIDEAPALGLSRSFEALGFALGRLKTGTPPRLDGRTIDWGAVEMQPG
                     DDPPEPFSVLTPAITTPQIECGITRTTPATHAVIRDNVHRSPMYSGQIQSTGPRYCPS
                     IEDKIVRFGDRDGHQIFLEPEGLDDPTVYPNGISTSLPEEVQRAILKTIPGLERTELV
                     RPGYAIEYDHVDPRELEPTLQTKRLRGLFLAGQINGTTGYEEAAAQGLVAGLNAVLAA
                     GGGDPAVFDRADGYLGVMIDDLVTRGINEPYRMFTSRAEYRLTLRADNADQRLTDKGL
                     ALGCVGAERAAFHRTKMAALADAKALAQSLSITPNEASRHGLSLNRDGQRRSAFDLLS
                     YPEIGWDEVKAIWPELAAVSPAIAVHVEIDAKYHVYLARQTADVEAFRRDEGLLLTEI
                     DYAQVPGLSNEARNRLERHRPRTVGQAGRLDGITPAALGILAAYLRREARKRPATVSG
                     ER"
     gene            497049..497750
                     /locus_tag="RPD_0431"
     CDS             497049..497750
                     /locus_tag="RPD_0431"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase GidB"
                     /protein_id="ABE37669.1"
                     /db_xref="InterPro:IPR003682"
                     /translation="MASRQSPMAVSQPDHADRSAALQLTPVSRETERRLDAYLDLLRQ
                     WQAKTNLVAPSTLPQLWTRHVADSLQLLTLAPDARRWLDFGSGGGFPGIVLACAMAEH
                     DGGHVTLVERNAKKAAFLREALRVTGSPGTVMLADIGDNVDRFPQGLDCITARAVAPL
                     HQLIGFARPLMTEGSKALFLKGQDVEAELTEATRYWKIDPQLHASLTGGHGWIVEIDR
                     IERQALPTASKEAAQ"
     gene            497747..498601
                     /locus_tag="RPD_0432"
     CDS             497747..498601
                     /locus_tag="RPD_0432"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome segregation ATPase"
                     /protein_id="ABE37670.1"
                     /db_xref="InterPro:IPR002586"
                     /translation="MTVIDQIYQGDKASTEPGRPRIIALANQKGGVGKTTTAINLGTA
                     LAAIGERVLIVDLDPQGNASTGLGIDRRDRNCSTYDVLAGEAPLRDAVVATAVPRLHI
                     AASTMDLSGLELELGHSRDRAFRLRDAIAVLNKDVDPPLDYTYVLIDCPPSLNLLTVN
                     AMAASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLNPELTIHGIVLTMFDSRNNLSS
                     QVVADVRQFMGKKVYDTMIPRNVRISEAPSYGKPVLVYDLKCVGSEAYLKLATEVIQR
                     ERELRTMH"
     gene            498870..499760
                     /locus_tag="RPD_0433"
     CDS             498870..499760
                     /locus_tag="RPD_0433"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome segregation DNA-binding protein"
                     /protein_id="ABE37671.1"
                     /db_xref="InterPro:IPR003115"
                     /db_xref="InterPro:IPR004437"
                     /translation="MADEHRSRLGRGLASLIGDVGGEAAHVERPRAQRKVPIEFIKAN
                     PRNPRRTFSDAELGELSDSIRQHGVIQPIVVRPVKGAQDRFEIIAGERRWRAAQRAGL
                     HEVPIVPVDVSDADALEIAIVENVQREDLNPLEEAQGYHALANEFKRSQDDIAKIVGK
                     SRSHVANMMRLTRLPDDVLALIAAGQLSAGHARALIGVPDPSAAAKRIVAEGLNVRQT
                     EALAHEEGVPERKPQKPRASAAAKPAKDADTLALEKRVSDALGMKVTIEDRDGTGSLQ
                     IRYADLDQLDDIIRRLEAGG"
     gene            complement(500113..501141)
                     /locus_tag="RPD_0434"
     CDS             complement(500113..501141)
                     /locus_tag="RPD_0434"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, delta subunit"
                     /protein_id="ABE37672.1"
                     /db_xref="InterPro:IPR005790"
                     /db_xref="InterPro:IPR010372"
                     /translation="MVALRGKDVTSFLARPDAARPIILLYGPDSGLVRERADALIASA
                     LDDPNDPFALVRLDGDELASEPSRLVDEAMSIPMFGGRRAIRVRAGSRSFVAGVETLA
                     ASPPRECRVVIEAGDIKPDNALRKACEKAPSAVAIGCYPDAEADLARLIDDELRHSNL
                     QIGRDARAVLMTLLGGDRQASRNEVRKLALYAHGQSEITLDDVMACVSDASDLKLDVI
                     VDAAFSGKPAVVESEFAKAMVAGTYPGQIILAAQRHAAFLHKTSLAVEAGAAAATALD
                     SGFPRLHFSRKAASETALRNLGAPRLAQIIDQLATAALETRRQATLGAAIAQRTLLSI
                     AVSARRRN"
     gene            complement(501189..501749)
                     /locus_tag="RPD_0435"
     CDS             complement(501189..501749)
                     /locus_tag="RPD_0435"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37673.1"
                     /translation="MSSVRPAVARVFARLALAAMLAAPVAGCFQPMYADRGDGSPTLR
                     DKLAAVTVPPLDVPNGSRNARIGVEIRNALMFKMYGSATGAPPLYSLALNINSSRSSL
                     IVDPNTTLPTIENYGIDANYRLTEIATGKVVMSGSTFSRVEYDIPGQTQRFARTRAGR
                     DAEDRAAQEIAENINTRLASFFYAGI"
     gene            complement(501736..504372)
                     /locus_tag="RPD_0436"
     CDS             complement(501736..504372)
                     /locus_tag="RPD_0436"
                     /EC_number="6.1.1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl-tRNA synthetase"
                     /protein_id="ABE37674.1"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002302"
                     /db_xref="InterPro:IPR013155"
                     /translation="MSNERYNARESEPKWQAKWDEAKIFATRNDDPRPKYYVLEMFPY
                     PSGRIHMGHVRNYTMGDVVARTMRARGHNVLHPMGWDAFGLPAENAAIERKVAPKAWT
                     YANIAAMKKQLQTMGLSLDWAREFATCDPTYYKHQQKMFLDFLKAGLAERETRKLNWD
                     PVDMTVLANEQVIDGRGWRSGAVVEQREMNQWVFKITRYAQELLDALETLDRWPDKVR
