LOCUS       CP000127             3481691 bp    DNA     circular BCT 28-JAN-2014
DEFINITION  Nitrosococcus oceani ATCC 19707, complete genome.
ACCESSION   CP000127
VERSION     CP000127.1
DBLINK      BioProject: PRJNA13993
            BioSample: SAMN02598329
KEYWORDS    .
SOURCE      Nitrosococcus oceani ATCC 19707
  ORGANISM  Nitrosococcus oceani ATCC 19707
            Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales;
            Chromatiaceae; Nitrosococcus.
REFERENCE   1  (bases 1 to 3481691)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C.,
            Glavina,T., Hammon,N., Israni,S., Pitluck,S., Chain,P.,
            Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Nitrosococcus oceani ATCC 19707
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3481691)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C.,
            Glavina,T., Hammon,N., Israni,S., Pitluck,S., Chain,P.,
            Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (21-SEP-2005) US DOE Joint Genome Institute, 2400
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     URL -- http://www.jgi.doe.gov
            Source DNA available from Dan Arp (arpd@bcc.orst.edu)
            Bacteria available from ATCC: ATCC 19707
            Whole genome sequencing and draft assembly at JGI-PGF
            Finishing done by JGI-LLNL
            Quality assurance done by JGI-Stanford
            Annotation done by JGI-ORNL and JGI-PGF
            Contacts: Paul Richardson (microbes@cuba.jgi-psf.org)
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
FEATURES             Location/Qualifiers
     source          1..3481691
                     /organism="Nitrosococcus oceani ATCC 19707"
                     /mol_type="genomic DNA"
                     /strain="ATCC 19707"
                     /culture_collection="ATCC:19707"
                     /db_xref="taxon:323261"
     gene            175..1524
                     /locus_tag="Noc_0001"
     CDS             175..1524
                     /locus_tag="Noc_0001"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein, DnaA"
                     /protein_id="ABA56557.1"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR003593"
                     /translation="MPSSLWKHCLNHLEGELDPQEFNTYIRPLQAIQQGTSLQLYAPN
                     QFVIDWVQNCAESRINALLSHYSSGRIEKALLEVGSCSLQPQPHIQAVELTSKSARSS
                     SRVVDRIPESRLNKNYTFDSFVEGKSNQLPRAASHQVAENPGSAYNPLFIYGGVGLGK
                     THLMHAVGNYIRSRNPSARVVYLHSEQFVAEMIKALQLNAINEFKTRYRSVDILLIDD
                     IQFFAGKERSQEEFFYTFNTLLEVQHQIILTCDRFPKEVNGLEERLTSRFGWGLTVAV
                     EPPELETRVAILMNKASIENIILSDDVAFFLGRLIYSNIRELEGALRRVIAYSRFTHR
                     PITMELTREALKDLLTLQEKLVTIENIQKTVAEYYKIRVSDLSSKRRSRVVARPRQTA
                     MSLSKELTDHSLTEIGKFFGGRDHTTVLHACRKINELKSIDRRMAEDYHNLLKKLST"
     gene            2396..3499
                     /locus_tag="Noc_0002"
     CDS             2396..3499
                     /locus_tag="Noc_0002"
                     /EC_number="2.7.7.7"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, beta subunit"
                     /protein_id="ABA56558.1"
                     /db_xref="InterPro:IPR001001"
                     /translation="MRFSIKREEIVRHLVTVCGVVERRHTLPILSNVLLSVKDSQLSL
                     MATDLEIEIRTALKVLSSEEGKVTVSARKFLEICRALPSGSALEAQYKEGQFYIHSGR
                     SRFTLSTLPAEDFPSIDSIDAVAELELTQAELKQLLHRTVFCMAHQDVRYYLNGLLLE
                     LTEESIHAVATDGHRLALASLAKGADQEGTEIQSIIPRKAILELVRLLEESQEPVRLK
                     FGTNQMRAEFQGLSFSTKLIDGQFPDYKRVIPVGCEKQFVADRERFKQALVRVNILTN
                     DKYRGVHLHLSDLKLQAIVTNLEQGSAEEELDIKYQGENLEIVFNNFYLIDVLNIIDT
                     KEVRLTFTNASSSCLITPIDASDSKYVVMPMRL"
     gene            complement(3590..4215)
                     /locus_tag="Noc_0003"
                     /pseudo
     gene            complement(4225..4635)
                     /locus_tag="Noc_0004"
                     /pseudo
     gene            complement(4765..5076)
                     /locus_tag="Noc_0005"
                     /pseudo
     gene            complement(5101..5247)
                     /locus_tag="Noc_0006"
                     /pseudo
     gene            complement(5426..5620)
                     /locus_tag="Noc_0007"
                     /pseudo
     gene            complement(5692..6738)
                     /locus_tag="Noc_0008"
                     /pseudo
     gene            complement(6745..7309)
                     /locus_tag="Noc_0009"
                     /pseudo
     gene            complement(7484..7735)
                     /locus_tag="Noc_0010"
                     /pseudo
     gene            7862..8404
                     /locus_tag="Noc_0011"
                     /pseudo
     gene            complement(8401..8592)
                     /locus_tag="Noc_0012"
                     /pseudo
     gene            complement(8632..9009)
                     /locus_tag="Noc_0013"
                     /pseudo
     gene            complement(9394..9711)
                     /locus_tag="Noc_0014"
                     /pseudo
     gene            complement(9938..10228)
                     /locus_tag="Noc_0015"
                     /pseudo
     gene            10252..10596
                     /locus_tag="Noc_0016"
                     /pseudo
     gene            complement(10544..11101)
                     /locus_tag="Noc_0017"
     CDS             complement(10544..11101)
                     /locus_tag="Noc_0017"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase of IS630 family insertion
                     sequence ISY100e (ISS1987)"
                     /protein_id="ABA56559.1"
                     /translation="MFNVGVSRRMHDALKRLGIRKKRVMPYEKQAFLGKLAAGDRTFG
                     FRNLVYIDESGFKAHCHRDAGWVDKGQQLLRLSSASANAAPTWAWPSAITPGGRKKEW
                     LAPMLLEGSCTSQLLETWVEQCLIKALHDPTLIIMGNASFHHHKRIQDIVAKDYHDMI
                     PLLPSSADLNPIEKTKIIHGTGGGN"
     gene            11319..12410
                     /locus_tag="Noc_0018"
     CDS             11319..12410
                     /locus_tag="Noc_0018"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecF"
                     /protein_id="ABA56560.1"
                     /db_xref="InterPro:IPR001238"
                     /db_xref="InterPro:IPR003395"
                     /translation="MMHITHLDIRNFRNLKHIELHPSKGVNILSGANSSGKTSFLEAI
                     YLLGLGRSFRTVQLISAIQAGMESLRVVAKVKQVGGSHTAGVEFGPAGFRARINKDTV
                     KKRSQLATQLPLLYMSSYSHVVLDGGPRYRRQWLDWSLFHLEPGFHDLWWCYQRTLKQ
                     RNHVLRVHKPSWQQEINAWNKKLSTYGEQITSLREAILFKLQDSVSQLFTALAHQPIS
                     PVTMEFKQGWARTVRLEEILNESLNYDRAAGYTRYGPHRAEVAFYVDGKDVREILSRG
                     QQKVFCYSLALSQANLLYRTKEQNCIFLIDDFTSELDADHRKRLLTLLNKLGMQVFAT
                     TIESLGSEIKAHPNIKEFHVKLGQVEEMV"
     gene            12438..14861
                     /locus_tag="Noc_0019"
     CDS             12438..14861
                     /locus_tag="Noc_0019"
                     /EC_number="5.99.1.3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="ABA56561.1"
                     /db_xref="InterPro:IPR000565"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR011557"
                     /db_xref="InterPro:IPR011558"
                     /translation="MKASTAYDSSHIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFE
                     VVDNSIDEALAGFCNEISIIIHSDDSITISDNGRGIPTDIHQEEGRSAAEVIMTVLHA
                     GGKFDHNSYKVSGGLHGVGVSVVNALSAVLFLEIHRDGKIYQQHYQEGVPQGPLVAVG
                     TTERSGTTIRFSPSPKIFSNIVFSFDIFAKRLRELAFLNSRVRILLEDERIGRKEEFF
                     YEGGISAFVEHLNKNKTPLHGNVFYFQGERDGVAVELAMQWNDSYQEHFFCFTNNIPQ
                     RDGGTHLAGFRSALTRTLNQYIEKEALAKKTKVGTTGDDAREGLTAVLSIKAQDPKFS
                     SQTKEKLVSSEVKPVVDSLVSEHFQNFLLEHPVDAKAIGGKMIEAARAREAARKAREL
                     TRRKGALDMAGLPGKLADCQERDPTLSELFLVEGDSAGGSAKQGRDRRNQAILPLKGK
                     ILNVEKARFDKMLSSVEVATLITALGCGIGREEYNPDKLRYHRIIIMTDADVDGSHIR
                     TLLLTFFYRQMPELVERGHIYIAQPPLYKVKRGKQEQYIRDDAEMERYLINLSTDNAK
                     IYSENGATSIAGETLSTLFTDYFQLRRAIERLSYRYDPLLLDQMLYLDVVPTPADPMI
                     EIKQLEEWATQLEIRSNSAAKGNARYEIEVATVPENSAPVLQVKITRHGVTAYQRIYM
                     DFFTSPDYQRIQNLGKRLVNSVKAESYVQRGDRRQLVNDIQEAVDWLMEEARRGQAVQ
                     RYKGLGEMNPDQLWETTMNPATRRLSQVRIDDVITADEIFTTLMGDHVEPRRDFIESH
                     ALSVAHLDV"
     gene            14920..15621
                     /locus_tag="Noc_0020"
     CDS             14920..15621
                     /locus_tag="Noc_0020"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF556"
                     /protein_id="ABA56562.1"
                     /db_xref="InterPro:IPR007565"
                     /translation="MNRWLASARNLEEASYLLAEGPDIIDFKEPKRGVLGALPPETVR
                     QAVALIGGRCQTSATIGDFFVESSQISQGVLEIAATGVDYVKIALFSNTQQAADCLIS
                     LQPLAARGVSMIGVIFADKQPDFSWIHLIKQAGFKGIMLDTAVKDGRGLLSHLSLPEL
                     DNFIKVARNANLVSGLAGSLSIQDIPKLLSLKANYLGFRSALCTAGNRCYRLDPKAVL
                     SIKRAIRENPRIVEN"
     gene            complement(17144..18151)
                     /locus_tag="Noc_0021"
     CDS             complement(17144..18151)
                     /locus_tag="Noc_0021"
                     /EC_number="3.1.3.11"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="D-fructose 1,6-bisphosphatase"
                     /protein_id="ABA56563.1"
                     /db_xref="InterPro:IPR000146"
                     /translation="MHSNPFLTQFILEEQRSIPSATGDFTGLLNDIVTACKTISHLVN
                     RGGLIDILGAAGTENIQGEGQKKLDVISNDIMVNSLEWTGHLGAMASEEIEGIIPIPG
                     QYPKGKYLLLFDPLDGSSNIDINISVGTIFSILRCPDDVSEPTQEDFLQPGTQQVCAG
                     FCVYGPTTMMVLTAGHGVNGFTLDQDIGEFILTHPNMTIPEDTMEFAINMSNQRFWAA
                     PVQRYIEDCLQGKEGCRNKNFNMRWVASMVSEVYRILTRGGIFMYPWDSRDPDKPGRL
                     RLMYEANPMSFIVEQAGGVSSTGDQRILEINPEGIHQRVPVILGSKNEVERVIAYHQE
                     A"
     gene            complement(18366..19184)
                     /locus_tag="Noc_0022"
     CDS             complement(18366..19184)
                     /locus_tag="Noc_0022"
                     /EC_number="1.2.99.5"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="formylmethanofuran dehydrogenase, subunit C"
                     /protein_id="ABA56564.1"
                     /db_xref="InterPro:IPR002489"
                     /translation="MNALTLILKEIPSQQVDASPLIPENLIGLSKPEIAAITLVTGNQ
                     HVRADTIFNISGDDPGRLIFAGETTKLDYIGKNCSGGQIDVQGSCGAYTGMGMHDGQI
                     NIYGNTGAFTACEMQGGLLRVDGDSDDFLGAARPGNQIGMTGGTVIITGNTGARVGDR
                     MRRGTLLIEGNAGNYAGSRMLAGTIAILGKTGNYLGYGMKRGTLLLWHPPDKLSATFN
                     DCGYHTLGFLPLLLESYRSLETRFAFLPKTIGRAHRFCGDMASLGHGEILILVP"
     gene            complement(19267..20124)
                     /locus_tag="Noc_0023"
     CDS             complement(19267..20124)
                     /locus_tag="Noc_0023"
                     /EC_number="2.3.1.101"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="formylmethanofuran-tetrahydromethanopterin
                     formyltransferase"
                     /protein_id="ABA56565.1"
                     /db_xref="InterPro:IPR002770"
                     /translation="MKATRILITAQDLKWAYHSAQTMTGFATSVIACGCEAGIERELD
                     PSETPDGRPGVAILLFAIGGKGLAKQLEARVGQCVLTSPTSALFAGIYEGELIPLGKN
                     LRFFGDGFQISKIINGRRYWRIPVMEGEFLTEEKVGMIPAIGGGNFLVLAQSQPQALT
                     ACEAAIAAMKKIPNVIMPFPGGIVRAGSKVGSKYPGIKASTNDVFCPTLKGKTHTNLS
                     AEIESVLEIVIDGFSKEDIQKAMYAGISAVCNFGAQNGIYRISAGNYGGKLGPIHFHL
                     QEIMMGQMA"
     gene            complement(20172..21842)
                     /locus_tag="Noc_0024"
     CDS             complement(20172..21842)
                     /locus_tag="Noc_0024"
                     /EC_number="1.2.99.5"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="formylmethanofuran dehydrogenase, subunit A"
                     /protein_id="ABA56566.1"
                     /db_xref="InterPro:IPR001604"
                     /translation="MLIKLTGGTVYDPMHGINGEVRDIYIRDGRIINPPPGDMSIDQE
                     YPLNNKIIMAGAIDIHSHIGGGNVNIARTLLPEGHHTNLLPRTELLRAGSGRAIPSTF
                     ATGYRYAEMGYTAVFEPAVLPMNARQAHMEMGDTPLVDKGGYALLGNDDYGLRMLAAN
                     KDQKTFNNYVAWILKASQCLGIKVVNPGGINAFKFNQRRLDLDEPGPFYGVTPRQILL
                     RLARAVHELDIPHPIHVHGCNLGVPGNLKTTLSTIEGIAGLPMHLAHIQFHSYGAEGD
                     RKFSSGAAQIAEAVNRHPNITVDVGQILFGQTVTVSSDTMQQYASHPHAYPKKWAFMD
                     IECDAGCGIVPFKYQDKHFVNALQWAIGLEIFLLVDDPWRVFLTTDHPNGAPFVSYPH
                     LIRLLMDRSFRNDMLATIHPEAAQASTLGTITREYSLYEIAIMTRAGAAKLLGLSDRG
                     HLGIGAAADITVYTEQKDKEKMFSKPDYVFKDGELVVRNGEIVKVTWGATHVVRPEFD
                     NSIEKELSSYFDRYLPMKISNFKINDEEMTYFGRGHIQVHPCRERNSF"
     gene            complement(21857..23134)
                     /locus_tag="Noc_0025"
     CDS             complement(21857..23134)
                     /locus_tag="Noc_0025"
                     /EC_number="1.2.99.5"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="formylmethanofuran dehydrogenase, subunit B"
                     /protein_id="ABA56567.1"
                     /translation="MFYHTQTGIWEEVPSPFCGIAADDLKVKVEGNRLTIIENGCPVT
                     QPAFEQEIGDSTPQIQGKTARLETAIARTVKLLRQSRFPLISGLATDVEGVRAALALA
                     DYYGAVIDHMDSEATLRNMLALQAGGWITTTLGEVRNRVDLLLVVGSDIEPCFPRFFE
                     RYIWNPETLFGQDTAQREIIYLGQSPSGQAAFGPNGHAPLIIPCKQEKLPEVVAVLRA
                     QVAGRPLQAESVAGITMEKIAALANRLKQAQYGVITWAAEQWTFPHAELTTQMLYEII
                     MALNKTSRCSGLPLGGRNGQAAANQVCTWQTGYPVPISFARGYPDYDPYHYNTKRLLE
                     SGETDTLIWISAFDQDDTPPITSIPTVVLGRAGMNFTQVPEVFIPIGTPGIDHAGHTY
                     RTDNVIAVPLRKLRDSGLPSTAKIINTMLERSY"
     gene            complement(23322..23927)
                     /locus_tag="Noc_0026"
     CDS             complement(23322..23927)
                     /locus_tag="Noc_0026"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56568.1"
                     /db_xref="InterPro:IPR007730"
                     /translation="MPPHKRRQYISPHQTPKPWPWLIAGLLIGASIVLLPMLQDRFFW
                     AEKNGNNHPIIQNNAQAKETVSTEQPPPHFEFYTLLPEMEAAVSEPKLPPSHQQPKLP
                     PKESAELTPKPQPSPSKSLSPEAYVIQAGSFRSYSQADKRKADLALMGVEAAIQTVTI
                     DNSKTWHRVRVGPSTNLAKLQQIRQQLRENQIECQLFKVKS"
     gene            complement(23931..25688)
                     /locus_tag="Noc_0027"
     CDS             complement(23931..25688)
                     /locus_tag="Noc_0027"
                     /EC_number="6.1.1.19"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="arginyl-tRNA synthetase"
                     /protein_id="ABA56569.1"
                     /db_xref="InterPro:IPR001278"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR005148"
                     /db_xref="InterPro:IPR008909"
                     /translation="MKEHLWNLIADALSSLQQEGILSSWNKDKIQVQRTRDKSHGDFA
                     SNISMVLAKEARQKPQKLADLIVARLPEHPWVKKVDIAGPGFINFTLALPAFQAVVSQ
                     VLEQKESFGRCRTGHGKTVHLEFVSANPTGPLHVGHGRGAAYGDALARLLTAVGYQVH
                     REYYVNDAGRQMDILAVSVWLRYLELCGETLPFPSNGYQGEYVRNIARSLKAGEEDLP
                     HHSATEILAGLPADAPTGDREKYLDALIQKIKNLLGKNSYQKVFEQALNTILAGIRED
                     LAKFGVTYDAWFSERHLTEMGAIEIAIERLKAAGHLYQKAGAWWFYATNFGDEKDRVV
                     IRENGQPTYFASDIAYHLSKLEQGYHKIIDIWGADHHGYIPRIKASLQALGADLQQLD
                     IQLVQFAILYRGKEKIQMSTRSGEFVTLRELCQEVGKDAARFFYVMRGAEQHMDFDLE
                     LAKSQSNENPVYYVQYAHARICSVFRQLKTREFVWNSEQGREHLGKLNEAHEVTLLDR
                     LSCYSEVVESAAIQSAPHLLAYYLLDLARDFHTYYNAHTFLVDIPELRDARLALIAAT
                     RQVIKNGLTLLGVSAPESM"
     gene            complement(25794..28004)
                     /locus_tag="Noc_0028"
     CDS             complement(25794..28004)
                     /locus_tag="Noc_0028"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Primosomal protein n"
                     /protein_id="ABA56570.1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR005259"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR011545"
                     /translation="MAVPPILRLAIPSPLRRYFDYLPPAKTPYQQLQPGIRLQVPFGR
                     RTLIGILVTIASQSEIETSKLRRAQYCLDKTPVVPNSLLQLLTWAASYYHHSPGEVFF
                     SALPQLLRQGKPATSPIYRQWLLSSKDCTTDATILSRAPRQQQLVELLRYHPEGLTSS
                     QIKAQLGTYQSSLRSLIAKGWVYSQEKPIYKSIPPSKEHLRHPLNDAQKAAVTTILAS
                     QQKFRPFLLEGVTGSGKTEVYLRAIEEIIAKSRQALVLIPEIGLTPQMVERFHRYLQT
                     PITVLHSALSDRERLAAWLAAYEGKTPVVIGTRSAIWAPLPRLGIIIIDEEHDSSFKQ
                     QEGFHYHARDLAIMRAYQTKIPIILGSATPSLESLDNVKRQRYHLLQLLQRAGAAQTP
                     RIQLLDVRSRPLEFGLSPPLLAALRYHLGQGNQALLFLNRRGFAPTLICHECGFAVPC
                     HRCDAYMTVHQHTNRLRCHHCGAEGSLPTSCPQCRNLLLRPRGLGTEQVEAGLKHFFP
                     EIEIARVDRDTTRRAGTLNKMLDGIHNGKYRLLIGTQMLAKGHHYPNITLAGILDADQ
                     GLFGSDFRAGEHMSQLILQVIGRTGRGNKPGEVLIQTHHPEHPLLTALVGHGYRHVAE
                     ILLEERRQIGFPPYGYLALLRARAVSPDSPMKFLEMARSMATAHNLHGVTLLGPVPAP
                     MERRAGRYRAQLLLQGSARAPLQRLLTTWIPTLERLQAARKVRWSLDVDPIDLM"
     gene            complement(28110..28664)
                     /locus_tag="Noc_0029"
     CDS             complement(28110..28664)
                     /locus_tag="Noc_0029"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DJ-1 protein"
                     /protein_id="ABA56571.1"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="InterPro:IPR006287"
                     /translation="MVKVLIPLAQGCEELEAVTLIDLLRRGGIQVVTAGLDEQVVTAS
                     RGTRLLPDTSLDKVFQQEFDMVVLPGGQPGADNLNGDRRIRALLKRTAERGKITAAIC
                     AAPTVLASTGLLASKRATGYPGFLDKLDLPTTTLEDQAVVVDGCVVTSKGPGTAMDFA
                     LTLIELLVGGGTRNEVEETLQRPA"
     gene            complement(28738..30057)
                     /locus_tag="Noc_0030"
     CDS             complement(28738..30057)
                     /locus_tag="Noc_0030"
                     /EC_number="3.4.21.102"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase S41A"
                     /protein_id="ABA56572.1"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR004447"
                     /db_xref="InterPro:IPR005151"
                     /translation="MPFSKRDLLIITLGLVLGVSLVFGPMVLAERSENRPEALPLEEL
                     RAFSEVFGQIKRSYVEIVDDKTLIEDSIRGMLTGLDPHSAYLDPEAYKELRIGTSGEF
                     GGLGIEVGMEDGFVRVVAPIDDTPAQKAGINAGDLIVRIDDTPVKGMSLSDAVQRMRG
                     KPGTDILLTIIREGEEQPLKFTITRAIIKVKSVKNRTLEEGYGYLRISQFQTETASNL
                     QKAIEKLKKENGGKLKGLVLDLRNNPGGVLSAAIEVSDAFLEKGIIVYTEGRDLESKQ
                     KFRATSGDALKGSPIVILVNGGSASASEIVSGALQDHHRAIVVGSRTFGKGSVQTILP
                     LTENTALKLTTARYYTPSGRSIQAEGIIPDIELESVKVSASALSDINPVREANLSRHL
                     SNGRKAEEKKESTEKVKKTSLATEDYPLYEALNLLKGLSIAASQQYR"
     sig_peptide     complement(29968..30057)
                     /locus_tag="Noc_0030"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.990) with cleavage site probability 0.986 at
                     residue 30"
     gene            complement(30469..32022)
                     /locus_tag="Noc_0031"
     CDS             complement(30469..32022)
                     /locus_tag="Noc_0031"
                     /EC_number="5.4.2.1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase"
                     /protein_id="ABA56573.1"
                     /db_xref="InterPro:IPR005995"
                     /db_xref="InterPro:IPR006124"
                     /db_xref="InterPro:IPR011258"
                     /translation="MSTPPRPLALLILDGWGYSEETASNAIHAAHTPIWDTLWDRYPH
                     TIIRASGAEVGLPNEQMGNSEVGHLNLGSGRVIYQEYTRVNRALRTGSFFTNHTLTEA
                     VDRAVKSDKAIHILGLLSPSGIHCHEDHIHAMVELAIKRRCQEVYLHAFLDGRDTAPK
                     SAQASILAMQAKFTELGKGRFASLIGRYYGMDRDHRWPRIQAAYNLIATGQAEYEAES
                     AKQALAMAYERGETDEFVQATRIVPSGKAPVQVKDGDVIIFMNFRSDRARQITRAFIE
                     PDFTGFERLYWPKLAQFVSLTEYSKEFDIPVAFPSEKPQNTFGQVLAKLGLHQLRIAE
                     TEKYAHVTFFFNGGREQPFEGEDRILIPSPQVDTYDQKPEMSAVEVTDNIVKAIESDK
                     YDVIICNYANPDMVGHTGDFNATVKAIETIDQCLGRVWAALQSAGGELIITADHGNAE
                     KMYNAQYQQPHTAHTHNAVPFIFVSERAAIASANGSLADVTPTMLYLMNIKPPPEMSE
                     HRLIELSSP"
     gene            32678..33424
                     /locus_tag="Noc_0032"
     CDS             32678..33424
                     /locus_tag="Noc_0032"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Rhodanese-like protein"
                     /protein_id="ABA56574.1"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR004829"
                     /translation="MDTTRLFEFLTNHWTLSLLLVVILLALVIDPLLRRLRGIRMASA
                     VEITRLINQENAQVVDIREEKEFEKEHILDSLNVPFSKFFKRLDGLGDFKGRPLVVIW
                     GMGQRALYVAGKLSRQGHKTIYVLHGGIEAWKQANMPLFSGSTKIKAKAQTEAPAQTE
                     APAQTEAPAQTEAPAQTEAPAQTEAPAQTEAPAQTEAPAQTEAPAQTEAPAQTDAPAW
                     TEAGNKPRISKNTNGNKKSKRRKKAKTRRS"
     gene            33428..33685
                     /locus_tag="Noc_0033"
     CDS             33428..33685
                     /locus_tag="Noc_0033"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutaredoxin, GrxC"
                     /protein_id="ABA56575.1"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR011767"
                     /db_xref="InterPro:IPR011900"
                     /translation="MPKVVMYATLWCPYCIGARRLLDSKGIDYTEIRVDLEPEQRAVM
                     INKSHRRTVPQIFINDQPIGGYDELAQLERARELDVLLGLA"
     gene            33751..34245
                     /locus_tag="Noc_0034"
     CDS             33751..34245
                     /locus_tag="Noc_0034"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase subunit secB"
                     /protein_id="ABA56576.1"
                     /db_xref="InterPro:IPR003708"
                     /translation="MAEDSTNQQTSEQGQQAQFAIQKIYVKDLSFETPNSPHIFNQEQ
                     EWKPEFNLQLSNKNQRIAENVHEVVLSLTVTAKLGDQTAFLVEVHQAGIFMLNGYGEE
                     SLGSLLGSYCPNILFPFAREVVADLVTKGGFPPLLLAPVNFDALYAQQQQQRQSAGAA
                     EVRH"
     gene            34256..35290
                     /locus_tag="Noc_0035"
     CDS             34256..35290
                     /locus_tag="Noc_0035"
                     /EC_number="1.1.1.94"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol 3-phosphate dehydrogenase (NAD(P)+)"
                     /protein_id="ABA56577.1"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR011128"
                     /translation="MALPVALQNDKENLRTLVVGGGSWGTALAILLARNRVPTLLWAR
                     DLAQVSAMIITRRNDRYLPQVPFPPSLEPITDLEGALSQTKQVLVAVPSCGFRPILER
                     LAGHLSSHVPLIWATKGLEPGTGRLLHEVVLELLGSGWPMAVMSGPTFAHEVVAGLPT
                     AVTVAATESEIATCFARSLHGDTFRVYTSDDLIGVQLGGAVKNVLAIAAGISDGLGFG
                     ANTRAALITRGLTELVRFALAWGGQRETLMGLSGLGDLVLTCTDDQSRNRRLGLALAQ
                     GKRLDEALTLIGQAVEGAAAAKVVVARAKQLAVEMPIAEQVYQVLYAGRHPRQAVEVL
                     CRREQKPEYA"
     gene            35307..36278
                     /locus_tag="Noc_0036"
     CDS             35307..36278
                     /locus_tag="Noc_0036"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56578.1"
                     /translation="MKSDNCCQFLWLKLSFICFLILCLIACGGDSAIKEEAGGSKEGS
                     ILWQAGEQYVRLTSSDGAVGNQHPAAVTPEEMRIVLESLFVPERRFITKKLNPIFSPA
                     EVQVLSTALSQGLALARPNQDITFVSIGTHQGTFAKVRKANTGRVFFRDGKLNIIFGM
                     LHDEVRDQDRQTGEEIDRRLHPFVVGSRLFETKLPNVIALGEGKAFYLDPESGEERED
                     WLVLDIPTLVTNAKVDPNIPGEQQVDSSLAENIKRSKQETQNLKEDLVKVKEVLFELK
                     EELLELQQGGGYATIEARLQSLKNLYDNELISSDEYRAKRQGLLNEL"
     sig_peptide     35307..35393
                     /locus_tag="Noc_0036"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.670) with cleavage site probability 0.507 at
                     residue 29"
     gene            complement(36273..37454)
                     /locus_tag="Noc_0037"
     CDS             complement(36273..37454)
                     /locus_tag="Noc_0037"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF185"
                     /protein_id="ABA56579.1"
                     /db_xref="InterPro:IPR003788"
                     /translation="MRRVQKDFFPHPEPIALAHSQKLENVIQTTIEQAGGQIPFARFM
                     ELALYTPGLGYYMAGLHKLGTFGDFITAPELSPLFARCISRQCQQIFELLGTGDILEF
                     GAGSGRLAADLLSELNLSGNLPERYFILELSADLRHRQQETLYQRVPLLASRVSWLDR
                     LPDRIDGFILANEVCDAMPTHCFQLENGYDWERYVGYEKGKFVWKKGPLSHPLLKDRI
                     AKIRLLLKHVNSYESEINLAMEGWTTEIAHRLRKGMLLIIDYGFPRHEYYHPERMMGT
                     LMCHYRHQAHPNPLIMAGLQDITTHVDFTALAEAGHSSGLRVAGYCTQADFLLACGLD
                     KLAATEIAAGEKQALETSQQIKRLVLPSEMGELFKALALTREINQPLLGFNLRDRRAR
                     L"
     gene            complement(37544..38032)
                     /locus_tag="Noc_0038"
     CDS             complement(37544..38032)
                     /locus_tag="Noc_0038"
                     /EC_number="2.7.6.3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="7,
                     8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK"
                     /protein_id="ABA56580.1"
                     /db_xref="InterPro:IPR000550"
                     /translation="MARAYISIGSNINRENNIRAGVNALRCSYGPLIISRVFESEAVG
                     FQGDNFYNLVVGFDTDEAPRIITRALHEIEHACGRKRDGPRFGPRALDLDLLLYDNLV
                     IDEPGLQVPRDDTLDYAFVLQPLAEIAPHLPHPVLSKRYADLWAAFDKPLNRLWPVEL
                     EL"
     gene            complement(38038..38415)
                     /locus_tag="Noc_0039"
     CDS             complement(38038..38415)
                     /locus_tag="Noc_0039"
                     /EC_number="4.1.2.25"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Dihydroneopterin aldolase family"
                     /protein_id="ABA56581.1"
                     /db_xref="InterPro:IPR006156"
                     /db_xref="InterPro:IPR006157"
                     /translation="MDIVYLNDLRIDTIIGIYDWERRIKQTVCLDLEMATNVAKAAAS
                     DNIEDALDYKAIAKRLINFVSNSEFLLVETLAEQAAQIILTEFGVSWLRLKVDKQGAI
                     RGAQGVGIIIERRQPEPEMTSHP"
     gene            38533..39126
                     /locus_tag="Noc_0040"
     CDS             38533..39126
                     /locus_tag="Noc_0040"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-phosphate glycerol-3-phosphate
                     acyltransferase"
                     /protein_id="ABA56582.1"
                     /db_xref="InterPro:IPR003811"
                     /translation="MLTILVLVIGGYFVGSLSSAIIVARLAGLGDPRTQGSGNPGATN
                     ILRLGSKRLAGIVLLGDALKGFLPVWLAQEVGANAWAVAGVGLAAFWGHLYPVFFGFR
                     GGKGVATGLGVLLGFSWSLALAVLGIWLSIFWCWRISSLSALCAAILAPFLAWWLVPD
                     SAIRFAVVLLAIFLLWRHQDNIRRLLSGQEDRASKQN"
     gene            complement(39123..40130)
                     /locus_tag="Noc_0041"
     CDS             complement(39123..40130)
                     /locus_tag="Noc_0041"
                     /EC_number="3.4.24.57"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="O-sialoglycoprotein endopeptidase"
                     /protein_id="ABA56583.1"
                     /db_xref="InterPro:IPR000905"
                     /translation="MRVLGIETSCDETGVAVFDSKQGLLADILHSQAKLHAGYGGVVP
                     ELASRDHIRKLLPLLRKVLNQAGLNKEDIDGVAYTGGPGLIGALLVGAAVGRSLAWAL
                     GKPAIAVHHMEGHLLSPLLEPNPPGFPFCALLISGGHTMLVTVNRIGAYRILGESLDD
                     AVGEAFDKTAKLLQLGYPGGPALAKLAEQGNPDRFYFPRPMLDRPGLNFSFSGLKTYA
                     LNTLHKNGSEAAADIARAFQDAVVDTLTVKCRRALQQTGLNRLVVAGGVSANQALRQR
                     LKAMGTQENVQVYYPRLAFCTDNGAMIAFAGCQRLLAGEQTSSGFSVRARWPLDTLPE
                     I"
     gene            40548..40763
                     /locus_tag="Noc_0042"
     CDS             40548..40763
                     /locus_tag="Noc_0042"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S21P"
                     /protein_id="ABA56584.1"
                     /db_xref="InterPro:IPR001911"
                     /translation="MPSVRLKENEPFDVAIRRFKRTCEKAGVLSEVRRREFYEKPTAV
                     RKRKAAAAVKRSMKKLARERARRTRLY"
     gene            40801..41271
                     /locus_tag="Noc_0043"
     CDS             40801..41271
                     /locus_tag="Noc_0043"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56585.1"
                     /db_xref="InterPro:IPR003789"
                     /translation="MVADGSPLKARLQEEVKIAMRAKDKARLGILRMVMAALKQFEVD
                     TRKPLDDAQVIALLDKMLKQRRESLAQYEAAGRTDLAEKERFEEEVIQSYMPTPLSEV
                     EVEQLIEEAISQCQATTARDMGKVMALLKPNLQGRADMAVASAKVKARLEAISS"
     gene            41378..43102
                     /locus_tag="Noc_0044"
     CDS             41378..43102
                     /locus_tag="Noc_0044"
                     /EC_number="2.7.7.-"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="ABA56586.1"
                     /db_xref="InterPro:IPR002694"
                     /db_xref="InterPro:IPR006154"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR006295"
                     /db_xref="InterPro:IPR006647"
                     /translation="MPMGERIPQEFIDELVARTDIVELIDSRVPLRKASHNYVACCPF
                     HNEKTPSFTVSPQKQFYYCFGCSVHGTAIGFLMAFDRLSFIEAVEELAQRAGMMVPQS
                     SKQQDYYNRHQGLYEVLACAAEFYQQQLEASAYQGQVKAYLRERGLSGPIIAEFGLGF
                     APPRWNALLHYTRPSLKSYLQAAGLTISKGEDRYYDRFRDRLIFPIHDYRGRVIGFGG
                     RLLGDGSPKYLNSPETALFHKGRELYGLYQVRKSLHRCDRLLVVEGYMDVLALAEHKI
                     RYAVATLGTATTSDHLTRLFRITPAVIFCFDGDRAGYQAAWRALETALPLLSQGRQVQ
                     FMFLPQGEDPDTMVRAEGQTAFEARLAEAVPLSDFLLNNLRQKVNLSSVDGCARLVEL
                     ARPLLARIPPGVYQDMLLARLAELAQIEQTTLIRHLSPGKKPTAVPLRRLEQGAASPT
                     RRAVAILLQRPKMIQWVDKNLSLRGLEGAGAELLQKLVDLLQNNPHLNTAALLERWRD
                     SEMGRYLEQLAGWELLLTDEDMVLELQAALERLQVQGAEQRIITLSNQPSLTGAEQRE
                     LLALLAEK"
     gene            43212..45020
                     /locus_tag="Noc_0045"
     CDS             43212..45020
                     /locus_tag="Noc_0045"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase, sigma 70 subunit, RpoD"
                     /protein_id="ABA56587.1"
                     /db_xref="InterPro:IPR000943"
                     /db_xref="InterPro:IPR007127"
                     /db_xref="InterPro:IPR007624"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR007630"
                     /db_xref="InterPro:IPR007631"
                     /db_xref="InterPro:IPR009042"
                     /translation="MLKIMEQDRQSQLKLLIARGKDRGYLSYSEVNDHLPDDVIDPEQ
                     IEDIITMFNDMGISVHEDMAEADALAIMDTAVADDEVAEEAAAALVSVDGEFARTSDP
                     VRMYMREMGSVELLTREGEISIAKRIEEGMRQVYTALSRFPGSVAELLCQYEKVEADE
                     IRLADVISGFQESEEADLKESAAEEASVSSEGSTEEEESDNGLDLDRVREQFTQLREL
                     YERYQAADLKDNDRALAELSECFLQLKLVPRLSQRLIENLRGVVAEIRVLERSIMKIA
                     VNSAQMPRKDFLSSFQKQETNLNWVEKHIRAKKHYSSVLRKQGDAIQKAQEKLIVLEQ
                     RAGMSITQIKEINRSLSIGEARARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQE
                     GNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNR
                     VSRQMLQEMGREPTPDELAERVEMPKDKVRKVLKIAREPISMETPIGDDEDSHLGDFV
                     EDAAVISPPDSAIFSGLRETTQLILAGLTPREAKVLRMRFGIDMNTDHTLEEVGKQFD
                     VTRERIRQIEAKALRKLRHPSRSEQLRSFLDIENNN"
     gene            45036..45111
                     /locus_tag="Noc_R0001"
     tRNA            45036..45111
                     /locus_tag="Noc_R0001"
                     /product="tRNA-Met"
                     /note="tRNA-Met1"
     gene            45851..46606
                     /locus_tag="Noc_0046"
     CDS             45851..46606
                     /locus_tag="Noc_0046"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Phage integrase"
                     /protein_id="ABA56588.1"
                     /db_xref="InterPro:IPR002104"
                     /translation="MIAECRDKLASGNITRYNQKNSGGQRSPGSVNRYLAALSHTFTI
                     AVKEWGWLEDSPMGRISKLKEPRGRVRFLSDSERERLLKACRGSSNSFLYPAVVLALS
                     TGARRMEIMALRWRNVDLQRGLISLHETKNGERRALPLAGHALDCVKRLSKVRQIDTD
                     LLFPSNHNPQQPLDLRKPWEIALKQAGIEDFRWHDLRHSAASYLAMNGATLAEIAEVL
                     GHKTLQMVKRYAHFSETHTARVVASMNAKIFGE"
     gene            46609..47358
                     /locus_tag="Noc_0047"
     CDS             46609..47358
                     /locus_tag="Noc_0047"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56589.1"
                     /translation="MSNSIGRPLPNCRHLRSLPLPSIAQYWAIETGTNPSDNLRDLAF
                     AVHCWLLCEKEFRSAYRKSGDPKFLEAVLPNNKEKLEQIGEALKKLYLDNILDAQIEQ
                     TLAAITIYAEDIKDWCQRNHRPLPRFWFPLSEAAASHESGSYQPSPKKLIAEAEEVGK
                     NLSGVLKASDKMPVDPPRKRSLIIPSTANQYNTKDKKSYLNIELVRRTYDHLCETQKD
                     RHLAPKEELAFVINKPAHFDTDKIIELYLNL"
     gene            47396..47731
                     /locus_tag="Noc_0048"
     CDS             47396..47731
                     /locus_tag="Noc_0048"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="ABA56590.1"
                     /db_xref="InterPro:IPR002622"
                     /translation="MTRCSIDLRKRVIDFVRGGGSKAEAARRFQVGRASIYRWLSQDD
                     ALCYERPGPRRSHKLDWEALRVHVEDKADLTYKERARHFGVSYYCIWHAMHKMGLTRK
                     KNDGVHAAL"
     gene            47706..48230
                     /locus_tag="Noc_0049"
     CDS             47706..48230
                     /locus_tag="Noc_0049"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase of IS630 family insertion
                     sequence ISY100h"
                     /protein_id="ABA56591.1"
                     /translation="MTGYTQRCNMKRKSFLRLRERYRRRGKRFVYLDESGFEPEVSRR
                     YAYAPKGRRVYGLISGHRRPRTSLLAARMDEGFEAPFLFEGTCNTAVFNAWLEKELCP
                     LLNSNHIVIMDNAPFHKAVSSREIIKKTGAGILFLPPYSPDFNPIEKDFGNIKKIREY
                     NEHETLENIVAAYQ"
     gene            48776..49048
                     /locus_tag="Noc_0050"
     CDS             48776..49048
                     /locus_tag="Noc_0050"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56592.1"
                     /translation="MTISNKVRHLLTVGQFSEKNPAFPEASLRYLIFRSEDRENSKGE
                     VIPGNGFSPAIVRVGRKVLIDEEKFFECIDEQNGQSTMRQKGGGDV"
     gene            49045..49437
                     /locus_tag="Noc_0051"
     CDS             49045..49437
                     /locus_tag="Noc_0051"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56593.1"
                     /translation="MTWPLFQKITWSVFVAVAAAYPPSGLPPSMACGYAINVWVGSGD
                     MSIFKKPVPGSRRRTLSKLPTFAKVPIKVVGTSQLTLREFRVLVALYAFADQKGRCWP
                     SRQRLSELTGIRPEHISRATSALKKKGG"
     sig_peptide     49045..49140
                     /locus_tag="Noc_0051"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.932) with cleavage site probability 0.902 at
                     residue 32"
     gene            49434..50033
                     /locus_tag="Noc_0052"
     CDS             49434..50033
                     /locus_tag="Noc_0052"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56594.1"
                     /translation="MKKTGNGGRSQSSRYQLPLAQDKALPLAPENGAHRGGVSPPKRC
                     QARQLNGAAQGTGIEQTREQTNLYTAPADAAGTKSGLKGDDFPRQETAPRAVEAYLTK
                     QGKRLQGQALRRFEIFWQVFDYRRGKAEAADAWWKLEPMDPGLLKAIIAGAQREASER
                     PAKLEKGLTPKMAQGWLSGRRWEDAPPRRSAPTKPKLVV"
     gene            50043..51848
                     /locus_tag="Noc_0053"
     CDS             50043..51848
                     /locus_tag="Noc_0053"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="toprim domain-containing protein"
                     /protein_id="ABA56595.1"
                     /translation="MDKTFSDFGIDVPPAASGQLSLTCPQCSAQRKKKRAKCLSVNVE
                     KGAWICHHCSWRGGLSQREQSNRTLYWRRPDYRQPAPFSPGALPEDIQRWFAKRGITP
                     AVLERNHIATKKVYMPQLERWVSAIAFPYYRGETLINAKYRDGRKHFRLEAGAERILY
                     GLNDLEQTTLIVEGEMDKLALEVAGFRNVVSVPDGAPPPQAKDYARKFEFLQADEEAL
                     KTVKTWVIAVDNDAPGQYLAEELSRRFGREKCKRVLWPEACKDANEVLLKRGPEVLTD
                     CIKNAQPYPLAGVLTVSHLSEDIDFLYTHGLKRGMSTGWPSVDICYTVKPGELTVVTG
                     VPNSGKSNWLDCLALNLAQQGWRFGVFSPENQPVGHHMARMIEKWAGKPFNKGSIARL
                     SRSTLAQGKDWVHEHFYWILPEDDQDWTVEHVLDRARALVLRYGIKGLLLDPWNEFEH
                     LRAPNVTETEYISLVLKRVRQFARYYQVHVWIVAHPAKLFRGKNDQYPVPTLYDISGS
                     ANWRNKADNGLVIWRDLGDPKKDLVEIHIQKIRFREVGRLGAVRLRFDPVTAVYREPE
                     PDDEAAFPPADGADKADEQAYLDSLYAEYEAQGGK"
     gene            complement(51909..52556)
                     /locus_tag="Noc_0054"
     CDS             complement(51909..52556)
                     /locus_tag="Noc_0054"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56596.1"
                     /translation="MRQARYPRNEDGLTPGQQVFADLYRAGPEKVRGNALACYRQAFP
                     RAALSTAKVQSSRLLRNPGVAAYLQSKRQAAEAEADVKEVQVLKELAQVGFSDIRALF
                     DGQGRLKPMDALPKHIAAAIAAVDVVVMKDEKKTAPLYVYKIKLWNKLDALEQLDKQL
                     GMFKEQREVKVQGELSHLLEEISGAPLSTPMGRIALQQEQEKAAGEPAHGPKRHD"
     gene            53559..54056
                     /locus_tag="Noc_0055"
     CDS             53559..54056
                     /locus_tag="Noc_0055"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56597.1"
                     /translation="MAEPVHDTIKSSLQAAEGLYHRLVLLVGEAGSDKTEAFHDVADE
                     LGTEVVNVNLVLSSELLELTAKQRALRLPEILDRIVDKVQSTVVLDNLEILFDKELKQ
                     DPLRLLQSISRNRPVVASWNGVIKEGKLIYAEIGHPEYRRYDMADTLIVSMDGTATID
                     LEKNN"
     gene            54071..57892
                     /locus_tag="Noc_0056"
     CDS             54071..57892
                     /locus_tag="Noc_0056"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56598.1"
                     /db_xref="InterPro:IPR000238"
                     /translation="MVRLQDRRFGHIKNIPVEENPGRAQIKYGDLIQFDPIESVVQLR
                     DADKSSAAHTLVNTYVISKEMAERLTQLVIPQMQFDQPVDNKGLLVVGNYGTGKSHLM
                     SVVSSLAADASLLEELNHASVRDAAAQIAGRFKVIRTEIGATTMSLRDILVAELEEHF
                     EKLGVEYVFPEAGTIISHKRAFEDMMAKFGEVFPEHGLLLVVDELLDYLRTRKDQELI
                     LDLNFLREVGEVCKDLRFRFMAGVQEAIFDSPRFAFVADSIRRVKDRFEQILIARSDV
                     KFVVAERLLKKTAEQQAKIRDYLMPFAKYYDGLNERMDEFVRLFPVHPDYIDTFERVT
                     VVEKREVLKTLSMGMKGILGKDVPQDEPGLIAFDSYWNTLKQNASFRAIPEIRAVIDC
                     SQVLESRIENALTPKNYKPMAVRLIHALSVHRLTTGDIYAPMGASAEELRDRLCLFEP
                     LITEMGSDEPDKDLQTHVETVLRKIHTAVSGQFISENKDNRQFYLDLKKTDDFDALID
                     KRAESLGQAQLDRFYYEALKRAMEYQDATYVTGYKIWQHELVWQEHKAARTGYLFFGA
                     PNERSTAVPQRDFYLYFIQPNDPPRFKDGKVSDEVFFRLKSTDEEFQTALKSYAAALD
                     LAGTSSGHAKATYESKANGFLKKLVQWLQKHMSDAFEVTYQGRAKSMTEWAKGKSIRD
                     LSGLLPHETINFRDLVNTIAGVCLAPNFENQAPDYPFFSVLITGNNRAQAAQDALRTI
                     AGQNRTKQATAVLDALDLLDGEKIDPYKSKYTKFILDAVKAKGHGQVVNRSEIIQDDQ
                     GLEYMNPGGSRLEPEWVSVLVAALVYSGDIVLAIPGKKFDATGLQQLAATGMDELARF
                     KHLEQPKEWNLPALKALFELLGMTPGMAQLVTQGKDEPVQNLQQAVGKIVKRIVMTQQ
                     TLREGLSFWGLDLLVGTDLASQTSGLDEAKGFFESLQAYSSPGKLKNFRYSAPEVLAH
                     EKAMKALDELDALRAFIMDNGPTASWLSTAEAVLPAEHDWVDRMKTTRQDVLDAFKQA
                     NLTELTSQSQSPLSGIGAKLQKLKKDYTVAYIGLHTKARLGVNEDKRKAGLLNDPRLQ
                     TLRKLAGIDLMPRQQLTDYQNRLAGLKSCFALTEQNLDASSICPHCGFRPAVETGAAV
                     GSQMIDQMDTQLDAMVAAWTSTILSNLEGPITQANMDLLKIDDREPLEAFIKSKELPV
                     PLDSNFVHALKEVLSGLVRVTAKAQELQQALQVTDGPATPVEMKKRFEEYIDQLTKGK
                     DPAKVRIVMEG"
     gene            57899..59566
                     /locus_tag="Noc_0057"
     CDS             57899..59566
                     /locus_tag="Noc_0057"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56599.1"
                     /db_xref="InterPro:IPR007421"
                     /translation="MNTNKHEIEALIQRGESVSLEFKSDLKRLPDRELVAAVVSLANT
                     DGGDLLLGVEDDGTVTGLHASHLNVLGIPPLIANKTNPAISVRVEKCESTGKSIARIR
                     VPKSQQLVSTSDGFLVRRRLKFDGTPEAVPFYPHEFIQRQSSLGLVDPSAMVLEEVDS
                     GQLDPLQRLRIRSAIKKYGGEQSLLALADDELDGALGLCRESNGARHPTMTGLLVLGT
                     EELLRAHVPAYEVAFQVLQRTDVKVNEFFRKPLLETFEEVDPLFKVRVEEEEIQVGLF
                     RVPVPNYDRRAFREAFVNALVHRDFSRLGAVHVKITDDGLTISNPGGFVEGVRLDNLL
                     VVDPRSRNPLLADVIKRIGLAERTGRGIDRIYEGMLRYGRPAPDYSMSDEFTVSVQMV
                     NAAADLDFLKMVVEQEDKLGNMPIDSLIILSRLREERRLTTADLAPSVQKSETNVRIT
                     LEKLVETGFLEPHGTGRGRTYTLSAALYRKAGKKSEYIRQAGFAPIQQEQMVLKYIDA
                     HGSIKRADAADLCRISPFQATRLLKRMEKNDLVKPVGQGRGTRYERK"
     gene            59633..59992
                     /locus_tag="Noc_0058"
     CDS             59633..59992
                     /locus_tag="Noc_0058"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56600.1"
                     /translation="MLGENILCVGRRWMWPCRQPCMDFNRLVAAIPQAHDELAKQACQ
                     AVYGEKVLSELTARLSDIPPIGILLCTDKNHALAEYARAGMDNSLFVSKYLLELPKKE
                     EMQAFIKRQVKEIGDVG"
     gene            59989..62832
                     /locus_tag="Noc_0059"
     CDS             59989..62832
                     /locus_tag="Noc_0059"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56601.1"
                     /db_xref="InterPro:IPR002052"
                     /translation="MKPKQESLFQTRLVPAEAGSGRLFDEELVAGSDGPVKCLGLEFE
                     NDEARRTHFTEELRKKLQDPEFRKIEGFPIGSDEDILNLSDPPYYTACPNPWIADFIT
                     EWEAQKPEQPEGYHYHREPFAADVSEGKNDPIYNAHSYHTKVPHKAIMRYILHYTEPG
                     DIVFDGFCGTGMTGVAAQMCGDREVVMSLGYQLKPDGTILQEEMDEDGKKVWRPFSKL
                     GVRRAVLNDLSPAATFLAHNYNLYVDTASFENEAKKFIKIIERECGWMYETTHTDGVT
                     KAKVNYTIWSDVFVCPDCTNEIVFWDVAVDKESETVNDEFQCPNCQTSLTKRNMDRAW
                     VTTYDRFLGETIRQAKQIPALINYSVGGKRYEKKPDEGDFAILEKIENEGLDGWFPIN
                     RMIEGHESRRNDPVGITHTHHFYSPRNLSVMSKILDLADKSEFTPFKFGFLNTSWHAT
                     QMRQYNPGGGHRPRTGTLYMPSIHSEGNMIPVYKKKLNQLVQFYKVKSHRNRVAIIQT
                     MSSTVESSIEAGLDYVFIDPPFGANLNYSELNSIWEAWLKVSTNNAEEAIENRSQNKG
                     IDEYRSLMTQCFRQAYNQLKPGRWMTVEFSNTSAGIWNNIQTAISDAGFIVANVSVLN
                     KKQGSIMAYTTPTAVKQDLVISAYKPNGGFEERFQKEAQTEEGVWDFVRTHLKYLPVT
                     KQQGALLQFVPERDPRILFDQMVAYYVRKGYPVPISSQEFQIGLSQRFIERDGMFFLP
                     DQVAEYDRKKMTSGELKQMSMFVSDEASAIQWLHQLIKEKPQTFSDINPQFMQQLGGW
                     SKNEAQLDLRELLNQNFLSYDGKGPVPEQIHAYLSTNWKELRNLPKDDPTLVAKARDR
                     WYVPDPNKAGDLEKLREKALLKEFEEYKEVKKKLKVFRLEAVRAGFKKAWQERDYAVI
                     VAVADKIPNNVLEEDPKLLMWYDQAVTRMGGGD"
     gene            62833..63705
                     /locus_tag="Noc_0060"
     CDS             62833..63705
                     /locus_tag="Noc_0060"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding region, ATPase-like protein"
                     /protein_id="ABA56602.1"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004358"
                     /translation="MLIPIGTIRSNCNGFDAIAEIAVKTKNVWLDSVEFDLSFCSFFE
                     ANMAAPLYAVIARLRDELNDVTITNVPAGVSTILRKNKFLSVFSQPELTDTNQTTLPF
                     KILKLTAGDQFNDYLDTYMRGRGIPAMSEALTKRFRQSLFEIFLNATIHSQSKAGIFV
                     CGQFYPNKHRLDFTIADAGVGIRENVRRYTRKQKLNSCKAIEWAMTEGNTTKTGNQPG
                     GLGLKLIKDFIQMNGGKIQVVSRYGYYDFSANGESIRKMSNDFPGTCINIEINTEDTS
                     SYCLKSELKSEDIF"
     gene            63723..64097
                     /locus_tag="Noc_0061"
     CDS             63723..64097
                     /locus_tag="Noc_0061"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56603.1"
                     /translation="MNDQVKIKVADLIGSSLCISAEDGQKVFGKVEQLVREGKQVTIS
                     FENVTMLISLFLNVAIGQLYGSFGEETIRAQLKVEGLSSDDMELLKRVVDNAKKYYSN
                     KKSYDDAWLEEDNNLEEDNNEE"
     gene            64087..64638
                     /locus_tag="Noc_0062"
     CDS             64087..64638
                     /locus_tag="Noc_0062"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="PilT-like protein"
                     /protein_id="ABA56604.1"
                     /db_xref="InterPro:IPR002716"
                     /translation="MKNKAYDLSSYSFSSDEQVLVDTNVWLYLFPAPGNPPHNFAQQY
                     STAFANLVSAQARPVLDPMVLSEYLNRYIRIEWEGHYRSHYPKFKDFRNSADFSTVAS
                     SAETFAKRILSFCQIHSIPANELDLNQALSDFSTGGVDFNDALLVDICKKRNIKLMTN
                     DGDFQDGGIEVLTTNPRLLRACP"
     gene            64658..67546
                     /locus_tag="Noc_0063"
     CDS             64658..67546
                     /locus_tag="Noc_0063"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Type III restriction enzyme, res subunit"
                     /protein_id="ABA56605.1"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001410"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR011545"
                     /translation="MPWQYSTVHNSACKVIEEQTLWGQAVCRIWLPNQDAVVRVPRSA
                     LRPLSADLQPEIEAGRIAYVAAAAKVAEVLEGSTSATDGHVLLAPMESNVIPLPHQIH
                     ALSRAISGDRVRYLLADEVGLGKTIEAGLVMRELKLRGLVRRILVVSPKGIATQWVAE
                     MQTHFNEQFQLVLGDDISTLQRLAPGADHRNSAWSMFDQVIVPLDSVKPMDKRRGWTA
                     GRVAEYNRSRFEDLITAGWDLVVVDEAHRLGGSTDQVARYKLGKGLAEAAPYVLLLSA
                     TPHQGKTDAFHRLMNLLDEDAFPDMDSVSRDRVAPYVIRTEKRKAIDADGKPLFKARR
                     TQMAPVVWESRHHLQQLLYEAVTDYVREGYNQALREKKRHIGFLMILMQRLVVSSTRA
                     IRTTLERRLAALKEGEQQASLRLAELENSAGGSENTDDEITELYDMDGQELLDELLKS
                     HVLALQSEGSHVETLLDAAVRCEQAGPDAKAEALIEWIYELQAEENEPDLKVLIFTEF
                     VPTQEMLKEFLEARGISVVTLNGSMDMEVRGAAQDTFRKSHRVLLSTDAGGEGLNLQF
                     AHVIINYDIPWNPMRLEQRIGRVDRIGQPKMVRAINFVFEDSVEFRVREVLEQKLSVI
                     FDEFGIDKTGDVLDSAQAGELFEDVFAQAFANPDGIETSVDQTVTRIRDEIQQVRESS
                     AIYGISEELNVQAAEQLRSHPLPHWVERMTVGYLNSHGGTASRKRSWWDLNWPDGQEH
                     RKAVFNAREADRLTDATLLNLENSRVRGLALNLPQIAAGQPLPCVSVSGLPTSISGLW
                     GLFEIRLQAGMHQKTQLLRIPMVRRGYVSVFLSEEGKLFLPTARHIWDALQTAEAQVQ
                     ATLGRDESITAHERLRIAAEQAGQELFDALQQVHLAAVAYEEERGIVSFASRRKAIER
                     VGLPEVRQFRLARCDAEESEWRHELQSARQIVPEIRSLLMLRIIKRGA"
     gene            67546..69540
                     /locus_tag="Noc_0064"
     CDS             67546..69540
                     /locus_tag="Noc_0064"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56606.1"
                     /translation="MSSWRDAILNDFVPNVSKLTLVADPDCLMTEEKLALELRGRGFD
                     LIEFSDPVEFRYVYESKYRSIWDRGEHTDLVVVLRLQDAELESLPYDLLQVGRKLSFN
                     LGELFPYLSYPVIEKLDRALLDVLFEAQRKTPSDRLGDNATKDFILRHVFGIAPELIV
                     SEVELLRLLLRLHYGKVQLPRILSDRLVQVLKGQGAFPTWPLDEIVPDEEAFFAFIQE
                     RWPVFLSKLEPGNEVRERSLEEILNYPGPSVLPFDHQDIRVYMDNLFIEGKLTPIQKP
                     EVAIDAGSWIRCGVIEASAGDDEMRISRLFGLVEKSLPTSESRYSDWITFALKWAELS
                     ALVHCGSNREDKARLLQTDNALNATFARWLSVHYASLINLPPNNPAMVHHVPRRLARD
                     LENAKNSRVALLVVDGLALDQWATIRPILQERDRSLIMRESATFAWIPTLTSVSRQAI
                     FSGKPPLYFPSSIKSTHKEEKLWKQFWEGHGLSRLDVAYQRGLGDGDAAGVLDSAIHP
                     GKTKVVGLVVDKVDKIMHGMQLGSAGMHNQIKQWCRGGFLGLLIGYLLDHGYEVWMTS
                     DHGNIECQGKGRPSEGVTAETRGERVRVYPTAELRAQVASKFSFAHEWLPVGLPSDYF
                     PLVAGGSNAFATPDEAIVGHGGITLEEVIVPLVKFERKTR"
     gene            69540..70307
                     /locus_tag="Noc_0065"
     CDS             69540..70307
                     /locus_tag="Noc_0065"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56607.1"
                     /translation="MDKRHEAIGIKQAIRYEWMQKAAYLLLAGLDAKAIRQELHDYLS
                     DRMGSGVRAERSTEARSFAVTILMNIWVTPDPVLETLRNDALPYLAQGRSAELAVHWS
                     MIGAAYPFWFNVARQTGRLLALQDQVTMKQVSRRLIEVYGERQTVSRNAQFVVRSFAF
                     WGVLKDTAQQGCYQKIVSAPISDLNLVSLMLEAALHAIPEGKGTLDLLLNNPAFFPFQ
                     LPLMTGDFIGQRREHIEIIRYGLDDELLMLKKKQGER"
     gene            complement(70800..71636)
                     /locus_tag="Noc_0066"
     CDS             complement(70800..71636)
                     /locus_tag="Noc_0066"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="TrfA-related protein"
                     /protein_id="ABA56608.1"
                     /db_xref="InterPro:IPR010751"
                     /translation="MEHITNKIARMAQEAKTRREAKAKREAETAKIIPLLPCWGKGQR
                     GVPNEMVRSALFSVKNKKQARAYLEGVPIVVVGDGRISYRGQELRQDDEDIWLQIMHE
                     AKARPLGKCVEFKPYALLKGVGWAIKGQSYQRLQISLERMVATALTVSSHRLGKSVTL
                     PLIQKFERDHGRGPWKVWISSEMVVLFGDVHYTRLEWAMRHQLGPIAKWLHGLYSSHA
                     RPYPMKVETLWKGSGSADGLLKTFKVNLKGALNELKAVDFLSDWRIEGNLVYVMRAEK
                     KA"
     gene            complement(71747..72058)
                     /locus_tag="Noc_0067"
                     /pseudo
     gene            complement(72068..72379)
                     /locus_tag="Noc_0068"
                     /pseudo
     gene            72690..72917
                     /locus_tag="Noc_0069"
                     /pseudo
     gene            72989..73324
                     /locus_tag="Noc_0070"
     CDS             72989..73324
                     /locus_tag="Noc_0070"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="ABA56609.1"
                     /db_xref="InterPro:IPR002622"
                     /translation="MMRCSIDLRKRVIDFVRGGGSKAEAARRFQVGRASIYRWLSQDD
                     ALCYERPGPRRSHKLDWEALRVHVEDKADLTYKERARHFGVSYYCIWHAMHKMGLTRK
                     KNDGVHAAL"
     gene            73299..73823
                     /locus_tag="Noc_0071"
     CDS             73299..73823
                     /locus_tag="Noc_0071"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase of IS630 family insertion
                     sequence ISY100h"
                     /protein_id="ABA56610.1"
                     /translation="MTGYTQRCNMKRKSFLRLRERYRRRGKRFVYLDESGFEPEVSRR
                     YAYAPKGRRVYGLISGHRRPRTSLLAARMDEGFEAPFLFEGTCNTAVFNAWLEKELCP
                     LLNSNHIVIMDNVPFHKAVSSREIIKKTGAGILFLPPYSPDFNPIEKDFGNIKKIREY
                     NEHETLENIVAAYQ"
     gene            74420..74746
                     /locus_tag="Noc_0072"
                     /pseudo
     gene            74779..75159
                     /locus_tag="Noc_0073"
     CDS             74779..75159
                     /locus_tag="Noc_0073"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="ABA56611.1"
                     /translation="MTYSSDFHYKVLSVRKKEGVTIAEAVSGFCVGVASVTRWLKGPE
                     PKPSRNKPATKIDMDVMAGDMFGTIRMRINTSERSRFGVRVQGINYALHRLGVSYKKK
                     LDAPKGMRRRTARLPDSHHMAQTE"
     gene            75203..75625
                     /locus_tag="Noc_0074"
     CDS             75203..75625
                     /locus_tag="Noc_0074"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="ABA56612.1"
                     /translation="MPRTHGYAPKGLRCFGERDWDAKGRTHAMGALIGKALLSVALFS
                     VALFNVNVNADVFTAWVAQDLLPKLPAQSIVVMDNATFHKREDTQNMIRNAGDGLLYL
                     PAYSPDLNPIEQKWAQAKALRRQTHRSIDEIFTENQFI"
     gene            75658..76188
                     /locus_tag="Noc_0075"
                     /pseudo
     gene            complement(75986..77884)
                     /locus_tag="Noc_0076"
     CDS             complement(75986..77884)
                     /locus_tag="Noc_0076"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase II"
                     /protein_id="ABA56613.1"
                     /translation="MNFNIGWIARYRNFDTMATFIPALTTIPRMTRGERRFGRRLDSL
                     LEEDYLVWYDIPLGRRRRYPDFIILHPARGLLFLEVKDWKIETIRSITPDSVVIDTQE
                     GRKTVSNPLAQARQCAFAAIDQLKRDPQLTQSDKCYRGKLCFPYGHGVVFPNITRRQW
                     NQAIPEAEQEILLPAHRVICKDEMLTTADPEAFQQRLWNMFDYRFGEQFSVPQLDRIR
                     WQLFPEVRIDAPTTDLFGNDEAAEDEPASNLVPNIVRVMDLHQEQLARSMGDGHRVIH
                     GVAGSGKTLILGYRCLHLAQAISKPILVLCFNITLAARLRCFIAEKGISEKVKVHHFH
                     EWCSLQLKTYQADLAPGKGPIWERQVESVIRAVDQSRIPRAQYGAVMIDEGHDFEQAW
                     LKLVVQMVDPDTNSLLLLYDDAQSIYQKSSLKFPLSSAGVQARGRTTILKLNYRNTRE
                     ILTFAYDFAQDFLKAHDADDDHIPLIAPEVAGVSGPRPAFRRLSSPRDEARYLVRCIQ
                     TWRSQGSGLNSIAVVYTGNSQGRLFYDALREASIPSRCLQQSADKRSYDPQADEVVLL
                     SRQSSKGLEFDTVLLCGLGALSNDEERLAQEARLLYVGMTRARRRLLVTSCKPNWYTQ
                     RLTELASA"
     gene            78286..79368
                     /locus_tag="Noc_0077"
     CDS             78286..79368
                     /locus_tag="Noc_0077"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate transporter/malic acid
                     transport protein"
                     /protein_id="ABA56614.1"
                     /db_xref="InterPro:IPR004695"
                     /translation="MNSTNRKAPIRQASSSHPFKNMKDLSPASFGMVMATGIVSLAAH
                     LLAMPVIADILFRLNIITYGVLWLLTVARLVGYPRYFFTDLSDHSSGPGFFTMVAGSG
                     ILGSQFVVLSGNISMGLAMWFVTIGLWLGTTYTIFTAFTIKREKPLLSRGLNGGWLLA
                     VVAAESIAVLSALLANHASQSYELELNFLAFLMWLWGGMLYIWIISLIFYRYTFFLFS
                     PKDFSPSYWINMGAMAISTLGGSLLVSNAANAPFLHSLLPFIKGFTLFYWATSTWWIP
                     ILLILSVWRYACMRLSLNYDPLHWGVVFPLGMYAASSHEMATVMALEFLSFLPPLFLY
                     AALLVWVVVFVSWILTLLRRIGICCF"
     sig_peptide     78286..78429
                     /locus_tag="Noc_0077"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.962) with cleavage site probability 0.269 at
                     residue 48"
     gene            complement(79413..85016)
                     /locus_tag="Noc_0078"
     CDS             complement(79413..85016)
                     /locus_tag="Noc_0078"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="UvrA family protein"
                     /protein_id="ABA56615.1"
                     /db_xref="InterPro:IPR001687"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004602"
                     /translation="MSKAFIKVKGARQNNLKGLNLKFPLNELIVITGVSGSGKSSLAF
                     DTIYAEGQRRYVETFSPYARQFLDRMDKPQVDRIEGIPPAIAIDQINPVRTSRSTVGT
                     MTELNDHLKLLFARAGKLYCQGCGQGVRRDTPEGIYKELLLHSQEQDDTPRILITFEI
                     TVPENFSFQEVKDQLLRQGYTRFHHQHDQVLEAIQDRVRLEPSRRERIMEALETALKH
                     GRGHVTVYPLDEHRQPQQPWRFSSDLHCPQCDIAYQDPFPSLFSFNSPLGACGTCRGF
                     GRTMGIDYDLVVPDENKTLAEGAIKPWQSASYEECQQDLMRFARKRGIPTRLTWRELT
                     PEQQHWVLAGEGEWEENKWYGVQRFFDWLESKSYKMHIRVLLSKYRAYHLCPTCQGAR
                     LKPESLLWRLGTKAGADEVLPDKRRFMPAGVRFSQRRLAALPGLTLHDVMQLSLKRCQ
                     QFFAQLTLSAPLDEAADLLLGEIRSRLNYLVEVGLGYLTLDRQSRTLSGGEVQRINLT
                     TALGTSLVNTLFVLDEPSIGLHARDLQRIIRILQRLRDAGNSLLLVEHDSQIMLAADR
                     ILDLGPGPGERGGQQVFFGPPQELMQAKRSLTGQYLTGKKRVVSERRKTRKLPASAYV
                     EIRGAAEHNLKNIDVRFPLNGLVCVTGVSGSGKSTLIQEILYKGLRKLKGKPVGTPGR
                     HQALEGHEHIQTVVLVDQSPIGKTTRSNPISYVGALDGLRKAFAAEPLAQERGYHAGT
                     FSFNTGKGRCPTCGGRGFEQVEMQFLSDIYLRCPDCNGQRYRPEILEVKLQPSAQGLG
                     KSIAEVLAMTVAEALDFFADYPEIKRGIEPLQAVGMGYVTLGQPVPTLSGGEAQRLKL
                     AGHLAKARGNKQGRNTLFLLDEPTTGLHFDDIATLLQAFYRLLAEGHSLVVIEHNLEV
                     IQAADWIIDLGPEGGEGGGKVIAMGSPQKVARSQHSHTGQALRDHAQAFDEIFQAASA
                     VGEAPAQYRTACGTAQTEAAPQESGAAAEGNGFIYIHNAREHNLKNIDVQIPRERLTV
                     ITGISGSGKSTVAFDILFAEGQRRYLESLNAYARQFVQPAARPDLDAIFGIPPTVAIE
                     QRTSRGGLKSTVATLTEIYHFLRLLFVKLGQQHCPDCKIPIEAQTLEAIQARLMGDYR
                     NRRLGILAPLIVARKGYYTELAKWAAAKGFTHLRVDGTLLPTDPWPRLDRFKEHSIEL
                     PVGELKVTPAAEKELHALLEQALNLGQGRVEILLPQKKQKILYSTQRACPSCSRSFGE
                     LDPRLFSFNSPQGWCPRCYGTGRVLPNFDGEQTGEEKEWAEKQGNPGQICPTCQGQRL
                     QPEALAVRFQERNIAEFTGMPIAVAEATFQSMKLQGRAADIARDILPELRTRLKFLRE
                     VGLSYLTLDRAAPTLSGGEAQRIRLASQLGSNLRGVCYILDEPTIGLHPRDNRMLLNT
                     LGKLEGQGNTIVVVEHDEDTIRRAEHVIDLGPGAGVNGGKVVAAGTVEALLQHPESVT
                     GRCLAQPLPHPLMEKRRPETAEAHLEIRGASLHNLKSLTLRLPLRQLVGVSGVSGSGK
                     STLIRQVLHGNLLRLLNRKQTAQHKETTTFQGCQEIRGWKAIQRVLEVDQTPIGKTPR
                     SCPATYVGFWDSIRRLFADTPEARIRGYGAGRFSFNTKEGRCPECEGQGVKRIEMSFL
                     PDVTVPCESCRGARFTQETLMIRYKDKNIGEILALSVDQAVEFFAAHKRIHRPLQLLQ
                     AVGLGYLSLGQPSPTLSGGEAQRIKLVTELAKAPLNPYRSANQHTLYLLDEPTIGLHM
                     ADVEKLIRVLHQLVEVGNTVIVIEHNLDIIAEVDWLIDLGPEGGDGGGQIVAQGTPET
                     VAKVKKNSYTAKFLTRFLKTRRAIN"
     gene            complement(85072..85677)
                     /locus_tag="Noc_0079"
     CDS             complement(85072..85677)
                     /locus_tag="Noc_0079"
                     /EC_number="3.2.2.21"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase II"
                     /protein_id="ABA56616.1"
                     /db_xref="InterPro:IPR003180"
                     /translation="MTDLLPPRFYARDALEVAADLLGASLCREQVVLRITEVEAYRWP
                     EDTANHGRHGQTLRNEPLWGPPGRVYLYLCYGIHHLLNLVTGEEGQAAAVLIRACEPV
                     AGLDLIQRRRRGKIKPGLLTGPGKVGAALGLDLSWNHHPLYEPGGLEVRRGTPVAALL
                     AGPRVGIAYAHPEHRDAPWRLAIPDNPWVSCRSQLQPRQQN"
     gene            complement(85910..86765)
                     /locus_tag="Noc_0080"
                     /pseudo
     gene            86929..87738
                     /locus_tag="Noc_0081"
     CDS             86929..87738
                     /locus_tag="Noc_0081"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56617.1"
                     /translation="MFSEEVLSRYFDHPEWYEIDDSLSGGHIWAKSEAPENRYLYVRH
                     GKRKLDNGQAAVTAIFKDLYAMSPEEQRHWHAYELSEARFDSNDPNFARFVARTYDGA
                     WVDFPKPLQEVLNRITEINQLFGEELLFKKCQNDHFRPPVENTRKSYYDSCSEFYKLI
                     GPDSLNQKLIKNILKKEFSIADVELIHTESKRPLGTIQLLELLEEKMGIDGVISSQIR
                     LIGKDRMEADHKITSSVIEEHNFTEEFISLCQNFSCAANQFKQRLQQHALT"
     gene            87829..88731
                     /locus_tag="Noc_0082"
     CDS             87829..88731
                     /locus_tag="Noc_0082"
                     /EC_number="2.8.2.1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Sulfotransferase"
                     /protein_id="ABA56618.1"
                     /db_xref="InterPro:IPR000863"
                     /translation="MNKIGFPTKEKELHNHHIDSTIWNDLRFRDDDIIISTYAKAGTT
                     WMQQIIAQLLFNGAEGLDVAEISPWVDLRVPPKEVKLPLIEAQSHRRFLKTHLPVDAL
                     VFSDKAKYIYIGRDGRDVVWSLYNHHLNANTAWYEALNDTPGRVGPPIEPPPSSIIQY
                     FNDWLDNDGFPFWSFWENVRSWWEIRNLPNVLLVHFAKLKEDMPGEIRRISEFIDTPI
                     DESNWEKILRHCSFDYMKTNATKSVPLGGAFWDGGAETFIHKGTNGRWRELLSAEDIA
                     RYDDRAVSEIGSNCAHWLATGELR"
     gene            88891..89154
                     /locus_tag="Noc_0083"
     CDS             88891..89154
                     /locus_tag="Noc_0083"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF497"
                     /protein_id="ABA56619.1"
                     /db_xref="InterPro:IPR007460"
                     /translation="MDEFEFDEAKSQANLDKHGINFVAAQGLWKDPCLLEIRAKSEGE
                     PRFLLIGKIGEKHWSAVVTYREACIRLISVRRSRKKEIELYES"
     gene            89144..89413
                     /locus_tag="Noc_0084"
     CDS             89144..89413
                     /locus_tag="Noc_0084"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56620.1"
                     /translation="MKAKDFDKKFDEGQEDIIDDLDLSTARRTNLEQKRINVDFPAWV
                     VESLDREAARIGVTRQSIIKVWLVERLQAESANKPLNGDASGGAH"
     gene            89460..89768
                     /locus_tag="Noc_0085"
     CDS             89460..89768
                     /locus_tag="Noc_0085"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF497"
                     /protein_id="ABA56621.1"
                     /db_xref="InterPro:IPR007460"
                     /translation="MGYPHSMNESHFEWDEAKNTANQRKHGVSFYEAQYAFLDPKRVI
                     AEDLSHSQNEKRYYCFGTNREGTGIITVRFTYRSGRIRIIGAGYWRKGKKVYEQANSV
                     "
     gene            89746..89982
                     /locus_tag="Noc_0086"
     CDS             89746..89982
                     /locus_tag="Noc_0086"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Helix-turn-helix protein, CopG"
                     /protein_id="ABA56622.1"
                     /db_xref="InterPro:IPR002145"
                     /translation="MSKRIRYSEEPIGEIKLVPDFLPSPEELALKNEQTKVTISLSSE
                     SVAFFKEEAKKHRMQYQKMIRQLLDEYVAQQKRR"
     gene            90148..90867
                     /locus_tag="Noc_0087"
     CDS             90148..90867
                     /locus_tag="Noc_0087"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF541"
                     /protein_id="ABA56623.1"
                     /db_xref="InterPro:IPR007497"
                     /translation="MTESNKSNAIVLGVCLIIALSSLGYLLGNAAIRFKEYERTVTVK
                     GLSEREYSADIVIWPIQFSTASNDLEEMYRSIDASTEKIKSFLESAGVNADEISYSLP
                     AITDKSAQQYGNQAKSEFRYTASQTVTVYSKNINVVRDVMGNMSDLGKRGIVFTGGDY
                     QSQTEYIFTRLNQVKPEMIEEATRKAREVAEKFAADSKSTLGKIKSASQGQFSISARD
                     KNNPHIKKVRVVSTVAYYLSD"
     sig_peptide     90148..90222
                     /locus_tag="Noc_0087"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.955) with cleavage site probability 0.555 at
                     residue 25"
     gene            complement(90979..91290)
                     /locus_tag="Noc_0088"
                     /pseudo
     gene            91778..92896
                     /locus_tag="Noc_0089"
     CDS             91778..92896
                     /locus_tag="Noc_0089"
                     /EC_number="1.7.2.1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="dissimilatory nitrite reductase (NO-forming),
                     copper type apoprotein"
                     /protein_id="ABA56624.1"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR001287"
                     /db_xref="InterPro:IPR002160"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /translation="MKKLIKYFAFYLATFSSVLYADGEASSYIANIGTHANLKDLERV
                     RQELVAPPHLPDHQQAYSGKPRIVEIEMVIEEKEVEIEPNVFVQAMTFNGTNPGPIIV
                     VHEGDYVELTLKNLDTNMLLHNIDFHPATGALGGGALTKVAPGQQVTLRFKADKAGTY
                     VYHCAPGGLMTPYHVVSGMYGAIMIFPKKGLRDQNGKKVTYDKAYYVGEQGWYIPKDK
                     NGKYKRYANAIEPYGDTLEVMRGLVPTHVTYNGSKGALTGDNAMKAKVGDSVLFIHSQ
                     ANEDSRIHLIGGHGDLVWPGGSFKNTPMVDKETWHVNGGESVAALYTFKQPGLYAYLN
                     HNLIQAFMLGGAAHVKVDGEWNNDLMEQVVKPSPINAD"
     sig_peptide     91778..91843
                     /locus_tag="Noc_0089"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.997) with cleavage site probability 0.975 at
                     residue 22"
     gene            92886..93251
                     /locus_tag="Noc_0090"
     CDS             92886..93251
                     /locus_tag="Noc_0090"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56625.1"
                     /translation="MQIDTPNKKRQQMLCTAARRESEILPYEIGNALSIMIKRKRLTH
                     NEALSAFKITSLIHVRLVAIDIQQALKLAFEFNIYAYGAYFLQCAQSLSCPLITLNKR
                     MKQVSVQDILNAIRDSRKG"
     gene            93439..93750
                     /locus_tag="Noc_0091"
                     /pseudo
     gene            94010..94753
                     /locus_tag="Noc_0092"
     CDS             94010..94753
                     /locus_tag="Noc_0092"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56626.1"
                     /translation="MGALYLIDMPEYVYIILLSLLAGAAMPVGALLARLDVMHPAFLR
                     QKSRQFMVAFGGGALISAVALVLVPDGASKLSPLTAALCFGAGGVFFYLLDMLLNQLK
                     SSAGQLVAMLSDFIPEAIALGAAFAVGESTGLILALLMVLQNLPEGFNAYEELENSAK
                     LAPNKILMAFASLALAGPVSALTGYFVLAESHQFVAGLMLFASAGILYLVFQDIAPES
                     KAKNSGFPALGAVAGFMLGLVGNMLIVPA"
     gene            95115..95894
                     /locus_tag="Noc_0093"
     CDS             95115..95894
                     /locus_tag="Noc_0093"
                     /EC_number="1.1.1.303"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Glucose/ribitol dehydrogenase"
                     /protein_id="ABA56627.1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /translation="MSINGKVALITGAGQGIGRAIALRLANDGADIAIVDLNEEKMGA
                     VADEVRAAGRKATTFKADVSKRNEVYAAVDHAEKELGGFDIIVNNAGIATIQSIAEVT
                     PEEVEKIFKVNIEGVLWGIQAAGAKFKEREQKGKIINAASIAGHESMPLLGVYSATKF
                     AVRALTQAAAKEFASDGITVNAYCPGIVGTDMWVEIDRRMAEITGAKIGENYDRYVGD
                     IALGRAQTPEDVASFVSYLAGPDSDYMTGQAPLIDGGLVYR"
     gene            95970..96542
                     /locus_tag="Noc_0094"
     CDS             95970..96542
                     /locus_tag="Noc_0094"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent FMN reductase"
                     /protein_id="ABA56628.1"
                     /db_xref="InterPro:IPR003680"
                     /db_xref="InterPro:IPR005025"
                     /translation="MIKIAVIIGSTRPKRVGESVARWVYDIAVQRSDAEFELVDLKEF
                     DLPLLDEPVPPSMGQYSQPHTKAWAAKVASFDAYVFVTPEYNHGTPGALKNALDFVYA
                     EWNNKAAGFVSYGSAGGARAVEQLRLVASELQMAHVRNQVMFSFFTDFQNMSEFTPHE
                     RHQKSVDDMLDQLIAWGGVLKTLRENAKAK"
     gene            96585..96945
                     /locus_tag="Noc_0095"
                     /pseudo
     gene            97214..97411
                     /locus_tag="Noc_0096"
     CDS             97214..97411
                     /locus_tag="Noc_0096"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56629.1"
                     /translation="MKVIYFEDTDTLYIKVRGSDIAESKDLDENTIFDMEANGNVRTI
                     TFEHASQRTNVSRLIVEGIAA"
     gene            97494..98048
                     /locus_tag="Noc_0097"
     CDS             97494..98048
                     /locus_tag="Noc_0097"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56630.1"
                     /translation="MRFKGVHHIEFSVLNYEESIRFFDQMFGWLGYRSFWTLDIGYRS
                     TYYMARFPFFHSYIGIQPAKTGNKLVHVDRTTGVHHIALWARNRKEVDDFHMEFLLKN
                     NIAVTNPPSEYPTYTPGYYAVFFNDPITGIHFELSHTPMLPSLSSYLAWIRALKNIWR
                     KHPEWKAPPWKESMRKLPSRHEQA"
     gene            98555..99265
                     /locus_tag="Noc_0098"
     CDS             98555..99265
                     /locus_tag="Noc_0098"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56631.1"
                     /translation="MKKTRLPLQRKAQLHPSKEEKTPLSQQELLRISQETRDCFLPPA
                     SPDKTQLGLMVVNPYRVYAYWSILNQDLIRAHKKLGIKKSAQWALRFYDFTAGKLAIS
                     SSFEVAIPRKAHHWYIDLWADNKHYMAELGLADSEDQFVALARSNMIETPRAGSADPT
                     APVIFTGHDLQPFHPAKTFPLEFSVSPEERAVRSQELTASYFSFLAESSQIQPKENML
                     SKPKSLSQWSASLPKRRY"
     gene            99270..100871
                     /locus_tag="Noc_0099"
     CDS             99270..100871
                     /locus_tag="Noc_0099"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="(1->4)-alpha-D-glucan branching enzyme"
                     /protein_id="ABA56632.1"
                     /db_xref="InterPro:IPR004300"
                     /translation="MASGYLSLILHAHLPYVRHPEQEEALEERWLFEAMTECYLPLLT
                     TFERLTNEGIPFYLTLSLSPTLLSMLQDPLLLQRYGLHMEKLISLAEKEIRYTRGNTD
                     LNRLARLYRRWFLQTLSDFEERYQRQLVPAFARLQQEGVLEIITCAATHGFLPLLQPE
                     PTAVYAQLQVAADYYRQCFGIAPKGIWLPECAYYPGLEKVLKAVGFRYFFIETEALLH
                     ASTRPRYDHFAPVACPNGVAAFGREPALSRQVWSAEEGYPGDGDYREFYRDVGFEREL
                     SYLQPYLPDGRIRVDTGMKYYRVTDKTEYKAPYQPAKAQARVACHAGHFYHHCLQQIT
                     GANRMDRPPLLVAPYDAELFGHWWFEGPQWLEQLLRRIGTGEGAIQTITPSQYLTQHP
                     VLQQATPNLSSWGDRGYYDFWLNEKTDWIYPLLHRAARRMKELTIAYGHESKGTLAGR
                     ALGQAARSLLLAQASDWPFILQNGTTVEYATRQLQDHLSRFHYLEMVLERKSFDERRL
                     QALEALDNIFPELDYRVYKHPYRER"
     gene            100934..102397
                     /locus_tag="Noc_0100"
     CDS             100934..102397
                     /locus_tag="Noc_0100"
                     /EC_number="2.4.1.21"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycogen/starch synthase, ADP-glucose type"
                     /protein_id="ABA56633.1"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR011835"
                     /translation="MYIVMITPECAPIAKVGGLGDVVQGLSNELSIRGNTVELILPKY
                     DCMRYERIWGLEKTHNNLWVPYHDQWIPCDVYFGFAEGLKCFFIEPHNGFFQRGTYYG
                     QPDDPQRFAFFCKAALEFMLRSNKYPEIIHCHDWQTGLVPVLLFEQYKYLGMTHPRVC
                     YTLHNMRHQGVTGGHILQQVGLDPAAYMTPERLLDHTYPHGVNLMKGGIVFSNFITTV
                     SPRYLDEIRYTDQGYGLQHTLHEHSQKLGGILNGVDYKVWNPDIDPYIAARYNLKTLD
                     KKYENKTALRHRLWLRDEYKPIVGVISRLDPQKGVELIRHALFYCLANGCQFVLLGAS
                     ASNSINADFWYLKQYLNDDPDCHLEIGYDEDLAHQIYAGADMLIVPSIYEPCGLTQMI
                     AMKYGTVPIVRHVGGLADTVFDANYAHKPYHERNGFVFHDFNHEGIEAALHRAIGLWY