                     LMQRNWIGRSEGLLVRFALDSATTPAGETELKIFTTRPDTLFGAKFMAIAADHPLAQA
                     AAAKDPKIAAFVEDCKKRGTAQAEIDTAEKLGIDTGIRALHPFDPNWQIPVYVANFVL
                     MEYGTGAIFGCPAHDQRDLDFVNKYQLGNTPVVCPEGQDPSSFVITDEAYDGDGRLIN
                     SRFLDGMSIAEAKEDVAKRLETATLGNAPVGERKVNFRLRDWGISRQRYWGCPIPVIH
                     CEVCGVVPVPDKDLPVVLPEDVSFDKPGNALDHHPTWKHTACPQCGAKATRETDTMDT
                     FVDSSWYFARFTDPWNENAPTTPDVVNRMLPVDQYIGGVEHAILHLLYSRFFTRAMKA
                     TGHVGLDEPFRGMFTQGMVVHETYRKADGMFASPAEVAIVAEGDGRRATLLDDGTPIE
                     IGPIEKMSKSKRNTVDPDDIIGSYGADTARWFMLSDSPPDRDVIWSEEGVKGASRFVQ
                     RLWRMINDAAEIAKAAPAARPDAFGPEALAVRKAAHGALDKVLSGIERLAFNVSLAHI
                     REFSNSLGEALARPGAASPDVAPDLAWAIREGAVILVQLFHPMMPHLAEECWAALGQP
                     GLVSEALWPQIERDLLLEDSITLPVQVNGKKRGEVTVARDANNPEIEAAVLALDAVRQ
                     ALDGKPVRKVIVVPQRIVNVVG"
     gene            complement(504585..506261)
                     /locus_tag="RPD_0437"
     CDS             complement(504585..506261)
                     /locus_tag="RPD_0437"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ABE37675.1"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR003660"
                     /translation="MSRIAIIRKKSQLRGMLGIRARLVVLALILVCPLMLDRVRLLEN
                     TRTTQIAAVADSVATLAQRATDAQREVISSVEAVLKSAAYIHAAASQIGRSCSILRAS
                     LRVDLPSIRMLSVADSSGIIRCSTSSMFVGSDVSNRAYFRKAFETHDFVVSDFVIGQQ
                     SRQGTILAAYPVSAVDTGEEAVLIAGMNLDWLSDIMANLAGRPGINVALIDGEGTVLA
                     TPPDHRSLIGRKLDQSTLDFALGARPLEREQATTSIDSGQTLSVSRIPGTNARLVVTL
                     DENIVSAAISRDIRTAYLQLALVCLLVLLGALIAAERLIVRPISVLTSIANQFAQGDW
                     SARVTRARLPAEFLPLARAFNAMAAQLGQRERELVASNNSLTVMASMDLLSGLANRRG
                     FQSRLDFEWMRGLQNGHTVALLLLDVDYFKSFNDSYGHPEGDACLSRIGETLATVAND
                     TGGFAARYGGEEFCLLLPDTDADTAYQVGEMVRATVERLDVPHHTSLFQRVTVSIGVA
                     STSPTEDASPAELIEAADAALYAAKGRGRNTVVEHGFIRATDTISMAIAS"
     gene            506433..507098
                     /locus_tag="RPD_0438"
     CDS             506433..507098
                     /locus_tag="RPD_0438"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function UPF0001"
                     /protein_id="ABE37676.1"
                     /db_xref="InterPro:IPR001608"
                     /db_xref="InterPro:IPR011078"
                     /translation="MSGAEVHGLAAVEQEIAQACKEARRERGSVTLIAVSKTFDADSI
                     LPVLAAGQRVFGENRVQEAKAKWPALVAGHPGTELHLIGPLQSNKAKEAVALFDAIHS
                     VDRESLAEALSKALPLAGRAVELFVQINTGEEPQKAGVAPQDADAFLTACRERWGLTI
                     AGLMCIPPVDEAPAPHFALTAKIARRNGLSKLSMGMSADFATAIEFGATHVRVGSAIF
                     GHR"
     gene            complement(507145..507714)
                     /locus_tag="RPD_0439"
     CDS             complement(507145..507714)
                     /locus_tag="RPD_0439"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37677.1"
                     /translation="MKITFRSERYKNPTVDRPLSMLQVRAAAGQRSRGWLTAGGMTIP
                     VALGRGGILANKREGDGGTPRGTFRPRRLWWRADRWPKPRTFLPVRPITAEDAWCEDP
                     SSRHYNRPLRRGPGEAGDRLQRADHLYDFIIEIDHNTTPRIAGRGSAVFLHLARDNFG
                     PTAGCVAMTRGNLLRLLARIGPNTKIVIG"
     gene            507883..508569
                     /locus_tag="RPD_0440"
     CDS             507883..508569
                     /locus_tag="RPD_0440"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator, winged
                     helix family"
                     /protein_id="ABE37678.1"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /translation="MPNARKILIVDDDTDLREALVEQLSLHEEFEASAVDTGAKGVQS
                     AKANSPDLVLMDVGLPDTDGREVVRSLRKGGFKAPIIMLTGHDTDSDTILGLESGAND
                     YVAKPFRFAVLLARIRAQLRQHEASEDAVFTVGPYSFRPGSKMLTGANAKKVRLTEKE
                     TAILRFLYRASQSPVSRETLLQEVWGYNSGVTTHTLETHIYRLRQKIEKDAANPEILV
                     TEAGGYKLVP"
     gene            508696..509142
                     /locus_tag="RPD_0441"
     CDS             508696..509142
                     /locus_tag="RPD_0441"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic nucleotide-binding protein"
                     /protein_id="ABE37679.1"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR002373"
                     /translation="MSIEDDVALLERVPTLRLLGDTSLRMLAIGSDQREFARGDVLFS
                     AGDASDAGYVVQTGSFQVTSADGGPHEMIARPGDLIGELALVLPMPRPSSAVAMEYSS
                     VVRIARSLFQRVLESDPVAARNLRDEFAARTTMIAKDITRAGAKLT"
     gene            complement(509393..510451)
                     /locus_tag="RPD_0442"
     CDS             complement(509393..510451)
                     /locus_tag="RPD_0442"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease III"
                     /protein_id="ABE37680.1"
                     /db_xref="InterPro:IPR000097"
                     /db_xref="InterPro:IPR004808"
                     /db_xref="InterPro:IPR005135"
                     /translation="MMDARVKPAHDAVLDRTDGRVGRLYQDRHAGLDPAIHPLRKTPQ