                     EYPQYFRELMENGMRYDFSWNHPGQHYLNIYHHIQEI"
     gene            102414..104069
                     /locus_tag="Noc_0101"
     CDS             102414..104069
                     /locus_tag="Noc_0101"
                     /EC_number="1.4.1.13"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Ferredoxin-dependent glutamate synthase"
                     /protein_id="ABA56634.1"
                     /db_xref="InterPro:IPR002932"
                     /translation="MSSLKLSVKRFNSDVLKRAIVPIMAGGLSLIFLSLVTVSPWWLL
                     GLTVTLPLVALGVYDWVQQCWTLTRNYPAAARIRWLFYDLRPYLRAYIVEDDLEGKPF
                     SFDARNLVYARARGKTDTHPFGTERDLASDEYEWLCHSMAPAENPEKNPRVSIGSAQC
                     EQPYNASLLNISAMSFGSLSARAVEALNKGARLGGFYHDTGEGGISPYHLKWGGDLVW
                     EIGSGYFGCRDDKGNFDPGLFHESATRNEVKMIEIKLSQGAKPGYGGLLPAAKVTEEI
                     AWVRKVPKGQDCLSPRSHSAFSTPLEMLEFAARMRQLSGGKPVGIKLCVGQVHEVLAI
                     MKAMLKTGIHLDFIVVDGGEGGTGAAPVELSDYVGMPLTEGLMVVRNALVGTGLRDKV
                     RLGASGKVYSGAGMARNFAIGADWCNAARAFMFSIGCIQAQRCHLGTCPTGVTTQDPG
                     RQRGLVVDVQAKRAARFHQQTLTALGHIVAAAGLAHPRDLQPYHLIRRVGTAEAKLFD
                     RIYPFLPENALLEGAEDTPYSEWWQAANPASFRPRIDLAAARI"
     gene            complement(104323..104952)
                     /locus_tag="Noc_0102"
     CDS             complement(104323..104952)
                     /locus_tag="Noc_0102"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="CBS domain containing protein"
                     /protein_id="ABA56635.1"
                     /db_xref="InterPro:IPR000644"
                     /translation="MDNGYFKLATHSLPKNTQVFQFLQNLPEKVTMASPAIDVMTDLR
                     RVKAVTVSSDLSIDSALQKMISEGVRLLLVTASDGAVIGAITAHDILGEKPIRLISQE
                     HIPHSEIQVAHVMTPRNQLEALDMEDVYQASVGDVVEVLREARRQHALVLDRSTETTG
                     PLVRGIFSITQIGKQLGMEIQATGRVQSFAEMEAWLIHGEMGMSSAVVS"
     gene            complement(105189..105731)
                     /locus_tag="Noc_0103"
     CDS             complement(105189..105731)
                     /locus_tag="Noc_0103"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56636.1"
                     /translation="MNSIQKTGNGIIRKFKRLISWFFMAALGAGAGAIGTPSADSQIP
                     KAKESYYLGEKLRGQQVRFVVNGASAPDEVDSNAIDAESLGVKRVFIYGITARDERFR
                     PSNWAERLYYTGASYSSNHTAIFNPHLNMGVSPQGIKCVMVDAELQLENPMLFDFLIG
                     FAKDNKLVMRDQNGNLLTAV"
     sig_peptide     complement(105612..105731)
                     /locus_tag="Noc_0103"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.578 at
                     residue 40"
     gene            complement(106087..107157)
                     /locus_tag="Noc_0104"
     CDS             complement(106087..107157)
                     /locus_tag="Noc_0104"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound metal-dependent hydrolase"
                     /protein_id="ABA56637.1"
                     /db_xref="InterPro:IPR007404"
                     /translation="MDIVTQGLLGAVVAQSAARPSQARLAAAVGFIAGLLADADIFIR
                     SPDDPLLVLEYHRQFTHSLLFVPIGGLVATVLLWPFLRRRINFGQLYPLAVLGYLPSG
                     LLDACTSYGTQLFWPVSEARIAWNLIAVVDPLFSGVLIIALGWGLLKSTPLPARLGLG
                     IAVLYLLVGLAQRERVENFITTFAESQGQRIERLEAKPTLGNIILWRTIYETNGRFYV
                     NAVRAGVFSEPRIYPGSSIEHFSPERLDGLKTGSVLAQDIDRFTDFSDGYIIQYPNQP
                     CILGDIRYAMLPTQLIPLWGIELDLARQNQHVRFRTFRHLDKVTRRAFLDMLLGRPLE
                     QAASPSPDSNSDASAQLRCRPD"
     gene            complement(107269..108123)
                     /locus_tag="Noc_0105"
     CDS             complement(107269..108123)
                     /locus_tag="Noc_0105"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56638.1"
                     /db_xref="InterPro:IPR008262"
                     /translation="MREESVRLGLLGKVPLGTANRDFRNYGIALIVFASIALCLYLDA
                     DATLTFQNFLGVCAWVFLFALLRGESGLVRAQVLVAVAFATIGEHFASPYMEGYIYRF
                     HNVPAYVPPGHGMVYLTAVALARSELFKQNLKVITATVLTAGGLWSLWGVTIAPQGDM
                     VGALLFIVFVLFVLFGRSPGVYLGAFFVTTWLELIGVSCGTWRWVPIDPVLQLPQGNP
                     PSGVAAWYCLVDAVALGVAPAVVRGFQRVHTAFWQQYFYPQVVPRLLFAPYLQQDYIP
                     VLVPAIWP"
     gene            complement(108238..108792)
                     /locus_tag="Noc_0106"
     CDS             complement(108238..108792)
                     /locus_tag="Noc_0106"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF924"
                     /protein_id="ABA56639.1"
                     /db_xref="InterPro:IPR010323"
                     /translation="MLLNSMHHQQIIDFWFKEIKPESWWKKIPHFDQLIKERFKAHHR
                     AAVQGELYEWRREPFGRLAEIIILDQFSRNIYRNHPLSFAYDTAALILSQEAIDKNVG
                     KMLNSEHKIFLYMPFMHSESLKIHQIGIKLFAEPGLESQYDCEIKHQAIITRFGRYPH
                     RNQILERPSTPAEIAFLKKADSSF"
     gene            complement(108917..109843)
                     /locus_tag="Noc_0107"
     CDS             complement(108917..109843)
                     /locus_tag="Noc_0107"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="ABA56640.1"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR005913"
                     /db_xref="InterPro:IPR008030"
                     /translation="MVKIISPLPNLITVFGGTGFLGRAIVHRLVESGMRVRIVARHPR
                     APNLAGARGQIALQRADVRDEDSVAEALKGATGVVNAVGLYVEQGQATFRAIHEEGAE
                     RVARRAGEAGIRRLIHISGIGVDPASASKYARARAYGEQRVREIFPNATILRPSVMFG
                     PNDAFLNSLKTVTRLPVVPLFGQGSTRLQPVYVEDVARAVLQVLEMPEASGKTFELGG
                     ARAYRYRDIIEQVLTHLSRRRLLLPVPFVVWRLLARIASLLPNAPLTLDQVILMETDN
                     VANAKASTFNDLGIEPCSLEQMLSACLDELSC"
     gene            109886..110800
                     /locus_tag="Noc_0108"
     CDS             109886..110800
                     /locus_tag="Noc_0108"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="MscS Mechanosensitive ion channel"
                     /protein_id="ABA56641.1"
                     /db_xref="InterPro:IPR006685"
                     /translation="MPNTTQNAPTNVEEIATSMQDTVLGIWADFVNHSPFLVMGALIL
                     LFTWGISALAARLMDASLRHSKMRGSLRELFVRLLSIGIWITGILLAAMVTFPGLTPA
                     RALSAMGIVSIAVGFAFKDIFENFFAGILLLWRFPFEKGDFIECEGISGQVEHISVRQ
                     TLIRQTSGELVIAPNSFLFLNPTKVLTNLPRRRITIITGIAYGENVTEAVRVIEHAVD
                     ECRTVHKDRPLEIFPQAFGASSIDIEVTWWADPTPVDVRRSRGEVVTAIKGALDEAGI
                     EIPFPYRTLTFKHPLETVSLEKSEGEIS"
     gene            complement(111011..111931)
                     /locus_tag="Noc_0109"
     CDS             complement(111011..111931)
                     /locus_tag="Noc_0109"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Formate/nitrite transporter"
                     /protein_id="ABA56642.1"
                     /db_xref="InterPro:IPR000292"
                     /db_xref="InterPro:IPR002119"
                     /translation="MKASHTMSETDKPIPQEAPPVNHPVAGGSTIAGNPVPAKSSDFT
                     VLDAVPPAQMGRDIAEDAVKKDKFTTSNILIRGFLCTPFLAYATALSALLVAQGWSSA
                     AAGLIFPVGYIMLATLGFEMATGSFSVMPIGMYAGRVKAWRVVRNWSWTLLGNLLGGL
                     FFAWLLWFSLTKGGAAAPPGVLTTLAHLAEKKASYVDYGAIGWLAAVGMGILCNWLVS
                     LAPVFAKAARSVPGKVMLMWFPLATFFALGFEHTVVNMFVFPVGILAGAEVTLYDWWM
                     WNQIPVTLGNILGALIFNATLWYYTHSINP"
     gene            complement(112457..112972)
                     /locus_tag="Noc_0110"
     CDS             complement(112457..112972)
                     /locus_tag="Noc_0110"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56643.1"
                     /translation="MFKNHKHYAMSVAAIILGFFSLPAFNAWAQEPYIFRETPQLAAI
                     PQIQSYDPELNELYEINGFNLETAEVTDHWEDFKFKNEEGVDVNDLHVIFSVDEIKTQ
                     KKGPFGKAVTEDKSTTAGTRSEITLEKGTVKDGETAKISFDADKSYEITHWWWTVDRV
                     RVGTIKDGSPD"
     sig_peptide     complement(112883..112972)
                     /locus_tag="Noc_0110"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.945 at
                     residue 30"
     gene            113444..116266
                     /locus_tag="Noc_0111"
     CDS             113444..116266
                     /locus_tag="Noc_0111"
                     /EC_number="1.2.4.2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate dehydrogenase E1 component"
                     /protein_id="ABA56644.1"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR011603"
                     /translation="MDATVKKQASPSPLNAANASYLEALYEKFLKDPNTVPAHWRIWF
                     KRLQAGVPEQAAPEFPARSPGPAVQPSAPSAVMTEGLTAEAAEKQIAVLQLINAYRFR
                     GHQKANIDPLRIYDRPVVSDLDPVFHGLTEEDMGKVFSTGSLIGIDQAPLEEIFALIK
                     KIYCHTIGAEYMHITETAEKRWIQSYLEGAQDDPGPSVELQRHILERLTAAEGLERYL
                     HTNYVGQKRFSLEGGDSLIPLLDNLILYAGSKGVGEIVIGMAHRGRLNVLVNTLGKLP
                     RDLFMEFEGQHETDNKRSGDVKYHLGFSADGDTPGGPVHITLAFNPSHLEIIDPVVEG
                     SVRARQQRRKDWLGDEVIPVLIHGDSAFAGQGVVMETFNMSQSRGFFTGGTLHIVINN
                     QIGFTTSNPLDTRSTVYCTDVAKMVQAPIFHVNGDDPEAVIFVTRLALDYRMTFKKDV
                     VIDLVCYRRQGHNEADEPAVTQPLMYQKIRSHPTVRHLYAERLAAQNIIASEEADRMM
                     NNYRQTLEQGTNVAPYAEEGARSSRVNWKPFLGTQWDQPVETEVPLPRLQELAAHIQQ
                     LPKGFELHSRVGHILADRRKMAAGALPIDWGFAETLAYATLLNEGFSVRLTGQDSGRG
                     TFFHRHAVLYNQKDGQVYVPLEQVNPVQTDFSIIDSLLSEEAVLAFEYGYAATEPNTL
                     VIWEAQFGDFVNGAQVVIDQFLASGEAKWSRLCGLVLFLPHGYEGQGPEHSSARLERF
                     LQLCAEDNIQVCVPTTPGQMFHMLRRQMLRPYRKPLVVMTPKSLLRHRLSVSSLDEFC
                     SGAFRLVIGEVDDIKPAMVNRVILCAGKVYYDLLQARREQKRQDVAILRLEQLYPFPQ
                     QQLERELERYRKAREIVWCQEEPQNQGAWDQLHRPLQGCLSRNQSLHYTGRASSAAPA
                     VGYFNLHLEQQRAVVEEAFGSMKESQ"
     gene            116282..117589
                     /locus_tag="Noc_0112"
     CDS             116282..117589
                     /locus_tag="Noc_0112"
                     /EC_number="2.3.1.61"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate dehydrogenase E2 component"
                     /protein_id="ABA56645.1"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR006255"
                     /translation="MGTEVRVPRLPESVTEAVVGDWHKKPGDRVQRDETLLDLETDKV
                     VLDVPSPGAGVLREVKKEKGATVGSEEVLGIIEAAGEAEEETAQESSPKSTPSKQAPE
                     SKTQATEKKKTRADSPETAFPSKETEAEKMPPLSPAVRRLVREHQLDPRGIPATGRDG
                     RLTKADVVQFLQAEEEQEPAATPPPTEPEAPETKPAPAPREEGYGVRREAMSRLRQRI
                     AERMLESQQTTATLSTFNEVNMQGIMELRHRYRDAFEERYGVRLGFMSFFIKACIEAF
                     KRYPVVNAAVQDDDILYYHYYHIGIAVATPRGLVVPVLRDADQLSFADIELQIMDFAE
                     RARSGRLTIEELSGGTFTITNGGVFGSLLSTPILNPPQSAILGMHKIEDRPVAENGEV
                     KIRPMMYVALSYDHRLIDGKGAVQFLVAVKEALEDPVRLLLEV"
     gene            117611..119053
                     /locus_tag="Noc_0113"
     CDS             117611..119053
                     /locus_tag="Noc_0113"
                     /EC_number="1.8.1.4"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="ABA56646.1"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR000205"
                     /db_xref="InterPro:IPR000815"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR006258"
                     /translation="MSERYDVVIIGAGPAGYTAAIRCAQLGLQTACIDKWIAADGRPA
                     LGGTCLNAGCISSKALLDSSELYQRAQKEFAEHGIKVEQAGVDVTAMQARKDRLVHRL
                     TANIAALFEDRQIKWLPGHGRLLEDNRVEFTPHGLDRPEILAAKSVVLASGSQPMELG
                     AAPIDGERVVDSTGALSFQEVPQRLGIIGAGVIGVELGSVWTRLGAKVTLLEAQDTLL
                     PMADITISQEAYKQFKDQGLDIRLGARVVSTRVSSKQVTVCYRIGEKEYELEVDKLVV
                     AVGRQPCLDNLFALEAGLLLDERGFIHVDEYGTTNLPGVYAVGDVVRGPMLAHKGSQE
                     GIAVAETIAEGKKTAVKRNSIPWVIYTEPEIAWAGRTEQALRDADIDVRVGTFYFADS
                     ARANVMSGSKGLVKIIADAMTDQILGVHIIGPWASELIAEAVLAMEFAASSEDLARTI
                     HAYPSLAEALHEAALDVDNRAIHKIGRKKE"
     gene            complement(119410..120861)
                     /locus_tag="Noc_0114"
     CDS             complement(119410..120861)
                     /locus_tag="Noc_0114"
                     /EC_number="1.11.1.5"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Di-heme cytochrome c peroxidase"
                     /protein_id="ABA56647.1"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR004852"
                     /translation="MRKKTILPFCLLLAGIPLYAVANQEPSIPTNGPNSHGHLTLFSY
                     LSANNLAYSGANYRLPLPATDSDFYDHGRPDPAKFQLGKFLFFDKILSGNQNISCATC
                     HHPLAATGDGLSLSVGEGGRGLGITRNTGFGNEAIYERVPRNAPPLFNVGAKHMTVMF
                     YDGRAEVDSLAPSGFNTPAGDELPIGVLENVLAAQAMFPVTSNSEMAGQPGENPIADA
                     AEAGNLAGPGGVWEQLANRLKANEEYAQLFNQAFALTPEQITYAHAANAIAAFEAAAW
                     RADHSPFDRYLRGDKEAMSRESIQGMSLFYGKAGCSQCHSGVFQTDMQYHAIAMPQIG
                     PGKGDGAEGHEDFGRERVTHDPADRYKFRTPPLRNVALTGPWGHDGTYNTLEAVVRHH
                     LDPVSSLLTYSCLREAQLPYREDLDFFDCLVQNDSAKVNLIAAANTLPTRELSDDEVK
                     HLLAFLHALTDPISLDLRGDIPDRVPSNLTLVE"
     sig_peptide     complement(120793..120861)
                     /locus_tag="Noc_0114"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.981 at
                     residue 23"
     gene            complement(121067..122944)
                     /locus_tag="Noc_0115"
     CDS             complement(121067..122944)
                     /locus_tag="Noc_0115"
                     /EC_number="3.6.3.27"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, transmembrane region"
                     /protein_id="ABA56648.1"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR001687"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MSSGNFHGPYLRLQDFVAYSDRYILLTSTTHSVQALARLLRYAK
                     GYRRRILAATACSIINKLFDIAPEILIGVAIDVVVNKEDSFVARLNFTTPEEQILVLA
                     ILTFFIWVGESLFEYLYKILWRNLAQRLQADLRQDTYEHVQQLDMSFFESKSSGHLVA
                     IMNDDVNQLERFLDGGANALIQVGVAVIAVGAVFFILSPLIALLAFTPVPLIIWGAFF
                     FQRKAGPLYNDVREKVGDLASRLGNNLSGIATIKSFTAEAREAERLKAVSETYVEANR
                     RAIRVSSAFIPVIRMAILVGFLATFTIGGMMALQGSLNVGAYGVLVFLTQRLLWPLTG
                     LAEVIDLFERAMASTRRILDLLEVTVEVQDVSNRSLATPVRGEVHFQGVSFRYASSGA
                     GVENINLSVPGGSTLALVGATGSGKSTLIKLLLRFYDPHEGQVCIDGQPVREISLYSL
                     RQAIGLVSQEVYLFEGSIRNNIAYGRPDADEESIIKAAITAEAWNFIHALPQGLDTPV
                     GERGVRLSGGQRQRLSLARALIKNPPILVLDEATSAVDNETEAAIQRSLQRIGHDRTV
                     IMIAHRLSTIVYADRIVVIHQGRVIEHGTHAELLEANGRYAAQWRVQTGLAKAEDTLL
                     G"
     gene            complement(123578..124543)
                     /locus_tag="Noc_0116"
     CDS             complement(123578..124543)
                     /locus_tag="Noc_0116"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56649.1"
                     /translation="MSTPAEQAAIIERKAAEQAAIVERKWEPLISWGAIFAGLFFVIS
                     TGWLLFLLGSAIGVGIADATDLDAIGEGLGIGVTIWTVVSMIVVFFLGALLAARLAGK
                     PDNTIGILHGITVWSAGTALMLVLGAWGVSGIINAGQSLVKGTVAATAEVGSAGFKGA
                     SEVGSEGKDLLPSSVMNAIQAQIKRRAAKVIANTGGEQISPDEARQALRELDEDTLKS
                     VAQELIFGNEQRAKNVLVANTNLSEREINAIIDGVSQEIEAQINEIQAELKQRAETVS
                     DYTQAVLWVTFVSAALALTAAIFGGLIGASTVRRISSSYRRHPSV"
     gene            complement(124788..126110)
                     /locus_tag="Noc_0117"
     CDS             complement(124788..126110)
                     /locus_tag="Noc_0117"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56650.1"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="InterPro:IPR005170"
                     /translation="MEGWIPVIIIVLLILLNGLFVAAEFAIIGVPRTTIELRAITGEA
                     SAVRVQTILRDPIQQDRYIATAQLGITLASLGLGMYGEHVLAQWFAGWLEELNASSWI
                     AVHTLASVLAITILTYFHIVLGEMVPKSLALIYAEGTTLWMARPMRWIQFATYPLVAT
                     LNGLGTAILRIMGIKRSFTSNHYHTAEELQLIVEESEEGGALNPEAGQMLRELLEFRE
                     QTAEEVMVPRVHITGIPLGASPDELITIIRSTHHTRYPVFEGTLDQIVGLIHIKEILR
                     LLVANHSLRQKNLQTLSFVPETASVDTVLTAMRRAHTHMVVVIDEYGGTSGIVSIEDL
                     CEEVVGEIEEEPGTSPTAFVDTQGGVHVPGLWRLDEVGKQLGINFCHKEVDTLGGLVL
                     HLLGREPAVGDTLTFQGIRITVTALEGRGIKWCVLTLHPDREKENDEK"
     gene            complement(126114..127442)
                     /locus_tag="Noc_0118"
     CDS             complement(126114..127442)
                     /locus_tag="Noc_0118"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56651.1"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="InterPro:IPR005170"
                     /translation="MNGTVFIVLLFLITANALYVAAEFAAVGVRRSQIKKLAENGHWL
                     AKGLLPNIEDTTRLDHYIAASQIGITLSSLILGAYGQATLGQDLALLLEQFGDMKALA
                     AQSTAAVVVLVLLTSLQVVLGELVPKALALQYPVHLALYTYLPMHWSLKFYSSFIAFL
                     NGSGMILLKIIGIRHSRHRHVHSPEEIDMLIAESREGGLLKLYEQQRLHQALYLSRHT
                     AQQLMVPRQFVAAVDIETPPRQLFQIVVESPFSSLPVYQNSLENITGMIHTKDITAYF
                     AEYKTLPTVAEAMRSTIRVLDKVTGDRLLAIMRQRRSRKLIVVDKHGAAQGLVTLDDM
                     LIALTRGVAKGSKEPALQPEYLPDGRVRLPGLLRVEETVLWTGLPWHSQANTVTDHIT
                     SVLERIPEPGERVIIDGLEVEIEELDGSAIRSVLVQTSPSPEASIPKVGD"
     sig_peptide     complement(127377..127442)
                     /locus_tag="Noc_0118"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.970) with cleavage site probability 0.484 at
                     residue 22"
     gene            127637..128251
                     /locus_tag="Noc_0119"
     CDS             127637..128251
                     /locus_tag="Noc_0119"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56652.1"
                     /translation="MDIAKKFLPLPWRAQFLAFAALTVFALPLHAESGEAPSLTPAQM
                     QEFHKLQQKMRTVGQQLDEIRQETLKTTPKLQEQQEEYQSLLFKTMKEQGSDPDPALA
                     RMREIEGQVQNEDLPEDERKQFIMEYQQKDAQLQQASRDAMQDEKVRKMAESLSQDTV
                     AAMREQDPKTEELLREMEQLREEMQGIVAKIKPKPQAGSGSSSE"
     sig_peptide     127637..127732
                     /locus_tag="Noc_0119"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.991 at
                     residue 32"
     gene            128393..128830
                     /locus_tag="Noc_0120"
     CDS             128393..128830
                     /locus_tag="Noc_0120"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56653.1"
                     /translation="MSVSVTSMAFFLCFLIIILAVAGCSGPRPILYPNNHFKEVGQEV
                     AEQDIAKCRAMAEAAGATPGKGKAAGAAKSSAVGAGVGAASGAVGGAVIGAPGSGAAI
                     GAASGAATGLLRRLFSPSPPSQAYIAFVNQCLKERGYTPMGWE"
     sig_peptide     128393..128464
                     /locus_tag="Noc_0120"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.947) with cleavage site probability 0.739 at
                     residue 24"
     gene            complement(129007..129249)
                     /locus_tag="Noc_0121"
     CDS             complement(129007..129249)
                     /locus_tag="Noc_0121"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56654.1"
                     /translation="MNQQTFRANIDVRSIRPQERHPLIFRTFYELEPGEALLLTNDHD
                     PKPLYYQFQQEQGENFNWQYLEEGPEIWQVQISKLG"
     gene            129464..130822
                     /locus_tag="Noc_0122"
     CDS             129464..130822
                     /locus_tag="Noc_0122"
                     /EC_number="2.6.1.-"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="ABA56655.1"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR005815"
                     /translation="MNAMNNQQWIERDLGVLWHPCTQMKDHEQLPLIPIRRGEGVWLE
                     DFDGRRYLDAISSWWVNLFGHTNPRINAAIAQQLDKLEHVLLAGFSHEAVVRLSERLV
                     DITPAGLSRCFYADNGSSAIEVALKMSYQYWRNVGKSRKTRFISLTNGYHGETLGALS
                     VGDVALYKETYQPLLMDVITVPSPDCFFREEGECEAAYCQRQFVHMERALEDYGEETC
                     AVIVEPLVQCAGNMRMYDPVYLSLLREACDRYGVHLIADEIAVGFGRTGTMFACEQAD
                     ITPDFLCLSKGLTGGYLPLSAVLTTETVYQAFYDDYSTLRAFLHSHSFTGNALGCSAA
                     LAILDIFKENSVLENNRLLAQTMRESTEHFADHPHVAEVRQHGMILAIEMVKNKASRE
                     PYPWQERRGLQVYQHGLQKEMLLRPLGNVVYFMPPYVVTPEQITDLAQVAWEGINLAT
                     QD"
     gene            130896..131627
                     /locus_tag="Noc_0123"
     CDS             130896..131627
                     /locus_tag="Noc_0123"
                     /EC_number="2.1.1.-"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA m(3)U-1498 methyltransferase"
                     /protein_id="ABA56656.1"
                     /db_xref="InterPro:IPR004382"
                     /db_xref="InterPro:IPR006700"
                     /translation="MRVPRVYFPLSLSIGSSVSLDERALQYVIRVLRLRLGAQLRLFD
                     GRGAEYQAVLETIEKRAVKVRILERIEHHVESPLHIILGQGISRGERMDYALQKAVEL
                     GVSRIIPLLTERSAVNLSAERAEKRLRHWQGVIISACEQCGRNYIPPVDTPRPLADFL
                     RDDHRGLAVLLDPRSRRPLKALPLPLDNRLIVLIGPEGGLNKGEAKQAQQADFIGVCL
                     GPRILRTETATVAALTALQLLWGDL"
     gene            complement(131648..132205)
                     /locus_tag="Noc_0124"
     CDS             complement(131648..132205)
                     /locus_tag="Noc_0124"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="CheW-like protein"
                     /protein_id="ABA56657.1"
                     /db_xref="InterPro:IPR002545"
                     /translation="MTFPLEMTTNQLSISNIRAETHPHDDDDKAGSHAQSSNQVPSIL
                     IPLQEQVLLLPRTAIAEIIPYLKPKSLPNAPRWLCGTVRWREQLLLLVSFEALQKKPV
                     PALSNHAHIVILNTVRKDSNRKFYALIIQNIPQLILAHTNNLSASPKAPNSPLLYCYA
                     EINQIPVLIPNLEYLEKTLQRCLTG"
     gene            complement(132215..133222)
                     /locus_tag="Noc_0125"
     CDS             complement(132215..133222)
                     /locus_tag="Noc_0125"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="CheB methylesterase"
                     /protein_id="ABA56658.1"
                     /db_xref="InterPro:IPR000673"
                     /translation="MLPSKPRLARVAIACNCEDTRLQIRHILEQHGLSVVADGPPDMQ
                     LLTIAESRHANVLFIGLNKAYEKQAQAFEKFLEQTSLPMLFNENISHAQWGQRASEKL
                     AKLANSAPAARIREGKTPRCLNPHGFSAERKTEQRVWVLGASTGGPQALQSFLSAIPE
                     TLPITFIVAQHIGANFLGLFTKQLAQYTCFSVEIPKPGHQLQNQQVLITPEKYDLSFD
                     DNCCLTLLPAIHNYRYNPSIDSIMHAVSKHFGAMAGAIIFSGMGEDGAQGCHHFLTNG
                     GTVWAQDTASCEISSMPDYARATGAVSFSAPPEELARSLVNLLENTHVKNRISRKEAI
                     S"
     gene            complement(133209..138485)
                     /locus_tag="Noc_0126"
     CDS             complement(133209..138485)
                     /locus_tag="Noc_0126"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="CheA signal transduction histidine kinase"
                     /protein_id="ABA56659.1"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002545"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR008207"
                     /db_xref="InterPro:IPR008208"
                     /translation="MSTNYEFSENALSWVKNELEESLREASLALEAFAENTDDITQLR
                     FYLNHLHQVEGVLEMVELSGANLLASETKALALGILEKEIESNSQALEILMQGTLSLQ
                     DYLNRLHSGKKDHPVSVLPMVNEIRQTYNKCPLKKIDFFEPELNTPLPNTLASPLEMD
                     SNVSPLFSSKLRLQYESALLNWFRNSSSDSLLHLAKVMSELRQSCRDIAAIRLWWLSQ
                     GVIEALQEDGIQSTQEIKLLLGGLNKKVKILIQSGESALVDDITDSLLKSLLFQVANA
                     TSSGSYVSAIKETYQLENYFSSSDQSLLSNLGAEVVDTVFDALQEDLTQAKDLLEISE
                     RANGISKEGIENLDRLFHKMADTLEVLGFDTSIFILHEAIRKLHAISQKETGSDSNQQ
                     LDLADNLLQIEASLKKEIALSKNPKKSSPATGSHSDIRQTTSSAPTSDDNVKAALHTA
                     AKECLAELMTVSEALTSYSLNLNDSNALNSVPNKLRQISEILSVLELTRIADLIAECN
                     IFINKALIGKIYKSYPAGLEELAEAICAIELYLEMLAEGALASSSLLDTAAECLTRVP
                     TPLDNAINNYQANVESMGAESAPEELSLGVTEENSVSEVKSDLIPFSRTTWEIPGAPV
                     YPKDVDPEIATYFIEEAQEEMLSIAKHFSQWRQDSSQQEALKTIRRSFHTLKGSGRLV
                     GAIDIGELAWAIENMLNRIMEGTIEIKPAVFEIIEGAQQALPQLLTLFTQGGGRPAES
                     ILALLQRAQAVADNTPNLASSEVDSTLQAVEVEDSYSPPAKNSESSTGEKNSKHDPEL
                     TQEAQLAEQGKFISGQHTSVSGHLSDPELLAVFLDEADDVLQAIETTLTDLRASPQES
                     TPVQQLQRELHTLKGGARLANLTALGDLSHDLESLIITAIDKGFTDNSEFLNLLQEGH
                     DRLAEMCDSLRHGAALLAANDLSSRIHGMAESLPYTEKMLPMPDELSQDDTPDPVSKA
                     PSIDPNNELVAAFLEEADELLQASQISLSAWQKNFSSEQAPAEEFQRHLHTLKGGARL
                     AGITLLADLAHHMETIASTIIEGKQNTESGLFGLLQHCLDRLCTLCEFAQNAVPLPSI
                     SDLLIEISRYNSEDLPSSQKSEQARLIHDQELPAATLALPPEQKLHKTARPLAETGTP
                     PVEQIRVRADLLDHLVNNAAEVNIFSTRLEQQIGTIRLNLGEMERTVARLRSQIRRLE
                     IETETQIIYRHEEANNQHLEGFDPLEMDRYSQLHQLSRGLVESISDLTNIKETLDGTA
                     READILLLQQSRTGADLQQGLMNTRMLPFTGVTPRLHRIVRQTAQELDKKVQIKITDS
                     GHELDRTVLNRIMAPLEHMLRNSIAHGIEKAPLRIAAGKKEMGSISLSLTREGSEIVI
                     HVSDDGQGIDLEKIRAKALTRGLVQKEAMPPDADLIQLILESGFSTANNVSQVAGRGI
                     GMDVVNSEIQALNGTLAIASQKGKGTTFTIRLPLTFTIVQALLVETKNELFALPIISV
                     QSVIRLDKETVDSLLASEQCLFCHENVNYRFIDLGAALGQDYPETSTSNTHYPVLLVR
                     SGEFQAAILVDALIGSREIVIKSVGPQLGAIKEIAGATILGDGRVVLILDLPALIRKA
                     TQKTETSIAIKRQANTKIAQKPAVMVIDDSITIRKTTEKILERHGMEVLTARDGVNAV
                     ELLQEYTPDIFLLDIEMPRMDGFELAAFIRKDKRLRGIPIIMITSRSGKKHRDKADQI
                     GINAYLIKPYQEDELLQHIQLFLNATEANVTL"
     gene            complement(138503..139351)
                     /locus_tag="Noc_0127"
     CDS             complement(138503..139351)
                     /locus_tag="Noc_0127"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="MCP methyltransferase, CheR-type"
                     /protein_id="ABA56660.1"
                     /db_xref="InterPro:IPR000780"
                     /db_xref="InterPro:IPR001601"
                     /translation="MKLNPKPSLNIENYPKWAEILEESGVCTDTIPNSFLETRLRMRM
                     SVHGFNNFHRYYNYLKSLNRNNMEWRVLIDSLTVKETRFFRDPDSLFLIEKFLLSNQY
                     LPGKAQGSIHAWSVACATGEEAYSLAIIIDKNTRATKDIFFGVTATDISHSALTTGKQ
                     GIYHESRLANIPPYLRTKYFIPLDDNFYQVKLMMRNRVCFSRLNVLQAKNAPLGKMNI
                     IVCQNFLIYFSLDKHSLILDALVTHLAPGGLLILSISDVFNWSHPALEKINYENTLAY
                     RRKADS"
     gene            complement(139364..140977)
                     /locus_tag="Noc_0128"
     CDS             complement(139364..140977)
                     /locus_tag="Noc_0128"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis sensory transducer"
                     /protein_id="ABA56661.1"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /translation="MNIQNHIYLSILTVKKHLLLTVITVLLVFTTTAGISYATWQINK
                     LNADIKLGSDLRVLTQRFPIFILSMISNNKTKKEKINEGISAFDKKLEELYNNKLHTP
                     STAATIEESRQKIQSIWSQLKKDLIDTLNTPQKSNISNLFEHSDDLFHIITGLLESYQ
                     NTRNQLQIILVASYVTGIGALILLLILFTRPVKTLRQKFNGLEIKNSHNQDAILKLLD
                     EMGDLADGDLTVSATVTEDITGAIADSINYTIDALRTLVQDINDTAIKVSSSAQETQA
                     TVMHLADASEHQAQQITTVGAAINEMAVSIEQVSDNATKSAEVAKQSVEIASKGTETV
                     KNAIEGMDNIREQIQETSKRIKRLGESSQQIGEIVELINDIAEQTNILSLNAAIQAAM
                     AGEAGRGFAVVADEVQRLAERSSSATKQIDALVKTIQSDTHEAIISMEESTSGVVSGA
                     KLSQDAGGALGQIESVSHHLAELIQNISGAAKQQAAAAAGISDTMNVIQEITDQTSKG
                     TNETASSIGRLSEYANEMRESVAGFKLPQ"
     gene            complement(141069..141605)
                     /locus_tag="Noc_0129"
     CDS             complement(141069..141605)
                     /locus_tag="Noc_0129"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="CheW-like protein"
                     /protein_id="ABA56662.1"
                     /db_xref="InterPro:IPR002545"
                     /translation="MDKNNPFSILRNIEAQNRQHGAALPQQTAIRQVWTNLGFLLGNQ
                     KLAALLTQVYEVFPCPAITRVPGAKPWVVGVANIRGYILPLIDLHAYIYGAPSQRTHR
                     SKVLVVTKEKFLIGLLVEEVFGLKHFLDEEWTGQNLPSHDPLTRYIQRGFAQNREIWL
                     EFDFHLLMEQESFFLATT"
     gene            complement(141617..141982)
                     /locus_tag="Noc_0130"
     CDS             complement(141617..141982)
                     /locus_tag="Noc_0130"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Response regulator receiver"
                     /protein_id="ABA56663.1"
                     /db_xref="InterPro:IPR001789"
                     /translation="MTHILVVDDSSTESHAFRIMLEKKGFTVSFANNGLEGLTKAKAL
                     KPDLILMDVVMPQVNGFQATRKLKRDPETAGIPVIIISAKNQETDRVWGLRQGAKGYL
                     SKPVSKEELFNKINMLINP"
     gene            complement(142062..142460)
                     /locus_tag="Noc_0131"
     CDS             complement(142062..142460)
                     /locus_tag="Noc_0131"
                     /EC_number="3.1.1.61"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Response regulator receiver"
                     /protein_id="ABA56664.1"
                     /db_xref="InterPro:IPR001789"
                     /translation="MSNAGNLEFNGLKVMVIDDSKTIRRTAETLLKKSGCKVVTAEDG
                     FEALPKINQHHPDIIFIDIMMPRLDGYQTCALIKNNTALKKTPIIMLSSKDGLFDRAR
                     GRIAGCDQYLTKPFTREELLGAISNHCNHS"
     gene            143391..144590
                     /locus_tag="Noc_0132"
     CDS             143391..144590
                     /locus_tag="Noc_0132"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56665.1"
                     /translation="MVNSNLVPLRVATFGVGQHVRKLLEMAFSGPGKGNYLLVEETSA
                     EAGILDLDGPSWKMVWNDYRSRFPKRPALIMSMRPAVFQDSLVIPKPVRLETLLAALE
                     KLRANCRCGGKAPRSSPQQPLKSRHGAGASKSFQIPSSSIKAANSTAYQPFIFGAAEA
                     MERGTIQEYCGNAPDRDVTDPIQLEKIYYDPHRYFQGYLHNALIKAQAIGGARITSGW
                     GEVIVLSEVNQAMLRLSDRQLRPLCVMPLAKANVDISALAPQEVEALYSQVVYSDSWQ
                     SLHPLLWKVALWTSRGRIPLGVPLDRPVCLKHWPNLTRLLLTPHAMRIAALWAVQPCS
                     LMGTVATLQIPQRYVFAFFSALHSVGLVELEQITVKKVPSSIPASHHQGILGRVLNRL
                     RKASPPL"
     gene            144630..145175
                     /locus_tag="Noc_0133"
     CDS             144630..145175
                     /locus_tag="Noc_0133"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Conserved hypothetical ATP binding protein"
                     /protein_id="ABA56666.1"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR004130"
                     /translation="MANHKLIFTGPVGVGKTTAISMLSDIPTVSTDETASDMTRRKKP
                     RTTVAMDYGLMNVSETERVHLYGTPGQERFDFMWDILTEGGIGLVLLLDNSRTNPLQD
                     MHFFLGAFRGFINRTGVAIGVSRMDLHSQPKISDYYQQLQGFAKKPPILEVDARNRRD
                     VSLLIQTLLYSLDPGLANSDG"
     gene            145168..145797
                     /locus_tag="Noc_0134"
     CDS             145168..145797
                     /locus_tag="Noc_0134"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56667.1"
                     /translation="MGSYQIIPNQYVLPTPGGAYYAISSPVVEPARELLFRVFQESNT
                     PPLTAEKVQAWGEDGAVTLELIFRMQSLAWLQGIPLSREAPAGSLEGVLPNLLAKLSG
                     SGKALLSDDQGFYLATHGYGHETAEELSALSADLSALHERHKGLLQEHLKLRSRGWGL
                     VGAAGTSQVGFWPLYMGKQHFMLVIGDCPRFNQPAFTELIWLLARRYSH"
     gene            146174..149083
                     /locus_tag="Noc_0135"
     CDS             146174..149083
                     /locus_tag="Noc_0135"
                     /EC_number="2.7.7.42"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutamate-ammonia-ligase adenylyltransferase"
                     /protein_id="ABA56668.1"
                     /db_xref="InterPro:IPR005190"
                     /translation="MNWQANIHKLPALLQGRLKNDLARFQEALEQKNLDTVFKAKTLK
                     TLCLVWGASEFVATNCIRWPSLLLDLQGSGNLFRAYEPNHYVKSLAQQLTNISTETEL
                     MVVLRRFRQREMVRIVWRDLAGWASLDEVFRELSQLAEACLNSALACLHYWQSQALGT
                     PYGSISGKPQSMVVLGMGKLGARELNLSSDIDLIFAYPESGETRGAQRTLNNEEYFIR
                     LARRLIRVLDERTEEGFVFRVDMRLRPDGDSGPLVASFNAMENYYQNQGRDWERYAMI
                     KARVVAGDCQAGTRLMAMLRPFSYRRYLDFGAIESLRSMKAMIAQELRRQGIKANIKL
                     GPGGIREVEFIGQSFQLIRGGRESALQERGILRVLTLLAERDHLPYYAKEELCAAYVF
                     LRRVEHRLQAYRDEQTHDLPTSTEGRVRLAFAMGYRDWEAFASALEEHRRRVQEHFEQ
                     LFAAPHMDITDQMAQEKRLAEVWLGGELREASLAVLSAAGYRAPEEAVQTLMYLRQSY
                     TVRALSAQARIRLDRLMPLLLGAVGRTEYPEQCLQRVIILLETVAQRTAYLALLAEYP
                     MALSQLVKLCAASPLIARQLTRYPLLLDELLDPRSLYQVLGYDSLAEDLKWSLESIPG
                     DDLEQQMELLRHFCQRQTLRVAAADVTGVLPLMKVGDHLTYLAEVILKKALELSWRHL
                     VHRHGRLQSSTGEQPEESGFAVIGYGKLGGYELGYGSDLDLVFLHNAKPGDPPSEGKK
                     PLDPVVFYSRLGQRLIHILQTSTPSGKLYEVDTRLRPSGVSGLLVSGLDAYRGYQCMQ
                     AWTWEHQALVRARFVAGDARLGAAFTAMRQEILGRQRDPIKLRDEVRHMRAKMRNQLD
                     RSQGGWFDLKQGRGGIADIEFIVQYGVLAWAHAHPQLLEYPDNIRILEGFAQAGLLAS
                     EESQLLADAYRAYRAAANRLNLQTHEARVEEGQFRQERIAVQQLWSALLEDESAK"
     gene            149126..150055
                     /locus_tag="Noc_0136"
     CDS             149126..150055
                     /locus_tag="Noc_0136"
                     /EC_number="2.6.1.42"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="branched chain amino acid aminotransferase
                     apoenzyme"
                     /protein_id="ABA56669.1"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR005785"
                     /translation="MSTMDDRDGIIWLDGELVPWREARVHVLTHTLHYGMGVFEGVRA
                     YKTPRGTAIFRLQEHTERLFRSAHILNMTIPYDKETLNQVQRLVVRENGLETAYIRPM
                     CFYGSEGMGLRADNLQVHVMLAAWSWGTYLGAENIERGIRVKTSSYTRHHVNITMCKA
                     KANGNYLNSMLALQEALASGCDEALLLDTEGYVTEGSGENIFIIRNGVIYTPDLTSAL
                     EGITRDTIFQLAQEIGVPLREKRITRDEVYVADEAFFTGTAAEVTPIRELDGRRIGDG
                     VRGPITERLQSLYFDQVHGRREAYPEWLTLVSD"
     gene            150092..150838
                     /locus_tag="Noc_0137"
     CDS             150092..150838
                     /locus_tag="Noc_0137"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF28"
                     /protein_id="ABA56670.1"
                     /db_xref="InterPro:IPR002876"
                     /translation="MAGHSKWANIQYRKGAQDAKRGKLFTRLIREITVAARLEGGDPA
                     TSPRLRTAIDKAFAANMPKDNIERAIKRGTGDLEGVAYEEVRYEGYGPYGVAVMVDCM
                     TDNRNRTVAEIRHVFSKWGGNLGTDGSVAYLFSKKGIISYSKESNEDAIMEVAIEGGA
                     EDVVTNEDSSIDVFTEPEEFSTVKKALDEAGLKAEQAEITQHASTSVSLALEEARKML
                     DFLDALEELDDVQQVYSNADFSEEILAQLG"
     gene            150942..151466
                     /locus_tag="Noc_0138"
     CDS             150942..151466
                     /locus_tag="Noc_0138"
                     /EC_number="3.1.22.4"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction endonuclease RuvC"
                     /protein_id="ABA56671.1"
                     /db_xref="InterPro:IPR002176"