                     QAPGWLYTSAACVRSRAAQQTARSSQRRRPARNSPRLPMRFTLTTWNINSVRLRIDLV
                     AAFLKEQQPDVLCLQETKCPDDAFPLKRFKQLGYEHIALNGQKGYHGVAVISKIPFVA
                     RDIRIFCDNLDSRHISVSLGTGDNDPPLVLHNFYVPAGGDVADPELNPKFKHKLSFLD
                     EMKACEPLHPSGDARHILVGDLNVAPHEHDVWSHKQLLKVVSHTPVECEKLLAVLRAG
                     NWVDVARDRIPLSEKIYTWWSYRAADWTVGDRGRRLDHIWVSEALRTRVTDFKILRDA
                     RSWERPSDHVPVTVTMEL"
     gene            complement(510508..511455)
                     /locus_tag="RPD_0443"
     CDS             complement(510508..511455)
                     /locus_tag="RPD_0443"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein carrier protein LolA"
                     /protein_id="ABE37681.1"
                     /db_xref="InterPro:IPR004564"
                     /translation="MEISERESRNRHSATVAAEGLGAGSAAPVQDITLTNDFNGLTPR
                     PAISTGLRRSLAAGVGLLMVTAAPLALAETVPVPRPSPKAVERQISTAEPSRPQRPPQ
                     PPAPVAKLATPPDPVIPDPRRNVPASIFTTFDAKQKADAARVSAYLSSLSTLVGNFVQ
                     VGPDGSKLKGDFYIMKPGKVRFEYDEPSPISMVANGQSLVVRDRKLATQDIYPLSQTP
                     LRYLLSDRIDLLRDTSVVAITSDELYISIIIEEKNAVIGTSRLMLMLGVKDGQLKQWT
                     VTDPQGYDTTVAIYNLDTARRPDPAMFKIDFTDYSTPPG"
     gene            complement(511473..513944)
                     /locus_tag="RPD_0444"
     CDS             complement(511473..513944)
                     /locus_tag="RPD_0444"
                     /codon_start=1
                     /transl_table=11
                     /product="cell divisionFtsK/SpoIIIE"
                     /protein_id="ABE37682.1"
                     /db_xref="InterPro:IPR002543"
                     /translation="MPAIERVIPLVGHLPASIRDALVRRLREFAGFGLIVIATVGAAA
                     LATWSVQDPSLSHATSRKIHNLIGYPGAIGADLSMQILGLGAVGLLLPVATWGWRMIN
                     HRPFDRRALRFAAWILCTIFAAGFASSFPHDSAWPLPTGLGGVVGDALVRAPSLVFGP
                     GLIFRVILSIVLGALMAVSFLIASGFGSREPDADDVIADDVPLDEDEDRDPGSVSLGW
                     LTHAALSAKARLWRLMKLGYRGLVSSAPAGPAAASFERQEPRLGGGRVAPPIVPRDHL
                     DDDDDTLDLEPADAIEDEEDEAPVARAPRKKAAPKPAAKKSGRFELPSVNVLTAPKAS
                     DRQPLNKAELEANSRALEGVLQDFGVRGEIVKAHPGPVVTLYELEPAPGIKSSRVIGL
                     SDDIARSMSALSARVAVVPGRNAIGIELPNAHREKVYLRELLSVKDGNETVHKLPLCL
                     GKNIGGDSIIIDLARTPHMLIAGTTGSGKSVAINTMILSLVYRLRPDQCRLIMVDPKM
                     LELSVYDGIPHLLTPVVTDPKKAVVALKWAVREMEERYKRMAKLGVRNIDGYNTRLSE
                     AKARGEDLTRTVHTGFDKESGKAIYEEEKLDLEPLPYIVIIVDEMADLMMVAGKDIEG
                     AVQRLAQMARAAGLHVILATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEMG
                     AEQLLGQGDMLYMAGGGRISRVHGPFVSDEEVEKVVKHLKTQGQPEYLEAVTAEEPAE
                     GEDGAVFDATGMGGDGAGDLFQQAVAIVKRDRKASTSYIQRRLQIGYNRAASLMERME
                     LEGIVGQPNHAGKREILVAEEDSNF"
     gene            complement(513953..515191)
                     /locus_tag="RPD_0445"
     CDS             complement(513953..515191)
                     /locus_tag="RPD_0445"
                     /EC_number="2.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="ABE37683.1"
                     /db_xref="InterPro:IPR001176"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /translation="MALPASSASARAAGSPSAAGHSERSPFARLTELLAPYQPGERLI
                     NLSLGEPQHPVPDFVGPVLAQHIADFGRYPMAKGIAPFRNAAASWLAQRFALPRAPDP
                     ETEVLVLNGSREGLFLAALAAARHVGPRDGTPAILMPNPFYPAYAAGARAAGCEAVFL
                     PTNLANGFLPDLESLDEATLKRTVAIYIASPANPQGSVASRDYFARLKALADRYGFLI
                     LADECYSEIYTRTAPGSALEAAGPDFRNVAVFQSLSKRSNLPGMRVGFVAGDADFLNA
                     FHELRNVAAPQVPVALQHVAVAAYGDEAHVEENRRLYRLKFDLADQILGERFGYQRPA
                     GGFCLWLDVSAHGGDEAATVKLFREGGVRVIPGSYLARPQPDGSNPGAGYIRLAMVQD
                     SESTAEALHRLVRILDESRG"
     gene            515319..515588
                     /locus_tag="RPD_0446"
     CDS             515319..515588
                     /locus_tag="RPD_0446"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AbrB family"
                     /protein_id="ABE37684.1"
                     /db_xref="InterPro:IPR006339"
                     /db_xref="InterPro:IPR007159"
                     /translation="MRAPQEQAEVDMASRITSDGRVRIPKDILETLDVGPGGEVDFKR
                     GADGAVVLEKVSQPSRRQIDWEKVIGSAGPGLSTDEVMKLLRGDD"
     gene            515593..516000
                     /locus_tag="RPD_0447"
     CDS             515593..516000
                     /locus_tag="RPD_0447"
                     /codon_start=1
                     /transl_table=11
                     /product="PilT protein-like"
                     /protein_id="ABE37685.1"
                     /db_xref="InterPro:IPR002716"
                     /translation="MTLVDTNVLIDLVTADPNWLGWSAARINEAIDRGPLLINDVIYA
                     EISTRFDQEEQLEVVLRTIGIVVAPIPRSALFLAGKAFVQYRRSGGVKTRVLSDFLIG
                     AHAATEHLSLLTRDARHYRTYFPNVDLITPDRG"
     gene            complement(516232..517674)
                     /locus_tag="RPD_0448"
     CDS             complement(516232..517674)
                     /locus_tag="RPD_0448"
                     /codon_start=1