                     /translation="MARILGIDPGSRITGYGLIETNNKKTVYIAAGCIRAGEGGLAER
                     LGQIFQGITGIIQAYHPDEVAVEQVFMHQNPGSALKLGQARGAAICAAVNAVLPIFEY
                     TPSQVKQAVVGRGDAAKSQVQYMIRLLLKLPAEPATDAADALACALCHEHAGPLLAGL
                     AGQVRGRRRGRYYR"
     gene            151463..152062
                     /locus_tag="Noc_0139"
     CDS             151463..152062
                     /locus_tag="Noc_0139"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase subunit RuvA"
                     /protein_id="ABA56672.1"
                     /db_xref="InterPro:IPR000085"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR011114"
                     /translation="MIGRLRGILLEKRAPFLLLDVQGVGYELEAPLSTFYVLPAMGAE
                     VILYTHLVVRDDAHLLYAFASEKERGLFRSLIRVNGVGAKLGLGILSGIEAESFTRCV
                     QEGDTVSLTRLPGVGKKTAERLIVEMRDRLLDMPESGVAGMRPDRVDGSAPGTVAEAV
                     SALVALGYKPNEASRAVRRLDTEALTTEEIIRQALQRML"
     gene            152065..153111
                     /locus_tag="Noc_0140"
     CDS             152065..153111
                     /locus_tag="Noc_0140"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase subunit RuvB"
                     /protein_id="ABA56673.1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004605"
                     /db_xref="InterPro:IPR008823"
                     /db_xref="InterPro:IPR008824"
                     /translation="MTLNRDMVSPQEDRGEKAVEFSLRPARLADYVGQPQVQEQMEVF
                     IPAARARHEALDHVLIFGPPGLGKTTLSHIIANELEVNLRQTSGPVLERPGDLAALLT
                     NLEPRDVLFIDEIHRLSPVVEEVLYPAMEDRQIDIMIGEGPAARSIKLDLVPFTLVGA
                     TTRAGLLTSPLRDRFGIVQRLEFYAVDHLVLIVERTARILGMAMEKEGALEIARRSRG
                     TPRIANRLLRRVRDYAEIKGDGQVTRQVAQKALDLLDVDSHGFDTMDRKLLLAMLEKF
                     DGGPVGVDSLAAAIGEERGTIEDVIEPFLLQQGFVMRTPRGRMATRHAYLHFGLKPAV
                     KMVPQEVSDLFPNE"
     gene            153104..153511
                     /locus_tag="Noc_0141"
     CDS             153104..153511
                     /locus_tag="Noc_0141"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoyl-CoA thioesterase"
                     /protein_id="ABA56674.1"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="InterPro:IPR006684"
                     /translation="MNEFVWPVRVYYEDTDSGGVVYYANYLKFMERARTEWLRSLGFE
                     QDVLLNEQGLLFVVRSLQLDYLRPGRFNDWLKVHSHLLERGRASLAFAQTVRRGEQTL
                     LCQAEVKVVCLNAQTFRPCPIPKLILAEITGDC"
     gene            153501..154178
                     /locus_tag="Noc_0142"
     CDS             153501..154178
                     /locus_tag="Noc_0142"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="TC 2.C.1.2.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Cell division and transport-associated protein
                     TolQ"
                     /protein_id="ABA56675.1"
                     /db_xref="InterPro:IPR002898"
                     /translation="MTVDLSLLDLITGASFLVQLVILILLIISVIAWTLIFRKRSELK
                     QAREEADEFEDRFWSGKELNSLYAELAAQELPPGGMEGIFLAGFSEFARLRKQAGVEH
                     RTVLDGTQRAMRVSLAREIDMLEASLPFLATAGSTSPYIGLFGTVWGIMNSFRGLGNA
                     HQATLAMVAPGIAEALIATAMGLFAAIPAVIAYNRYAYEVERLANRYDTFVEEFSTIL
                     QRQIHTV"
     gene            154191..154637
                     /locus_tag="Noc_0143"
     CDS             154191..154637
                     /locus_tag="Noc_0143"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="TC 2.C.1.2.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Cell division and transport-associated protein
                     TolR"
                     /protein_id="ABA56676.1"
                     /db_xref="InterPro:IPR003400"
                     /translation="MYTLQQRKRRRLLAEINVVPYIDVMLVLLVIFMITAPMLTQGVK
                     VDLPRAGSKPVKPPEDERPLLINVDAQGRYYINIGETPDQPVTADKLLEVVTLVLRHK
                     PDTPILIGGDRQVSYGAVVKIMALLRQADVSQLGLITEPPPPQESR"
     gene            154648..155604
                     /locus_tag="Noc_0144"
     CDS             154648..155604
                     /locus_tag="Noc_0144"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="TC 2.C.1.2.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Cell division and transport-associated protein
                     TolA"
                     /protein_id="ABA56677.1"
                     /db_xref="InterPro:IPR006260"
                     /db_xref="InterPro:IPR010528"
                     /translation="MENPRQKWFAFALALLVHGILFAVLVISLGWTPKPEPVNIAPAQ
                     IVQATVVDKEKLLAEAAQRRQAEQDALARQQALVQKREAAERQRAEAQRQQQARAEQA
                     RRETQEQQALEQKQQEEQARLKRLEAERQAKEEAARRQAEAEKKRAEEKKRQAEAEKR
                     RLEEERRRAEAAKRKAEEERKKIEAAKRKAEEERKKAEAARRQQELQDRIEAEENAAQ
                     VEAARNRFLTQVKMRVQRYWIRPPSARDDLVVLLQVEMLPSGEVRNVKVAKSSGDRAF
                     DRSGEAAVYKAAPLPIPAESAAAEDFLPRFNFKFCSDPSNCK"
     sig_peptide     154648..154719
                     /locus_tag="Noc_0144"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.660) with cleavage site probability 0.633 at
                     residue 46"
     gene            155601..156905
                     /locus_tag="Noc_0145"
     CDS             155601..156905
                     /locus_tag="Noc_0145"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="TolB"
                     /protein_id="ABA56678.1"
                     /db_xref="InterPro:IPR007195"
                     /db_xref="InterPro:IPR011659"
                     /translation="MMNTRVWCKIIGMLALLVWLVSSPSVFAVLTIEITGGTEAALPI
                     AIVPFQNEGSTPPENVAAVIAADLARSGRFAPLPEEDLISRPRNASDIQFQDWRRLGS
                     EGLVIGKVISLGADRYEVRFQLFDIYKEEQLVGRRYQVPAAGLRHLAHQIADLIYETL
                     TGEKGIFTTHIAFVTVSRAAHGAKQYSLQVADVDGHNPHTILRSKEPILSPAWSPDGT
                     QLAYVSFERRRSEVFVQELRTGQRQSVASFSGINSAPDWSPDGGKLALVLSKEGNPEI
                     YIRDLATGRLTRLTHNTAIDTEPAWAPDGGSIVFTSDRGGRPQLYQIPVSGGRAQRLT
                     FDGAYNASASFAPDGRRLALIHGDKGQFHIAVLNLQSKELQVLTETRMDESPSFAPNG
                     RMILYATSSPQGGVLAAVSTDGRVRQRLAQQGDEVREPAWSP"
     sig_peptide     155601..155687
                     /locus_tag="Noc_0145"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.999 at
                     residue 29"
     gene            156939..157502
                     /locus_tag="Noc_0146"
     CDS             156939..157502
                     /locus_tag="Noc_0146"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="OmpA/MotB"
                     /protein_id="ABA56679.1"
                     /db_xref="InterPro:IPR006664"
                     /db_xref="InterPro:IPR006665"
                     /translation="MRLVILFFLLAGIYGLVGCAGGTATTQGGPPDVVVEERGASPYP
                     EGEALEEESATTWGIGEGAAYQGDPLADPASPLASRVVYFEFDSSEIQQDDRPIVEAH
                     GGYLAKHPDIKVTLEGHTDERGSREYNLALGERRANAVRSLILLMGASEDQVEVVSYG
                     EERPAVDGQDEGAWQLNRRVEILYPGE"
     sig_peptide     156939..157019
                     /locus_tag="Noc_0146"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.970) with cleavage site probability 0.419 at
                     residue 27"
     gene            157502..158275
                     /locus_tag="Noc_0147"
     CDS             157502..158275
                     /locus_tag="Noc_0147"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="TPR repeat protein"
                     /protein_id="ABA56680.1"
                     /db_xref="InterPro:IPR001440"
                     /translation="MMVSWCRGRWLLAGGVLWAQLSVASGAEEVEVIDPGALEQRLQQ
                     IERIIEGQGLSELLSQMAELEANVRRLQGESEELRYEMDNLKRQQRELYVDLDRRLQK
                     LSTSGESLSPLLPSEATEEVAEEVLVDSGEQTYQAALELLKEGRYEEAIAAFDQFPQQ
                     YPDSRYRPNAQYWLGEARYMLGDFNAAADTFQALVEQYPESAKVPDAMLKQGLAYYEL
                     AQWEQAKAQFQAVMTRYPASTASRLAEERFEKMKREGHP"
     sig_peptide     157502..157582
                     /locus_tag="Noc_0147"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.878) with cleavage site probability 0.388 at
                     residue 27"
     gene            158586..159227
                     /locus_tag="Noc_0148"
     CDS             158586..159227
                     /locus_tag="Noc_0148"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Radical SAM domain protein"
                     /protein_id="ABA56681.1"
                     /db_xref="InterPro:IPR007197"
                     /translation="MKRLRITEIFYSLQGEARSVGWPTAFVRLTGCPLRCHYCDTEYA
                     FQGGRWMALDGILDAVAEFGVRHVTVTGGEPLAQSACLGLLTRLCDAGYEVSLETSGA
                     LDISAVDRRVIKVMDWKTPGSGEEARNLSTNLEHLSSQDQVKLVLCNRHDYDWAKGVL
                     ERHRLTEYCEVLFSPSYEQLSPTDLADWILADHLPVRMQIQLHKYLWGEEPGR"
     gene            159224..159898
                     /locus_tag="Noc_0149"
     CDS             159224..159898
                     /locus_tag="Noc_0149"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="preQ(0) biosynthesis protein QueC"
                     /protein_id="ABA56682.1"
                     /db_xref="InterPro:IPR004479"
                     /translation="MTAPKAVVLVSGGLDSATVLAIAREQEFICHTLSFNYGQRHRVE
                     LQAAAEISRRMGAVEHKRITIDLGGFGGSALTDPSMAVPEASSGAIPITYVPARNTVF
                     LSFALGWAEVLGAQDIFIGVNAVDYSGYPDCRPAFIKAFEHLAKLATCAGLEGRAFRI
                     QAPLLHLSKAEIIREGMRLGIDYSRTISCYQADENGRACGVCDSCRFRKQGFWDAGVP
                     DPTRYH"
     gene            159954..160029
                     /locus_tag="Noc_R0002"
     tRNA            159954..160029
                     /locus_tag="Noc_R0002"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys1"
     gene            160371..161618
                     /locus_tag="Noc_0150"
     CDS             160371..161618
                     /locus_tag="Noc_0150"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane efflux protein"
                     /protein_id="ABA56683.1"
                     /db_xref="InterPro:IPR003423"
                     /translation="MRPVIVISSYLLSCGGLILALTYSTIGAAAYTLTLEDVLALAQG
                     NPNIVAAQAQQDAASAALQTARAYPNPEAQLMAGPSKALAPGTPGGLSAFAQIAQPIE
                     LPSVRSSRARGAMAGLETAQAATSNVSLAILAQAKQAFYEILRRQNEAEVAIQNQALL
                     EQIRDRVKLRVETGEAPRYEFVKAEAEVLSAIKNRERAQLQINSAKSMLRALIGASLP
                     IDFEAKGKLAVPKDVPSVEKLRSLVLERHPAIIQIQGQMRQAQAQLRLEQNLRYPQPT
                     FMASFQRAPDLDQWLFGFAIPLPLWNQRQGPIAAAAAELKQSEAAAEQQRLVLLREIE
                     IAHTRYRIAARQEEAFETGLLKEAEYALKVAETAYRQGARGILDYLDAQRIYQTVRQD
                     YINARFDKQMAYIEIERLLASDL"
     sig_peptide     160371..160463
                     /locus_tag="Noc_0150"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.981) with cleavage site probability 0.613 at
                     residue 31"
     gene            161653..161925
                     /locus_tag="Noc_0151"
     CDS             161653..161925
                     /locus_tag="Noc_0151"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56684.1"
                     /translation="MFLPVCVRTRTGRQNFISLENSRFSAAFGEGFFLASVGWLLLAL
                     SLWVLSTLGSVNKRMLARIHGEKLALALDAPFHGASSARGSLNIHV"
     gene            161918..163066
                     /locus_tag="Noc_0152"
     CDS             161918..163066
                     /locus_tag="Noc_0152"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Secretion protein HlyD"
                     /protein_id="ABA56685.1"
                     /db_xref="InterPro:IPR006143"
                     /translation="MFNSNAMQVFVLALVFSLVLFPSCLVAEGPSPSLDSANTIEVSD
                     ILAQQLKVRPVGHGRVRDTLRLPGRVQLDEQRLARIGASVTGRITALYAILGQEVQRG
                     DILAELNSTELGAAQAAYLKASSQVSLRKLAVSRAQRLLAGDVIGSAELQEREGELVA
                     AEVEMQAGADQLRVLGMSDRSIKQLTRNGQIDSHSHITATLSGTVIDRRISLGQVVQP
                     SDTLYTIADLSHVWLVAQIPENQAYLVQEGQEAEAEIPALPGPSATGQLIYVADVVDP
                     NTRTVTMRMDVPNPQGQIRPNMLASIVIHTRAAPELVVPAQAIVRQGREDFIFVQSDP
                     RHFTLRPVKLGPNGGEFRGVVSGLTVGEPIVVEGAFHLNNERLRRNLD"
     sig_peptide     161918..162001
                     /locus_tag="Noc_0152"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.999) with cleavage site probability 0.872 at
                     residue 28"
     gene            163071..166208
                     /locus_tag="Noc_0153"
     CDS             163071..166208
                     /locus_tag="Noc_0153"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Heavy metal efflux pump"
                     /protein_id="ABA56686.1"
                     /db_xref="InterPro:IPR001036"
                     /db_xref="InterPro:IPR004763"
                     /translation="MVKSLIHGALEQRVVIVVVALVLLGFGLRAPSQLSMDAFPDVTN
                     IQVQVATEALGRSPEEMERFITVPVEIAMTGLPGLTEMRSLNKSGLSIITLVFTDETD
                     VYFARQLVMERLIGVQDRLPPGVTPVLGPVSTGLGEVYQYTLQRPDDGGRALTPAELI
                     ERRTIQDWVVRPLLRSIPGVAEINSQGGYVKQYHVLVDPDRLHHYQISLKEIEEALIR
                     NNANSGGGVLPHYAEQYLIRGLGLIASIEDIGNIILKEFGGTPIYIRDVASIRIGHEV
                     RQGAIIKNGVSEQVSGIVLMIRGGNAMEVVGRVKEKVAEINEQGLLPGGLEIVPYYDR
                     TDLVGAALNTVTKTLLEGVVLVIVILFVFLGDIRSSFIVVCTLVLTPLLTFMVMNRYG
                     ISANLMSLGGLAIAIGLIVDGSVVVVENTFRYLSERRNTGESKTRIVLEAAVEVGKPV
                     IFGVGIIIVVFLPLFTLEGMEGKIFAPLALTISIALSISLLLSLVLSPVLCSYVLKGG
                     SEEDTRLIAWLKRGYLKLLAWALNWRITVVLSSVLLLGLALSLFPYLGKSFIPVMKEG
                     ALTPQINRVAGMSLSESIRMEMYATRLIREVPGVEMVVSKLGRGESPADPVGPNESDP
                     IVTLKPRAEWPEGWTQDDIDAAIRDKLKALPGVQIVLSQPIAERVDEMVSGVKSQLAI
                     KLFGDDLSALKRTADDIARLLRTVEGTRDLRVERVSGQQYLLVDVNRHAIARHGINVA
                     DVHSVIETAIRGKVATHIYEGERRFAALVRFPESNRNSPEAISRILLTSASGARVPIE
                     DLADVRLEEGPARISRESAKRRIVVGANLVDRDMGGYVDEVQQKIAEQIKLPEGYFLV
                     WGGQFENMERAMARLTIIVPLTIAIIFFLLFVLFNTVRLAALIILVLPFASIGGIVAL
                     FLTGEYLSVPASVGFIALWGIAVLNGVVLVSYIRSLRDGGLEQWEAIVQGCAQRFRPV
                     LMTATVAMLGLTPMLFAEGPGSEVQRPLAVVVIGGLISSTALTLIVVPVLYRWFDVRR
                     RGEGGQVEFEGKRDS"
     gene            166595..167374
                     /locus_tag="Noc_0154"
     CDS             166595..167374
                     /locus_tag="Noc_0154"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56687.1"
                     /db_xref="InterPro:IPR000051"
                     /translation="MRKRYRIQFPKAKLSSCKQDEAYFYLQEENGRRKIRFHDYSEIY
                     QKQDLYEQIFYERLQCSSPSKVSSILEAAVKQSQDNFSELRILDLGAGNGMMGDELKK
                     HGVSRLIGIDIVPEAYEATIRDRPGIYDAYYVEDFTRLDNDKKEEIKTWNCDCMVTVS
                     ALGFSDIPAKVFIEAFNIIKNEGWLAFNIKETFFNISDESGFSKMIRELIFSKYIDIY
                     CIERYRHRFSIDGEPLYYFAVAGRKNLDIPSNFLDSKNILA"
     gene            167427..167924
                     /locus_tag="Noc_0155"
     CDS             167427..167924
                     /locus_tag="Noc_0155"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56688.1"
                     /db_xref="InterPro:IPR001865"
                     /translation="MKTKSPPLSSWIFIVTILWIGFLLAISFMEAPLKFCAPSLTLPV
                     ALEIGYIVFHALNLVEIIFAALILAATYFGLTSRKSILFAVGVIGILIIQTVLLFTKL
                     DARTLAIINGLETSSTPYHIVYMVMEVIKLIGLVVLAFYQLGDFRLSVIKLTRQNLEN
                     PNRVR"
     sig_peptide     167427..167504
                     /locus_tag="Noc_0155"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.641) with cleavage site probability 0.613 at
                     residue 26"
     gene            168016..169194
                     /locus_tag="Noc_0156"
     CDS             168016..169194
                     /locus_tag="Noc_0156"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="HI0933-like protein"
                     /protein_id="ABA56689.1"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR004792"
                     /db_xref="InterPro:IPR006076"
                     /translation="MPLWDVVIIGGGAAGLMCAIEAGKRQRRVLLIEHSNRVGKKILM
                     SGGGRCNFTNLHVRPDNFLSANPHFCKSALARYSPWDFIAMVERHGIAYHEKESGQLF
                     CNQSSKLIVNMLVAECQQVGVRIELGSKVTTVKHRFPGFALETSLGSVQASALVIASG
                     GLSIPKMGASGFGYELAKRFGHRILATRPALVPLIFTEEDLEQYRDLSGIGLLAEVGC
                     NNQYFTGGMLFTHRGISGPAILQISSYWQLSDELGINLLPGTDVLAWLTERQRSRPSA
                     ELRTVLAKCLPKRLAQRLCKLVFGSFPLRQYSPLELRAVAERLQYWRFYPKGTEGYRT
                     AEVTLGGVNTDELSSATMASKKVPGLYFIGEVVDVTGHLGGFNFQWAWASGHAAGQAV
                     "
     gene            169291..169908
                     /locus_tag="Noc_0157"
     CDS             169291..169908
                     /locus_tag="Noc_0157"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="HylII"
                     /protein_id="ABA56690.1"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="InterPro:IPR005744"
                     /translation="MQEGEKFNSISHLVGAVAALAGLVVLVVLAARQGDPWKIVSFSI
                     YGTTLFLSYLASTLYHGSEGKIKHIFRKLDHHTIYLLIAGTYTPFTLVTLHGPWGWSL
                     FGIIWGLAVFGMVVDSLPHKGHRILPVAIYLLMGWLVLVALVPLLQALPFAGFIWLLA
                     GGLFYTVGVIFYALDKKLSYAHGLWHLFVLAGGLTHYLAIFFYVV"
     sig_peptide     169291..169383
                     /locus_tag="Noc_0157"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.907) with cleavage site probability 0.827 at
                     residue 31"
     gene            170569..172110
                     /locus_tag="Noc_0158"
     CDS             170569..172110
                     /locus_tag="Noc_0158"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56691.1"
                     /translation="MKKFNRSSKPLFPHVLLAPLALSTGLLGFAPSAQAVEVTVTIEN
                     ISPSSGLFLTPVWVGFHDGNFDIYDLNTPASSALEQLAEDGNNAPLSAEFTASVPNGL
                     DATIADPSGIPGPLDPGSRVSETFDLSADNHRFFSYATMVIPSNDAFIANANPQAHEL
                     FDAGGSFTGPISFTVLGTQVRDAGTEANTETDAAFFDQTTPDSGTSSTDPVLVHPGFN
                     GSSGNPGAVPVNILGGTSNDGVFFDSLAADFTQPSYTLARITITGPGDKLFNFVLDGN
                     QEVPPVDTPANGSCVGILNKDETAFTANCHHTVQDVTVAHIHEAPAGVNGGVIFPFAS
                     AESPIQETFNFTAEDVATLIAGNFYVNVHSGDFPGGEVRGQIAAPLKGSFSGSWFNPN
                     RSGEGFLLEVTNSDDPTLVATWFTYPPSGDSGAQAWLVGSGPIRLNESIITNTVITEG
                     AAFGDDFDPSAVNRIPWGTLKFTFTSCTTGIVEYDSVREDFGSGTFHIQRLTPPLIGQ
                     EEDCP"
     sig_peptide     170569..170676
                     /locus_tag="Noc_0158"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.999 at
                     residue 36"
     gene            172387..173655
                     /locus_tag="Noc_0159"
     CDS             172387..173655
                     /locus_tag="Noc_0159"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="TC 2.A.36"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/proton antiporter, CPA1 family"
                     /protein_id="ABA56692.1"
                     /db_xref="InterPro:IPR006153"
                     /translation="MDILNIATTLIVLAAFFGYLNARFLKFPDAIGLMLIAILFSAAT
                     IMAGSIFPDILEFEKELVTQIDFKEILLDGFLSIILFAGALHTDLNLLRTMRGPILMF
                     ATLGVLLSTFLVAGMMFVGFQGLGLDVPFIHCLLFGALISPTDPIAVLGILKNAGVSK
                     ALEIKIVGESLFNDGIGVVIFLTIFSIAFLGNGEISSVDIALLFFKEVGGGILLGFGL
                     GYLAYFLMKSIDSYQVEVLITLAIVLGGYWLARYLHFSGPLAMVVAGLMIGHERFRSS
                     GMSNITETYVDKFWELLDLSFNAILFVLIGLELTIISLDGEYLLAGLLAIPVVLLARY
                     MALFFPIRLFKRRLGLAPQTGIMMTWGGLRGGISIALALSLTASMSRELLITVCYIVV
                     VFSIIVQGLSVGGLARKYRKRLEAAGQPAD"
     sig_peptide     172387..172455
                     /locus_tag="Noc_0159"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.662) with cleavage site probability 0.631 at
                     residue 23"
     gene            complement(173812..176919)
                     /locus_tag="Noc_0160"
     CDS             complement(173812..176919)
                     /locus_tag="Noc_0160"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="type I site-specific restriction-modification
                     system, R subunit (helicase)"
                     /protein_id="ABA56693.1"
                     /translation="MRATGELELNLMPTQNSPPNIAMDKVQKTALQQVIIDHLLSHGW
                     QKGKAELYDPVLALYPEDLIGFIRECHSQPLPKLIQDAPDQAVQILLRRAAEEMDQRG
                     ALEVLRHGFKEQENDISLCQFHSYQEFHSGTLARYKKNRLRVVPNLSYSPYTHEDYIP
                     YLDLVFFVNGVPVATLKATSESQPSLSAIIRQYQRDCPPHDPRMGHEEPLLAFRKRAL
                     VHFAVSQEEVWVSTRLQGLATHFTPFNQGHKGGAGNPPNPAGYPTDYLWQKIFECDTW
                     LDLLGQFIHFERKNAAWKEEKEFPSETLVFPRFHQWEMVTQLAGAVRQEGPGQQYLIQ
                     HGAGSGQRYSIAWTAHHVAALADRKHQKIFTGVIVVTDCHEFHAQLQNTLYSPKYERK
                     QIYRLTQEIAQNCQAEWLAATLAAAGIHIITVTPQAFPSVLALIQNQVIFKEHTFAVI
                     AHQAPFPTSRSLFSRLGEVLLSESAQKEITTNTEDLLITSLTNSPPSPHISYFLFTAA
                     PQEKTLALFGQPTSPALPFSDNNQPEPFHHYTLQQAIEEGFMLNPLKRYMTYVTAARL
                     AQQQLSLNQEENLSCRIFPWMGQSPDNLNIVQKAEIITEHFRHQVVHLMNGQAKAILT
                     THSCQAAQRYQRTFERYIAAQQYQDVQTLTNDHQVIIGAHKHQAKFSSSQLCALYIDK
                     KFTGTDCVQTLSHLGEIHPGKEAPFILDFANPAEQVLHAFRPYHPAAEIFSVSDPKLI
                     YQLQSYLDEARIYNWQDVESFAAAFFDTEQTTERLNYHCQSAVERFREQYQENIKIIQ
                     TAQQAKQEATAAGDRIRRENACHSFKQAEERKNALDRFKENLLSFADCYEHLSQILDY
                     GNQELEKLNVYARHLYSLLGEMQQSEAIDSPPREFISYRLNKICERTFKAARQESLGE
                     PAYNTTGESRANPWRKEASCSLLINRLKPLLAGEYLSDRDRLNYLHAIKDKLLENPAL
                     AAQLEDQRPNPIPSSDFSQIVQHTVMENLKNHHEMAAQLLHDEGMVKDFSRLLLDLLS
                     NQPEQ"
     gene            complement(176949..178229)
                     /locus_tag="Noc_0161"
     CDS             complement(176949..178229)
                     /locus_tag="Noc_0161"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Succinylglutamate desuccinylase/aspartoacylase"
                     /protein_id="ABA56694.1"
                     /db_xref="InterPro:IPR007036"
                     /translation="MKDYTKPHSRIFQHPKKYVHHCLCRLLFSSQLLLILPTVAAALE
                     AQQEDAASSIQISRSLKRVEPDSPKNLPSEGSATIQGKAATQEPLQLLGETINPGVKK
                     RLSWTLSHTFEGIPVSAPILVVNGSHPGPTLCLTAAVHGDEINGIAMVHQTIAALKSS
                     QLNGAVIGVPIVNMYGYRRSSRYLPDRRDLNRHFPGSPEGSSAARIAHSFFQQVITHC
                     DVLVDLHTGSFHRTNLPQVRADLNHPNILKLARSFGGVAVVHSKGVSGTLRRAAMDRD
                     IPSITLEAGEPKRLQLQEVHQGLKGIKNLMNELGMVDEGETKSAPEAVFHQTKWIRTH
                     QAGILLSEVELGDPIKAGQQLGIITNPITNQQIPIVSPYHGQLLGMALNQVTIPGYAA
                     YHIGIKADKPGPIEELPEHVATKTEMLDYSDGEE"
     sig_peptide     complement(178101..178229)
                     /locus_tag="Noc_0161"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.849) with cleavage site probability 0.535 at
                     residue 43"
     gene            179093..179476
                     /locus_tag="Noc_0162"
     CDS             179093..179476
                     /locus_tag="Noc_0162"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56695.1"
                     /translation="MSTILYEANPSMLRMNPFITALSILLIPVGIGIIILLWMYIKTK
                     MDKLTIKTDEIVWMHGLLNKSYTEINMSSVRTVKVNQSVLQRMLNAGDVAIYTAGDNP
                     EVVIRGLPEPDKVRDYIKGQNEERG"
     gene            179480..179779
                     /locus_tag="Noc_0163"
     CDS             179480..179779
                     /locus_tag="Noc_0163"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56696.1"
                     /translation="MGTGVRGELKVLAIVLVVAAGFVLITFAAGGPLIAAVMEALEPG
                     VGLKEAAKWSFSVTVLLFVGFAVAAGDGLLGELQYMLFGFFSFFGIITLLIAWVF"
     sig_peptide     179480..179566
                     /locus_tag="Noc_0163"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.952) with cleavage site probability 0.809 at
                     residue 29"
     gene            180399..182360
                     /locus_tag="Noc_0164"
     CDS             180399..182360
                     /locus_tag="Noc_0164"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity Fe2+/Pb2+ permease"
                     /protein_id="ABA56697.1"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR004923"
                     /translation="MGAIIFSLGKWLGGLVFLISLLGYSGVGSAEVAEGRAQTALHML
                     DYIGVDYPEFVQGGQALNAEEYQEQLEFAREVLGIVEQLPVTLQKGGIEEQAHQLLAL
                     IEEKGPGDRVAMVADQLRWDIIRAYQIEIAPQQAPDLSVAEALYQAQCATCHGAEGYG
                     DGPAAEGMEPEPTNFHEQARQEQRSIYSLFSTITLGVPGTAMPSFKQPLSEHKRWALA
                     FYVSTLITTAEEQQTGAALWQQGIGKEAFPDLQALASQTPQEVGARYGEESRQVLAYL
                     RSAPALLDSEKAPLDLSLEGLEKSLNAYREGHHERAQQLAVEAYLEGFELVETSLNTV
                     APNLRSHIEQEMMAYRALIRKGAPVESLESQQGKLQGLLNQAREQLDEAELSTTAIAL
                     SSLTIILREGLEAVLIVGAIISFLIRSGRRDALIYVHLGWIPALVLGVATWFAATYLI
                     SISGASRELTEGIAALISAAILLYVGFWLHSKAYAKGWRAFLAKQVRGALNKRTLGAL
                     ALLSFLAVYREVFETVLFYQALWTQAGPEGRGAVLGGFGAGVGVLLLVSGLIFYYSVR
                     LPIKLFFGVTSVILALLAVILAGKGVGALQEAGMIPVDAVAFPSMPALGIYPNWQVLL
                     LQGGVLVAIIAGFAYTHFASQRTPSPDNA"
     sig_peptide     180399..180491
                     /locus_tag="Noc_0164"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.916) with cleavage site probability 0.791 at
                     residue 31"
     gene            183535..183948
                     /locus_tag="Noc_0165"
     CDS             183535..183948
                     /locus_tag="Noc_0165"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56698.1"
                     /translation="MTKDRSDNEDKRTLVEQLVSVERISFNVTQSVIVTTEDKIRLSL
                     SSYLQNAKRRSDWIAPASLLIAILATLVTATFNDFILSGATWKAVFIIVGLGAAIWLI
                     RALLFLRDKSTIEELIEEIKTGNRNEESQSSGGSI"
     gene            183948..185312
                     /locus_tag="Noc_0166"
     CDS             183948..185312
                     /locus_tag="Noc_0166"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="TPR repeat protein"
                     /protein_id="ABA56699.1"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR002151"
                     /db_xref="InterPro:IPR011716"
                     /db_xref="InterPro:IPR011717"
                     /translation="MKLQGRLDVLQKKAKAALAIRHYKEAESLLQELLETQVQHFGDA
                     DTQIATTLNNLAALYEAQGRYAQAEELYHRSLAIREQLLGPDHPEVATTLNNLAALYE
                     AQGRYAQAEELYHRSLAIREQLLGPDHPEVATTLNNLAALYEAQGRYAQAEELYHRSL
                     AIREQLLGPDHPEVATTLNNLAALYKKQGRYAQAEELYHRSLAIREQLLGPDHPEVAT
                     TLNNLAALYEAQGRYAQAEELYHRSLAIREQLLGPDHPEVATTLNNLAALYEAQGRYA
                     QAEELYHRSLAIREQLLGPDHPEVATTLNNLAALYKKQGRYAQAEELYHRSLAIREQL
                     LGPDHPEVATTLNNLAALYEAQGRYAQAEELYHRSLAIREQLLGPDHPEVAIMLNNLA
                     GLYRATGLGEKAESLYDRSLAVMEKIFGPRHPNTAIVRANRDAYKHTAPNKANSADAK
                     KRRG"
     gene            185695..185955
                     /locus_tag="Noc_0167"
     CDS             185695..185955
                     /locus_tag="Noc_0167"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, XRE family"
                     /protein_id="ABA56700.1"
                     /db_xref="InterPro:IPR001387"
                     /translation="MSEYRKAGKRVDVSIGESVRILRELQELSQNELSEMTGIPQSTI
                     SAIERDRIRLGVERAKVLARALRCHPAVLVFPGWDVEHESAA"
     gene            186527..186745
                     /locus_tag="Noc_0168"
     CDS             186527..186745
                     /locus_tag="Noc_0168"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function UPF0150"
                     /protein_id="ABA56701.1"
                     /db_xref="InterPro:IPR005357"
                     /translation="MTMHKYEVIIYWSQEDKTFIAGVPELPGCMVHGPTQMAALESVN
                     QAIELWLDTAREFNDPIPEPKGRRLLYA"
     gene            complement(186815..187459)
                     /locus_tag="Noc_0169"
     CDS             complement(186815..187459)
                     /locus_tag="Noc_0169"
                     /EC_number="2.4.2.7"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="ABA56702.1"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR002375"
                     /db_xref="InterPro:IPR005764"
                     /translation="MARLARTFCDGHHKSQGVRFICLFNPNHIKCLPQILVYLGKASM
                     ERLKTKIRDIPDFPKPGVLFKDITPLVGDPATLRLAVHQLLHPFLEQDITAVGGIEAR
                     GFIFGALVAWELGVGFIPLRKSGKLPYEVRSISYQLEYGSASLEAHTDSLGPGDNVLL
                     VDDLLATGGTAKASCELVESLGATVAACAFVIELDFLHGRERLSDYTVHSLVHY"
     gene            187731..188318
                     /locus_tag="Noc_0170"
     CDS             187731..188318
                     /locus_tag="Noc_0170"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56703.1"
                     /translation="MLGGCTLFGGGGDSPGGYTLEVVRVLEQPSPQARERILEVVPFR
                     ISPRYRSRLWLYQEAGSWHRVEEEQAFLIPPQVLVTEQASTYFRRSGLFGAVVEGESR
                     LQVTHLLEGAVTALYGDFSDPMAPRAVMEIQFFLIDPRLDPPKTLLKSGFRVEAEILA
                     ATPQALIQGWNNGLESILENFENDLRRLFDHSSRG"
     gene            188607..191147
                     /locus_tag="Noc_0171"
     CDS             188607..191147
                     /locus_tag="Noc_0171"
                     /EC_number="5.99.1.3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
                     /protein_id="ABA56704.1"
                     /db_xref="InterPro:IPR002205"
                     /db_xref="InterPro:IPR005743"
                     /db_xref="InterPro:IPR006691"
                     /translation="MDEIAQEVFPVNIEDEMKHSYLDYAMSVIVGRALPDARDGLKPV
                     HRRVLYAMRELGNDWNKPYKKSARVVGDVIGKYHPHGDAAVYDAIVRMAQLFSMRCPL
                     IDGQGNFGSIDGDSPAAMRYTEVRMAKIAHELLADLNKETVDFVPNYDESEHEPAVLP
                     TRIPNLLANGSSGIAVGMATNIPPHNLGELLSACIALIDDPALSIAGLMSHIPGPDFP
                     TAGIVNGARGIQEAYLTGRGRIFMRARTHVETDEGSGKQSIIVTELPYMVNKARLLEK
                     IGNLVKEKKIVGIVGLRDESDKDGMRMVVELRRSEMPEVVLNQLYLHTQLQSVFGINM
                     VALVDGQPQLLNLKLALEAFLRHRQEVVTRRTMFELRKARERAHVLEGLAIALANIDS
                     IIALIKASSSPAEARDGLIARFWPPGVVIDMLQRAGAESSQPEKLETAYGLQQDGYRL
                     SPAQAQAILEMRLHRLTGLEQSKIIDEYEQVIIFILGLLEILANPERLMAVIREEFME
                     MREQYSTPRRTEIQDNHVDLRLEDLIQEENVVVTLSHSGYAKSQTLDTYRSQKRGGKG
                     KSATAMKEEDFIDKLFIANTHDTLLCFSSRGKVYWKKVYELPQGSRVARGKPFVNLLP
                     LEEGERINTVLSIREFEKDKYIFMVTASGVVKKTSLADFSRPRSSGIIALDLREGDQL
                     VGADLTDGVQEIMLFSSGGKVIRFSERDVRPVGRTARGVKGMELPSEHRVIALIIAAS
                     GTILTATELGYGKRTAIAEYRLQGRGGRGIISIRTTPRNGEVVGAVQVEKEDEVVLIS
                     DGGTLIRTPVDNISLMGRNTQGVKLINLQEGERLVGIERIVEDGEAGI"
     gene            191189..192271
                     /locus_tag="Noc_0172"
     CDS             191189..192271
                     /locus_tag="Noc_0172"
                     /EC_number="2.6.1.52"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoserine aminotransferase apoenzyme"
                     /protein_id="ABA56705.1"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR003248"
                     /translation="MTRVYNFSAGPAVLPEDVIIQARDEMLDWRGTGMSVMEMTHRGK
                     QFMAIAEQAEADFRELLAIPENYKVLFLQGGATSQFAMVPMNLLQGKKQADYICTGHW
                     SKKAIAEGRRFCEINLAASSEDTGFQHVPPHQDWKLDPEAAYVHYTPNETIAGVEFHW
                     IPDSGEVPLVADMSSTLLSRPLDVSRFGVIYAGAQKNIGCAGLTVVIVRNDLIGRPQA
                     GTPAMFDYQIHADHNSMYNTPPTYAWYVAGLVFSWLKRKGGLTAIAKINQAKANTLYS
                     FIDSNDFYYNPVERAFRSRMNVPFILSEQQLDEIFLEQAKKAGLTNLKGHRSVGGMRA
                     SIYNAMSQEGVETLVEFMKEFERTRA"
     gene            192378..193541
                     /locus_tag="Noc_0173"
     CDS             192378..193541
                     /locus_tag="Noc_0173"
                     /EC_number="1.1.1.95"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="ABA56706.1"
                     /db_xref="InterPro:IPR000205"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /translation="MYKILTLNNISIVGLDRLPRDKYEVASEIQHPDAILVRSHNMHE
                     MAIPPTLKAVGRAGAGVNNIPVARLSEGGVAVFNAPGANANAVKEAVLAGLLVSARNI
                     CQAWEAARTLTGTDKEIHREVEAQKKRFVGVELPGRTLGVVGLGSIGVQVANAALALG
                     MRVVGYDPQITVQRAWALSAQVEQATNLDHLLSQADFLSLHVPLLEATRGLINRERLR
                     NIKPEARLLNFARAEIVDEDAVVDAIEEGKIAAYICDFPSNRLKGHPQVIALPHLGAS
                     TYEAEENCAVMVVEQIREFLENGNVQNSVNFPDAVLPRTDSWRLAIANANVPTMVAQI
                     STHLAEAGLNIIDMLNKSQNDLAYTLVDVDRPIPKYLVDGISAVQGMLSVRAL"
     gene            193581..194666
                     /locus_tag="Noc_0174"
     CDS             193581..194666
                     /locus_tag="Noc_0174"
                     /EC_number="5.4.99.5"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate mutase"
                     /protein_id="ABA56707.1"
                     /db_xref="InterPro:IPR001086"
                     /db_xref="InterPro:IPR002701"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR010957"
                     /translation="MDDSHQLQEIRARIDALDEQLQCLINERAELARQTAQIKQAAGL
                     GENCFRPEREAEILRRVIARNQGPLSGQEMARLFREIMSACLALETPLVIAYLGPEGT
                     FTEAAALKHFGHSVKTQPLMAIDEVFREVEAGTAYYGVVPVENSTEGAVTHTLDRFLV
                     SPLQICGEVELRIHHHLLSRNQTIAEVNRLYAHQQTLAQCREWLDAHLAGCERIPVSS
                     NGEAARRAGDESDCAAIASDRAREIYGLHALATNIEDEPGNTTRFLVIGSQAVVASGN
                     DKTSLLVSGPNRSGLLYDLLSPLAEYGISMTRLESRPSRRQLWEYVFFIDVEGHIDDS
                     NLTTALATLKERASFLKLLGSYPRAVI"
     gene            194683..195795
                     /locus_tag="Noc_0175"
     CDS             194683..195795
                     /locus_tag="Noc_0175"
                     /EC_number="2.6.1.-"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="ABA56708.1"
                     /db_xref="InterPro:IPR001176"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005861"
                     /translation="MAESLFYQLAAAGVQGLTPYQPGKPIEELEREYGVRGAVKLASN
                     ENPLGPSPMAIDAIYGVLGESGRYPDGNGFALKTALSQCLGIPANQITLGNGSSDLLE
                     FAARVLISPEHEVIYSQYCFALYPLLIQILGAKGHAVPAKGFGHDLEAMVKAVNSQTR
                     LVYIANPNNPTGTWLHSDELEAFLAALPEHVLVVLDEAYYEYVNEAQYPYSLAWMSRY
                     PNLMITRTFSKIYGLAGLRIGYGVSHPDLADLMNRVRPPFNVNSLALAAATAALQDHD
                     HLQRSRKVNQAGMAQLTMAFTALGLDYIPSVANFVTVDVKQSGDKVYENLLRHGVIVR
                     PMTGYGLPRHVRVTVGREEENARFIQVLETVLEEFR"
     gene            195792..196652
                     /locus_tag="Noc_0176"
     CDS             195792..196652
                     /locus_tag="Noc_0176"
                     /EC_number="1.3.1.12"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydrogenase"
                     /protein_id="ABA56709.1"
                     /db_xref="InterPro:IPR003099"