                     /transl_table=11
                     /product="ammonium transporter"
                     /protein_id="ABE37686.1"
                     /db_xref="InterPro:IPR001905"
                     /db_xref="InterPro:IPR010256"
                     /translation="MTFKRPYGAGLAVLAAGLFAATAAYAEPTVNKGDNAWMMTSTIL
                     VLLMTIPGLALFYGGLVRSKNMLSVLAQVFYTVCVGSIIWAVYGYSLAFTGGSDFIGG
                     FSKAFLAGITPDSKAATFSVDANISELIYVCFQMTFCTLTPALIVGAFAERTRFAAVA
                     LFIPLWITLIYLPMAHMVWYWAGPDAISDAVKALAAATDEATKAAAQAKLDEVNADAG
                     FLFKKGALDFAGGTVVHINAGIAGLVGALLVGRRTGYGKELMAPHSLTMTMIGASLLW
                     VGWFGFNAGSALEASGGAGLAMANTFVATAAAALSWMFAEWIFKGHPSLLGALSGAVA
                     GLVAVTPAAGYSGPMGAIVLGLVAGVVCLFFCTVIKNALKYDDSLDVFGVHAVGGIVG
                     ALGTGIVVNPALGGTGVYDYTLGKVAEYDLVNQMISQSWGVGTTLLLSGIGSAILYKV
                     VDVIVGLRAPVEVEREGLDLVEHTERAYNM"
     gene            complement(517715..518053)
                     /locus_tag="RPD_0449"
     CDS             complement(517715..518053)
                     /locus_tag="RPD_0449"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulatory protein P-II"
                     /protein_id="ABE37687.1"
                     /db_xref="InterPro:IPR002187"
                     /db_xref="InterPro:IPR002332"
                     /translation="MKIVMAIIKPFKLEEVRDALTAIGVHGLTVTEVKGYGRQKGHTE
                     IYRGAEYAVSFLPKIKIEVAIATDQVEKTIEAITTAAKTGQIGDGKIFVLGLDHAVRI
                     RTGEADAAAL"
     gene            complement(518377..518691)
                     /locus_tag="RPD_0450"
     CDS             complement(518377..518691)
                     /locus_tag="RPD_0450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABE37688.1"
                     /translation="MMAAFVLMMSIPGLSLFYSGRQSPRPIWPPAPVRRPGARSPASA
                     QSCPPAAMCKGHGDAGGVDQRPSGTAYVPLKLVGVFVALRVFREHEIKGLDISQHGEA
                     LQ"
     gene            complement(519000..519338)
                     /locus_tag="RPD_0451"
     CDS             complement(519000..519338)
                     /locus_tag="RPD_0451"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulatory protein P-II"
                     /protein_id="ABE37689.1"
                     /db_xref="InterPro:IPR002187"
                     /db_xref="InterPro:IPR002332"
                     /translation="MKLVVAIIKPFKLDEVRQALTEIGVHGMTVTEVKGYGRQRGHTE
                     IYRGAEYIVNFLPKLRIEIAVDSALAEKAVEVITRSARTGQIGDGKIFVTPLDHALRI
                     RTGETDADAL"
     gene            complement(519615..520496)
                     /locus_tag="RPD_0452"
     CDS             complement(519615..520496)
                     /locus_tag="RPD_0452"
                     /EC_number="3.1.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA thioesterase II"
                     /protein_id="ABE37690.1"
                     /db_xref="InterPro:IPR003703"
                     /translation="MPLSKSLIDLISILDLEPIEVNLFRGTSPKTSWQRVFGGQVIGQ
                     AMVAGCRTVENRLPHSIHCYFILPGDPQVPIIYQVERLRDGKSYSTRRVTAIQHGQAI
                     FSVMMSFHDDEETAFDHQDKMPDVPPPEALTAEEISKQPFFKEMPDFIKRYYEADRPI
                     ELRPVELSRYFGKKIEDGRIHVWIRTAAKLPDDPALHMCALAYASDFSLLDAVMARYG
                     RTLFDKRMMPASLDHAMWFHRPFRADEWLLYAQDSPSAQGGRGLTRGQIFKPDGTLVA
                     SVAQEGSIRQRRDTPKD"
     gene            520635..521954
                     /locus_tag="RPD_0453"
     CDS             520635..521954
                     /locus_tag="RPD_0453"
                     /codon_start=1
                     /transl_table=11
                     /product="Ubiquinone biosynthesis hydroxylase,
                     UbiH/UbiF/VisC/COQ6 family"
                     /protein_id="ABE37691.1"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR010971"
                     /translation="MSGRTAAVITTAVPACFAQLRHGRKNSGARARKMTAPRSIVIGG
                     GAFAGLALALALRQGLGPEVPVIVADPALALRPSRDPRATAIVAACRRLFEALGVWDE
                     VAPTAQPIIDMVVTDSALEDATRPVFLTFAGEVQPGEPFAHMVENKYLIEALAKRAEA
                     EGVELRATPVTSYQSRAEATMVTLGDGSVIEASLLVAADGAKSKLRERAGISTYGWDY
                     DQTGIVVTVAHERDHNGCAEEHFLPAGPFAILPLTGKRSSLVWSESRADAAKIMALPD
                     AQFQAELEKRFGLRLGEVKPLDKPKAFPLGYFVAQSFIAPRLALIGDAAHVIHPIAGQ
                     GLNMGLKDVAALAEVVVDAARLGIDPGQVDVLERYQRWRRFDTMAMGVATNGLNLLFS
                     NKSPLLRSVRDIGLGIVDRLPPLKEVFIRQAAGLGGETPRLLKGEAL"
     gene            complement(522175..522372)
                     /locus_tag="RPD_0454"
     CDS             complement(522175..522372)
                     /locus_tag="RPD_0454"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF343"
                     /protein_id="ABE37692.1"
                     /db_xref="InterPro:IPR005651"
                     /translation="MTTSSERPETSVDRKLLEILVCPVTKGPLEFDAARQELISRGAK
                     LAYPIRDGIPIMLPEEARKLG"
     gene            complement(522466..523140)
                     /locus_tag="RPD_0455"
     CDS             complement(522466..523140)
                     /locus_tag="RPD_0455"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S16, lon-like"
                     /protein_id="ABE37693.1"
                     /db_xref="InterPro:IPR003111"
                     /translation="MPINADYRGPADLPEVIALFPLPGALLLPRGQMPLNIFEPRYLA
                     MIDDAFRDGHRLIGMIQPDATHSEKDGTPKLFQVGCVGRITQLAESGDGRYILELTGV
                     SRFKLVEELSVKTPYRQCKVDYFPYLDDFTARKGEDEVDREALLTVLTDFLKANNLKV
                     DWDGVETAPNEALVNALAMMSPYGAPEKQALLEAPDLKTRAEILIAVTEMDLAKKRTS
                     GDPPLQ"
     gene            complement(523270..524190)
                     /locus_tag="RPD_0456"
     CDS             complement(523270..524190)
                     /locus_tag="RPD_0456"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="ABE37694.1"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="InterPro:IPR006663"
                     /db_xref="InterPro:IPR011717"
                     /translation="MTIIEQGSAAAPQAAPDLIKDTTTQSFVRDVIEESKRQPVLIDF
                     WAPWCGPCRQLTPMLEKAVRAAGGKVKLVKMNIDEHPSIPGQMGIQSIPAVIAFVDGR
                     PADGFMGAVPESQVATFIEKLTAGVPGGAPSAAELLQEAEAVLAEGDPATAGAIYAEV
                     LQADAANVEAMAGLARCYMQSGAVDQAKQLLDQVPENRREDAAVKAVQAMIDLAEQAE
                     QLGPIAELEQKVAADPLDHQARFDLATALNAAGRRDEATAHLLEIVKRDRKWNEDGAR
                     KQLVQLFEAWGPTDDATVEGRKRLSTILFA"
     gene            524502..524576
                     /locus_tag="RPD_R0014"
                     /note="tRNA-Gly1"
     tRNA            524502..524576
                     /locus_tag="RPD_R0014"
                     /product="tRNA-Gly"
     gene            complement(524645..525583)
                     /locus_tag="RPD_0457"
     CDS             complement(524645..525583)
                     /locus_tag="RPD_0457"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR, substrate-binding"
                     /protein_id="ABE37695.1"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /translation="MRFDLIDLRLFVNIVQSGSITRGAEASHMALASASERVSGMESL
                     LGTPLLRRERRGVAPTAAGRALLHHARSVTLQIERMRGDLRAFSAGMRGEVRMLSNTA
                     GLVDLVPAALRRFLTAHPNVDVDLEERTSMEIVQAVAEGQAEFGVIAGTADPGALDIR
                     TLIVDRLAVLAARTHPLAAREAVGFAELLDERFVGLGAGALHDHLQQHAAQLGRRIAY
                     RVRLSSFEAVARLVEAGVGLAILPMSAIDRHPADDVTAIALTDAWSQRQLLVCAIDFG
                     ELTTHARLLVEELQRQAGKLDDHLGPSPVTAGPQSP"
     gene            525665..526414
                     /locus_tag="RPD_0458"
     CDS             525665..526414
                     /locus_tag="RPD_0458"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF81"
                     /protein_id="ABE37696.1"
                     /db_xref="InterPro:IPR002781"
                     /translation="MSEVFLLIGAGALAGAMNATAGGGSFVTLPALIGVGVPSVLANA
                     SSTIALYPGGLASAWVYRDGFSRVAGVPLGTMLLTTLFGGLIGALLLLWTPTSLFDRV
                     LPWLLLLATLALAFGRRLGPALRARFRTGIVTLLVIQFLLGVYGGYFGGAVGLMMMAA
                     WNLLDGADVKALNPPRTLLVSAANTVAVICFIVAGAVRWPEALLVGAGAILGGYFGAI
                     LGKALPSSVVKSATVLLAAAMTIHFFLRAYA"
     gene            complement(526524..527306)
                     /locus_tag="RPD_0459"
     CDS             complement(526524..527306)
                     /locus_tag="RPD_0459"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase, HAMP region"
                     /protein_id="ABE37697.1"
                     /db_xref="InterPro:IPR003660"
                     /translation="MQFDLSNRNLSQKISILVLGITFFVALAIGGVGEMILHKVGADQ
                     AKQSASVASLDRLVGLGGATLSPVRAADGSIVGMLVMQQDAGPVVMPASYEGQGLVVQ
                     AAETVAAPAADYALSAAHTMLLLAGIVVFAVVGLVGTRISRGLLAPLGELEKDVARLA
                     SGDTSIRIHALSRSDEIGRIARSIAKIQESLIELARLKTQKVVGGATSVMENLKEMWG
                     DLKSAARNAREMLFTDGRTVGETLTRSWNDWVHNGLGVPKRA"
     gene            528003..528995
                     /locus_tag="RPD_0460"
     CDS             528003..528995
                     /locus_tag="RPD_0460"
                     /codon_start=1
                     /transl_table=11
                     /product="putative photosynthesis gene regulator,
                     AppA/PpaA family"
                     /protein_id="ABE37698.1"
                     /translation="MIQSKDGLSFPGLPRRCGNGAAGFATSRDRRTGAPGTPICFPLG
                     SFAGPGQSSFPFPAIRGQPDRVRAVHPESIVSTVIPHLLVKHSAAPKRVRIAKDPAEA
                     RADELARLLIAPNLADAFDLIDSSLTRASSPTALFTGLFEPTARKLGDLWSEDACSEF
                     EVTIGLCQLQTAMRRISFDLLSAPLTRSQPRTVLVISQPGEPHSFFPALHSELLRQAG
                     WNTVSEFPDTDKALSDLVANGWFDAVNLSLSPALRREHWLPRVAETIRKVRRASRNPA
                     LAVVASGRVFAERADACTMVGADAATVSSVQIERCLMRSLLNRTARPAANFAWI"
     gene            529350..530435
                     /locus_tag="RPD_0461"
     CDS             529350..530435
                     /locus_tag="RPD_0461"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37699.1"
                     /translation="MPPEGKSYPFDHLPAIDYDAHPAYGRVMSMPMLGARLKALSIFG
                     YGFLLTSAQRAIDVEHLPRPAQGGKPLITVLRGLPTYLRLILLQRLSRFTAGRAYAPK
                     TERGTAVFVPLQGDGFAVVRLGNDVIAQIRTQLAPQLKTLEQRATPAGDPDSSRIWVD