                     /db_xref="InterPro:IPR004455"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR011128"
                     /translation="MIRRLCILGVGLIGGSLALALKQAKGVGEVVGYERDPIARDKAL
                     SLGIIDRAELDLAEALRGADVVVLAVPLGAMEELLQAMAPSLKPGMVVTDVGSVKGSV
                     VASARAKLGEYIVDFVPGHPIAGTERNGPEAAFADLFCLHKVLLTPLPESRAVAVRMV
                     RMMWHQVGAEVIETSISHHDRMLAGTSHLPHILAYTLIDMLAKLGETQEALQFAAGGF
                     RDFSRIASSDPSVWRDICLANKEPLLALLERFRTELHGIGEAIHRGDGAKLAEIFARA
                     KAVRDTHYKR"
     sig_peptide     195792..195854
                     /locus_tag="Noc_0176"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.996) with cleavage site probability 0.937 at
                     residue 21"
     gene            196685..198019
                     /locus_tag="Noc_0177"
     CDS             196685..198019
                     /locus_tag="Noc_0177"
                     /EC_number="2.5.1.19"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="ABA56710.1"
                     /db_xref="InterPro:IPR001986"
                     /db_xref="InterPro:IPR006264"
                     /translation="MQPIEEVSQDTMAFVVAPGGALRGRLRVPGDKSISHRAIILGAL
                     AEGITQITGFLEGEDTLATLQAFRDLGVSIEGPEGGRVKIHGVSLQGLRAPEKPLYLG
                     NSGTSVRLLAGLFAGQSFDVILRGDESLSRRPMRRVCDPLARMGAFIETTAQGTPPLH
                     IHGGQSLYGIEYAMPMASAQVKSSLLLAGLYASGRTCVVEPAPTRDHSERMLAGFGYP
                     VEREGAKVCIQGGGTLHGTVVEIPADISSAAFFMVGAAIGKGSDILLEHVGINPTRTG
                     IIDILRRMGAEIEIRETGVVGGEPVAAIRVRASRLHGINIPEDLVPLAIDEFPALFIA
                     AACAEGETVLAGAGELRVKESDRIQVMADGLQALGISAQPTADGIIIQGGELQGGEVH
                     SHGDHRCAMAFAMASLVAKGPIIIRDCANVATSFPGFLELACGAGLAIRHGK"
     gene            198046..198738
                     /locus_tag="Noc_0178"
     CDS             198046..198738
                     /locus_tag="Noc_0178"
                     /EC_number="3.1.3.18"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-superfamily hydrolase subfamily IA"
                     /protein_id="ABA56711.1"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006402"
                     /db_xref="InterPro:IPR006439"
                     /translation="MSPYKLIVFDWDGTLMDSEARIVASMRSAIHDLSFPFREDAQLR
                     NVIGLGLPEALAMLYPEGDKVMKNALVERYRHYYLSADLTPSQLFEGVEELLGKLHEQ
                     GYLMAIATGKGRSGLDRVLPEVGVAHYFCTSRCADETASKPNPRMLLEIMAQTQARPE
                     ETLMVGDTEYDLLMAKYAGTDALAVSYGVHEKTRLQQCGPIGCVDSVTALEGWLSAGP
                     AYAARNASCRHG"
     gene            198813..199496
                     /locus_tag="Noc_0179"
     CDS             198813..199496
                     /locus_tag="Noc_0179"
                     /EC_number="2.7.4.14"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidylate kinase"
                     /protein_id="ABA56712.1"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003136"
                     /db_xref="InterPro:IPR011769"
                     /db_xref="InterPro:IPR011994"
                     /translation="MSKEIPVITVDGPSGSGKGTLAQQLAQHLEWHYLDSGAMYRVLA
                     LAADKHGIAPNAPKQLETLAQNLDVRFISGLEGMPARVFLEGSEVSDSIRREECGNAA
                     SKIAALAEVRGALLMRQRAFRKAPGLVTDGRDMGTVVFPEADLKIFLTASPYERARRR
                     YKQLKEKGIGANLKNLEKEIAERDRRDCERNIAPLKSADDAIILDSTNLAIKEVFQQV
                     LPWLSGKNT"
     gene            199616..201301
                     /locus_tag="Noc_0180"
     CDS             199616..201301
                     /locus_tag="Noc_0180"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S1P"
                     /protein_id="ABA56713.1"
                     /db_xref="InterPro:IPR000110"
                     /db_xref="InterPro:IPR003029"
                     /translation="MGESFAELFEESQADMPMAPGSIVTGTVMEIRSDVVIVNAGFKS
                     EGVISAEQFRDEKGNLNISEGDLVEVALEAIEDGFGETRLSRQKAKEARVWNDLEGAF
                     EAGETITGVLTGKVKGGFTVDLNGVRAFLPGSLVDARPVRDTAYLESKELEFKLIKLD
                     RRRNNIVVSRRAVMEAEYSAEREALLSSLEEGKTVKGVVKNLTDYGAFVDLGGLDGLL
                     HITDMSWKRIKHPSEVVNIGDDITVQVLKFDRERQRVSLGLKQMGEDPWKDLARRYLD
                     GTRLFGKVTNVTDYGCFVEIEEGVEGLVHMSEMDWTNKNIHPSKMVQVGEEVEVMVLD
                     IDEERRRISLGMKQCLPNPWEEFAHRYNKDDRVAGEIKSITDFGIFVGLEGGIDGLVH
                     LSDISWSASGEEIIRDYKKGDQVEAVVLAIDPERERISLGVKQLEDDPFSSYIATCPK
                     GSIVKGIVKVVDTRGAVIELAEGVEGHLRASEIARERIDDARTSLNVGDSIEAKFTGI
                     DRKNRVITLSVRAKDVEEEAEAIKEYSGTGAEAASTTLGDILKEQMERQEEEG"
     gene            201338..201679
                     /locus_tag="Noc_0181"
     CDS             201338..201679
                     /locus_tag="Noc_0181"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Integration host factor, beta subunit"
                     /protein_id="ABA56714.1"
                     /db_xref="InterPro:IPR000119"
                     /db_xref="InterPro:IPR005685"
                     /translation="MAPELVVVCGFGSALFVMTKSELIERLAQRQALLSYRDVELAVK
                     MLLEVMSQALAQGERIEIRGFGSFSLHYRPPRSGRNPKTGDAVPLSSKYVPHFKPGKE
                     LRERVDRGESI"
     gene            201743..202186
                     /locus_tag="Noc_0182"
     CDS             201743..202186
                     /locus_tag="Noc_0182"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF598"
                     /protein_id="ABA56715.1"
                     /db_xref="InterPro:IPR006729"
                     /translation="MKFSLDERTDVYTVSAYGSGYVEFRIPVSSEKEPERLQGEGLKE
                     NRGRQKICRNVVVSPGRLQEWSPASFSELEKAHFQAFLEMEPEVVVVGTGEQSHFLSP
                     RLIEPLLRHQIGVEFMDTAAACRTYNILVGEGRRVVAALFIIRQP"
     gene            complement(202201..203166)
                     /locus_tag="Noc_0183"
     CDS             complement(202201..203166)
                     /locus_tag="Noc_0183"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase, sigma 38 subunit, RpoS"
                     /protein_id="ABA56716.1"
                     /db_xref="InterPro:IPR000943"
                     /db_xref="InterPro:IPR007624"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR007630"
                     /db_xref="InterPro:IPR009042"
                     /translation="MVFLSKGGKTLSISKSETALREYEEPQHLSINPENTRESQPLGD
                     HEFDATHLYLSEIGCAPLLTAEEEVYHARLAKKGNPAGRKRMIESNLRLVVKISRRYM
                     NRGLALLDLIEEGNLGLIHAVEKFDPEMGFRFSTYATWWIRQTIERALMNQTRTVRLP
                     VHVVKEIKSYQRVANKLAQELEHDPSFEELAQQLNKPVEEIKRVWSLKDNTASMDTGY
                     RNNQEKTLLDALPDEDAPDPTVLLQNDDMQSRLKLWLSQLNDKQREVVIRRFGLQGYE
                     PQTLEQVGQAIGVTRERVRQIQLETLKRLRRILTKEGISVDILFK"
     gene            complement(203245..203583)
                     /locus_tag="Noc_0184"
     CDS             complement(203245..203583)
                     /locus_tag="Noc_0184"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
                     /protein_id="ABA56717.1"
                     /db_xref="InterPro:IPR000813"
                     /db_xref="InterPro:IPR001450"
                     /translation="MTFVVTENCIKCKYTDCVEVCPVDCFHEGPNFLVIDPDECIDCT
                     LCEPECPAEAIFSEDDVPKEHQKYLGINAELAKSWPVITESKEPPADADQWDRIKNGE
                     VEDKLPHLEK"
     gene            204089..205252
                     /locus_tag="Noc_0185"
     CDS             204089..205252
                     /locus_tag="Noc_0185"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="TPR repeat protein"
                     /protein_id="ABA56718.1"
                     /db_xref="InterPro:IPR001440"
                     /translation="MIEWLLLLLPVAAASGWLAGKRSAETVNADSHSQLNSAYFAGLN
                     HLLNEQPDKAIDTLLNALKVDSDTVEPYLALGNLFRRRGEVDRAIRVHQNLIERPYLS
                     SSQRGQALLELGLDYMRAGMLDRAESSFLEVLKRRSHIGITLRQLLDLYQQEKNWHQA
                     IAMAQKLHEESGEATESMIAHFYCELAEQHWAQKKAVETTRFIKQALASDWRCVRATL
                     LQSSLAMEKGDYKRAIRCLRQVERQDPDYLPEILKPLSECYQYLEGQDKFFFWLTEAS
                     KRHPGCTSLVLARAAYLQQRGEQKEARYFLIEQLRVYPSVEALQQLLALGVPEDIEAA
                     SEPWSLIEEVASRLLKAKLNYVCGFCGFGGKYCYWQCPGCKRWGTVKPLAVGT"
     sig_peptide     204089..204163
                     /locus_tag="Noc_0185"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.971) with cleavage site probability 0.954 at
                     residue 25"
     gene            205381..205731
                     /locus_tag="Noc_0186"
     CDS             205381..205731
                     /locus_tag="Noc_0186"
                     /EC_number="1.20.4.1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Arsenate reductase"
                     /protein_id="ABA56719.1"
                     /db_xref="InterPro:IPR006659"
                     /db_xref="InterPro:IPR006660"
                     /translation="MSQVSIYHNPRCSKSRQTLQLLREQGIEPIIIEYLTSPPTSAQL
                     SEILQLLDKNPRDLMRQKEAEYQDNGLDNPSLSQEQLIAAMVAHPILIERPIVLANGK
                     AAIGRPPEKVLEIL"
     gene            205748..206350
                     /locus_tag="Noc_0187"
     CDS             205748..206350
                     /locus_tag="Noc_0187"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Flavodoxin/nitric oxide synthase"
                     /protein_id="ABA56720.1"
                     /db_xref="InterPro:IPR008254"
                     /translation="MPEILILYYSRHGSVAAMAERIARGVEEVEGMQARLRTVPAVST
                     VCEAVEDSIPAGGHPYASHDDLRECAGLALGSPTRFGNMAAPLKYFLDSTSTLWLSGA
                     LAGKPAAVFTSTSSLHGGQESTLLSMMIPLLHHGMVLLGIPYTEPALMNTQEGGTPYG
                     ASHVAGADNQLPLSENEIILCRALGRRLARMGASLAVTRQ"
     gene            206424..207233
                     /locus_tag="Noc_0188"
     CDS             206424..207233
                     /locus_tag="Noc_0188"
                     /EC_number="6.3.4.15"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Biotin--acetyl-CoA-carboxylase ligase"
                     /protein_id="ABA56721.1"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004408"
                     /translation="MQTDIAPLKSQLIRAAMGEDSLEWLSQLELYPVLDSTNRYLLAR
                     VKHGAKKGTVCLAEAQSAGRGRHGRLWLSPPSGNIYLSLLWCFSKNPQFLSGLSIAAG
                     VGVLRALQDQGVTKIGLKWPNDVLWDDRKLGGILVELVPKEGGTGVVVGVGINVNMPI
                     PYREQLVQSCTDLAEATQNRSVDRNYLAGRLIHHFLLIMHNFERWGLRDCLDDWRRWD
                     ACYQREVYLYEGSRVISGIACGINEEGSLLLQEKGRISCHFCGEVSLRRVK"
     gene            207230..208030
                     /locus_tag="Noc_0189"
     CDS             207230..208030
                     /locus_tag="Noc_0189"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Bvg accessory factor"
                     /protein_id="ABA56722.1"
                     /db_xref="InterPro:IPR004619"
                     /translation="MILLVDIGNSRIKWARLDGGKPADMGAVTRGKTGIKRVLSKAWK
                     EFGDVNRVVVANVGGPKVAEQLEQWLQTHWQIAPEFLTARSNGYGIRNAYSKPETLGI
                     DRWLGLVAVRQRYRGGDRKKAICIVDCGTAITLDVLAADGKHLGGLIIPGLAMMPKFL
                     ADHTAGINETTEAVEYSLLASTTSAAINAGALYGAVAFIDRVSHDVAVEMKGELKFVI
                     TGGDAPRILPLLRDKYEHLPDLVLRGLARVAKDTSKVRRETDLDCAAQ"
     gene            208097..208171
                     /locus_tag="Noc_R0003"
     tRNA            208097..208171
                     /locus_tag="Noc_R0003"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr1"
     gene            208217..209287
                     /locus_tag="Noc_0190"
     CDS             208217..209287
                     /locus_tag="Noc_0190"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function UPF0118"
                     /protein_id="ABA56723.1"
                     /db_xref="InterPro:IPR002549"
                     /translation="MRLVRNWFQRHFADPQVVGLAILLAVGFITVVLMGRMLAPVLAS
                     LVIAYLLEGIIGYMERWHCPRWLAVTLVFITFMAALFSLIFGLLPLLSQQLTEFFQQL
                     PVMIARGQELLLSLPEYYPNLFSGEQVYDLMSALRSELAQWGQKVLSVSLASVVGLIT
                     LAVYLVIMPLLVFFFLKDKARLIGWLEQYLPRERKLAAQVWHDVDFQIGNYVRGKFLE
                     ILIVCAVTAITFTFMGLQFSMLLSVLVGLSVIIPYIGAVAATLPVAFVAYFQWGFSID
                     FAYLLGAYGIIQALDGNVLVPLLFAEVVDLHPVAIIVAILVFGGFWGFWGIFFAIPLA
                     TLVQAVLKAWPSLPPPEESTIL"
     gene            209603..210415
                     /locus_tag="Noc_0191"
     CDS             209603..210415
                     /locus_tag="Noc_0191"
                     /EC_number="2.8.1.1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Thiosulfate sulfurtransferase"
                     /protein_id="ABA56724.1"
                     /db_xref="InterPro:IPR001307"
                     /db_xref="InterPro:IPR001763"
                     /translation="MAMFSLLLQPDELVRRLDEKNLLLIDLGSEESYLARHVPGAVHL
                     DYTHIVAARPPVMGLLPDEHRLSRVLSQLGFTPESHVVAYDAEGNGRASRLLWTLEEL
                     GHKHFSLLDGGLKAWLVEECPVKEGRESRQPSHFHGRYQGHQAADKEYILAHLLDPKV
                     VILDARSPAEYHGEYVRAQRGGHIPGAVNFEWTQAIDQERNLRFKPMDELRSSLEALG
                     ITPDKEVICYCQTHHRSAHTCMVLKYLGYPKIKGYPGSWSEWGNAPDTPIKV"
     gene            210423..211235
                     /locus_tag="Noc_0192"
     CDS             210423..211235
                     /locus_tag="Noc_0192"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Metallophosphoesterase"
                     /protein_id="ABA56725.1"
                     /db_xref="InterPro:IPR004843"
                     /translation="MTSLPHLKIANDRSEFINVLQLTDSHLLADSEAFLWNDLNTRRS
                     LVAVLNHIQQQGLLGDLMVISGDIAEKAEPEAYYWLLERCQELGLPVYCLPGNHDDPV
                     LMDEILNGMNVSTESLVTLKNWQLIFLNSVVTQRSHGHLSKGQLGFLNRSLADSLDLN
                     TLIFLHHPPVALGSPWMDAMGVDNAADFFAVLDLYPQVRGVAWGHAHQEFHTERQGVQ
                     LLGSPSTCVQFVPGSEHFQLDQRGPGYRWLILLPGGQIETRVYYVDCPPPAR"
     gene            211316..211726
                     /locus_tag="Noc_0193"
     CDS             211316..211726
                     /locus_tag="Noc_0193"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="ABA56726.1"
                     /db_xref="InterPro:IPR000086"
                     /translation="MSKPTFFVVAVAVFLVHDNRFLALRRSTSKAVAPGAWEVISGKV
                     ERGELPHETARRETYEETGITVALDERPVTTYQADYGMAPMIVLVYRGKRLAGEASLS
                     SEHEAMAWVTEDEFAQLCLYGELVEAARWALKVP"
     gene            212129..213991
                     /locus_tag="Noc_0194"
     CDS             212129..213991
                     /locus_tag="Noc_0194"
                     /EC_number="3.1.6.6"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Arylsulfatase A-like enzyme"
                     /protein_id="ABA56727.1"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR006311"
                     /translation="MAKSNNLSRRQFLKTTGAVAMASSVAGFSDVLAVRDWSHPGRGL
                     RGRPNILLMLVDEMRYPPVFEGLGAQQFRQTYLKTQNALRASGVEFHRHYAAATACAP
                     SRASIFTGHYPSLHGVTQTTGAAKEENDPDVFWLDPASVPTMGDYFQAGGYRTFYKGK
                     WHVSNADLQIPGTHDQLLSYDDQGNPDPGKQQLYLEADRLADYGFEGWIGPEPHGKAP
                     LNTGSSPAQGQGRDVGFATQVVNLIQQLGTERHSAPWLTVASLVNPHDIALWGYVARH
                     TGLFNFTVEDIVPAFTELFDPVMFAQTLADDLTTKPSCQQSYQESYNEWMQGVPPHDY
                     FRFYYQLHKNVDDELYKLYQALQQSPFYDNTIVIFTSDHGDLLGAHRYMHQKWYQAYD
                     EAVRVPLIISNPHLFPEPRSIDSVTSHVDLLPTLLSLARLKQARLRRKVAKGHSDPVP
                     LVGRNLRRLVLGRNRRPVADPVYFMTDDDMSRGLDQENFIGIAYGSVIQPSHVETVIV
                     EIDGEVWKYSRYFDNKQFWSDPSQPKDVVTQVENKLIDPPAGTYDVNATQSFKYEPEP
                     DEYEMYNVTQDPMELDNLYGNLVYAAMQTHLATLLDQQRAQKRLTPISGVVPGQ"
     sig_peptide     212129..212230
                     /locus_tag="Noc_0194"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.993) with cleavage site probability 0.493 at
                     residue 34"
     gene            214478..215035
                     /locus_tag="Noc_0195"
     CDS             214478..215035
                     /locus_tag="Noc_0195"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56728.1"
                     /translation="MRGVGDNSLTADLQLVSDDFTGQNSGQSILASCETAADVKVPKK
                     DTLDDRPAWEFSTSLIEYYADTEIVGVAMLADDFHLQVISTGWPKITPQAIPLLIICR
                     LWSAATRLPICHARAPVPPPPIITPTTGRTLSPSSTMAGHPIPPITVTAERLRFALGG
                     RPRYGKNRYIANRVKGLYSKRAMGL"
     gene            215139..215462
                     /locus_tag="Noc_0196"
     CDS             215139..215462
                     /locus_tag="Noc_0196"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56729.1"
                     /translation="MFSAIDRGDGSSADGEFNALALAFDALVQRELVYQRVKRFFHHH
                     VFETDLAAVRVTSWVDLGERWVLCLDRTLWQLGHTPINVLVLSVAYAEVSVPLQLILN
                     KMIQF"
     gene            complement(215434..215754)
                     /locus_tag="Noc_0197"
                     /pseudo
     gene            complement(215802..216214)
                     /locus_tag="Noc_0198"
                     /pseudo
     gene            216418..216494
                     /locus_tag="Noc_R0004"
     tRNA            216418..216494
                     /locus_tag="Noc_R0004"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg1"
     gene            216937..217581
                     /locus_tag="Noc_0199"
     CDS             216937..217581
                     /locus_tag="Noc_0199"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, TetR family"
                     /protein_id="ABA56730.1"
                     /db_xref="InterPro:IPR001647"
                     /translation="MIKRSASRDQDTQTSGQGREAILSAAKIQFAEQGYHGTTLSLIA
                     AHAKVCKANIFHHFGSKEGLYLAVLKDYCEQLSPLRGGRSISAPTCREQLRQFAQIHL
                     ENMFNEPGAVQLFLRELLAQDSHRKEMLAKGVLEGNFARLVQMVREGQAAGEIRSTID
                     PAVLAVALLGADVFFFMARDVFQHFRDVSFAEGVEDYSKALSEILLTGCLVERD"
     gene            217663..218760
                     /locus_tag="Noc_0200"
     CDS             217663..218760
                     /locus_tag="Noc_0200"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Secretion protein HlyD"
                     /protein_id="ABA56731.1"
                     /db_xref="InterPro:IPR006143"
                     /translation="MLKRLIVVLLALGLFFGGIFGWKYHQQQQQAAQAAMPPPPATVA
                     AAKARPESWRTSLHAVGSLVATQGVYVTNEIAGLIEAINFESGERIKKNKLLLQLEDS
                     VDKAELEGLLAEQKLAELQFQRNARLLKKKMVSRSIYDESQAQLENAQAMVAAKRALI
                     QKKQIRAPFSGLLGIRQVDLGEYLAPGSPIVLLQALDPIYVDYSLPERYFSLLAQGQT
                     VLITVQAYPAQHFKGRITAINPGIDPNSRNVQVRATFDNPELHLRPGMFAEVRAVLPE
                     KKQVLTVPQTAITYNPYGDMVFIIQKENGGLVVQQQPVRTGKVRQGQVEIIKGLQAGD
                     WVVSAGQMKLHSGQQIRISEQEVLDGQVDGT"
     sig_peptide     217663..217728
                     /locus_tag="Noc_0200"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.962) with cleavage site probability 0.557 at
                     residue 22"
     gene            218757..221843
                     /locus_tag="Noc_0201"
     CDS             218757..221843
                     /locus_tag="Noc_0201"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Acriflavin resistance protein"
                     /protein_id="ABA56732.1"
                     /db_xref="InterPro:IPR001036"
                     /translation="MKFTDLFVRRPVLASVVSLLILLIGMRSLTLLEVRQYPETENTV
                     VTVSTAYPGASSELINGFITTPLQQAIAEAEGIDYLVATSTQGHSIIEAHMVLNYDSN
                     AAVAEIQAKVASQRNVLPEEAENPVIDSTTGDSTALMYMAFYSEAMSPAQITDYLLRV
                     VRPKLQAVPGVSKAQLIGNKTFAMRIWLDPRRMAALGVTANDVREVLLENNYLASVGH
                     TKGAYVAVDLSATTDISREEDFLNLVVREADGALVRLRDVAEPQLGAEDYDSSNWYNG
                     KPAIFIGIEQAPGANPLDIAGHLHDLMPEIRRQLPSGVDGYIVYDASAYIEDAIREVF
                     RTLAEAVLVVLVVIFLFLGSLRAALVPAIAVPLSLIGGAFLMLVLGFSLNLLTLLAMV
                     LAIGLVVDDAIIVVENIHRHLEHGESRFQAAIHGARELGLPIIAMTTTLVAVYAPIGF
                     MGGLVGTLFTEFAFTLASAVLVSGVVALTLSPMLSSKMLRPVSEAGRFEQWVERFFTR
                     LAGYYLRLLRYALESLPVVIVFAGAILCSIYFMYVTSQNELAPTEDQSILFFQATAPQ
                     TATIDYDEAYSRQIIDIFESFPEYHESFLLLGQGGDPSTVFGGFKMPVPSQRERSQME
                     IQPEMQQKLQGIAGFQIAVFPRPSLPGSGGGLPLQFVITSAADFSRLDQIAEELIRQS
                     MASGKFAFLQKSVKFSRPKTTLKINRDLAGDLGIRMKDIGQNLGIMLGGGYINWFNLE
                     GRSYKVIPQVDRRYRLDQEMLENYYIRTGAGELIPLATLISFEETVEPSKRVQFQQLN
                     SLTVQGVMAPGVAVGEALAYLEDKAREIFPSAFSWDYAGESRQYTQQGSALMVTFFFS
                     LLVIYLVLAAQFESWRDPVIILMSVPMSIAGALVFLTLGFATVNIYTQVGLITLIGLI
                     AKNGILIVEFANQLQLQEGLDKQAAVEKASSIRLRPILMTTVSMIVAMVPLLMASGPG
                     AVSRFDIGLVVASGLGIGTLFTLFVVPAVYLLVAGDHREEKEAVQEPMEQESGFKA"
     gene            222460..223192
                     /locus_tag="Noc_0202"
                     /pseudo
     gene            complement(223337..223744)
                     /locus_tag="Noc_0203"
     CDS             complement(223337..223744)
                     /locus_tag="Noc_0203"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Cu(I)-responsive transcriptional regulator"
                     /protein_id="ABA56733.1"
                     /db_xref="InterPro:IPR000551"
                     /db_xref="InterPro:IPR011789"
                     /translation="MMSISEAATQSGLPAKTIRYYESIGLVYPPQRGSNGYRRYDQGT
                     VRILQFIRRARGLGFSVEECRNLLSLYQDKNRASAEVKRLTKQRVVDINNKIAELTAM
                     RTTLTQLIDRCQGGQRPDCPILEDLAQSNLPPP"
     gene            complement(223766..223972)
                     /locus_tag="Noc_0204"
     CDS             complement(223766..223972)
                     /locus_tag="Noc_0204"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Heavy metal transport/detoxification protein"
                     /protein_id="ABA56734.1"
                     /db_xref="InterPro:IPR006121"
                     /translation="MEKTYKVEGMTCGGCVQSVEKAINAVAPAATVKVDLENNHVTVT
                     GIEDDNLVAQAVENAGFDYEGPVF"
     gene            complement(223984..226455)
                     /locus_tag="Noc_0205"
     CDS             complement(223984..226455)
                     /locus_tag="Noc_0205"
                     /EC_number="3.6.3.4"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Heavy metal translocating P-type ATPase"
                     /protein_id="ABA56735.1"
                     /db_xref="InterPro:IPR000150"
                     /db_xref="InterPro:IPR000579"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR001802"
                     /db_xref="InterPro:IPR001877"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR006403"
                     /db_xref="InterPro:IPR006416"
                     /db_xref="InterPro:IPR008250"
                     /translation="MLEISRLTTDKESFSAVPSKEAAQTLVLPIKGMTCATCSTRLER
                     VLNKVPGVVKSQVNLASEQAKIAFNPQQTSPQRFYQAITQAGFSVPLEGMEFRIGGMT
                     CATCSARLEKVFSRLAGVSKVTVNLATERALLKAPAGVLPPAAVIATAQQAGFTATLL
                     SNRAEKGNQDEAEKIAEEQHEWNHLLLAILLTLPLALPMLLMPFGIHADLPAGIQFLL
                     ATPVQFWVGRRFYTGAYRSLRGGSANMDVLVILGTSAAWGLSTWNTLMPGAGSDLYFE
                     ASAMVITLILLGKRLEGRAKRSAASAIRALMALQPTVARIEQGEKILEVPIEQVAEND
                     IVLVRAGERVPVDGVILEGHSQLDESLITGESLPVSRGEGETITGGSVNGEGLLRVRA
                     TTVGTESTLARIIRLVEDAQASKAPVQKLVDRVAHIFVPVVVTLALLTFAGWWWLAGS
                     ADTAFIAAVSVLVIACPCALGLATPTALMVGTGVAARYGILIRDAVALERAQDSNTVV
                     FDKTGTLTEGQPAVTEILAVNISEETLLQWVASAQQGSEHPLAKAALAKAQGLPLQPP
                     RNFRSLPGRGLRAQVQKRTLIVGNLRLMREYQVDFTSLSARAQILEESGHTLMWVAEI
                     DSAAQLLGVLAVTDPIKNTAPQAVAALRARGLTTMMLTGDNPRVAQVVADKVGIDQVI
                     AEVLPEDKAAHIQALRAKGCHVAMIGDGVNDAPALAAADVGMAMGTGTDVAMEAAGIT
                     LMGGNPTLVAEALSISRATYGKIRQNLFWAFIYNVIAIPLAASGMLSPVVAGAAMALS
                     SVSVVSNSLLLRRWRPGSQSIISSF"
     gene            complement(226949..228220)
                     /locus_tag="Noc_0206"
     CDS             complement(226949..228220)
                     /locus_tag="Noc_0206"
                     /EC_number="3.1.3.3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="protein phosphatase 2C-like, stage II
                     sporulation E"
                     /protein_id="ABA56736.1"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR010822"
                     /translation="MNTSLLEGKRNDIPATDLLRLLEISRQLAIITDLQKLLAQIEHA
                     ALKIFACERATVFVFDHDSNELYSYVASRPEKIRFPARQGIAGECFHNNHIIKVSDAY
                     KDPRFNPAVDDETKFKTHNILSCPLTTHDQTPIGVLQILNKCSGEFNQWDEILLRTLS
                     AQCGVALERQFLLEQFVEKQRLQHDINIARQIQQHLLPKQPPAVEGFDIAAWNQPAEE
                     TGGDFFDYHQLIDGRLMLTIADVTGHGIGPALVAAQCHALQRAAFAFLPEIQQVATLV
                     NRLLSEDIPDDRFVTVFFALLSPHNQELVFTSAGHGPILLFQAKDNQIQKLPTHGPPI
                     GIIPNITYEGWDRLCFNQGDMLITFTDGFFEWVNPEGKPFGVERICKIVKNYPTLPAA
                     NIIQQIYSELLAYTQGVPQADDLTALLIKKN"
     gene            228655..230709
                     /locus_tag="Noc_0207"
     CDS             228655..230709
                     /locus_tag="Noc_0207"
                     /EC_number="3.1.3.3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="protein phosphatase 2C-like, stage II
                     sporulation E"
                     /protein_id="ABA56737.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR010822"
                     /translation="MNKREIDPARAELELERELTKEKSVEQSLPQQIVSLKERLFQQA
                     VELKKVKATLKESEERFNQVAAMTGEWIWEQDDKGHYTYSSISVDAVLGYPWQALIGR
                     CYDEFIPIEEQEKLRSKMRQGVETGQGFQHLIRRYRHRDGHLVFTESTAMPVFDEQNS
                     LLKWRGIDRDITATRRADELVFMLSRALEQSPNAILITDLKGNIEYVNTSFTRLTGYE
                     AKEVIGKNPSLLQSGKTPLEQYRRLWETIRAGREWRDEIQDRKKSGELYWALETITAL
                     RDGEGNPTHFLAIQEDITERKRVEAALRESEAQTRLIIENALDAIVLISANDSITDWN
                     PQAEKIFGWKREEVLGLSLAETIIPPRHREAHWQGLRRFLNTGKGPILGKRVELSALH
                     RDGHEFPVELTVLPLKVRNSYVFSGFLRDLTQQKETEEAIRQARVKLAVAQNEMRIAQ
                     QIQESLFPPAPLVLPTVKIMGYCLPATHVGGDYFDYFQWRDKTIDIVIADVSGHSVGP
                     ALLMAEARSALKSQFHLHRTVVETLSSLNETLYEDLDRADLFITLCYLRYDMVTRQLT
                     YANAGHLPPLLFRQGQRCRQLDADGLVLGVNREVIFETRSESLQPGDMLFLYTDGIIE
                     AENKKGDFFGIERLCDLLNEHHQAGSEPQEIITNIIERLQAFRHRKTFEDDVTMVVVK
                     VL"
     gene            230782..232821
                     /locus_tag="Noc_0208"
     CDS             230782..232821
                     /locus_tag="Noc_0208"
                     /EC_number="3.4.24.70"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptidase A, Metallo peptidase, MEROPS
                     family M03A"
                     /protein_id="ABA56738.1"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR006025"
                     /translation="MSNPLLEFAGLPPFSKIQPAHVEPAIDCLLAEGRALIEQLLTRH
                     TVYTWDNLAQPLEDLREHLDRVWSPVSHMNAVVNSDGLRRAYNACLPKLSEFATELGQ
                     NENLYRAFQSIAEGDEYPSLNVPQKKIIVNALRDFRLSGVTLPSEKKARFKAIQQQLA
                     SLNAKFEENLLDSTQAWRKHLADETILAGLPEGARAQARQAAEQAGLEGWLLTLEAPS
                     YVAVTTYADDRELREEIYTAFVTRGSDQGPHGGRWDNTQVMEEILALRHEAAQLLGFA
                     NHAECSLATKMAGNPQQVLDFLNDLAVRSKRVAEQDLAEVRSFAQAHYGIEDLQAWDV
                     AYYGEKLRQHKYAISQEELKPYFPVWRVLEGLFTIVNRLYGLEIQERKDVDTWHPQVR
                     FFDIFDDSGELRGQFYLDLYARSNKRGGAWMADCLSRKRQGSQLQIPVAYLTCNLTPP
                     VDDKPALFTHNEVITLFHEFGHGLHHLLTKIDYPSVAGISGVFWDAVELPSQFMENWC
                     WQQEALALIACHFETHEPLPEKLFERMLAAKNFLSGMMIVRQLEFALFDFRLHLEYDP
                     AKGARVDELLQEAREQVAVVKPPSFNRFAHSFSHIFAGGYAAGYYSYKWAEVLSADAF
                     SRFEEEGIFDRQAGRAFMSSILEQGGSRDPLELFIEFRGREPVIDALLRHSGIAA"
     gene            232882..233595
                     /locus_tag="Noc_0209"
     CDS             232882..233595
                     /locus_tag="Noc_0209"
                     /EC_number="3.1.11.2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Exodeoxyribonuclease III"
                     /protein_id="ABA56739.1"
                     /db_xref="InterPro:IPR000097"
                     /db_xref="InterPro:IPR004808"
                     /db_xref="InterPro:IPR005135"
                     /translation="MVDWLEIHQPDVLALQETKLVDDSFPQEAFKEIGYHAAYSGQKT
                     YNGVAILCRQAPKDILTDLPNLVDSQRRILGVTVDDIRLLNLYVPNGSEVGSKKYAYK
                     LDWLGRIKDYLQEALVEYPKLIVLGDFNVAPADQDVHDPDIWHETILCSTPEREALKE
                     ILALGFQDSFRLFEQEAQSFSWWDYRGGAFRRNRGLRIDLILISKALVPKCTGCVIDK
                     EPRRLTRPSDHAPVIATFA"
     gene            233680..235110
                     /locus_tag="Noc_0210"
     CDS             233680..235110
                     /locus_tag="Noc_0210"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56740.1"
                     /db_xref="InterPro:IPR001440"
                     /translation="MHRLCQKNFGGAGELLREAAEGKAKQLAKVRKELEQLTEETVNS
                     FRLAGDAHSNNYAFDEALIAYEQALACVLREITPHLWAVIMVQVGRACHELGVRAEGA
                     ALHYHLSAAVEAYRRALKVQTRRYLPQDWARTQAYLGTTLREQGVRMGEEAGGRLLEQ
                     SVEAYRRALKVQTRWHLPQDWARTQAHLGTTLREQGVRMGGEAGGRLLEQSVEAYRQA
                     LEVQTRRDFPQDWAWTQSHLGIALREQGMQAGGEAGRQLLGKAIAAYQGALEIHTPET
                     LPWHWNQTQHHLIQTWLALEDWPAAATGFVRLLEIYPDDAEAYYGASMLYHEKLFAFE
                     EAFSLSRRWFASRPEDLEARGQLAEQCFTTGRFAEAIEHFAELLANPEINPQIKIPLQ
                     AFEIAALLGLNQKVAVPEKFEQLCMAIAHQSGNFVLEWAFAGSKYFIARNERLMPYRE
                     WLLALFIALEAPGRDAILNRLGEDIR"
     gene            235195..236658
                     /locus_tag="Noc_0211"
     CDS             235195..236658
                     /locus_tag="Noc_0211"
                     /EC_number="4.1.1.-"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
                     /protein_id="ABA56741.1"
                     /db_xref="InterPro:IPR002830"
                     /translation="MKYKDLRDFIAKLEAEGELKRITVEVDPYLEMTEICDRVLHAGG
                     PALLFERPKGASMPVLGNLFGTPRRVAQGMGEDSVAALREVGKLLAFLKEPDPPRGMK
                     EAWRALPIFKKVLDMAPKIVRSAPCQEVILEGSQVDLSQIPIQTCWPGDIAPLITWGL
                     VVTKGPYKERQNMGIYRQQVLGPNRVIMRWLAHRGGALDFQAWQQAHPGKPFPIAVAL
                     GADPATILGAVTPVPDTLSEYAFAGLLRGSKTELTRCLGSGLQVPASAEIVLEGYLKP
                     GDEANEGPFGDHTGYYNEVEKFPVFTIERLTHRRHPIYHSTYTGRPPDEPAVLGVALN
                     EVFIPILQKQFPEIVDFYLPPEGCSYRLAVVTMRKQYPGHAKRVMLGVWSFLRQFMYT
                     KFVIVTDEDINARDWKDVIWAMTTRMDPARDCVIIENTPIDYLDFASPVSGLGSKIGF
                     DVTHKWKGETQREWGQPITMDNAVKKRVDEMWDGMGL"
     gene            237105..237788
                     /locus_tag="Noc_0212"
     CDS             237105..237788
                     /locus_tag="Noc_0212"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF1555"
                     /protein_id="ABA56742.1"
                     /db_xref="InterPro:IPR011449"
                     /translation="MIIRLMLSQVRTGIFAMLMLAVFTNPAFGGLIQVDMGATGQDVQ
                     AGWFPLTESGGPVAIAADFAAVGTDIIFSSTLDEFQDRGNIAGPLADVIEDFAFERPG
                     PTSLTFSNLAAGLYTLTGYHNDFSFPGQFRFSATAVNGALASDILGAQDIISGTTTPV
                     TSVITFTADGSTDVDVVYTATRLGSVFNGFELERIPATAVPEPTTLALLGLGLAGIRF
                     CRRRNRRPV"
     sig_peptide     237105..237194
                     /locus_tag="Noc_0212"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.997) with cleavage site probability 0.995 at
                     residue 30"
     gene            238326..238919
                     /locus_tag="Noc_0213"
     CDS             238326..238919
                     /locus_tag="Noc_0213"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-alcohol phosphatidyltransferase"
                     /protein_id="ABA56743.1"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR005829"
                     /translation="MTNIPWDARLAALLVRPLCNSWVTPNHLTTLRLATGLGAALCFG
                     SGEWLNLAAWLWVMSTFLDHTDGELARMSGKQSRAGHFYDLITDAVATIGLFMGIGWG
                     LSSSLLGGWALFMGAIAGIAIAIIFHFRNEIEQRSGKAATKQPGFAGFEPEDSLYLLP
                     LITWLDGLALLLLIAALITPIIAIVVGWQYLTQLDKV"
     gene            239000..239347
                     /locus_tag="Noc_0214"
     CDS             239000..239347
                     /locus_tag="Noc_0214"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56744.1"
                     /translation="MCISLFMISSYDHSGSKLAVSRFLSKKMERRQNSRRQSAVKVYL
                     SWPGQESQCCRVKNLSATGAFIEVGALRIPEDRIIKLAFVLPINSLIKIHRLSAIVVH
                     RSHQGLGLMFQQV"
     gene            complement(239445..239702)
                     /locus_tag="Noc_0215"
     CDS             complement(239445..239702)
                     /locus_tag="Noc_0215"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56745.1"
                     /translation="MPDYIPINCNFHDQLEALATLRKQCHIFYQTMDGKIIETLDTIT
                     DIYTKNQEEFTVLGSGEIIRLDRLLEVDGQSYLEMKTSGDS"
     gene            complement(239767..240057)
                     /locus_tag="Noc_0216"
     CDS             complement(239767..240057)
                     /locus_tag="Noc_0216"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutaredoxin 2"
                     /protein_id="ABA56746.1"
                     /db_xref="InterPro:IPR008554"
                     /translation="MAANPASVNYPMTITTHSKRLILYHTAGCHLCEEARQLLAQLPE
                     ITTEEVDIGNDPLLVERYGTRIPVLLQPDSGLTLNWPFTLEAIHQWTHAGQR"
     gene            240162..240821
                     /locus_tag="Noc_0217"
     CDS             240162..240821
                     /locus_tag="Noc_0217"
                     /EC_number="3.1.21.-"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Endonuclease V"
                     /protein_id="ABA56747.1"
                     /db_xref="InterPro:IPR007581"
                     /translation="MKTHSWNLSPKEAVALQRRLADQVVAEDRLGQVHFVAGVDVGFE
                     EQGKITRAAVVVLRLADLSLVEQVVARRPTHFPYIPGLLSFRECPTVLAALEKLTVTP
                     NLLLCDGQGIAHPRRFGIACHLGVLTGLPSIGVAKTRLVGKHGPAPDKRGGWTPLTDK
                     GETIGVVLRTRIKVNPVFVSTGHRISLLTAIQYVMACTTRYRLPETTRLADKLASGSK
                     K"
     gene            241013..242965
                     /locus_tag="Noc_0218"
     CDS             241013..242965
                     /locus_tag="Noc_0218"
                     /EC_number="5.4.99.16"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Alpha amylase, catalytic region"
                     /protein_id="ABA56748.1"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006589"
                     /translation="MSDARWMKQHSTVSLRRLMPRLEARFKAQVDPDEWQGYVQRLET
                     HFPRLFDCLYRLYGQQYDFFFHLESILASATEMWWVRPAELKALDALRTADPYWYQSH
                     RLVGAMCYVDLFAGDLVGLRERISYLTELGINYLHLMPVFKVPEGDNDGGYAVSSYRE
                     INPNLGTMEDLVRLADELRYRGISLCLDFVFNHTADEHDWARRAQAGDREYQEYYRMF
                     PDRELPDAYERSLNPIFPDEHPGSFTYRNRIRKWIWTSFHNYQWDLNYENPVVFNRML
                     EEMLFLANQGVEILRLDAVAFVWKELGTSCQNLPEAHIIIQAFNALVRIAAPAMVFKS
                     EAIVHPDDVRKYISEEECQLSYNPQLMALLWDALASRDIRLLRYGLQRRFALPSGCAW
                     VNYVRCHDDIGWTFSDDDARALDLDPQAHRQFLSQFYTARFEGSFARGMPFQENLATG
                     DARVSGTCASLAGLEKGLYHNDETEIEYAIRKILLIHGVILTIGGIPLIYLGDEIGVL
                     NDYDYEKDLAKIGDTRWLHRLPFDEARAEQRWDFTTVPGRIYQGLLRLIQIRQQNLAF
                     TRAETEVVDTGNDHVFGYFRNHDEYTVLILANFSDFTQHLEARRLRMLGLRKTEVDLF
                     AGKTVTATRELSLEPYAFMVLARPGK"
     gene            243038..243862
                     /locus_tag="Noc_0219"
     CDS             243038..243862
                     /locus_tag="Noc_0219"
                     /EC_number="2.1.1.-"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA Gm-2251 2'-O-methyltransferase"
                     /protein_id="ABA56749.1"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR004441"
                     /translation="MSRKRRFERLHPSPGLEKAEGDGLSSCELRYGLHAVRAALEQPA
                     LQVMALWLDQARIDRSLQKLAKLAFQRGLKAQLVKREELDDLVPGARHQGVVARCSVQ
                     PALTEEGLLTFLENLEAPPLLLLLDGVQDPHNLGACLRTAEAAGVHGVVTPKDRAAGL
                     TAVARKVASGAAERIPLVRVTNLARVMRALRERGLWLVGTVVGGSHNSLYETDLQGPL
                     GLVLGAEDRGLRRLTQEHCDCLVQIPMQGAVGSLNVSVAAGVCLFEAQRQRGLLPS"
     gene            244005..244475
                     /locus_tag="Noc_0220"
     CDS             244005..244475
                     /locus_tag="Noc_0220"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S6P"
                     /protein_id="ABA56750.1"
                     /db_xref="InterPro:IPR000529"
                     /translation="MRHYEVVFLVHPDQSEQLSAMMDRYRQIIETDGGCIHRLEDWGR
                     RQLAYPIQKLYKAHYVLMNIECTPRTIEELTSAFRFNDAVLRDMVIRREEAITETSPL
                     AKGEESGGRGYDSARSGRDRDESGGRGYDGARPGRDEDESKENTDRDEQSEDSE"
     gene            244608..244832
                     /locus_tag="Noc_0221"
     CDS             244608..244832
                     /locus_tag="Noc_0221"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S18P"
                     /protein_id="ABA56751.1"
                     /db_xref="InterPro:IPR001648"
                     /translation="MARFFRRRKFCRFTAEGVKEIDYKDLATLKDYITETGKIVPSRI
                     TGTKAKYQRQLSRAVKRARYLALLPYCDRH"
     gene            244898..245353
                     /locus_tag="Noc_0222"
     CDS             244898..245353
                     /locus_tag="Noc_0222"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L9P"
                     /protein_id="ABA56752.1"
                     /db_xref="InterPro:IPR000244"
                     /translation="MEVILLEQVVNLGKLGDKVAVKSGYARNYLIPQGRAVSATKENE
                     AHFESRKAELEKAAGDKVAVAERCKQALADLGSVTIPAKAGTEGKLFGSVGAADIAEA
                     LTKAGVEIGKKEVRLPEGALRQVGEYELVIHLHPTVEAPIKVVVTGEEE"
     gene            245434..246852
                     /locus_tag="Noc_0223"
     CDS             245434..246852
                     /locus_tag="Noc_0223"
                     /EC_number="3.6.1.-"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="primary replicative DNA helicase"
                     /protein_id="ABA56753.1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007692"
                     /db_xref="InterPro:IPR007693"
                     /db_xref="InterPro:IPR007694"
                     /translation="MPELAYQEKKDEFVEGLRIPPHSMEAEQSVLGGLLLDNQAWEQI
                     ADILGSEDFYRQDHRLLFLSIGEMLEQSRPCDVVTLSEWLKNKRLLEETGGLAYLTNL
                     ARNTPTAANIKAYAEVVRERSVLRQLIRVGTDIAGSAYQPEGRESGELLDEAEKRVFE
                     IAEQGARGQRSFVNIKDLLGKVVDRIDHLFEQDSPITGLPSGFADFDLLTSGLQPADL
                     IIAAGRPSMGKTTFAMNIAEHVAIKRRVPVAVFSMEMPGEQLAMRMMSSLGHIDQHRV
                     RTGRLEDDDWPRLTSAISLLTEAPLFIDDTPALSPTELRARARRLMREQEGLGLILID
                     YLQLMQVPGHRENRATEISEISRNLKAVAKELKVPVLALSQLNRSLEQRPNKRPVMSD
                     LRESGAIEQDADVIVFIYRDEVYNEESPDRGTAEIIVGKQRNGPIGTVRLTFRGQYTR
                     FENYVQDAYGAGSGFPAADKMN"
     gene            246882..247952
                     /locus_tag="Noc_0224"
     CDS             246882..247952
                     /locus_tag="Noc_0224"
                     /EC_number="5.1.1.1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="ABA56754.1"
                     /db_xref="InterPro:IPR000821"
                     /db_xref="InterPro:IPR001608"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR011079"
                     /translation="MNFPQAIIDASALRHNLQRVRELAPRSQIMAVVKADGYGHGLTR
                     VADVLVAADAFAVARLEEATALRQAGHRCPVVLLGGISDKEQLQLAAAHRLTLVVHEF
                     AQLDLLERVRITSPLPVWVKADTGMHRLGFPPQVVAKAIARLRCCPAVASVVGLMSHL
                     ASADESEDFLTPIQLQTFEGIAAPGLLRSMANSAAVMVYPYAHFDWVRPGLMLYGASP
                     FAHGTGAAVGLKSVMTLQTRLIAIHHLRPGDSIGYGATWVCPEAMTVGVAALGYGDGY
                     PRHAVSGTPVLVNGRPVPLVGRVSMDMITLDLRTQPKAKVGDPVIAWGPNLPVEEVAR
                     HATTIPYELLCQVTGRVPRTME"
     gene            247958..249328
                     /locus_tag="Noc_0225"
     CDS             247958..249328
                     /locus_tag="Noc_0225"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RadA"
                     /protein_id="ABA56755.1"
                     /db_xref="InterPro:IPR001553"
                     /db_xref="InterPro:IPR001984"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004504"
                     /translation="MGKPKTVYQCTQCGAESARWAGQCAGCGAWNSLEEQLSAELPKR
                     TGRYAHYAGALSTVQPLAEVQVTGEVRLSTGLSELDRVLGGGLVTGSVVLIGGAPGIG
                     KSTLLLQALAKMGAVQEGKVLYLTGEESLAQISLRAQRLGLGAAPVRLLADTLVERAL
                     AVARQERPQVMVVDSIQTLYTEQLQSAPGTVTQVRESAGQLLRFAKQGGTGVILVGHV
                     TKEGALAGPRVLEHMVDTVLYFEGDGGERLRVLRAAKNRFGAVNELGVFAMTEQGLRG
                     VTNPSAIFLSRGKEAVPGSAVTVIREGSRPLLVEVQALVDDSHLANPRRVTVGLEPNR
                     LAMLLAILHRHGAVMPGAQDVFINVVGGVRVNETGADLAVLAAIVSSLRDRPLDQELV
                     LFGEVGLTGEIRPVPGGEERLAAAAKHGFKKAILPRGNTPRRPVENIAIVPVNRLAEV
                     LEALKE"
     gene            complement(249384..251159)
                     /locus_tag="Noc_0226"
     CDS             complement(249384..251159)
                     /locus_tag="Noc_0226"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase/phosphodiesterase with
                     PAS/PAC sensor(s)"
                     /protein_id="ABA56756.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR001633"
                     /translation="MHDVTARNRAEAALVAEKERIQVTLESIGDGVITTDANSRINYL
                     NPTAEAMTGWLLAAARGKALPDVLQIINESTREPVADPLAPCLTGSSAVRSTNPTVLI
                     SRHGAEYSIEISAAPIRDANNQVLGAVLVFHDVSEQRRLQCEIAHQAQHDALTGLVNR
                     REFERRLQRVIETVQTQNSEHALCYLDLDQFKLVNDTCGHASGDALLQQLAVLFEKNI
                     RRRDTLARLGGDEFGLLLEHCSLDRALQIANTLRQTVEGFRFCWNGQHFRIGVSIGLV
                     PITIANSSAASVLQTADSACYVAKDGGRNRIHIYREHDVELARRHGEMQWVARIQQAL
                     EENRFQLYAQPIVPLKATLSGGIHCELLLRLVENDGKISPPGAFMPAAERYNLAVAID
                     RWVVTQALRWLAAHPALLDRITLCTINLSGHSIGDRFFHAYVLRQFDDTGLPAKKICF
                     EITETAAVANLADATRFMEALKTRGCCFSLDDFGSGLSSFAYLKALPVNFLKIDGLFV
                     KDIVDDPIDLAMVRSINEIGHLLGKKTIAEYIENDAILDKLRGLGIDYGQGYGLGQPQ
                     PLSALLATVSRPANSIKTGADTHFI"
     gene            complement(251159..252547)
                     /locus_tag="Noc_0227"
     CDS             complement(251159..252547)
                     /locus_tag="Noc_0227"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS and MASE1 sensor domain containing protein"
                     /protein_id="ABA56757.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR007895"
                     /translation="MGGKPVTRAQGIRFLAVGLAYFLTALLKTELSNEGDNIAVLWPS
                     NAILIGVLLRANPRYWPGYFGSCLLADLVASKLMGESTSIALGFMLANGLAVAVTVAC
                     MQRLMPLPVTLREPSQLLALVGAGLLGTAAGAVFIGVVYGTFYWAAWPTWWLADVVSI
                     ALITPVLLSASWPVAKMLLTKRAIETAMALLSAAAVTVGVFHSSSYALIYLTAPVMLW
                     FSFRLGLFACGVLGLVITIIVVALTLQGVGPIASQAGGISLTTIQTLQIYLSLVILPA
                     LVISIERENRLRAEAEIIQNQARYRSLYHDTPAMLHSIDHQGRLLRVSAYWLTIMGYE
                     HDEVIGRCSTDFMTEASRRYATEVVLPAFMRSGACRDVPYQMVKKNGEVFDVLLSAIA
                     ERDPDGSVAHSLTVMHDVTARNRAEAALVAEKERIQVTLESKRKTAKFLMSCYRPLPS
                     ATLTAVWLTRSQ"
     gene            252777..253196
                     /locus_tag="Noc_0228"
     CDS             252777..253196
                     /locus_tag="Noc_0228"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Conserved hypothetical protein 701"
                     /protein_id="ABA56758.1"
                     /db_xref="InterPro:IPR005265"
                     /translation="MLWIKAFHIIFVVTWFAGLFYLPRLFVYHAQCQDKPGRERFKVM
                     ERKLYRGIMHPSAILAVGLGVWLIYLTPAWMGAGWLHVKLSLVLLLIAYHLYCGRLLI
                     AFREERNRHSHVYYRWFNEFPVLILIGAVILVVVKPF"
     gene            253253..254296
                     /locus_tag="Noc_0229"
     CDS             253253..254296
                     /locus_tag="Noc_0229"
                     /EC_number="2.3.1.-"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
                     N-acyltransferase"
                     /protein_id="ABA56759.1"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR007691"
                     /translation="MEIRLSEIAQFLGCAIEGDGEAPIRGIAPLHQAQASELSFYTNR
                     KYAAQARLSKAGAIIVGAKDREQFAGRRLLISDNPYRDFARVVDRWFNRSYRPAPGVH
                     PTAIVGDDVQIAENCSIGAYCVIEDGVTIKAHTVLFPFCYVGAKTILGEHCLLYPRVT
                     LLERVRIGHRVILHPGVVIGGDGFGFAPDPPQGYFKVPQVGWVEIADDVEVQCNTAID
                     RGALGPTRIGQGSKIDNLVQVGHNVEIGEHSIIVSQVGISGSSKIGNWVTLAGQVGLV
                     GHIRIGDGAVITAQSGVAKDVPPKAIMTGSPVQPMMENRRALAELNRLRELRKKVREL
                     ERRLTVLEQVESC"
     gene            complement(254265..255284)
                     /locus_tag="Noc_0230"
     CDS             complement(254265..255284)
                     /locus_tag="Noc_0230"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56760.1"
                     /db_xref="InterPro:IPR006651"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR011498"
                     /translation="MRSNKTYLSLLFLLSLSLLFLTYSASAQWQQLHPMPTHRSEMAA
                     AYLDGKIYVPGGLGGQHQFEVYDVTTDSWEQLAPLPAPRHHLMATAHQGKIYVFGGGD
                     QDWSPTVTAWVYDPPSNQWQTLTPLPEPRYAGDAVSMGDFIYVVGGKGPSGRLLRYDP
                     QQDSWDFLKGMHQRREHIRSVVFEDRIVVLGGRYQGAGELGSVEIYDPATDTWREGPS
                     LNTARGGHGAAVYQGKIMVFGGEIIMTGRTTLASSEILEKLSGKWQPGPPLPMALHGM
                     PAISTGSHLYILGGSEQAAASINRGRVYRLLETPGPPPALTLGLFLTTLPPEPISSFQ
                     LAPAP"
     sig_peptide     complement(255201..255284)
                     /locus_tag="Noc_0230"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.888 at
                     residue 28"
     gene            complement(255421..256185)
                     /locus_tag="Noc_0231"
     CDS             complement(255421..256185)
                     /locus_tag="Noc_0231"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56761.1"
                     /translation="MVTKAELLTQTAQQASIEANKRHLNDSATEQLQAEAQAIVKDIF
                     RSIGWENSENVPEIPPNPLTAWHHRTLNDRELDWRNLNFAQEELQQAAGRYLRAPWLH
                     CRELDWLVLNTLIYGDYLAALDTIRARTMPFSRYQSRKSGKTGFRVLTEAWRGALLLL
                     KIAAWFIIFAAVSPASPLGPLIWIGMTGWWLWRKWMIRRKNNALLKSMFSAYGALSPT
                     HLDWPRIWEGLEKSQALGAVWNNMIYPLVEMRMQKI"
     gene            complement(256439..257734)
                     /locus_tag="Noc_0232"
     CDS             complement(256439..257734)
                     /locus_tag="Noc_0232"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56762.1"
                     /translation="MKNLARHCFIFLGLLLVPTLGAAGLNIFPELDSNDNNNTSSNNT
                     SQESTQNFSNTADPEPEADTNASPPANKDEIIAETKAGCATDPASCGVTLSSFLDSTG
                     FGETEPNNHAMGADAMEFGVEYAGQLYSPEDVDWFRITTTESNQMLTVNFNVPGLNDI
                     TGWNLSIRDSGGNIFSEVYTGFDFGPESPLQTILSRAGTYYVVVKSLKQAQEETRSSD
                     QSGEADLIYEHLPHEYRLAAFLGDSQVTTEPLDVNFFDAEVEPNDSRDEANPLTFATP
                     LASNVTMEGLISGPLIFGSVGFAFEEDWFVYDTAGNEILSIEFCASQDCEDSTWQVTV
                     YDENERMLLTGRTDMEQNYYLGIRNPGKYFIRIGVAPALDEESGGAQYVCSIDPTMPL
                     KDCPSPSERTLLVESPWHQYNFTVTSTKLPPLMSEVDNP"
     sig_peptide     complement(257666..257734)
                     /locus_tag="Noc_0232"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.994) with cleavage site probability 0.838 at
                     residue 23"
     gene            257924..258736
                     /locus_tag="Noc_0233"
     CDS             257924..258736
                     /locus_tag="Noc_0233"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Prolipoprotein diacylglyceryl transferase"
                     /protein_id="ABA56763.1"
                     /db_xref="InterPro:IPR001640"
                     /translation="MMMSYLNIDPVAFSLGPLKVHWYGVMYLIGFLGAWWLGRFRAKR
                     PASGWRPEQVDDLIFYGALGVILGGRLGYALFYDFDHILADPFAIFKIWQGGMSFHGG
                     LLGVLVAMMIYARKVGKGFFQVTDFVAPLVPIGLGAGRIGNFINGELWGKATELPWGM
                     VFPDPRAGGLPRHPSQLYEAALEGVALFLILWFFSRRPRPTMAVSGLFLFCYGLFRFA
                     VEFVRVPDAHLGYLALDWLTMGQILSLPMVFMGIILLGWAYRKRSSTHLIKS"
     gene            258764..259558
                     /locus_tag="Noc_0234"
     CDS             258764..259558
                     /locus_tag="Noc_0234"
                     /EC_number="2.1.1.45"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="ABA56764.1"
                     /db_xref="InterPro:IPR000398"
                     /translation="MKPYLELIQKILDTGVERDDRTGTGTWSIFGHQMRFDLRQGFPL
                     ITTKKLHIRAIFIELLWFLRGETNVKYLHDHGVTIWDEWADEQGELGPIYGYQWRSWP
                     LPDGGYLDQMAKTLTQIRNHPHSRRHVVVAYNPACVDEMALPPCHALFQFYVAQGRLS
                     CQLYQRSADVFLGVPFNIASYALLTHLIAQQCDLDVGEFVWTGGDVHLYRNHLEPARL
                     QLTREPLSLPHLRIKRRPPSLFEYQYDDLEIVDYQSYPAIKAAISV"
     gene            259569..260066
                     /locus_tag="Noc_0235"
     CDS             259569..260066
                     /locus_tag="Noc_0235"
                     /EC_number="1.5.1.3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="ABA56765.1"
                     /db_xref="InterPro:IPR001796"
                     /translation="MIISFIVAMDENHLIGANRRLPWHLPADLKYFRRMTMGKPMLMG
                     RSTHEAIGRPLPGRHNIVVTHNPDYKAPGCTVVHTVEAGLQAAGEAEEVTVIGGASLY
                     EQLLPQARRIYLTLVRGHFQGDTWFPAFDPGTWVEVWREDYDPDPQNPYPYSFIRLER
                     EERKK"
     gene            complement(260116..260790)
                     /locus_tag="Noc_0236"
     CDS             complement(260116..260790)
                     /locus_tag="Noc_0236"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RadC"
                     /protein_id="ABA56766.1"
                     /db_xref="InterPro:IPR001405"
                     /translation="MAITDWPVHERPREKLLQRGPNALSDAELLAIFLRTGVAGKTAV
                     DLARELLESFGSLRALLEADLKQFCHAPGLGIAKYTQLQACLEMGRRHLEDTLKRGDV
                     LTDPQTTQRYLVARLRAYPFEVFSCLFLDNRHRVLAFEELFRGTIDGASVHPREVLKR
                     ALAHNAAAVILAHNHPSGVAEPSRADECITQRLKEALALVDIRVLDHIIVGDGETLSF
                     AERGLL"
     gene            260991..262334
                     /locus_tag="Noc_0237"
     CDS             260991..262334
                     /locus_tag="Noc_0237"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
                     /protein_id="ABA56767.1"
                     /db_xref="InterPro:IPR002792"
                     /db_xref="InterPro:IPR005839"
                     /db_xref="InterPro:IPR006463"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /translation="MAKKLYIKTHGCQMNEYDSSRMADVLRESHGLELTSDPEQAEVL
                     LLNTCSVREKAQEKVFSQLGRWRQLKQSRPELVIGVGGCVASQEGETIRVRAPYVDLV
                     FGPQTIHRLPAMLTQAKASSQPVVDLSFPEIEKFDKLPEPRAEGPTAFVSVMEGCSKY
                     CSFCVVPYTRGEEISRPFDDVIAEIVGLAEQGVREITLLGQNVNAYRGSIGEGDTADL
                     ALLIHYVASIEGIERIRFTTSHPVEFSDSLIQAFAEVPALVSHLHLPVQSGSDRMLSL
                     MKRGHTVLEYKAKLRKLRQVRPDISISSDFIVGLPGETEADFQATLALVDEVGFDHSF
                     SFIYSPRPGTPAASLPDCTPIALKKERLAILQGRLRALEIAISRGMVDTVQQVLVERP
                     SKKDPTMLAGRTANNRVVNFSASQDMVGQFVNIRITEALPNSLRGIVLDAKRRCA"
     gene            262616..263608
                     /locus_tag="Noc_0238"
     CDS             262616..263608
                     /locus_tag="Noc_0238"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="PhoH-like protein"
                     /protein_id="ABA56768.1"
                     /db_xref="InterPro:IPR003714"
                     /translation="MNEHPPSDHSEISDFVLEPADNQRLANLCGQMDEHLRQIERELG
                     VEINNRGNFFQVLGNSPSVEAAGEVIRRLYDDADEAPVTPAQVHLLLREAGSQEYSPL
                     EEQEEILIRTRRGVVKGRSPRQIRYLRNILTHDISFGIGPAGTGKTYLAVACAVEALE
                     KDRVRRVLLVRPAVEAGERLGFLPGDLAQKIDPYLRPLYDALYEMLGFERVAKLIERH
                     VIEVAPLAYMRGRTLNESFIILDEAQNTTIEQMKMFLTRLGYGSIAVVTGDITQIDLP
                     KGQPSGLRHVIEVLKEVKGISFDFFQSRDVVRHPLVQRVVQAYEHFGGSGRVES"
     gene            263605..264066
                     /locus_tag="Noc_0239"
     CDS             263605..264066
                     /locus_tag="Noc_0239"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function UPF0054"
                     /protein_id="ABA56769.1"
                     /db_xref="InterPro:IPR002036"
                     /translation="MSITVHIQYAVPKASVPLQADFLRWVKAALVNQSKAGEITIRVA
                     SESEAAQLNWRYRHKEGATNILSFPFEVPSCVSLDVPLLGDLVICAPVVAREALEQTK
                     KEQAHWAHLVVHGVLHLLGFDHQQEVEAQQMESLEVTILESLGYPDPYESV"
     gene            264076..264951
                     /locus_tag="Noc_0240"
     CDS             264076..264951
                     /locus_tag="Noc_0240"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative Mg2+ and Co2+ transporter CorC"
                     /protein_id="ABA56770.1"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR005170"
                     /translation="MNEGRPSHNLVSRSWRERLGQVLLGEPQDREQIIEILRNASQRR
                     LLDPETLSMIEGALVVGEMQVRDIMVPRSQMVVVERDAPPEDTLEVITRSAHSRFPVI
                     GESRDGIVGILLAKDMLLYCRQQEARTFNIRDILRPVVFIPESKRLNVLLREFRASRN
                     HMAIVVDEYGGTAGLVTIEDVLEQIVGEIEDEHDVAEDAFIFRRREDNYTVKALTPIE
                     DFNEYFGTDFSDEEFDTIGGLVLNGFGRMPERGETIAIGSFEFKVLRADSRRLYLLEL
                     CLKTNGVEHSVAAGT"
     gene            265021..266586
                     /locus_tag="Noc_0241"
     CDS             265021..266586
                     /locus_tag="Noc_0241"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Apolipoprotein N-acyltransferase"
                     /protein_id="ABA56771.1"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="InterPro:IPR004563"
                     /translation="MGYTPEQKPFYERVCQKKCFFSDSAGAKTWCGDALALVAGLLGP
                     LAFSPYNFYPLAVILPALLFVVCRNLSARRAFWRGWLFGLGWFGAGVSWVYFAIHDFG
                     YASVPLALGLTTSFVAFLSLFPAILSGSVALLFPQENSRKYLLVWPAAWVMIEWFRGW
                     FLTGFPWLNLGYSQIESPLRGLAPIVGAYGVSLAVAFSAGLIVVAWRWAQRTRLIALG
                     SLGILWASALLLSLVSWTTPVGKPLQVSLIQGNIPQAIKWQPEQIEATLERYWQLTAK
                     HWESDLIVWPESALTVFYHQVANGYLAALAAEARVHGTDLLIGLPVFHQETGKYYNGM
                     LSLGSQQAFYYKRHLVPFGEYIPFEEYLRGLIRFFDLPMSSFSAGPEGQPLLQAAGYP
                     VATSICYEDAFGEEVITALPEANLLVNATNNAWYRDSLASHQHLQISRMRALETGRDL
                     ARATTNGISAIIDAQGALLATTPQFQTAVLTGSVQPRAGATPYVFWGNEFILGLCLCL
                     FAIGSYYPRSKGS"
     gene            266594..268045
                     /locus_tag="Noc_0242"
     CDS             266594..268045
                     /locus_tag="Noc_0242"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="K+ transporter Trk"
                     /protein_id="ABA56772.1"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="InterPro:IPR004772"
                     /translation="MQLAVVQRILGLLLALFSTAMLPPVIVSLFYRDGAGAEFLIAFG
                     LILGIGLLCWLPVRNYRQELRLRDGFVVVVMFWVVLSLSGALPLFLTAEPRLSFTDAV
                     FESVSGLTTTGATVITGLDNLPKSVLFYRQELQWLGGMGIVVLAVAILPMLGIGGMQL
                     YRAEIPGPMKTTKLTPRIAETAKALWLIYLGLTIACATAYWIAGMTLFDAVGHSFSTI
                     AIGGFSTHDASMGYFNSPLIEMIAVFFMLLAGVNFSLHFLAWRHRTVGHYWQDEEFRT
                     YLSVLAGVAALTSSYLWITHSFDNPLLALQHGIFHTVSIGTTTGFTSSDYYSWPGFLP
                     ILLLMTSYIGGCAASTAGGMKVIRILLLYKQGVREIKRLIHPSAIIPIKIGSKSLPDR
                     IVEGVGGFMAVYVACFIVMYLLLLATGLDMITSFSAVTACLNNLGPGLGQVGAHYEVI
                     NAASKWVLCFAMLLGRLEIFTLLVILSPTFWRR"
     gene            268174..268380
                     /locus_tag="Noc_0243"
     CDS             268174..268380
                     /locus_tag="Noc_0243"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L31P"
                     /protein_id="ABA56773.1"
                     /db_xref="InterPro:IPR002150"
                     /translation="MRQDIHPKYSEITVTCSCGNSFSTRSTAGKDFHIEVCSACHPFY
                     TGKQKLLDTAGRVDKFRQRYNLKS"
     gene            268636..269841
                     /locus_tag="Noc_0244"
     CDS             268636..269841
                     /locus_tag="Noc_0244"
                     /EC_number="1.1.1.40"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Malate dehydrogenase (oxaloacetate
                     decarboxylating) (NADP+)"
                     /protein_id="ABA56774.1"
                     /db_xref="InterPro:IPR000205"
                     /db_xref="InterPro:IPR012301"
                     /db_xref="InterPro:IPR012302"
                     /translation="MATALGYHAEPRPGKLEISITKPCATQQQLSLAYSPGVSVPVGA
                     IVADPEAVYRYTAKGNLVAVITDGSAVLGLGNTGPLASKPVMEGKAVLFKSFAGLDAI
                     DIEVEAESPEAFVDTVARISPTFGGINLEDIAAPHCFMIEQALIERLDIPVLHDDQHG
                     TAITIAAALQNALELQGKSLPEARIVCVGAGAAGIATLRLLVALGLDQENILLVDRQG
                     VIREESQAPHSYCRPFISSSPKRTLEEAIEGADVFIGVAAPNLLTMEMLKSMASRPIV
                     FALSNPDPEIDPGLAHAARDDLILATGRTDYPNQVNNVLVFPFLFRAALNVRARCIND
                     AMKLAAVRALVELTKEPVPKQVLEAYGEQQLAFGANYILPKPLDPRLREFVTMAITQA
                     AIESGIARI"
     gene            complement(269838..270452)
                     /locus_tag="Noc_0245"
     CDS             complement(269838..270452)
                     /locus_tag="Noc_0245"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56775.1"
                     /translation="MPKKDQQMREYIATEAARFMVEHGIKNYYQAKRKAAAFLGAADT
                     RNLPTNQEIEQAVGAYLRLFKSKSQPATVEKLRQTALEAMDFFSRFNPRLVGSVLSGL
                     ASEYSDINLHLFADTGEEVAIFLTEAGIPFQLRSRQLSLSPKLFQNFPVYRFIAGEVA
                     VELTVFPPAATRHAPLSPIDGKPMRRAGRKKVQSLLETKAQTAD"
     gene            complement(270470..272914)
                     /locus_tag="Noc_0246"
     CDS             complement(270470..272914)
                     /locus_tag="Noc_0246"
                     /EC_number="2.4.1.129"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Penicillin-binding protein 1A"
                     /protein_id="ABA56776.1"
                     /db_xref="InterPro:IPR001264"
                     /db_xref="InterPro:IPR001460"
                     /db_xref="InterPro:IPR011816"
                     /translation="MTYLLRLFRWMVLLLLTATTVGILVAVGMYFYLLPQLPSTDTLK
                     NIHLQVPLRIYSHDKKLIAQYGEKRRIPLAFEQFPDLLVKAILAAEDDRFYEHPGVDY
                     QGILRAALYLVKTGKKAQGGSTITMQVARNFFLSREKTYLRKFNEILLALQIERELSK
                     QDIIELYLNKIYLGNRAYGAAAAAQVYYGTTLDKLELSQLAMIAGLPKAPSRYNPIAN
                     QKRALLRRNYVLRRMREVGYIDPETYQDAAAQPATAKFHELPIELNAPFVAEMARSQM
                     FEKYGSDIYTAGYNVYTTIKAEHQKAANDALRKALLDYDRRHGFRGPERHIELPVDAG
                     EIFYQQALSQRRLANGLVPALVLATDERTSRIYTKTDGEAMLTWEGLSWAQPYLEVNA
                     VGEKPKQAADILKAGDLIWVEALPKGGWRLAQRPRVEGAIVSLSPYNGNITALSGGFD
                     FYESKFNRATQSQRQPGSSFKPFLYSAALNKGYTAASIINDAPIVLDEPGGPDNAWRP
                     ENYSGRFYGPTRLRTALTHSRNLVSIRLLRAIGIDYAIEYIQNFGFKAEQLPQSLSLA
                     LGSGSASPLEMARGFAVFANGGYLIEPYLIERTENADGKIIFRSRPAQVCQRCEKIKT
                     ERTQAYNPTLTADLLNTESAQFNPAPRAITAQNAYLINSMLHDVIRHGTGRRAKKLGR
                     NDLAGKTGTTNDQHDAWFSGFNPELVAVCWVGFDQPESLGSLETGARVALPMWINYMG
                     TVLDGTPEKPFIPPKGMVTVRIDPETGLLADSNASDAIFETFIAGHAPTRYDDSSSEG
                     SDGSTKTDTPVAERLF"
     sig_peptide     complement(272834..272914)
                     /locus_tag="Noc_0246"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.983) with cleavage site probability 0.868 at
                     residue 27"
     gene            273132..274250
                     /locus_tag="Noc_0247"
     CDS             273132..274250
                     /locus_tag="Noc_0247"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Type IV pilus assembly protein PilM"
                     /protein_id="ABA56777.1"
                     /db_xref="InterPro:IPR001023"
                     /db_xref="InterPro:IPR005883"
                     /translation="MLNSLVRVSNNWLNFRDNSLSYFLRKSPSLLGIDISSSAIKLLE
                     LSRKGERICVENYAIEALPPHTVVENKIENVEALGETIKRAVKRSGTRTKKVAAAVTG
                     SAVITKTISVPNALSNRELESHIELEAGQYIPYPLEEVNLDFAVLGPSEKDSERVDVL
                     LAACRSENIESRVASLELAGLTPAVIDVEAYAMEKVFPLIAGQMSSRGKGQTIAVVDA
                     GATLTTINVLHDYKIIYTREQIFGGNQLTEEIQRRYGLSYEEANLAKRQGGLPDNYIP
                     EILDPFKKSIAQQVSRAFQFFFSSTQYNDVDHVILAGGCASIPGVDELIEHMVGTAVS
                     VANPFSDMVLGSQIEAKALRNDAPALMTSCGLALRSFD"
     gene            274250..274825
                     /locus_tag="Noc_0248"
     CDS             274250..274825
                     /locus_tag="Noc_0248"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Type 4 fimbrial biogenesis protein PilN"
                     /protein_id="ABA56778.1"
                     /db_xref="InterPro:IPR007813"
                     /translation="MVRINLLPWREAQRKEREKRFHLALGLAAVLAAGTVFYINSYIN
                     GLIENQIQRNKYLQDQIAIVDKKIRKIKDLEKEKKKLLARMEIIQQLQSSRPQIVHVF
                     DKIVRALPDGIYLESIKRQEHTNMLNGVATSNARVSVLMRNLDASPVFRNPRLDVIQR
                     TGNKQRSVRKFTLRVDENPQLSDSNESMGTL"
     gene            274825..275433
                     /locus_tag="Noc_0249"
     CDS             274825..275433
                     /locus_tag="Noc_0249"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Pilus assembly protein, PilO"
                     /protein_id="ABA56779.1"
                     /db_xref="InterPro:IPR007445"
                     /translation="MNLSDFNELDFSEIGDWPTVAKAIAVLLIFASVVGGGYWFFTKD
                     EILQLEDFKKKEPGLKATFEAKQAKAANLESYEKQMEEMKLSFGTMLRQLPSKTEVAD
                     LLVDISQTGLSSGLEFEFFKPSSELPADFYAELPIQIRVIGNYHQFGEFVSKVAALPR
                     IVTLHNFAIENQDKESGKLAMDITAKTYRYFAEDETTAATRN"
     gene            275447..276025
                     /locus_tag="Noc_0250"
     CDS             275447..276025
                     /locus_tag="Noc_0250"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Pilus assembly protein, PilQ"
                     /protein_id="ABA56780.1"
                     /db_xref="InterPro:IPR007446"
                     /translation="MSYTRHIKRWTILNRQVGIASLLGIFSVTLSGCNDEEMIDLKQY
                     VQQVKSRPRGIIESLPEIKPHETFIYQAAELRNPFVSAVVDLPLETIAQASPTLENTL
                     KPNLKRHKEILEEYALESLRMVGMLEQGMEIWAIIRASDGILYRVKKGNHIGRNYGKI
                     THINEEKIEFTEIVPDEQGGWLTRQNMLALAE"
     sig_peptide     275447..275545
                     /locus_tag="Noc_0250"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.960) with cleavage site probability 0.905 at
                     residue 33"
     gene            276042..278141
                     /locus_tag="Noc_0251"
     CDS             276042..278141
                     /locus_tag="Noc_0251"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Fimbrial assembly protein pilQ precursor"
                     /protein_id="ABA56781.1"
                     /db_xref="InterPro:IPR001775"
                     /db_xref="InterPro:IPR004846"
                     /db_xref="InterPro:IPR005644"
                     /db_xref="InterPro:IPR011662"
                     /translation="MKPAHKIVPHDSRKAYRERCFLPALIGLLLLCWLPCITFAATKL
                     QGIEYSSLPGEGVQLRLEFSAPVAEPTFFAIDDPARIVLDFPRVKIGTVRQSQVIGAG
                     MTRSVTMVEAADRTRVVVNLVQSVPFETRVDKNFVYVTVNGFPAAASAEKSGAAPTGR
                     HLIKNIDFRRGEAGEGRVIVSLSDIRTPVDIREEGKRIIVDFINTALPNELERRLDVL
                     DFATPVKLVDTFTKNQNVRMVITPANVEHEYLSYQSDDTLVVELKPLTKKEKELARKK
                     EFGYVGEKLSLNFQSIEVRSVLQLIADFTGLNLVASDTVQGSVTLRLKNVPWDQALDI
                     ILRTKGLAMRRMGNVVLVAPSQEIADREKLELEARKQVEELAPLGSEFIQVNFAKASN
                     LAALIQSEENSLLSPRGHATFDERTNTLLVMDTADRLAALRKLVASLDIPVRQVLIES
                     RVVIASSDFSRDLGVRFGLSGRGDTSGTFDQATTSGSLNGTTQIINRETLELQDRLNV
                     NFPVTKKDAAKIALALTNLPLGALLELELSALQAEGRGEVISNPRVITSNQKEAIIEQ
                     GTEIPYQRASSSGATSVSFKKAVLSLTVTPQITPDDRIIMDLGVTKDSVGKVFNGVPS
                     INTRKVATQVLVNNGQTVVLGGIYEQEKNRAVRRIPFLGDLPYAGILFRDKSEFNNKR
                     ELLIFVTPKIIKEGARL"
     sig_peptide     276042..276164
                     /locus_tag="Noc_0251"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.969) with cleavage site probability 0.961 at
                     residue 41"
     gene            278467..279039
                     /locus_tag="Noc_0252"
     CDS             278467..279039
                     /locus_tag="Noc_0252"
                     /EC_number="2.7.1.71"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="ABA56782.1"
                     /db_xref="InterPro:IPR000623"
                     /db_xref="InterPro:IPR001687"
                     /translation="MLNFNIFLVGPMGSGKTTIGRYLARITGKNFYDSDREIESRTGV
                     SIPVIFEIEGESGFRQRECKIIAELVQLNNIVLATGGGAVLAAENRRELSQRGIVVYL
                     YAPPKQLYRRTSHDNNRPLLRTGNPLERLKCLLKERDPLYREVADVIIKTGKQPVKAV
                     ANEVLRQLRQYKGGAPQRKSFVHVKSNKGA"
     gene            279084..280163
                     /locus_tag="Noc_0253"
     CDS             279084..280163
                     /locus_tag="Noc_0253"
                     /EC_number="4.2.3.4"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate synthase"
                     /protein_id="ABA56783.1"
                     /db_xref="InterPro:IPR002658"
                     /translation="MITVQVDLQERSYPIYIGSGLLKQNSLLAKHIVGSEVMVVTNET
                     VAPLYLDTLLKGLKDYRCAEIILPDGEQHKTLAVLQQIFDDLLKVPFSRHCTVIALGG
                     GVIGDMAGFAAACYQRGVAYIQVPTTLLAQVDSSVGGKTAVNHPLGKNMIGAFYQPRC
                     VLADTDTLDTLDERQLRAGLAEVIKYGLIRDIDFFTWLEEHASEVLAREPSALIHAIE
                     RSCRNKAEIVAADERESGVRAILNLGHTFGHAIETGLGYGAWLHGEAVAAGMAMAADL
                     SQRLGWLSATEVGRVLNLLERAGLPRHSPEAIHKARFLELMAVDKKVIDGCLRLVLLR
                     QLGQAVVTDGFDSDLLEATIDKATV"
     gene            complement(280286..280894)
                     /locus_tag="Noc_0254"
     CDS             complement(280286..280894)
                     /locus_tag="Noc_0254"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid kinase family protein"
                     /protein_id="ABA56784.1"
                     /translation="MQVIKIGGSLYESRCLPRWLHQLATLEAGKAIIVPGGGPFANQV
                     RHAQKCWGISDACAHTMALLAMEQFGYLLQGLEPTLRLAASPKEIKEVVSQQQIPIWL
                     PATELLDQPEIPKNWEVTSDSLAAWLSSKLKASRLVLIKKVRLSEPVISVHSLVTRGI
                     VDAAFPRFLHSITIPCYCITADNYPQIALKGIVNMGTRISPD"
     gene            complement(280895..282310)
                     /locus_tag="Noc_0255"
     CDS             complement(280895..282310)
                     /locus_tag="Noc_0255"
                     /EC_number="2.6.1.85"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="aminodeoxychorismate synthase, subunit I"
                     /protein_id="ABA56785.1"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="InterPro:IPR005802"
                     /db_xref="InterPro:IPR006805"
                     /translation="MKYSPRYAELPYSEDSAPLFEAIRQEPWAIFLDSGWPVNQSGRF
                     DILAADPFMTFSCWGSETTIRKRHEAFSSLENPFILLQSELRRYTRNPSSIFPELPLT
                     GGAMGYFGYDLGRRIEQLPTLALDMEGMPEMAIGLYDWVIVVDHRQQRSLLVGQGYDY
                     RTWERWEALQSHLSQCHDSAPSQTTFRLWEPIESNLKQKDYQQAFTSIQHYIREGDCY
                     QVNLAQRFEALAQGDPWALYRRLRLLNAAPFSAYFAIPEGAVLSTSPERFLRTNAGGV
                     ESHPIKGTRPRNPDPIADRKLALELQNSPKDRAENVMIVDLLRNDLGRVCLPGAIHVP
                     RLCAIESFATVHHLVSTIRGRLTPGRDSIDLLQACFPGGSVTGAPKVRAMEIIEELEP
                     HRRGVYCGSLGYIGFDGNMDTNIAIRTLVYSQSYLRFWAGGGIVADSVEEVEYQETLD
                     KAAAILQALSEYTAPVSNRVP"
     gene            complement(282317..283378)
                     /locus_tag="Noc_0256"
     CDS             complement(282317..283378)
                     /locus_tag="Noc_0256"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="S-layer protein, putative"
                     /protein_id="ABA56786.1"
                     /db_xref="InterPro:IPR002756"
                     /translation="MLSRPLAISGWDIGGAHLKAALTDSQGRIAACIQLPCPLWQGLE
                     KLQQAFSQMQLELKNKDCLAAITMTGELADLFNDRDEGVIKILEYASQHFQNIPVYVF
                     AGTQGFISLEQAAKYTEAIASANYLATSQLAARHWKEGLFLDIGSTTSDLIPCKDSIP
                     CPRGKNDQERLASGELLYSGVTRTPLIALARRAPLEGQWIRLAAEWFATTADVYHLLG
                     RLSPSDDLHPSADNRGKQPRDCARRLARMVGTDSKHWPLPAWQGLAAYFAEQQCQQLT
                     DAVFQVLSRVDISPKAPLIGAGIGRFLVAECARRLRRPYADFSEALDIHPPIPISADH
                     APAAALARLAWEQLRDKIH"
     gene            complement(283353..284393)
                     /locus_tag="Noc_0257"
     CDS             complement(283353..284393)
                     /locus_tag="Noc_0257"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF201"
                     /protein_id="ABA56787.1"
                     /db_xref="InterPro:IPR003806"
                     /db_xref="InterPro:IPR005479"
                     /translation="MKILVYEHITSGAFCTESLPSHLAREGDAILQALLYDLARTQGV
                     QSVILRDFRLDTPPYIHRCHYIRNLNDFRRCWLISLDYVDGVLPIAPESDNLLAEIQS
                     WVLKAGKRLLGCRPEATAIVTSKTRTARHLAAAGLVTAPTVWLKDWQPDTFTESALIC
                     KPDDGAGCSNLLYFENTAALSAWKQQRAPEIWGKQIVQPYIWGTASSLCLLCADGEAR
                     LLCGNRQGLRITEGTIQLTSITVNGVNSQEFYPPSFQEIADIIATALPGLWGFVGVDL
                     VLSPQPVIIEINPRLTTSYIGLREVYGINPGTWLLTLLNKGMKAVELPPRPCQKVTVA
                     TEEGDAIQATRH"
     gene            284443..285150
                     /locus_tag="Noc_0258"
     CDS             284443..285150