                     PVSAPDLYRWFNQTAADLGLTEAASAYLKRPVGVGHIAAEVVDAPGAPPASPFADVGV
                     DVSPCDGFKVDLGYNAMKLVIYLDEVGPANGPLTYVAGSNRAATRFGDALIRRANDLS
                     GLSSRLQAWRETFYALPAGLQRKASFGADLVADSNFATAIQSHQVAVTSSEGNAVLYD
                     PAGIHRDAAPTQGRRTAVIVRFTELSR"
     gene            complement(530582..531880)
                     /locus_tag="RPD_0462"
     CDS             complement(530582..531880)
                     /locus_tag="RPD_0462"
                     /EC_number="4.1.1.39"
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
                     large subunit"
                     /protein_id="ABE37700.1"
                     /db_xref="InterPro:IPR000685"
                     /translation="MTPDDIAGFYAKRSDLNLDDYIELDFDFECAGDPREAAAHLCSE
                     QSTAQWRRVGVDEDFRPRFAAKVLELHAEPRPSGFSTPVECAVRGEVHACRVTIAHPH
                     GNFGPKIPNLLSAVCGEGVFFSPGIPLIRLQDIRFPDSYLAAFAGPQFGVAGLRERLK
                     AFDRPIFFGVIKPNIGLSAEPFAELGYQSWLGGLDIAKDDEMLADVDWCPLAERAALL
                     GDACRRAEAETGVPKIYLANITDEVDRLIELHDLAVSNGAGALLVNAMPVGLSAVRML
                     RKHATVPLIAHFPFIAAFSRLANYGIHSRVMTRLQRLAGFDVVIMPGFGPRMMTPEHE
                     VMDCVRACLEPMGPIKPCLPVPGGSDSAATLESVYRKVGCADFGFVPGRGVFGHPMGP
                     AAGAASIRQAWDAIASGIAVSDHAARHPELAAALRAFGGR"
     gene            complement(532026..532454)
                     /locus_tag="RPD_0463"
     CDS             complement(532026..532454)
                     /locus_tag="RPD_0463"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function UPF0047"
                     /protein_id="ABE37701.1"
                     /db_xref="InterPro:IPR001602"
                     /translation="MNIVRHRIELATTAPIQIIDITEQVRGFVAGSGLGDGLVTVSCL
                     HTTARINVNEREPQLERDMLTFLKRFAPRDGDYLHNLAPIDGRDNAHSHLIGLFMNSS
                     ETIPLAGGAMVLGEWQSIFFIELDGPRERRGVELQIIGQV"
     gene            532736..534718
                     /locus_tag="RPD_0464"
     CDS             532736..534718
                     /locus_tag="RPD_0464"
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase 3"
                     /protein_id="ABE37702.1"
                     /db_xref="InterPro:IPR002656"
                     /translation="MRPTYRSDIDGLRAIAVLLVVAFHAFPNSVRGGFVGVDVFFVIS
                     GFLITSIICQAQHSDGFSFRTFYARRINRIFPALALVLTVCAVAGWFMLFPVDYRDAG
                     KAIGFGAAFLSNLALLHDAGYFATTSELNPLLHLWSLGVEEQFYILWPPVIVLAWRWK
                     RGALIAALVILLASFAANILLTPRNALAAFYLPVTRFWELMAGCLLAIIATAGPGRDI
                     SSIAALDRLRAMLERHEALLRAGCAWFGLLLLAAGAVLISSDRGFPGWWAALPVLGAA
                     LLIFAGPSPWVNRLLLGNRAMVYVGLISYPLYLWHWPLLAAIRIVRFGEEPPPLMKAI
                     AILLAFALADITWRFVERPFRFRPTRSKTAAAFASVAVIGAVGAGIYAADGFPSRFGP
                     ELQAITRDLTAEASTAYRAGACFLTSESHFAEACDDNAPADAPRLLLWGDSHAAHLYP
                     GLRALQIADGNIRLSQYTTAGCPPMFGFASEKSPACAANNAIVRARLSSLKPDTVIMV
                     ARQWRDYDGPDRDPQASDAMIRATIAEVRAAGVRRIVVVGMFPSWRTPPRRILAQSYR
                     QHAAGLITADAIPIRDRSGHLDSSRADDNERLRRIFEAEGAAFISPTPVFCNPDGCLL
                     AAPDSGGTPVVHDGSHLTAAGSVFFARETAPAILGR"
     gene            complement(534811..535989)
                     /locus_tag="RPD_0465"
     CDS             complement(534811..535989)
                     /locus_tag="RPD_0465"
                     /codon_start=1
                     /transl_table=11
                     /product="putative AlgJ protein, required for
                     O-acetylation of alginate in Pseudomonas aeruginosa"
                     /protein_id="ABE37703.1"
                     /translation="MAAATTRAGQWLRRLAAAAVLLMPVLTLWNIAVPSRAFNIGPSL
                     IGVTKQTPLDLSLRAFLDGTLQKTAAIRIAEAMPLRRTLIRLNNQIAYSLFGEVNAPG
                     ILAGVGGQLVERSYLEEYCTRSDGDADRLADTVVPLLRNLQAYYRDRGAIFLYVVTPS
                     KVAHLPQHFVHLISCRSTDAARVELVPRYVARLRAAGIDVVDAATSTHALKGQYPVEL
                     FPRGGIHWNDQAMARASQQIVEAVNRQAGRELLPQFDFTSTVSLPPEGRDRDLAELIN
                     LLVSPLDYATPKLTFSNPPCAGQPARTIDAAIVGGSFMDAVGEVLTESACMARLSQYF
                     YLKLGRYGGTRRQLIQENLSDSDLQRLRDVDIMLLEENESAIGRQGYLTLLHHIVTDK
                     "
     gene            complement(535992..537404)
                     /locus_tag="RPD_0466"
     CDS             complement(535992..537404)
                     /locus_tag="RPD_0466"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane bound O-acyl transferase, MBOAT"
                     /protein_id="ABE37704.1"
                     /db_xref="InterPro:IPR004299"
                     /translation="MLFYEPLFLTCFPFLLVLYFAAGDARSKRWILLTGSGLFYLWGE
                     PLFVPVVVVSALVDHLLALRITRTPNAATRRALLTLGVVQNLAILVIYKYTSFAIESL
                     NLLLAAGRLGALPLWQIALPIGVSFVAFEKITYLVDSYRGVSKPARRFSDYCLFVFFF
                     PKLLAGPILKYHEIDGQIAAPRGFAWNDFGYGLLRFSRGIFKKLMIADPLGGYADQVF
                     GADPAGLSAATAWFGVACFTLQIYFDFSGYSDMAIGIARMLGFSLRENFNLPYIARSI
                     TDFWRRWHISLTTWIRDYLYIPLGGNRVSDLVTTRNLWICFLLSGLWHGASWNFVLWG
                     AYNGLFLTLDRLFLERALKRSGAVVATLLTLLIVMIGWVIFRSPSAAHLGSFFAALAG