                     /locus_tag="Noc_0258"
                     /EC_number="5.3.1.16"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Histidine biosynthesis"
                     /protein_id="ABA56788.1"
                     /db_xref="InterPro:IPR003009"
                     /db_xref="InterPro:IPR006062"
                     /translation="MQLLPVLDLWGGVVVHARGGQRDSYLPLNSPFAPNSSPLQVVAG
                     LLQWCRFQQLYIADLNAIMGDGNNHFMIAAIARSYPDLELWVDGGTARHEAVAQLFAL
                     GVARPVVGTETLPDLESWQALQSSWPEQLALSMDHRRGAFLGPAGLDRQPELWPGTVI
                     AMSLDQIGSQQGPDWSLLERLGQRSLRKRISLLAAGGVRCLEDLKQLAAWGVEGVLLA
                     SALHDGSLNPAELQQML"
     gene            complement(285186..286109)
                     /locus_tag="Noc_0259"
     CDS             complement(285186..286109)
                     /locus_tag="Noc_0259"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S6P modification protein"
                     /protein_id="ABA56789.1"
                     /db_xref="InterPro:IPR004666"
                     /translation="MLRIVIFNNSHGWHSKQLEAALAPQGVAIIRSNLAQCRIDLDSP
                     SGLHIPGLGGDLPDAAIVRGIAAGSFEQITLRLDVLHTLAEFGIPVLNTASAIERTVD
                     KARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIG
                     KPADLEACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNVAR
                     GAQYFPAPLEREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSWKALQQT
                     TEVNIAGALAKNLLERLHSSYFAHSGSSQKI"
     gene            complement(286194..287405)
                     /locus_tag="Noc_0260"
     CDS             complement(286194..287405)
                     /locus_tag="Noc_0260"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56790.1"
                     /translation="MAKLQRAPSSKLGIRCNQGGWNQLHPILILANSGRALAQSAAAS
                     GYRVVVADNYGDRETRQAALAWIRIFSGANVGHWRQKIVRFIEAEKYPVGLIFGSGFE
                     NRPDIMEELSRRGILLGNTPHCVRLLKDPRRFFPLLGKLTIPAPEVQLQLPDNPLGWL
                     CKAIGGAGGHHIFPATIPNIRRQQLWVRQGWTTAAPVPYYYQRKLEGQPGSVLFLANG
                     KEVQILGYHYLWLAPTPAMPYRYGGIAAPLNLTPSAGALLRNYLQAIVTATGLRGLNG
                     LDFIHGSQGIQVLEINPRPPASLDLYQDRFSPFDAHVKACLGSSLPIQIAPIAVARAF
                     SILYSPHPWRIPPNIVWPAFCTDLPAENTLIKREEPLCSIHAMATSTETCQQLIRRRQ
                     NQVLEWLTSSF"
     gene            complement(287670..289118)
                     /locus_tag="Noc_0261"
     CDS             complement(287670..289118)
                     /locus_tag="Noc_0261"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase, beta subunit"
                     /protein_id="ABA56791.1"
                     /db_xref="InterPro:IPR004003"
                     /translation="MSQGLVTMAYIGAAILFILSLGGLSHQETARRGNIYGMVGMTIA
                     ILATILSEAVAGIGAYILLTITMVIGAVVGVKVAQQVKMTQMPELVAILHSFVGLAAV
                     LVGYTNFIAADNHLIGVEKTIHDVETYLGVLIGALTCSGSVIAFGKLSGRISGKPLLL
                     PARHWLNLGLLILAIWLGKAFVEAESMGGGLFFLFLMTVIALGFGVHMVMTIGGADMP
                     VVISMLNSYSGWAAAATGFMLANDLLIVTGALVGSSGAILSYIMCRAMNRNFISVIMG
                     GFGTEGGSATAPVAGGTSEVNAITAEETTHLLEAAKNIIIVPGYGMAVAHAQHTVYEI
                     TKLLRKQNINVRFAIHPVAGRMPGHMNVLLAEAKVPYDIVLEMDEINQDFPNTDVVIV
                     IGANDIVNPSAQDSPDSPIAGMPVLEVWKAKTTIVLKRGMATGYAGVDNPLFYKENNR
                     MLFGDAKESLDAVLSHLHNDIREVASYQAVTN"
     gene            complement(289131..290699)
                     /locus_tag="Noc_0262"
     CDS             complement(289131..290699)
                     /locus_tag="Noc_0262"
                     /EC_number="1.6.1.2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase, alpha subunit"
                     /protein_id="ABA56792.1"
                     /db_xref="InterPro:IPR004571"
                     /db_xref="InterPro:IPR007698"
                     /db_xref="InterPro:IPR007886"
                     /db_xref="InterPro:IPR008143"
                     /translation="MRIGIPKEIHRGEKRVATTPDTAERLQKLGFSVALESGAGLNAN
                     FSDAAYREAGAEIIEDTRSLWSTSDIILKVRSPSIHPELGIDEVELLQEGGYLISFIW
                     PAQNKELLERLAAKKNTVLAMDSVPRISRAQKLDPLSSMANIAGYRAVIEASHHFGRF
                     FAGQITAAGKIPPAKILVIGAGVAGLSAIGTAAGLGAIVRAFDTRPEVKEQVQSMGAE
                     FLELKFAEESAGEGGYAKEMTPEFIQAEMDLFTQQAREVDIILTTALIPGKKAPELIT
                     EEMVKSMKEGSVIVDLAAEQGGNCALTTPDEVVVKHGVTIIGYTDLPSRLSTQSSQLY
                     ATNLRHLLEELCPEKDGTIHLNMEDEVIRGLTVIKEGEITWPPPPPRISATPASQPAK
                     PQPAPAPAEVKEKSKLSKEWRIAMIMALGGLGLWGLGTVAPPSFMTHFTVFVLACFVG
                     YQVIWNVTPSLHTPLMSVTNAISSIIVIGALIQVSKSGILIALLAGIAILITSINIAG
                     GFLVTQRMLRMFRK"
     gene            complement(290980..291420)
                     /locus_tag="Noc_0263"
     CDS             complement(290980..291420)
                     /locus_tag="Noc_0263"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Blue (type 1) copper domain"
                     /protein_id="ABA56793.1"
                     /db_xref="InterPro:IPR000923"
                     /db_xref="InterPro:IPR002386"
                     /db_xref="InterPro:IPR011572"
                     /translation="MVNIKSALLSVTLILALTFSAITIAQTHIIKSIGTAFNPIIVFA
                     EPGDTITWINMPAHNTKSINGLIPQAAKPWQSQMGQDFSVTLEEEGIYLYECNPHLSF
                     GMAGAIVVGEPKNLAELEKKVNYTHGAIQRVFRKTKEAIATTGQ"
     sig_peptide     complement(291343..291420)
                     /locus_tag="Noc_0263"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.791 at
                     residue 26"
     gene            291742..293151
                     /locus_tag="Noc_0264"
     CDS             291742..293151
                     /locus_tag="Noc_0264"
                     /EC_number="6.1.1.17"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA synthetase"
                     /protein_id="ABA56794.1"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004527"
                     /translation="MTVRTRFAPSPTGYLHVGGVRTALFSWLYARKHGGRFILRIEDT
                     DRERSSMESVNAILEGMTWLGLEYDEGPFYQTNRFSRYREIIEQLLASNHAYLCYCTR
                     EELASMRAEQMARKEKPRYDGRCRERHSPREGVSPVVRFKSPLEGRVVIRDLVRGMVI
                     FQNNELDDLVLARTDGTPTYNLTVVVDDMDMGMTHVIRGDDHLNNTPRQSNIFYALGK
                     EPPVYAHVPMILGPDRQRLSKRHGAVSVMNYREAGYLPEALLNYLVRLGWSHGDQEIF
                     SVAEMIKLFDIEDVNQSASTFNSEKLLWLNQQYIKNSAPEHIAHHLSWHLGQLGIDPS
                     KGPDLAAVVKAQQERSKTLLEMAHNSAPFYREFEAYEETAARKHLNASVLGPLRDLRE
                     RFKEAQSWVAPALHEIILATVESHHLKLGKLAQPLRVAIMGRPISPPIDVTLELMGQA
                     TTLARIDRALAWIDHRSNA"
     gene            293763..294464
                     /locus_tag="Noc_0265"
     CDS             293763..294464
                     /locus_tag="Noc_0265"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56795.1"
                     /translation="MVTATMHSREKRLERALVGGAITAAASGVAAVILSILGLVHIGP
                     LLMTPIAAIVIGAGLLSESGTLAAEYSEILSKTRRNRWRKVEFGSGASAEMLAGIAVI
                     TLGILSLLNLQPLVLLPVSVITLGACLLLSTGAKALLNSMRLEIPENHRRAEMVAHTT
                     LRGAIWVQVIVGLAAIVLGILALAGWVPLILTLVAMLAIGASILLTGAAVSARMLSAY
                     TAHTPPKGISHRSSI"
     sig_peptide     293763..293858
                     /locus_tag="Noc_0265"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.957) with cleavage site probability 0.632 at
                     residue 32"
     gene            294497..295195
                     /locus_tag="Noc_0266"
     CDS             294497..295195
                     /locus_tag="Noc_0266"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56796.1"
                     /translation="MNITSEQMPTESHTQSISSERLKRGLVGGALTEAIAGIGAVTLT
                     IIGLSGVAPMTMGAIAVIVVGVGLLSEAGTLVAEYPAIISRTRKRFRDKIEFSAGFGA
                     EGLAGTVAIVLGILVLLGAEPLVLLPSAAIVLGAGLVLTSAAISFISSLNLNFLLDGH
                     EDSHEEHIAHVALGTAMGVQVVLGFAVVVLGILALVGFIPSSLTLVAILVASVAALMD
                     GIAVSGRVISASTD"
     gene            complement(295301..295708)
                     /locus_tag="Noc_0267"
     CDS             complement(295301..295708)
                     /locus_tag="Noc_0267"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Calcium-binding EF-hand"
                     /protein_id="ABA56797.1"
                     /db_xref="InterPro:IPR002048"
                     /translation="MAGCGDSSQVPSSNQNDRTSQAEQPSQHSGGSNGNNKHTMDKSE
                     RMEMQQPSFSQLDSDGNGSISKEEAQAFEDLALYFKQLDRNKDNKIDSDEFRNFKAMQ
                     MRSFDHGGDSGAEYGEHGALSTQKNKSATTQEQ"
     gene            complement(295857..297677)
                     /locus_tag="Noc_0268"
     CDS             complement(295857..297677)
                     /locus_tag="Noc_0268"
                     /EC_number="2.2.1.1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Transketolase"
                     /protein_id="ABA56798.1"
                     /db_xref="InterPro:IPR005474"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /translation="MMKSLQNTAQQLRRLVIRMTTEAGSGHPTSCLSCAEIVAALFFH
                     EMRWDPSDPKARNVDTFILSKGHAAPILWAALWEAKAIHEDPLSLRKLDSSLEGHPTP
                     NNPWVKVATGSLGQGLAAANGIALANRLDGIDARIYCLLGDGECSEGSVWEAAQFASL
                     NHLSNLVAIVDVNALAQSGPAPYQHDIEVFSRRFQSFGWETITIDGHDLGAILSALEQ
                     AKKTGPTAIIAKTEKGKGVSFLEGKEGWHGKPLSQEEMEKALAELGEDQAVAPLEPRR
                     VGHYTPPPQQKKPTPALAVDYALGDQAATRDGFGNALKKLGELLPELVVLDGDVKNST
                     RTEYFAEAYPDRFFESYIAEQNMAGTALGLAAYGKIACATSFACFLSRAYDFIRMAGH
                     SRPSHLIFCGSHAGVSIGKDGPSQMGLEDLAMFRAVSGSTILYPCDGVSAERLTQQVT
                     KAQGIVYIRTTRGKTPVIYANDEEFPVGGSKTLCASKEDKFTIIAAGITVHEALAAYE
                     ELKSKEILVRIIDAYSIKPLDQETLAKAAHETQGIITVEDHWIDGGLGDAVAATVSAL
                     APVHRLAITAEPRSGKPEELLERYGISQQAITRKILELMD"
     gene            complement(297683..298813)
                     /locus_tag="Noc_0269"
     CDS             complement(297683..298813)
                     /locus_tag="Noc_0269"
                     /EC_number="2.2.1.2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="transaldolase"
                     /protein_id="ABA56799.1"
                     /db_xref="InterPro:IPR001585"
                     /db_xref="InterPro:IPR004732"
                     /translation="MDSLLKLLEFGQSYWIDNLTRRMIKNGELKHRVEEQGLGGVTSN
                     PSIFHKAIANSDDYDPQIETLIREGRSKIEIYEALITTDIRDACDILHPVYKERKGQD
                     GFVSLEVSPYLAHDTEGSIQEARRLWQTVDRPNLFIKIPGTAAGVPAIEELLFEGINI
                     NITLLFSIDHYQAVAEAYLRALERRLEAGQTVENIASVASFFLSRIDVLADQLLSHRI
                     PPEGKSPSAPHPENLRGKVAIANAKLAYQRFKEILQSERWKTLAGKGAQVQRMLWAST
                     STKNPAYRDVMYVEPLIGPYTVNTLPEKTIKAFADHGIVKETVEENIEESRKVFADLE
                     KIGIDFNLVTAQLENEGVQKFIDPYDALLAMLEAKCEDCKNR"
     gene            complement(298816..299556)
                     /locus_tag="Noc_0270"
     CDS             complement(298816..299556)
                     /locus_tag="Noc_0270"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoesterase, PA-phosphatase related protein"
                     /protein_id="ABA56800.1"
                     /db_xref="InterPro:IPR000326"
                     /translation="MENIYWVLLYLLNSEILVKKQIQSWHKSVPYNFSITTLRYSIVI
                     AGGILSFIMLAQHLHQHGELWFDAPALNFLAEHRTLLLDNFFLWITWAGSSFLLLPIS
                     IGIAIILIRYRYYPAALLMGLGFSGASLMTKMIKTLMVRERPVLFPPLEIYGGFSFPS
                     GHTTQVAAFALSVFLIISRIWPRWQWPAAILLTALVLCVSTSRLYLQVHYPSDILGGC
                     LVALIWVLSIDILIRTTIRIGTLKKSGG"
     gene            299700..300365
                     /locus_tag="Noc_0271"
     CDS             299700..300365
                     /locus_tag="Noc_0271"
                     /EC_number="3.5.1.19"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Nicotinamidase"
                     /protein_id="ABA56801.1"
                     /db_xref="InterPro:IPR000868"
                     /translation="MERPPVTFNKARAVLLLVDIQPDFLPGGGLPVADGSQIIEPVRL
                     LMESDKFCHYVATQDWHPPGHVSFASSHPGAEPMATLEINGYAQTLWPDHCIQGTSGA
                     ELHGDLPWEKVAAIIRKGTDPESDSYSGFHNNWNSAGERPATGLAGYLRERGIEELFI
                     CGLARDVCIKWTAEDGANAGFNVYVLWDLTRPVEPSSDDQVRRELIAHDVKIIDWEQL
                     VRY"
     gene            300556..302475
                     /locus_tag="Noc_0272"
     CDS             300556..302475
                     /locus_tag="Noc_0272"
                     /EC_number="3.6.4.6"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase M41, FtsH"
                     /protein_id="ABA56802.1"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR011546"
                     /translation="MDNEKQASPPPAAPPLNWRYLLWIILLGIFLISWLGNAGRQAGD
                     EITYTEFKQALHQGKIAKVTLEGQHISGTYHEAGGNIQPEGKDSKGFSTTRPPFDDPE
                     LMKLLEQKGVVVQAKSEEPSLWMQAIIGILPWFLILGLIFYVSYRMQQRMMGGGRGGP
                     FGFGKAPVKRFREGSIGVTFEDVAGVENAKRDLREIVDYLKEPGQFKAVGAKIPKGIL
                     LVGRPGTGKTLLARAVAGEAGVPFYSISGSDFIEMFVGVGAARVRDMFKAAKEEAPSI
                     LFIDEIDSVGRARGTGLGGGHDEREQTLNQILGEMDGFAAHENVVVLAATNRPDVLDP
                     ALLRPGRFDRKVVLDLPDKKARQRVLEVHTKNVPLAADVDLERVARRTVGFSGADLAN
                     LVNEAALLTGRERKKEVDMDMFNLARDKIVLGAKRETILGEEEKKLVAYHESGHALTA
                     WLLPEADPLHQVSIIPRGMALGVTEQAPEEERHSLSRAYLLDRLGVMLGGRISEKITF
                     GDVTSGAESDLKQATQLARRMVCQWGMSDKIGAAAFSRSEEHVFLGRELSQPRDFSEQ
                     TAQIIDDEIRRILSEVERKTENLLQENRAKLDALAKALIEAETLNLVEVEKIFKNVKE
                     LPQEGHNEAVATGAG"
     gene            complement(302493..303521)
                     /locus_tag="Noc_0273"
     CDS             complement(302493..303521)
                     /locus_tag="Noc_0273"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Sigma-54 specific transcriptional regulator, Fis
                     famliy"
                     /protein_id="ABA56803.1"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003593"
                     /translation="MKYLDEAHHMVGLSKATRNLQNAIQKVAPLEAAVLLYGESGTGK
                     ELAARMIHDLSNRRESPFISVNCGALPRELLNTELFGHEKGSFTGAIYQHQGYFEQAD
                     GGTLLLDEITEMPLTFQIYLLRALETGTFRRVGGHQEIKTNPRVIATTNIDPWQAVET
                     GKLRSDLFFRLAEFPLYLTPLRDRDEDVILLAQYFLDGFNETYKENKQFTKDTLQFIS
                     TNSWPGNVRELRHAIHHAFILANDEIDEKEFHTGQRQSKPCYQDKLVHSLVGLSIEDI
                     EKNLIPATLDHFKGDKKQTAQCLGISLKTLYNRLNFINGIDGKEDLNKIVNFSTKNPN
                     AFLSRESD"
     gene            303911..304117
                     /locus_tag="Noc_0274"
     CDS             303911..304117
                     /locus_tag="Noc_0274"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="CsbD-like protein"
                     /protein_id="ABA56804.1"
                     /db_xref="InterPro:IPR008462"
                     /translation="MPINWDQIEGNWKQFKGHARQKWGKLTDDEIDEAAGNKQILAGK
                     IQERYGIEREEAEKQVEEFRNSLK"
     gene            304534..304974
                     /locus_tag="Noc_0275"
     CDS             304534..304974
                     /locus_tag="Noc_0275"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56805.1"
                     /translation="MWLDDREVMLDEMILACMHIERDYRSLINLTDDPLLTQLFNELA
                     NHHKDWAGQLEFHIREMGGMPSDLDPEKQAVEEMITYAKVALSDHERHTILKNQKEEE
                     EKLKLLASKLLEKKIPDSTKSLLRHIEKGVEKNQSRLLAARFRS"
     gene            305219..305893
                     /locus_tag="Noc_0276"
     CDS             305219..305893
                     /locus_tag="Noc_0276"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcription regulatory protein,
                     LuxR family"
                     /protein_id="ABA56806.1"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /translation="MNRMNQCFPSAHDHSGSQHNFEARVFIVNSDEKTHSSLCRMIAS
                     AGWRTKSYFSAESFLDKFDPAHPGCLLLDNHVSEMGGLSLQQELRDRNSLTPVLFTSS
                     QGTVPEAVEAIHGGAVNFFTRPLEKPLLMKCIRESIEKSQYLREEQKEREEIIIRMMR
                     LTPREREVMALVLKGQPNKLIASDLDISIKTVEIHRGQVMKKLQVRTQADLIHLALSY
                     PSEMEH"
     gene            complement(306117..307097)
                     /locus_tag="Noc_0277"
     CDS             complement(306117..307097)
                     /locus_tag="Noc_0277"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="possible streptogramin lyase, gluconolactonase
                     family"
                     /protein_id="ABA56807.1"
                     /translation="MKLTHSFILFVFFYDLALAESVTVDIKEWPVPYENSRPRDPYVA
                     PDGRVWFCGQLNGYIAMLDPATGKFKKMDMTDGERPHNLIIDNQGTLWYAGNTLGYIG
                     RLDPTTGETKKYLMPDNVRDPHTLAFDSKGDIWFTAQHSNIIGKLFVKIGEVKAVEAS
                     TPGARPYGIGIDSNDRPWVALFGTHKLATVDPESFTIEEIELPRKKTLPRRLVITSDN
                     TVWYGDYKGGYLGQYNPETAKIKEWPMPGGKRSQPYGMSVDDRDRIWFVATGLSPNLL
                     TGFDSKTKEFISETAIPSGGKTIRNMYYYPPERAIWFGADTNTIGRAIIP"
     gene            307626..307937
                     /locus_tag="Noc_0278"
     CDS             307626..307937
                     /locus_tag="Noc_0278"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic or secreted lipoprotein"
                     /protein_id="ABA56808.1"
                     /db_xref="InterPro:IPR007055"
                     /translation="MKNPIKYIGFMLIVFMAVLMLGCADSPKQSAGGYVDDAWITSKV
                     KSSLLSDPLVSGTDVEVNTYQGVVQLSGFVATEEQSEEAERITRSIKGVKDVENKITV
                     K"
     sig_peptide     307626..307700
                     /locus_tag="Noc_0278"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.926) with cleavage site probability 0.523 at
                     residue 25"
     gene            complement(307968..309128)
                     /locus_tag="Noc_0279"
     CDS             complement(307968..309128)
                     /locus_tag="Noc_0279"
                     /EC_number="3.6.3.25"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="TC 3.A.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter ATP-binding
                     protein, CUT1 family"
                     /protein_id="ABA56809.1"
                     /db_xref="InterPro:IPR001687"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MAGIIIDKVTKRFPDGTETLSDVSLNIEDGEFFILVGPSGCGKS
                     TLLNMIVGLEEITRGEIRVDGRVINTLDPKDRNMAMVFQSYALYPHMTVRENMAFPLK
                     LAKKPKEEILQKVKQAAAILELTELLDRKPASLSGGQRQRVAMGRAIVRQPRAFLMDE
                     PLSNLDAKLRVQMRTELARLQKRLGTTTIYVTHDQSEAMTLGDRVALLYQGKVQQVGT
                     PRELYTVPNNLSVASFIGSPAINFLPARVEKDRLILPMTQFKLPPNLEGQLSNFQGPA
                     IAGIRPEHLQEADSAKEKQAMFPAFKATVDVIEWMDAEVYAHFNIQGEISESLQSLTK
                     DLEIKATTDKTIRLVARLDGASYAREGVKLKMQLDPCKLHLFDIQSGENLIC"
     gene            complement(309133..309975)
                     /locus_tag="Noc_0280"
     CDS             complement(309133..309975)
                     /locus_tag="Noc_0280"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="TC 3.A.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter membrane protein 2,
                     CUT1 family"
                     /protein_id="ABA56810.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MRGKFKRNLPERLFWGASSLIVMVYALIPVIWIISLSLKRGADL
                     NDNRFFPATVSFEHYQAIFQDPQFPAALWNSIGIGAISTLLAVLLAMFAAYAIVRLEF
                     PGKRLILSGALAIAMFPPIAIIGPLFNLWRQIGLFDTWLGLILPYMTFTLPLAIWTLS
                     AFFKEIPWDLDKAARVDGATPFQAFRKVIVPLAAPGVFTAAILVFIFAWNDFLFAMSL
                     TSTAQARTVPAAIAFFTGTSRFELPVGSIAAASVVVTLPIVVIVLIFQRRIVAGLTAG
                     AVKG"
     gene            complement(309978..310856)
                     /locus_tag="Noc_0281"
     CDS             complement(309978..310856)
                     /locus_tag="Noc_0281"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="TC 3.A.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter membrane protein 1,
                     CUT1 family"
                     /protein_id="ABA56811.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MNPRGKAERRLGWLLCAPAVITMGAVTVYPILYALWLSLHRYDL
                     RFPADRSFVGLSNYWSVLSSELWWQALGNTLMMTAGSVLVELALGFCLALVMHRVLFA
                     RSLVRAAILIPYGMITVVAALAWKFAFDPTTGFVNALFNLEGAWLTERWSAFFVIIFT
                     EIWKTTPFMALLLLAGLTLIPEDLLKAARVDGASAIQRFFKITLPLMKPTILVALLFR
                     TLDAFRIFDTVFMQTRGAHGTETVSMTGYNALIVRLNLGLGSAVSVLIFIAVILIALL
                     FIKGFGTSIARQESEK"
     gene            complement(310853..312124)
                     /locus_tag="Noc_0282"
     CDS             complement(310853..312124)
                     /locus_tag="Noc_0282"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="TC 3.A.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter substrate-binding
                     protein, CUT1 family"
                     /protein_id="ABA56812.1"
                     /db_xref="InterPro:IPR006059"
                     /translation="MKQWLKVGLLHLVSGLKTGMLLLFLLLAAACSDSPDNPVPTLKW
                     YVFDEPSGAFETAAKRCSADAKGVYQVEIAALPADASQQRVQLVRRLAAKDTAIDLIG
                     MDVIWTAEFAEAGWILPWLGEAADQARQGRLPSTIESATYDHQLWGIPFTSNIQLLWY
                     RTDQVAKPPQSWDELIQSAEALGIGTLQVQGARYEGLTVLFNSLLASAGGSVLDKTGK
                     AVSLEATPTEKALRIMKRIATSPATNSSLSIAREDETRLAFEGGSAFMINYTYVWPSA
                     QQNAPRVAAHMGWVRWPAVIEGQPSRVTLGGINLSVGAYSRYPQLAFRAATCIASQEQ
                     QRLAAIKGGLLPTFEKLYADPSIREALPFADTLRATLKNAAQRPSSPLYNDISLAISR
                     TLHPMKAIDPQKDIARLRKNINRALHSQGLL"
     sig_peptide     complement(312026..312124)
                     /locus_tag="Noc_0282"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.914) with cleavage site probability 0.685 at
                     residue 33"
     gene            complement(312416..312724)
                     /locus_tag="Noc_0283"
     CDS             complement(312416..312724)
                     /locus_tag="Noc_0283"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, XRE family"
                     /protein_id="ABA56813.1"
                     /db_xref="InterPro:IPR001387"
                     /translation="MPLTEKELLERDAKRDIGAELLQSIRQMKAGNRGRVHYASISSV
                     TEARHKVGLSQAQFAALLGVSKRTLQDWEQGRREPSGAAKSLLKIAKKRPDVLREIFS
                     "
     gene            complement(312711..313049)
                     /locus_tag="Noc_0284"
     CDS             complement(312711..313049)
                     /locus_tag="Noc_0284"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56814.1"
                     /translation="MPYDLIMFTVVETLTFSKLAADYWTEEERGEFAAWLAANPEAGN
                     VVPGSGGVRKVRWSRKGSGKRGGIRVIYYNRLVHGEIWLLLLYAKSAQEEIPAHVLKT
                     IKEEIKNATD"
     gene            313451..313711
                     /locus_tag="Noc_0285"
     CDS             313451..313711
                     /locus_tag="Noc_0285"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56815.1"
                     /translation="MLSPRETRSAISSYWEIELSIRCICITLHVVKLNDIANIKNTRL
                     IIINSNFIKILKAFLTHQLLSEEQYYSGAYPFYSQLIISLTL"
     gene            complement(313867..314127)
                     /locus_tag="Noc_0286"
                     /pseudo
     gene            complement(314145..315260)
                     /locus_tag="Noc_0287"
     CDS             complement(314145..315260)
                     /locus_tag="Noc_0287"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56816.1"
                     /translation="MNHSRLFEELLLELQILINSNDEYDLIKSSRVLRQLLLDGDALL
                     HLVNRELRVSPQFLARNITQPLEDFFEPEIYPQNATDETVQLSLKNFLSFTIGNTEGN
                     QISVRDIIKYGAIVLGGVHFKEDPKGEYANIARLHNEREPTAFSQVLLALRNIGAIVR
                     DELIPIRNQLLMRKRFESGIGWTALLSLRLLPVPADEENYILDIGTREKLNRFSIFVD
                     TREELTFRVVDKKGERRYLRAGRVGEAIPLERPITILCELNTLGSDTLLTIRAGSWDH
                     AEIVQGKFLDQIGKPFHFVIGSDCTGRKSTHMDIFGTLVISRILSDFETSQAVSHFVP
                     KARVATHYANFSGNQFLYSTGHPNFAHEDTKHNKLDV"
     gene            complement(315513..315944)
                     /locus_tag="Noc_0288"
     CDS             complement(315513..315944)
                     /locus_tag="Noc_0288"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III chi subunit, HolC"
                     /protein_id="ABA56817.1"
                     /db_xref="InterPro:IPR007459"
                     /translation="MTKVDFYLLTSRQPQASKRFTCKLIEKVYRLGHQVYIQVEDQAQ
                     AQEMDDLLWTFRQGSFVPHALVNSEEATGTPVLIGYDGEPGGKLELLINLGAEVPAFF
                     SRFQRVAEVIGPDETHRHAGRQRYRYYRDHGCSLETHELNF"
     gene            complement(315951..317456)
                     /locus_tag="Noc_0289"
     CDS             complement(315951..317456)
                     /locus_tag="Noc_0289"
                     /EC_number="3.4.11.1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase A, Metallo peptidase, MEROPS
                     family M17"
                     /protein_id="ABA56818.1"
                     /db_xref="InterPro:IPR000819"
                     /db_xref="InterPro:IPR008283"
                     /translation="MNFHVTSGTPEKQRTAALVVGIYEDEKLSSYAQRIDKASEGYVS
                     RLIKQGDFTGKKGQALLLFALPGVKAERVLLMGCGQKDKVTAKNLRQSWSGAVKALQA
                     CGATEAMICPLEAKPKDEELTQWARLIVETAEQALYRYEHTKSKKESLKKPLAKLTLL
                     LDQRSQQPLAEQGIQQGQAIAKGVNLARDLGNLPGNICTPTYLADEARRLAKEYKSLK
                     AKILEQAEMEKLGLGALLAVSRGSRQPPKLITLEYKGAPGKQKPIVLVGKGLTFDAGG
                     ISIKPGERMDEMKYDMCGGAGVLGTMQACAELELPLNVIAVVPSSENLPDGAANKPGD
                     VLTSLSGQTIEVLNTDAEGRLILCDALTYSKRYRPDVVIDVATLTGACVIALGAHASG
                     LLSNDQSLAEHLLAAGQTSDDRAWQLPLWDDYQQQLDSNFADMANIGGRGAGTITAAC
                     FLARFTEEFRWAHLDIAGTAWLSGKEKGATGRPVPLLTQYLIQRAQEAKTS"
     gene            317679..318086
                     /locus_tag="Noc_0290"
     CDS             317679..318086
                     /locus_tag="Noc_0290"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Penicillinase repressor"
                     /protein_id="ABA56819.1"
                     /db_xref="InterPro:IPR005650"
                     /db_xref="InterPro:IPR011585"
                     /translation="MLSIRSSYLGELEIAVLEYLWSEGAMDAKDVHQGIGTQRGISLN
                     TVQSALERLYRKKLLSREKVRHAYVYAPAVRREELMAQLMGQVAHVLSAGKGYDLLST
                     FVDFAARVDEHSLDRLEQLIAERRRQQQEDDPP"
     gene            318095..319081
                     /locus_tag="Noc_0291"
     CDS             318095..319081
                     /locus_tag="Noc_0291"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56820.1"
                     /translation="MEVFPFAFVAWCGFAMITALFCALLYPWVCPRLLLLPPALRANQ
                     ALVWAVAPAAAGVLLTGFIFLPPVLSYLGVAPDHCQPAGVDFSYHCLLHPFAVMERDL
                     PWFLLLPLSGLALFFLSRMVWELLRAHRLIRALSLAGSPDIFRGIWVVESEWPLALTS
                     GFSQPRIFISTKLLRDLSPPQLAAVLAHERAHFYRYDPARYFIARAAAGLHISWLRRK
                     LLEDLSLAAEQACDEEAARQVGDRLLVADTIVQVERWCCRQRRSAPVPLPSFMGSQVV
                     ARVEFLLASPQKAQWSYPRMLGVCTGVALSGLLLAAEPLHQLTEIILGFLAR"
     gene            319085..320383
                     /locus_tag="Noc_0292"
     CDS             319085..320383
                     /locus_tag="Noc_0292"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane efflux protein"
                     /protein_id="ABA56821.1"
                     /db_xref="InterPro:IPR002345"
                     /db_xref="InterPro:IPR003423"
                     /translation="MIPLGSSRFYKKPIIYRFYKVLLVVLMVWLATPCFLAASETRSS
                     PTQWLTIREAVRMGLSRPAIKQWVEGRISMAQSEAAQAALWSNPQLQYQREDAGGSID
                     QFLWLTQKFDFSGRRGLQVDAAQQRVRATRQDTRLRRLALVAKIRQDFYQALHQRELL
                     GNLARWLERLEVIEAVVQKREAAGVISGYDHLRLTREQAAVQARLQGEEATQQRIWEQ
                     LAAILGGQEQIIDYQGVTGALLPDPPPPLASLLQAMTLRPDLQRLKRQMSAYSLERQA
                     AARGWIPKLTLSLGSKRVTNTSTLRSDTGPFIVAGINLPLFDRNQAERDWARARAQVA
                     RSEYQLALMEAQGAVRGRWREVQQLIATAQEVRRRDVNAARALVRTARAAYEGGEVGI
                     LELLDAYREEMNTVVRALALEQRARQAQIELERLMGKDWP"
     sig_peptide     319085..319201
                     /locus_tag="Noc_0292"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.993) with cleavage site probability 0.612 at
                     residue 39"
     gene            320380..321924
                     /locus_tag="Noc_0293"
     CDS             320380..321924
                     /locus_tag="Noc_0293"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Secretion protein HlyD"
                     /protein_id="ABA56822.1"
                     /db_xref="InterPro:IPR006143"
                     /translation="MKILRFGLLGSLFLLAACSAGRESPQEGTPELGGISITDFTDKT
                     ELFVEFLPLVVGQESAFAVHLTQLEGFLPMAQGRVIVFLGGGDLPLEKFVADGSQVPR
                     IFRPIVKPQNPGRRQLAIRLVAPAFTVTHFLGGVTVYPDLKTAAHAHPPEAEKERGIT
                     FLLEQQWQVDFALEAVRPHTLRESVAATGVVRPRSDGEVWIHAPTAGHLLTHGSDFPQ
                     VGMAVTQGQILAQIAPRMAGEADFASLQLAVQKGHSQYQFAAHERQRLEDLFKQNAMP
                     KHRLIEARKEETIAKAELEAAQRRLAQYQVLSSGTLVGVPVRAPIKGLLTQVQVTAGS
                     YLATGQALFHVVQTDRLWLEARIAEADLGRLHDPTAAWFEVEGFEQPFRIGPAQGARR
                     VTFSMEVDEVSRTTPLVFEFPNPNPALRIGMFAQVHVLTGKKVHDLTVPRSALVDHNG
                     QVVVYVLLGGESFERRSVQLGIRDGNYAQVREGLSAGERIVTHGAYLVHLAAASPAAP
                     GHGHAH"
     sig_peptide     320380..320445
                     /locus_tag="Noc_0293"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.997) with cleavage site probability 0.621 at
                     residue 22"
     gene            321908..325033
                     /locus_tag="Noc_0294"
     CDS             321908..325033
                     /locus_tag="Noc_0294"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Heavy metal efflux pump"
                     /protein_id="ABA56823.1"
                     /db_xref="InterPro:IPR001036"
                     /db_xref="InterPro:IPR004763"
                     /translation="MVTLTEAAMIAKIIQWSLKQPLLVLLSAAALLGWGSIEALRMPV
                     DVFPDLTTPRVTVVVEAHGMAPEEVEVLITFPLETAFNSAMGVRRVRSSSGVGFAVIT
                     VEFDWGMGIYRARQIVAEKLQLVRGALPPDIPPPVMQPVTSIMGEIMFIALTSERHSA
                     MELKTQADWVVRHRLLAVPGVAQVIPIGGDTKQYQVILKPERLVAYDIAMDEVVAALR
                     ETNQNISAGFYVEGGQEHLIHGIGRVQRLEDIRETLIGQRGGQSVLVRHVAEVALGPA
                     PKRGTGALNGEAAVIIGIQKQPGTNTLALTARLDQVLAELQASLPSGMIFNTHIFRQA
                     DFITVSINNLLAALRDGAILVAAIVFAFLMSTRASVITLLAVPLSLVTVILVMKALGT
                     TFNTMTLGGMTIALGALVDDAIIVMENIVRRLRENQQRDKGQRRSTGKVVFEATREIQ
                     GSIVFATLIIVLVFLPLVFLSGVEGRLMQPLGVAYVVSLAASLLVAITVTPVLSALLL
                     PQARIVQASREISLARSLKRHYERLLAATITQWKVITLIAMTALAAALITLAGVGQVL
                     LPSFNEGSLTINTMTLPGTSLEQSDRLGQRVEKILLSYPEVVSTARRTGRAELDPNAQ
                     AIYASEIDVNLRQGERSKEAFLAALRADLARLPGMQINIGQPISHRIDHMLSGTRANI
                     AVKIFGPDLYELRRLGQQVKAVMAGVPGVVDLAVQQQTDIPFLTIRFKRQAIARHGLR
                     VQEVAEAVKGAFYGQPVSKILEGRANFDLVVRYDPRVKADLEAVRATLMTTGSGAHLP
                     LHALAEIRKDRSPNFISREDVQRKMVVMANVAGRDLVSAVEEIQQGVRQSLSLPAGYH
                     VEYGGQFKSAKAAFRTLSIVSVLVILGIFLLLFMAFNSARDAFLVMLNLPLALIGGVV
                     GVYFSGGILSVASIIGFITLFGIATRNGVMMIAHIHHLVERERVRDPMTAVIRGAKER
                     LIPILMTALATALALIPLALGAGEPGSEIQAPMAMVILFGLLTSTALNMMVVPALYLR
                     FGVASQKLRHP"
     gene            complement(325142..325546)
                     /locus_tag="Noc_0295"
     CDS             complement(325142..325546)
                     /locus_tag="Noc_0295"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Stringent starvation protein B"
                     /protein_id="ABA56824.1"
                     /db_xref="InterPro:IPR007481"
                     /translation="MADNSNHPMTSNRPYLIRALYQWIIDNDLTPHLLVDTTLSGVQI
                     PQQHASEGKIILNIHPNSVRDLCLENDWISFSARFSGTSYKALFPVQAALAIYARENG
                     QGMIFQKGDHDGDPPPPAPDEGGRKPSLRVVK"
     gene            complement(325563..326207)
                     /locus_tag="Noc_0296"
     CDS             complement(325563..326207)
                     /locus_tag="Noc_0296"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutathione S-transferase-like protein"
                     /protein_id="ABA56825.1"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR005442"
                     /db_xref="InterPro:IPR011767"
                     /translation="MPLSPGKRSVTALFSDPLCPFCHRTRIVVAEKNISAEIIDIDPA
                     NLPEDLVRLNPHNSAPTLVARDLILYDSKVIMEYFDERFPHPPLMPVDPISRARIRLM
                     FYRIDQDWYRLLGGTKTHRSNISSKTRKMLIEDLTILSPTFEKTPFFMNEEFSLLDCA
                     LAPLLWRLLALEAELPPQAKLVEDYANRMFARDSFQQSLSAAERAMRTKATSPI"
     gene            complement(326375..327097)
                     /locus_tag="Noc_0297"
     CDS             complement(326375..327097)
                     /locus_tag="Noc_0297"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytochrome c1"
                     /protein_id="ABA56826.1"
                     /db_xref="InterPro:IPR002326"
                     /translation="MKRMTTCLLLFISSTSLVWAASSNYPLDTVEININDKASLQRGA
                     QVFMNYCLSCHSAKYMRYSRMAQDLGLTEQEVTDNLMFTTDKIHDPMTIAMQSKDSEG
                     WFGVTPPDLSLVARSRGPEWLHTYLRTFYLDPSRPTGVNNLVFKDTAMPHVLWPLQGW
                     QELADKDSDTSSTKLELAVAGTLSPSEYEKMLDDLVNFMTYMGEPARLEREKLGPWVL
                     FYIALFCGVAYFLKREYWKDIH"
     sig_peptide     complement(327035..327097)
                     /locus_tag="Noc_0297"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.999 at
                     residue 21"
     gene            complement(327094..328320)
                     /locus_tag="Noc_0298"
     CDS             complement(327094..328320)
                     /locus_tag="Noc_0298"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytochrome b/b6-like protein"
                     /protein_id="ABA56827.1"
                     /db_xref="InterPro:IPR005797"
                     /db_xref="InterPro:IPR005798"
                     /translation="MKNTINQIFTWIDARLPISQPWKEHLSEYYAPKNFNVWYFFGSL
                     AMLVLVIQLVTGLFLTMHYKPAADLAFGSVEYIMRDVEWGWLIRYMHSTGASAFFILI
                     YLHMFRGVIYGSHKKPRELVWIIGVLIYLTLIAEAFMGYLLPWGQMSYWGAQVTISLF
                     GAFPLIGEGLSEWIRGDFVVSDATLNRFFAFHVFLMPLLLLALVVAHIIALHQTGSNN
                     PDGVEIKEKKDPKGVPLDGIPFHPYYTVKDLWGVGVFLLLFAWVVFYAPGFGGWFLEH
                     DNFTPANPLATPEHIRPLWYLTPFYSILRSVPDKLLGVLAMDAAIFLWFFLPWLDRSP
                     VKSIRYRGWLYKAAIGIFVISFLGLGYLGTQPATPLMTMFARVFSILYFAFFLLMPIY
                     TKMDKTKPVPERVTSK"
     gene            complement(328320..328925)
                     /locus_tag="Noc_0299"
     CDS             complement(328320..328925)
                     /locus_tag="Noc_0299"