                     LGQSTTTLTPAASVIWTAALGAALSLIPALPGFAALRAAWQGGAVLRLAGNIGLGLLG
                     IVAIARAVAIPFQPFIYFRF"
     gene            complement(537564..537639)
                     /locus_tag="RPD_R0015"
                     /note="tRNA-Thr3"
     tRNA            complement(537564..537639)
                     /locus_tag="RPD_R0015"
                     /product="tRNA-Thr"
     gene            complement(537900..539666)
                     /locus_tag="RPD_0467"
     CDS             complement(537900..539666)
                     /locus_tag="RPD_0467"
                     /codon_start=1
                     /transl_table=11
                     /product="HemY-like"
                     /protein_id="ABE37705.1"
                     /db_xref="InterPro:IPR010817"
                     /translation="MLRIILFLVIIALAAAGAAWVAEQPGDVVLSWNDWRAEMRLPVF
                     VLGLGAAIVSIVLAWAIITGLWRAPSRMKRGRFERRSGRARHAITQGLLAVGHGDAAA
                     ARNHASAARRHAPHDPLALLLQAQSAQLEGDRDGARRAFLAMAGRDDTKSLGMRGLYI
                     EAQRADDPYGALAIAEEALRLQPNSTWASQAVLGFRCARADWSGALDILETNLSSGLV
                     DKKVFRRQRAVLLTARAIDLEDSDESLARDSALEANKLAPTLIPAAVLAAKCLAETHQ
                     VRRAMKVIEAAWQAQPHPDLAAAYANIKPGDPANIRLARVQNLIAKNPADFESALAIA
                     RAGIDAGEFSRARRALQPFIDNPTQRVAMLMAEIEHGERGDTAKARAWTLRAVRALPD
                     AMWTADGYTSDHWRPVSPVTGRLDAFQWQVPIAALPARKAVVIEDNPFHDALIASSAT
                     EALPAANAHDPVTVTIESVVETTVVAPKQAEATVVTVEPEAAADKPKDQKGSSRGGAT
                     KDAGKSAPEAPVAASETVIAMPSTPLFHRRPSQATPPVIPIVRAPDDPGVDEEAAPGD
                     FTEQSAAPAGQTGNWRGYRPPR"
     gene            complement(539674..541113)
                     /locus_tag="RPD_0468"
     CDS             complement(539674..541113)
                     /locus_tag="RPD_0468"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37706.1"
                     /translation="MVKNRPGHENTQHEKDPRENAASVGASDAHPEQAAEVDVDAPIE
                     ALALNPVEPTAEELRDDPALELSAEHRQQDVIDAEPLPETATDDPPETRFASTSDKAE
                     EAAARSAAAAEPRRPGIVAAMLPPVLAVAIAAAVVVGAAKTGLLPQFLSSTSVSAPEG
                     DVAAIDALKARIADLEARPTPTGSNTAAATPAAAADPALAGKVDALEKTVAALRDDLA
                     TLRDRSEQLASALKEVKAAPSEPTATASEPPAMASTDKTPPDKAAADKAATDSAAALA
                     AINARLTELEHAAKTATEAAPQAPQPAVVSDDAPLRRLVTATMLDLTVKQGAPYAAIL
                     KAAEPLATETGALKPLEPFAATGVPAAAALGRELIALLPKLLSGAEGASNANFIDRFQ
                     SNAERLIRIQRSDATAGIDRTAIVGRITAAAQRGDLAEARRELKALAPADRAPVQSWI
                     DKSEARDQALAASHSFATAALAALQKPSP"
     gene            complement(541174..541917)
                     /locus_tag="RPD_0469"
     CDS             complement(541174..541917)
                     /locus_tag="RPD_0469"
                     /codon_start=1
                     /transl_table=11
                     /product="Uroporphyrinogen III synthase HEM4"
                     /protein_id="ABE37707.1"
                     /db_xref="InterPro:IPR003754"
                     /translation="MAMLVTRPQPDNDATAAALRAKGYDVLLAPMLRFEPLPFPDDQD
                     TITTGVIVTSANALRAIEHQPGFARLLKLPLFAVGKHTARAARDAGFQDVVVADGDAA
                     RLRLKVSDSVRGKKKTEGTLLYLAGADLSRDLAGELREDGFNVVMQTTYRMAPVPTLP
                     ASVCDAFAAHRIEAVLHYSRRSARAFIDATRESGIEISALAIPQCCLSETVSEVVREA
                     GATQVTVARTPDEPALFEALDRAIGAPAR"
     gene            542016..543185
                     /locus_tag="RPD_0470"
     CDS             542016..543185
                     /locus_tag="RPD_0470"
                     /EC_number="3.4.24.57"
                     /codon_start=1
                     /transl_table=11
                     /product="O-sialoglycoprotein endopeptidase"
                     /protein_id="ABE37708.1"
                     /db_xref="InterPro:IPR000905"
                     /translation="MIAFRDPAMLREARRTLVRPQTQGLNLTSEQTLLVLGIETTCDE
                     TAAAVVERRADGSGRILSNIVRSQIDEHAPFGGVVPEIAARAHVDLLDGIVANAMREA
                     GTGFAQLSGVAAAAGPGLIGGVIVGLTTAKAIALVHNTPLIAVNHLEAHALTPRLTDA
                     TEFPYCLFLASGGHTQIVAVLGVGDYVRLGTTVDDAIGEAFDKIAKMLGLPYPGGPQV
                     ERAAASGDAARFAFPRPMLGRPDANFSLSGLKTAVRNEASRLTPLEPQDINDLCAGFQ
                     AAVLDSMADRLGAGLRLFRERFGAPKALVAAGGVAANQAIRRSLREVAAKAQTTLMVP
                     PPALCTDNGAMIAWAGAERLALGLTDTMDAAPRARWLLDANATAPGKFANTRAGF"
     gene            543222..544211
                     /locus_tag="RPD_0471"
     CDS             543222..544211
                     /locus_tag="RPD_0471"
                     /EC_number="1.1.1.94"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycerol-3-phosphate dehydrogenase (NAD(P)+)"
                     /protein_id="ABE37709.1"
                     /db_xref="InterPro:IPR004455"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="InterPro:IPR013332"
                     /translation="MSAFNSISVLGGGAWGTALALTAARAGRSVTLWEHDPGHAQHLE
                     QTRESRFLPGVMLEPSIKVTRDLAEAARAEALLLVVPAQVLRSVATSLQPLIAARTPL
                     IACAKGIEHGTHRFMTEIIAECAPNAIPAILSGPSFAADVARGLPTAVTIAASDAAIA
                     QALAQAMNSGSFRPYHSTDVRGVELGGATKNVMAIAAGIVAGRKLGASALAAMTTRGF
                     VELVRFGKAYGARIETMHGLSGLGDLTMCCSTPQSRNFSFGMALGRGESIDEAAHGKL
                     AEGYYTAPVLLEMAQAKGVEMPISTAVAAILQGQLGVDAAIEGLLTRPLKAEE"
     gene            544215..544628
                     /locus_tag="RPD_0472"
     CDS             544215..544628
                     /locus_tag="RPD_0472"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF589"
                     /protein_id="ABE37710.1"
                     /db_xref="InterPro:IPR007628"
                     /translation="MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMK
                     KGDRAFFYHSNEGKEIIGIAEIIREAYPDPTDESGKFVCVDLKADKKLKTPVTLVAVK
                     AEPRLAEMALLKYSRLSVQPVTADEWKLICKMGGL"
     gene            544799..545476
                     /locus_tag="RPD_0473"
     CDS             544799..545476
                     /locus_tag="RPD_0473"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABE37711.1"
                     /db_xref="InterPro:IPR000051"
                     /translation="MSSTSAIADPIAFIRANTRLRPVPLVPEVMLHVADEALPLWSKT
                     EEELGEAGLPPPFWAFAWAGGQALARYLLDHPETVAGRDVIDFASGSGLVAIAAMKAG
                     ARRVTAFDIDGFAREAIAVNAAANGVAIAVSGDDLLAAPHVAPAQTVLAGDIFYQSDI
                     AELAFGFLQNRADGGAFVLIGDPGRYYLPKDKLIQLASYGVPVTRELEDAEIKATGVW
                     TLKQPVR"
     gene            545958..547910
                     /locus_tag="RPD_0474"
     CDS             545958..547910
                     /locus_tag="RPD_0474"
                     /EC_number="6.2.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-coenzyme A synthetase"
                     /protein_id="ABE37712.1"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011904"
                     /translation="MSEKIYDVPSEWASRAFVDDAKYREMYARSVSDPNGFWAEQAKR
                     LDWIKPPHKIENCSFAPGNVSIKWFEDGVLNVAHNCIDRHLHTRGDQVAIIWEGDDPS
                     QSRKITYRELHDEVCKFANILRNRNVGKGDRVTIYLPMIPEAAFAMLACARIGAIHSV
                     VFAGFSPDSLAQRITDCQSKVVITADEGLRGGRKVPLKANVDAALAKCGGVDWVVVVK
                     RTGAAVEMDDVRDFWYHEAAEMVTTECPIEPMHAEDPLFILYTSGSTGQPKGVLHTTG
                     GYLVFAGMTHQYVFDYHDGDVYWCTADVGWVTGHSYILYGPLANGATTLMFEGVPNYP
                     TNSRFWEVIDKHQVNIFYTAPTAIRALMQAGDEPVKKTSRKSLRLLGSVGEPINPEAW
                     EWYHRVVGDDRCPIVDTWWQTETGGILITPLPGATKLKPGSATRPFFGVVPEILDPEG
                     VVLEGECTGNLCLARSWPGQMRTVYGDHARFEQTYFSAYKGKYFTGDGCRRDADGYYW
                     ITGRVDDVINVSGHRMGTAEVESSLVAHPKVSEAAVVGYPHDIKGQGIYAYVTLMAGI
                     EPSEELRKELVAWVRKDIGPIASPDLIQFAPGLPKTRSGKIMRRILRKIAEDEPSTLG
                     DTSTLADPAVVDDLVEHRQNKHHKAV"
     gene            548292..548819
                     /locus_tag="RPD_0475"
     CDS             548292..548819
                     /locus_tag="RPD_0475"
                     /codon_start=1
                     /transl_table=11
                     /product="ErfK/YbiS/YcfS/YnhG"
                     /protein_id="ABE37713.1"
                     /db_xref="InterPro:IPR005490"
                     /translation="MSFGFRSAKTAGAVAALASAFVLTAPDAQARPDLVSFRGDYSPG
                     TIVVKTNERRLYLVVEPGQAVRYPVGVGKAGKRWEGVTKIDGKYRNPAWSPPADVKRD
                     NPAIPDVIPGGTPENPMGVAAMTLAGGEYAIHGTNRPNSVGGFVSYGCIRMLNDDISD
                     LYQRVSVGTQVLVTR"
     gene            complement(548928..551021)
                     /locus_tag="RPD_0476"
     CDS             complement(548928..551021)
                     /locus_tag="RPD_0476"
                     /codon_start=1
                     /transl_table=11
                     /product="OmpA/MotB"
                     /protein_id="ABE37714.1"
                     /db_xref="InterPro:IPR006665"
                     /translation="MRRLRLALLATTAITLWQAASLPARADTALMLMAQAAPAPDKGD
                     EKDRKGPPPGERKGPPPGAAPSQAPPPAAAPQPRPAPPPAAAPAPRAEPPAAPRAEPP
                     PRPAPPPAPRAEPPAAPRAAPPPPPPAAAPPRPPAPPAEKSAPRVEPPAPPRAAPPPP
                     PPAAAPPKPSAPPAADKGAAPPPAATPPRPSVPPAADKGAAPTPPPAAAPQRQPAPAD
                     RLAPADKGGAPSQRPTPPAAGQIGAPPAAGSPPPAAQTPPPAAGQTSAPTTPPPAGQP
                     PAAQTGAPAQPPAGQPPAAQKDVTPPAAGQIGTPTPAAPTPATPTQPPAGQTTAPVPG
                     TIGPQGAQPGAAGALPPGAPVARTPPPTVTAPIPAAPPPAQALTPIAPGAAPQGPRNI
                     TDFRSERREVQQGGRTVITEPGRIIVRDPNGQEFIRHNEMDRFRYGARNIRTEKIRGG
                     DTRTIVLRPDGSEIINVTGGDGQLLRRIRRDRQGREIIIIDNSFGPRDRANFYVDLPP
                     PVLRMPRDRYIVDYEDASPELIYETLDAPPVERIQRRYSMDEIRYSPSVRQRMPSIDL
                     NTITFELGSWDISPDQASKLQAIADGLNRSISRNPREVFLIEGHTDATGNDTDNLSLS
                     DRRAESAAALLTQQFAVPAENLTSQGYGEQYLKVQSDGPERQNRRVTVRRITPLLNGG
                     QASLPPPPPGTAPRR"
     gene            complement(551564..552052)
                     /locus_tag="RPD_0477"
     CDS             complement(551564..552052)
                     /locus_tag="RPD_0477"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase-related,
                     FMN-binding"
                     /protein_id="ABE37715.1"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR011576"
                     /translation="MAADTNQGDAQHAWDLMKKITFAMLA