                     /EC_number="1.10.2.2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Ubiquinol-cytochrome c reductase, iron-sulfur
                     subunit"
                     /protein_id="ABA56828.1"
                     /db_xref="InterPro:IPR005805"
                     /db_xref="InterPro:IPR005806"
                     /db_xref="InterPro:IPR006317"
                     /translation="MSTDSVDQGKRRFLTAATTVVGGVGMGFTAVPFVKSMQPSERAQ
                     AAGAPVEVDISNLEPGHIMTVEWRGKPVWILRRTQEELESVEAMTGEDILRDPHSEVE
                     EQQPPFAQNVYRSIEPEILVVVGICTHLGCSPTFRPEVAPEDLGPDWQGGFFCPCHGS
                     RFDLSGRVYDGVPAPTNLEVPPYRFLAENRLRIGESPSEAT"
     gene            complement(329169..329558)
                     /locus_tag="Noc_0300"
                     /pseudo
     gene            329728..330054
                     /locus_tag="Noc_0301"
     CDS             329728..330054
                     /locus_tag="Noc_0301"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56829.1"
                     /translation="MPIYEYRCEACGHKMELLQKIAEEPLLQCPSCGKEQLRKLVSAV
                     GFRLKGGGWYETDFKSGNKRNLAASNDASKESSNNKEGPGKAKDKQEKTPGANSKPTG
                     DAAATG"
     gene            330232..332019
                     /locus_tag="Noc_0302"
     CDS             330232..332019
                     /locus_tag="Noc_0302"
                     /EC_number="6.1.1.12"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl-tRNA synthetase"
                     /protein_id="ABA56830.1"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR004115"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004524"
                     /db_xref="InterPro:IPR006195"
                     /translation="MRSHYCGELSEAHLDQSVTLCGWVNRRRDHGGVIFIDLRDREGL
                     IQLVFDPEYSPESFRHAEQIRSEYVLQVKGRVQHRPEGTENPDLKTGQVEVLGQELIL
                     LNASETPPFPVDEKLEVGEDIRLRYRYIDLRRPESLQRLRFRSAIIRQLRKFLDERGF
                     LDIDTPILTQSTPEGARDFLVPSRTHPGQFFALPQSPQLFKQLLMVAGVDRYYQVVRC
                     FRDEDLRADRQPEFTQLDIEASFLHEETLMALMEEMFKELFATVLEVPLHTPFVRMPY
                     AEALACFGLDKPDLRIPLRLVEVGDLMKTVDFKVFAQPAQDRDGRVAALRLPGGGKLS
                     RKEIEEYTQFVAIYGAKGLAYIKVVERSRGREGLQSPILKFLPDEVIGAMLERTEAEN
                     GDIVFFGADKASIVNESLGALRVKLGHDHGLVEHGWSPLWVIDFPMFEWDEDDHRWHA
                     LHHPFTSPKEEDLSLLEQNPGACRSRAYDLVLNGTEVGGGSIRISQSQVQSQVFRLLG
                     IGDEEAQDKFGFLLDALKYGCPPHGGIAFGLDRLVMLMTGSASIREVIPFPKTQTAAC
                     PLTGAPGQVAEAQLRELGIGVRRLASDKV"
     gene            332177..333274
                     /locus_tag="Noc_0303"
     CDS             332177..333274
                     /locus_tag="Noc_0303"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="quinolinate synthetase A"
                     /protein_id="ABA56831.1"
                     /db_xref="InterPro:IPR003473"
                     /translation="MAEAAVIQSYIDLRDSECEARVAKAKAALGAQVVILGHHYQREE
                     VFRFTDYAGDSLKLSRQAAVSEAKYIVFCGVHFMAEVADILSRPEQIAILPDMAAGCA
                     MADMADLAKVERAWRELGQILEPEEKVTPVTYINSAANLKAFCGRHGGIVCTSSNAEA
                     VLNWAFERREKVLFFPDQHLGRNTAYRMGIPLEKMAVWNFNRPNGGLTQEQIQEARII
                     LWQGFCSVHQMFQPEHIDRFLARYPDAKVISHPENSFEVCQKSHYVGSTEYIIKTIRE
                     AESGTRWLVGTELNLVNRLHERYKNEGKSIHFMSPTVCMCSTMFRIDPQHLAWSLENL
                     LSGQVVNQIKVPEDEAELARLALSRMLEVSP"
     gene            333329..333547
                     /locus_tag="Noc_0304"
     CDS             333329..333547
                     /locus_tag="Noc_0304"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56832.1"
                     /translation="MVVSKTAAPSAASSIPANEARRYEVTRADLPLSCPMPSMALWNS
                     HPRVYLPIEETGWERCPYCGAVYVLKEE"
     gene            complement(333623..333823)
                     /locus_tag="Noc_0305"
     CDS             complement(333623..333823)
                     /locus_tag="Noc_0305"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56833.1"
                     /translation="MSRLLIILGLILVVVGVLWPWLAKLGLGRLPGDIVIERENFRFY
                     FPITTSILISLLLSLLFWLFRR"
     gene            333869..334834
                     /locus_tag="Noc_0306"
     CDS             333869..334834
                     /locus_tag="Noc_0306"
                     /EC_number="3.6.1.-"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="8-oxo-dGTPase"
                     /protein_id="ABA56834.1"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR003561"
                     /db_xref="InterPro:IPR003733"
                     /translation="MVLQVAAGAIFNRQGQVLLSKRPLHVHQGNLWEFPGGKLKPGEE
                     VRQALSRELWEELGIQVLQARPLLQVHHDYPDRSVLLHVWRVDRFSGTPKGQEGQPVV
                     WVSPENLNAYPLPAANHAVVTAVCLPPTYLITKEPAGNQMAFLSSLRQSLQAGVQLVQ
                     LRAKKLSPEHYQNLTWKVQRLCFEYKAILLVNTVPAQAAEWGADGVHLTGNHLMHLSH
                     RPLPANKWVAASCHNAAQLAHAANIGVDFAVLGPVFHTSTHPQALPLGWERFQTLIAQ
                     IPFPVYALGGVGPEHLKEAWSRGAQGIAAIRALWGDRAGSFGVSP"
     gene            334831..335142
                     /locus_tag="Noc_0307"
     CDS             334831..335142
                     /locus_tag="Noc_0307"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56835.1"
                     /translation="MTDVDFVPTKPHQPGEFSLQGVFWAGHDLARKALGWVSPSTRII
                     SPPTEGRSRSWQQGKYTANCWRNASHAGPRARSKVSLRLSACGHARAGTLTGGSFNIH
                     V"
     gene            complement(335156..335344)
                     /locus_tag="Noc_0308"
     CDS             complement(335156..335344)
                     /locus_tag="Noc_0308"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF329"
                     /protein_id="ABA56836.1"
                     /db_xref="InterPro:IPR005584"
                     /translation="MNKDKKRHVNCPTCGQEALWSEENPWRPFCSERCRLIDLSDWAT
                     ESHRIPGEEEHPIPSSEE"
     gene            complement(335350..336000)
                     /locus_tag="Noc_0309"
     CDS             complement(335350..336000)
                     /locus_tag="Noc_0309"
                     /EC_number="2.7.1.24"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="dephospho-CoA kinase"
                     /protein_id="ABA56837.1"
                     /db_xref="InterPro:IPR001977"
                     /translation="MDKVKFSPYETPGKMSYKVGLTGGIGSGKSTVAKIFSELGVPVI
                     DADIIARELVKPGQPALAEIVTTFGREILNAQGGLDRSRLRHLVFTSEALKTRLEAIL
                     HPRILQEMKRRATRLSAPYCVLVIPLLVEIAQKDIVDRTLVIDIPDAIQRQRVKARDQ
                     LSDTEIEAILRAQSPRAVRLAAADDIIVNDTDLATLQRQVEHYHQKYLFLASQQRN"
     gene            complement(336009..336875)
                     /locus_tag="Noc_0310"
     CDS             complement(336009..336875)
                     /locus_tag="Noc_0310"
                     /EC_number="3.4.23.43"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="type 4 prepilin peptidase 1, Aspartic peptidase,
                     MEROPS family A24A"
                     /protein_id="ABA56838.1"
                     /db_xref="InterPro:IPR000045"
                     /db_xref="InterPro:IPR010627"
                     /translation="MEAIVFFESHPAAFMASAFLLGLTVGSFLNVVIYRLPLMMERQW
                     EEQCAELHGKPQPEREPLTLSLPRSHCPACRRTIRAQENIPLFSYLLLRGRCRHCKAP
                     ISLRYPLVELLTGILSIAVAWRFGVSWETMAALLLSYALITLTFIDFDHQLLPDNITL
                     PFLWFGLGLGLFEVFTDARTSLIGAITGYLSLWLVYHLFRLLTKKEGMGYGDFKLLAL
                     LGAWLGWTMLPAIILLSSIVGALLGTAWLYLSSQHRETPIPFGPYLAAAGWLALMWGQ
                     DINQFYLSLTGR"
     gene            complement(336895..338115)
                     /locus_tag="Noc_0311"
     CDS             complement(336895..338115)
                     /locus_tag="Noc_0311"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein F"
                     /protein_id="ABA56839.1"
                     /db_xref="InterPro:IPR001992"
                     /db_xref="InterPro:IPR003004"
                     /translation="MAQAAAKQQIFIWEGANRQGHKIKGEVGGKNLSMVKADLRRQGI
                     VPLKVRKKPKSLLGQRKKKITPKEIAIFSRQLATMMAAGVPLVQAFEIIGRGHESISM
                     QEMVLKIKGEVEGGGTLAEALKQHPRQFDPLFCNLVHAGEQSGTLETLLDKIAMYKEK
                     TEAIKGKIKKALFYPTAVVVVAFIITAILLIFVIPQFEALFQNFGADLPALTLLVLKL
                     SALFQEWWWAIFGAMGGAIYGLMEAKRRSQKINHLFDRLLLKLPVIGEILNKATIARY
                     ARTLSTMFAAGVPLVEAMVSVAGAAGNSVYTQAILRIRDEVSTGTQLQAAMRSSQLFP
                     NMVVQMVAIGEEAGSIDQMLSKVADFYEEEVDNAVDALSSLLEPLIMAILGVLVGGLV
                     IAMYLPIFKMGSVV"
     gene            complement(338120..339835)
                     /locus_tag="Noc_0312"
     CDS             complement(338120..339835)
                     /locus_tag="Noc_0312"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein E"
                     /protein_id="ABA56840.1"
                     /db_xref="InterPro:IPR001482"
                     /db_xref="InterPro:IPR007831"
                     /translation="MATPGVQIIMSGLVRRLVEDGLLSEANARQAQEHSRKNGTPLVT
                     YLVRQKLLKSLDIGQAASQEFGVPLFDINALDLDYLPKGLVEEKLVRQHQALPLFKRG
                     NRLFVAVADPTNLQALDEIKFHTGINTEAILVEEDKLARMIDRAMEAQDTSLAELNDT
                     ALDDLDISGGENEPPENTAESEADDTPVVRFINKVLLDAIHQGASDIHFEPYEKIYRV
                     RYRQDGVLREVATPPVTLAGRLAARLKVMARLDISERRVPQDGRMKMNISKNRAIDFR
                     VNSCPTLFGEKIVLRILDPSSAQMGIEALGYEERQQQIFLETIHRPYGMVLVTGPTGS
                     GKTVSLYTALNILNTADRNISTAEDPAEINLPGINQVNVYPKVGLTFAGALKAFLRQD
                     PDVIMVGEIRDLETAEIAIKAAQTGHMVLSTLHTNDAPQTLTRLLNMGVASYNIASAV
                     SLIIAQRLARRLCSRCKAPEKISHEVLLEEGFTKTQLETTPTLYKAAGCEHCTKGYKG
                     RVGIYQVMPVSEEMGRIIMAGGNSMELAEQSKKEGVADLRQSGLKKIIDGVTSIEEIN
                     RVTKE"
     gene            339953..340195
                     /locus_tag="Noc_0313"
     CDS             339953..340195
                     /locus_tag="Noc_0313"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56841.1"
                     /translation="MRRMEPAGEKIIARKPLQWGFKTFRREQSAARLEIIGADGVIAY
                     RVISDGMRPERPALLTKRKWDDAKGKLNDGIFSLPL"
     gene            340167..341420
                     /locus_tag="Noc_0314"
     CDS             340167..341420
                     /locus_tag="Noc_0314"
                     /EC_number="4.1.1.20"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate decarboxylase"
                     /protein_id="ABA56842.1"
                     /db_xref="InterPro:IPR000183"
                     /db_xref="InterPro:IPR002986"
                     /translation="MMEYFHYRYNVLWAEEIPLPEIASRFDTPCYVYSRAAIEHQWRA
                     FDQAFEKHPHQICYAVKANSNLAVLNILARLGSGFDIVSVGELERVLAAGGDPGRIVF
                     SGVGKRADEMERALAVGIACFNVESEAELIRLNEIAGKLEQRAPVSLRVNPDVDARTH
                     PYIATGLRDNKFGIEIDQALAVYARAATLPHIDILGVDCHIGSQLTSLSPFLAALERV
                     LALVDQLAERGIKIRHIDLGGGLGIIYRDEAPPSPQQYAAALRQKLAGRNLEIWIEPG
                     RAIVGNGGVLLTRIEYLKQAPQKNFAIVDAAMNDLLRPALYDAWQEIIPVAVDATGEP
                     LFFDVVGPVCETGDFLGKRRQLAIEAGDLLVVRAAGAYGFTMSSNYNSRPRAAEIMVD
                     GAEAHLVRERETVESLYRGEATLPG"
     gene            341471..342142
                     /locus_tag="Noc_0315"
     CDS             341471..342142
                     /locus_tag="Noc_0315"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56843.1"
                     /db_xref="InterPro:IPR000051"
                     /translation="MERIPEPELMDDETQARAYAEADFSEPNSRFIELLRGAFPSDAL
                     SGYVLDLGCGPGDITLRVARAWPSCIVHGVDGAAAMLHYGQRAVSEAGLKARVKFVHG
                     RLPAVRLPREQYDVLISNSLLHHLLEPAILWDCLKRYGVRGAPVFIMDLRRPAARSEA
                     AALVDQYAAEEPEILQRDFFNSLLAAFKPDELQEQLAQAGLNSLEVAVVSDRHLAISG
                     FLTLS"
     gene            342181..343011
                     /locus_tag="Noc_0316"
     CDS             342181..343011
                     /locus_tag="Noc_0316"
                     /EC_number="5.1.1.7"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate epimerase"
                     /protein_id="ABA56844.1"
                     /db_xref="InterPro:IPR001653"
                     /translation="MRIAFTKMQGLGNDFVVIDALSQPLSLTASQVRWIANRRLGIGC
                     DQVLLVTPASLPAIDFGYRIFNADGGEVEQCGNGARCFARFVREQGLTDKNVLRVQTA
                     SGIIELQLETDGQITVDMGVPRFAPHQIPFKVDQEADYYSLELDGQQVEIGAVSMGNP
                     HCVLRVPAVDTAPVAHWGPLLESHPRFPQRVNVGFAQIVSPGHLRLRVYERGAGETPA
                     CGTGACAAAVIGKRRGWLSGQVNVDLPGGRLGIHWEGDGKSVWMSGPAEIVFKGSIEL
                     "
     gene            343008..343742
                     /locus_tag="Noc_0317"
     CDS             343008..343742
                     /locus_tag="Noc_0317"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF484"
                     /protein_id="ABA56845.1"
                     /db_xref="InterPro:IPR007435"
                     /translation="MRKKAGEKETRKTPLEEVQEREQSIAKYLQTHPDFFARHPDLLS
                     ELTIPHPSGAAISLVERQLALLRGQNRELKRQLRDLIENAMVNDDLSKKVHKLALGVL
                     TAATPQAAIEVLFSSLQTGFDVDVIALRLFFDGKSLPPPAPDHLNVMRVSRNAPELEV
                     FASVLKSPQPICGRLTVEQRDYLFGEEAERAVSCALIPLGEEQRRGMLAMGSQEPNRF
                     RADLGTIFLDYLGVIVERALHRHWPY"
     gene            343746..344648
                     /locus_tag="Noc_0318"
     CDS             343746..344648
                     /locus_tag="Noc_0318"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine recombinase XerC subunit"
                     /protein_id="ABA56846.1"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR004107"
                     /db_xref="InterPro:IPR011931"
                     /translation="MEEEQQIWIQKFFTHLQYERGLSPQTVVSYRRDLAKAIAFCGRN
                     GIGNWQELDAQRVRALVVAHHQAGLSGRSIQRLLSALRSFYVYLQRENIVDHNPAQGI
                     SAPKGKRALPPSLDVDQTAQLLNTQPCSDLLLRDQAILELFYSSGLRLAELVGLNLSA
                     LDLDTALVRVVGKGAKTREVPLGRRAKVALLAWLPVRAGWINQSQEAVFITRHGRRLS
                     PRAVQKRLRLWGLRQGFDVAIHPHRLRHAFASHLLESSGDLRAVQELLGHADISTTQI
                     YTHLDFQHLAKIYDQTHPRARKKR"
     gene            344789..346774
                     /locus_tag="Noc_0319"
     CDS             344789..346774
                     /locus_tag="Noc_0319"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver modulated
                     diguanylate cyclase"
                     /protein_id="ABA56847.1"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001789"
                     /translation="MSFATRFDELKAMGDLPSPSGVALEIMRLTQREETSIQDLARVI
                     QADPALAGRLLKFANSASVGVRRPVVAIEDAVKLLGIAAIRQFVLGISVLSNYSHGRC
                     EGFNYPGFWSHSLATALAAQALASLERVIAPEEAFTCGLLACVGQLGLATIYPDGYTA
                     ILLSCSREDEQALLAREQEEFATNHREMTMALLEDWGLPPIHLEGIAASYQPGPGGLE
                     DASRVQRIARQLYFSGHIAKFCVAQAAEQSNRLVNLEELASCFALDKTGLEQLLKKIT
                     QAWTKWGRLLAVPTQEVPSLANLKEELQGKMERQISAPEASDFTPLRILLVSDDELNC
                     KRFTGWLESMGHSVNVAREEKEGLSLILENRCQLVIYEHRLPGANSMKFCRSLREMKC
                     GRQIYLIVLTGMVSGGEAIRIFEAGADDHIAKPFNYEVLQARVGGGERLIRLREEAEQ
                     EREAVRGYLADLAVANRRLGQMAMTDSLTGLPNRRYAMERMEQAWAEYERNQTPFSCL
                     VMDLDFFKRVNDQYGHEIGDSVLLEIANVFRGSARSSDIICRLGGEEFLVVCPHTVAT
                     EAFQVAERLRRAVEEHSWTMLDSTSVLSVSIGLAASSEGMQHWNDLYRLADQALYQAK
                     RNGRNRVCMAPSPNGKDQTVSLVYPARVHENNPRFIF"
     gene            347161..347427
                     /locus_tag="Noc_0320"
     CDS             347161..347427
                     /locus_tag="Noc_0320"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56848.1"
                     /translation="MKQSFLPLGFSFSLRNPLFIASVMLPFAAWRGEVEAAEEYRDRL
                     IPKTDSNPVVKVAQGDGAKEGGEAARSELAPMTVTGAADAPFTK"
     sig_peptide     347161..347271
                     /locus_tag="Noc_0320"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.668) with cleavage site probability 0.599 at
                     residue 37"
     gene            347424..349301
                     /locus_tag="Noc_0321"
     CDS             347424..349301
                     /locus_tag="Noc_0321"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrichrome iron receptor"
                     /protein_id="ABA56849.1"
                     /translation="MNTSTAGSKFPLEIDRVPQSIQVITEDAFQDQGAQSIGDIMKQM
                     PSANVFGLRFGRFPSVTIRGFGTEQIRNGIQQLFFAGTDFSALSYIQNVEVLKGPGSV
                     LFGQGGNGGGIINVVTKRPYDRLGAEVSFTRGGWTGFGGDITRGQWDINALLTPDGAL
                     KARFTGQVERSDTFINFQDLDRENFGLALTYDNGGPVRAFINAEYQHRETLPNPGLPA
                     VGTVQGSDVGQVLRNTFLGEPKFDKLTVDAPLVQAWVEFDVLDNWNNIFKNWKVIPRY
                     QYQQFNGSQDQVFLGATTVDPVNGDILVSRSGRTDFNEKDVIHIGQIDITGMIDTGPL
                     THQILLSGDYQNKRSPSDGNDNNKWFNRINVPAIDALNPAYLSSAPQINPNIVTFGQN
                     YQVWAATFQDVVSITPYFDLMGGFRYTTASGGPRGNLVNRVRPGNNEVDNTSFQIGGT
                     FHVTDSIHLFSGYGEGFNLNLAGQKADGSAFAPGEFDQVEAGIKADFPWGLRGTTSFF
                     DITRSNVTTPDRQNPGFSVQTGEVRHRGAELELAYQVTPQWYFQGGYAFIDSDITQSN
                     AGDEGNRFQNTPTHQGNVWTHYQFDRGLLRNLTLSSGVNFVGDRPLDNATTVELTNFT
                     I"
     gene            349655..350881
                     /locus_tag="Noc_0322"
     CDS             349655..350881
                     /locus_tag="Noc_0322"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="PepSY-associated TM helix"
                     /protein_id="ABA56850.1"
                     /db_xref="InterPro:IPR005625"
                     /translation="MANLLKVTTSRFRWHSLWRKVHLYLALTVGFFFVLLGLTGSVNV
                     FHWELEELSLPALETRESPKAGLPLNAVMANLHQAHPQRQGRWLLFMPGYEREYVWAI
                     YPHPEETRDVFFAPLRVQLDPGSGKLVAEHFWGETLGTLIYSLHASLLTGIIWDRDMG
                     LIGFQTVTFLGLFLLISAAIGLYLWWPRTGTFLKAMRFQRQGRVTRTHFELHRLVGFY
                     GSVILLVLAFTGFSFGYYDYLKPLVAAFSPVEAKHFKDPEGLKSTPVPGTQPITIEQA
                     VAIANQVFPNAELRWLATPEGPEGVYAIEKRQPGEANQRRPRSKVWVEQYSGEVLAVE
                     DPNKFTAGETFFNLMWPLHNGQAFGFPGRLLWCLVGFVPLTLYITGLTLWLRKRRVRR
                     LARHKGMAATVGGLWL"
     gene            351061..353037
                     /locus_tag="Noc_0323"
                     /pseudo
     gene            353034..353369
                     /locus_tag="Noc_0324"
     CDS             353034..353369
                     /locus_tag="Noc_0324"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="ABA56851.1"
                     /db_xref="InterPro:IPR002622"
                     /translation="MMRCSIDLRKRVIDFVRGGGSKAEAARRFQVGRASIYRWLSQDD
                     ALCYERPGPRRSHKLDWEALRVHVEDKAALTYKERARHFGVSYYCIWHAMHKMGLTRK
                     KNDGVHAAL"
     gene            353344..353868
                     /locus_tag="Noc_0325"
     CDS             353344..353868
                     /locus_tag="Noc_0325"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase of IS630 family insertion
                     sequence ISY100h"
                     /protein_id="ABA56852.1"
                     /translation="MTGYTQRCNMKRKSFLRLRERYRRRGKRFVYLDESGFEPEVSRR
                     YAYAPKGRRVYGLISGHRRPRTSLLAARMDEGFEAPFLFEGTCNTAVFNAWLEKELCP
                     LLNSNHIVIMDNAPFHKAVSSREIIKKTGAGILFLPPYSPDFNPIEKDFGNIKKIREY
                     NEHETLENIVAAYQ"
     gene            353831..354148
                     /locus_tag="Noc_0326"
                     /pseudo
     gene            354684..355184
                     /locus_tag="Noc_0327"
     CDS             354684..355184
                     /locus_tag="Noc_0327"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="possible signal peptide protein"
                     /protein_id="ABA56853.1"
                     /db_xref="InterPro:IPR006663"
                     /translation="MTYLFHGVLKRAIWLLVLGIGAVAVAGIGTAPLPFESGSLEKIL
                     DSRAGKPFLLVMWSLECPPCRKEMDLLAEMRRQHPKLDVVLVSTDEMERADQVTAAVK
                     GHGLEKTESWLFAGPAQRLRYEIDPGWYGEMPRSYFYDANHKRAAVSGALEEAQIQAW
                     LEHVYP"
     gene            355197..356396
                     /locus_tag="Noc_0328"
     CDS             355197..356396
                     /locus_tag="Noc_0328"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="BNR repeat protein"
                     /protein_id="ABA56854.1"
                     /translation="MKKFLRSHLCAMVLLWLIGYGGTMASASEMLVPEIETPTPVGSR
                     QHQLNQTAQGQLLLSWVEKGEQGSHLRFAVLEAEGWSAPQTVVTVRGKLAAAPVVLGL
                     KDGGALAAAWMSSTEQKDNPFGAELYLSRSTDGGESWSKPLQPYSGEARIYDAQMSLA
                     SLDDGRLALVWTDQRHKPERYQLMATLIDGQGKPGSEMILDKDVCSCCNTRTIAQGDT
                     LWTAYRDRLEGEVRDIALVRWSSEGPSQANIVHDDQWVIEGCPSNGPAVARRDGLTMV
                     SWFTAADGVGRVRTAFWPEGENHFAKPIEVDAHANGYVNALLLEDGSALVVWRGRVGP
                     TEELRLAQVKQDGTVQNQIALYRGDFPRWPSRHLSLAQVGDSVYVAWLDLEQARIRLV
                     KRPMPAE"
     sig_peptide     355197..355280
                     /locus_tag="Noc_0328"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.868 at
                     residue 28"
     gene            356557..357426
                     /locus_tag="Noc_0329"
     CDS             356557..357426
                     /locus_tag="Noc_0329"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="possible putative HlyD family secretion protein"
                     /protein_id="ABA56855.1"
                     /translation="MAVEPRSVRLKIRSQGTVRACTDMKLTAQVEGKVVKMAPGFKEG
                     KFFREGDVLIQIEPRDYDLAVIKAQARVAAAQGELLREEAKADLARKDWESIGKGEPS
                     PLMLRIPELKEARARLQAAKAALEEARLRRERTELQAPFNGRVQERWVEVGEYVEEGT
                     HLARLFAVDRAEARLPLTPAELAFLDLPLAPRQNLGEKGPKVMLQASLAGKRHSWEGR
                     IVRTEGVIDEKTRMLYAVAEVRDPYGDLGLSPGALLLVGLFVEAEIEGRTLDHAHLLP
                     RQALRQPSTGGQW"
     gene            complement(357766..358158)
                     /locus_tag="Noc_0330"
     CDS             complement(357766..358158)
                     /locus_tag="Noc_0330"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56856.1"
                     /translation="MKQPKSMGTLKRSDETTPLRVLSKTIEATHFNRVRLALRRLGRP
                     LRVELPAHRGLEVVLDNQMWLCVDGLHKDLPILAWRSFDTAERYGLHEPVDCELCLYH
                     SHAGLIMGSALEQLSEALAQRLAEEAEA"
     gene            complement(358161..359123)
                     /locus_tag="Noc_0331"
     CDS             complement(358161..359123)
                     /locus_tag="Noc_0331"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="AAA ATPase"
                     /protein_id="ABA56857.1"
                     /db_xref="InterPro:IPR000470"
                     /db_xref="InterPro:IPR000641"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /translation="MESDIMNNPENTSVPTRSAHRVDDASVDLEAEFKASNIQEVLDK
                     LDRELIGLKPIKTRIREIAALLLVDRLRRQFELTSETPTLHMNFTGNPGTGKTTVALR
                     MGEILKRLGYVREGHLVTVTRDDLVGQYIGHTAPKTKEVIKKAMGGVLFIDEAYYLYK
                     PENERDYGQESIEILLQVMENNRDDLVVVLAGYKDKMDRFFQSNPGMRSRIAHHLDFP
                     DYSPEELMAIAKLMLADQNYRLSAEAEKALAEYIPVRMKLAHFANARSIRNALDRARL
                     RQANRLFASRSKTLNKLDLITIEDEDIRASQVFQEGKPDGADDD"
     gene            complement(359185..359622)
                     /locus_tag="Noc_0332"
     CDS             complement(359185..359622)
                     /locus_tag="Noc_0332"
                     /EC_number="4.1.1.39"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose 1,5-bisphosphate carboxylase small
                     subunit"
                     /protein_id="ABA56858.1"
                     /db_xref="InterPro:IPR000894"
                     /db_xref="InterPro:IPR002160"
                     /translation="MMTNHGNRITQGQFSFLPDLTDEQILAQIKYALKNDWAVNVEYT
                     DDPHPRNTYWEMFGIPMFDLKDPAGIMMEINDCRKTYPNHYVRVTAFNSHRGVESPCM
                     SFIVNRPKNEPGFGLVRQEVDGRHINYTVRSYAADRPEGERYQ"
     gene            complement(359642..361120)
                     /locus_tag="Noc_0333"
     CDS             complement(359642..361120)
                     /locus_tag="Noc_0333"
                     /EC_number="4.1.1.39"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
                     large subunit"
                     /protein_id="ABA56859.1"
                     /db_xref="InterPro:IPR000685"
                     /translation="MGKSETIAEGKDRYQAGVIPYKKMGYWEPDYQPKDTDIIAMFRI
                     TPQPGVDPEEAAAAVAGESSTATWTVVWTDRLTDCELYRAKAYRADLVPNTGEGTKNE
                     AQYFAYIAYDLDLFEPGSIANLTASIIGNVFGFKAVKALRLEDMRIPVAYLKTFQGPA
                     TGVVVERERLDKFGRPLLGATTKPKLGLSGRNYGRVVYEALKGGLDFVKDDENINSQP
                     FMHWRDRFLYCMEAVNKASAATGEVKGHYLNVTAATMEDMYERAEFAKSLGSVIIMID
                     LVVGYTAIQSMAKWARKNDMILHLHRAGNSTYSRQKNHGMNFRVICKWMRMAGVDHIH
                     AGTVVGKLEGDPLMIKGFYDTLLDSHTPTSLEHGLFFDQDWASLNKVMPVASGGIHAG
                     QMHQLIQYLGEDVILQFGGGTIGHPQGIQAGAVANRVALEAMILARNEGRDYVKEGPQ
                     ILQDAAKWCSPLKAALDTWKDVTFNYESTDTADFVPTATASV"
     gene            361375..362280
                     /locus_tag="Noc_0334"
     CDS             361375..362280
                     /locus_tag="Noc_0334"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="ABA56860.1"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /translation="MHVTLRQLHVFEAVARHLSYTRAAEELHLSQPAVSMQIKQLEGN
                     VGLALFEQLGKKIFLTEAGRELYHYSQQISRELSEAEDVLEELKGSRRGTLTIAVAST
                     ATYFALHLLGRFHQRFPEANISLDVTNRKSLLRHLEENTIDMAIMGKPPEGLEVVAKP
                     FMENPLVVIAPPAHPLAGQRVPLTVLRQETFILREHGSGTRIAMERFFARLGATITSS
                     MEISSNEAIKQAVQAGFGLGIVSQHTLEKELALRRLVILEVDSFPIMRHWYIVYRKNK
                     RATALHKAFKKLVFEEAREQSITFN"
     gene            362415..365354
                     /locus_tag="Noc_0335"
     CDS             362415..365354
                     /locus_tag="Noc_0335"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase/phosphodiesterase"
                     /protein_id="ABA56861.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001633"
                     /translation="MFKSVAFSAKNILMPDPEQTPAPRFLSLKWKAVLVFSLVLVTIN
                     ISLAGLAYLGLQRQFAQQREQIYLGHIKEIRGLIKTSYQRMEQLADIVPLLRGDRADK
                     NSLAGKIDSIFERHGHLLQIVWGVEIASFYSSENKLLVSWGQQVGTDRILEWVRAANK
                     RERPITGLDCGERCLQYVAVPLLANDERAGVLLLGRSLAEVVLSFRQISGDDIGIMTA
                     VKLPSENATELRRLMPEWGMRMAALTNAERNLLVLRSLSEGHSLAEVASQHVWYHHAG
                     REYEVRLIPINKAGVENREAQLVVISDVTRALADIRLATRRSLLGGLVGLVVSETLLL
                     LLLWKPMARLQRVVLSLPYLAEHAFEKVRARLSHSAQPAWGRDEIDVLNDTAVTLSYQ
                     LEALQAEIQDRTRHLAERGDDLARERDFVTGLLNTAQVIILTQDSAGRVTMLNRQGQK
                     ITGYGADQITGRPFYELLAGDKVSPELFQQLEELRTGRRGQVRVDTGLQCQNGSQRTI
                     SWFHSRLAVHPSSDVVVLSVGHDVTEREQAEQRLAWLADHDPLTELFNRRRFQHEFEQ
                     ILGASIRYGTQGGLLYFDLDQFKYINDTSGHQAGDALLRMVADKLRQVVRGSDIVARL
                     GGDEFAVVIRECDVESAVRVARKVCTQLSTLEFPARGGNHSISLSIGIALFPLHGATV
                     RDLMANADVAMYQAKEEGRGRWHLFSSDEQVRERMQQRVYWKEQIEQALREDRFLLYF
                     QPVLDIRTHTIGHYEVLLRMYDHRGRIISPAQFIPVAEQSGLIHAIDHLVLRKAIAQQ
                     AKLWSQGYHLTLSINLSGRVVDDPELVPILEDLLRTTGVNPSSLMFEVTETAAVADLA
                     AAEGFMHRIKAHGCRFAVDDFGVGFSSFFYLKRLPVDYVKIDGMFVRELAKSHQDQVF
                     VKALSEVAKGLGKKAVAEFVEDAEALALLHEYGVDYAQGHYIGRPTPHIVETPCAEGK
                     VAWSHAQ"
     gene            complement(365383..367134)
                     /locus_tag="Noc_0336"
     CDS             complement(365383..367134)
                     /locus_tag="Noc_0336"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutL"
                     /protein_id="ABA56862.1"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /translation="MAAPSIPRIQILPPALANQIAAGEVVERPASVLKELVENALDAG
                     AQRIEIETEAGGIGLIRVRDDGCGIHHNDLPLALSSHATSKVRHGEELLNITTLGFRG
                     EALASIDAVSRLSLSSRMADNEHGWCIRENTPVQPIAHPLGTTVEVRDLFYNTPARRR
                     FLRGEKTEFIRLRTIQTQLALSHFEISFRISYNRRPFLTLPACTCPPEQLKRITELCG
                     RNFAEHSMYFKREIEGLCLWGWLGHPEFARSQTDLQYCYVNHRMVRDKLLSHAARQAY
                     GNRLSQGRHPAYLLYLELPTHQVDVNAHPAKHEVRFRESRQVHGFIVRTLAEILEQTE
                     PEGEHRLASGEFRSHPHEVLGKEQAGDTYLVAEVPGSYGPRKHGKHNPLSKGRNDAPS
                     RFGQVQAFVLGRYLLTENSQGLMLVDLPIARAHLAQARLRTAYAAGHIIRQPLLLPLT
                     FQVSLQQAEWTERHVQELRKLGLGLHRLGPQTVVLREIPAAIRELDLEGLLLALLAQL
                     TRQQHIMPAEIPLGELIVALTAQYPASTTSRPSLQEMNAFLQELENLYQIETGLKAPL
                     PWRELPEHEIAQWFLPS"
     gene            complement(367146..368564)
                     /locus_tag="Noc_0337"
     CDS             complement(367146..368564)
                     /locus_tag="Noc_0337"
                     /EC_number="3.5.1.28"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="ABA56863.1"
                     /db_xref="InterPro:IPR002482"
                     /db_xref="InterPro:IPR002508"
                     /translation="MKRIAYFLICLVPVLAFAGVQVQGVRVWSAEEKTRLVFDLSAPV
                     QHRVFTLASPHRIVIDLANTRLAQPLPPNSLNGKLLRGLRSANKSTGILRVVLELSHA
                     AHAKSFSLKPYKNHSHRLVIDLTRTDIGESQQKLVKTVAAITDNKPQQTTHKIRIAPE
                     NNPPRGNPPQGGKSEKTQPNSTTIIAAARDKPRDIVIAIDAGHGGEDPGAIGPQGTQE
                     KQVVLAIARKLARLLDREPGMRPVMIRKGDYYVGLRERIKEARQHKADLFISIHADAF
                     THPKARGSSVYILSEKGASSEAARYLAKRENESEFIGGVNLNEKDDLLARVLLDLSQT
                     STHEASLKIADTLLAGLKNVGQVHSQHVQHAGFAVLKSPDIPSVLIETAFISNPHEER
                     QLRSQTHQQQLANAMMNGIRYYFYSNPLPDTLLAQRRHIINRGDTLSGVAQHYDVSLN
                     QLRLANDLKGDRIHVGDILLIP"
     sig_peptide     complement(368508..368564)
                     /locus_tag="Noc_0337"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.997) with cleavage site probability 0.938 at
                     residue 19"
     gene            complement(368703..369161)
                     /locus_tag="Noc_0338"
     CDS             complement(368703..369161)
                     /locus_tag="Noc_0338"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function UPF0079"
                     /protein_id="ABA56864.1"
                     /db_xref="InterPro:IPR003442"
                     /translation="MIDVVLADEEATLALGARLGHACRKEGAIIFLLGTLGTGKTTLT
                     RGFLQALGHKGTVKSPTYTLVEPYILNQQQIYHFDLYRLTDPQELEFMGIQDYFTPGA
                     IILIEWPERALSWLPPPDLQISLGYLEIGSRSARLEAKTERGQHLLHPIS"
     gene            complement(369158..370654)
                     /locus_tag="Noc_0339"
     CDS             complement(369158..370654)
                     /locus_tag="Noc_0339"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56865.1"
                     /db_xref="InterPro:IPR000631"
                     /db_xref="InterPro:IPR004443"
                     /translation="MAILPLNLYTAAQVRELDRCTIEEFGISGAMLMERAGKASLEQL
                     RKHWPQAQRLVIICGVGNNGGDGYVLARLARKAEMYVSIYQLGDNSKLSTDAQAARQM
                     LLDSGMEILPFQPQVLRAADVVIDAIFGTGLSRGVTGQWADAIEAINTCGQPVFAMDI
                     PSGLHADTGNILGIAIKAQVTATFGGLKQGMFTHLGPDYCGEIAFDSLSIPPEAYHGV
                     TPSARRITLEDHITKLPSRAKAGHKGDYGHVVIIGGERGMPGAARMAGEAAYRVGAGL
                     VSIATREKHASLLNLARPELMCYGVESAEELKPLLNRATTLVIGPGLGQDLWGQTMLA
                     EALNHSHPLVVDADALNLLASQPRQHNRWIITPHPGEASRLLNINIEEIQADRFAAVQ
                     ALQQRYGGVAVLKGNGSLVCSTNHPLGLCTAGNPGMASGGMGDVLSGTIAGLLAQGLT
                     LNNAAHLGVTIHAMAGDRAAREGGERGLLASDLMEHLRQLANLQQIGP"
     gene            370998..372104
                     /locus_tag="Noc_0340"
     CDS             370998..372104
                     /locus_tag="Noc_0340"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S cluster binding protein"
                     /protein_id="ABA56866.1"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR004453"
                     /translation="MHGAEKTGPDLHTLAADIKQWGYQLGFQQVGIADIELGEAEQHL
                     LAWLQAGRHGEMDYMARHGLKRTRPEELVPGTLRVISARMDYWPETEDNPWHILEDDS
                     RGYISRYALGRDYHKVLRKRLQKLAKQIEAAIGPFGYRVFSDSAPVMEKALAEKAGLG
                     WIGKHTNLLARDVGSWFFLGEVYTDLPLPLDGATTSHCGSCRACIDICPTQAIVAPYQ
                     LDARRCISYLTIELRGAIPESLRPLIGNRIYGCDDCQLICPWNRYAQVTGEQDFRPRQ
                     GLEAPQLLDLFAWSEEDFLSRTEGSAIRRIGYVGWLRNIAVALGNAAPQPDIVQALRS
                     RADHPSPLVREHVIWALEEQLRKRAVPVRQEKRG"
     gene            complement(372108..372659)
                     /locus_tag="Noc_0341"
     CDS             complement(372108..372659)
                     /locus_tag="Noc_0341"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Exonuclease"
                     /protein_id="ABA56867.1"
                     /db_xref="InterPro:IPR002086"
                     /db_xref="InterPro:IPR006055"
                     /translation="MAQDSSNLIWLDLEMSGLNTIQDVILEIATVVTDSQLNIIEEGP
                     VIAVHQKDIILDNMDEWNTRQHNKSGLVERVRHSLISEAAAEQRTLEFLNRHTPANSS
                     PMCGNSICQDRRFLARYMPKLEAHFHYRNLDVSTIKELAKRWAPGIAKGFKKENTHLA
                     LADVHESIQELIYYRTHFLHLPD"
     gene            372736..373992
                     /locus_tag="Noc_0342"
     CDS             372736..373992
                     /locus_tag="Noc_0342"
                     /EC_number="3.4.24.84"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Ste24 endopeptidase"
                     /protein_id="ABA56868.1"
                     /db_xref="InterPro:IPR001915"
                     /translation="MITINLYSVLFLVFLGLIWILEVWLARRQFRHVRLHRAQVPPLF
                     QDHIPLAAHQKAADYTVAKLQLGVISNGLGVAIVLLWTLGGGLAWLDSLWRELGWNDL
                     GTGIAVLLSFVFIGTLLDLPVRIYRTFVLEQNFGFNRTTGWLFFQDFLKQGALMFLLG
                     IPLAAGALWLMEHAGSYWWLYLWLSWLSLIFLMMWAYPAFIAPWFNTFTPLTDESLRQ
                     RVEGLLARCGFKSQGIFVMDGSRRSGHGNAYFTGLGNNKRIVFFDTLLESLNSEQIEA
                     VLAHELGHFKRRHIFKNLIMMALLSFAGLALLGWLSAQPAFYQGLGVGYPSHYMALAL
                     FMLVAPVLTFFLHPFLTYLSRRYEFEADEFAVKMTNGQALAQALVKLYKENAGTLTPD
                     PIHSAVYDSHPPAPVRLAHLQAQGAR"
     gene            complement(374207..375385)
                     /locus_tag="Noc_0343"
     CDS             complement(374207..375385)
                     /locus_tag="Noc_0343"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56869.1"
                     /translation="MILNAKEHTLMKHTTVMMSAVVAASLLSTSALALDRANTSEKGS
                     LLVFPNVDVSGDKNTIIRLQNDYSDSVSLKCYWKNGTKFFTDFQIELTKFQPIWISAR
                     DGEGTYSVPPFPTSTNQDYLDKIGLGGGEYATPSRVTLPENAHTAGELQCWAVDGGGA
                     SEIRWNHLAGSATVVDASQGTAYQYNAWGFRCLVGGNGDACVVADAGQLDLNGNEYEA
                     CPKKLIGHFSPAETALGGMQVHRNELTLASCNQDLTQDQQFHFTKLKFNVWNEQEAKY
                     TGAYQCMDSWHQGLLDGVQNNGRNFTASSLKTDVARFKVRGMKSSVCERADNRKTFAI
                     DESIVTEEAGLLGVMATTYGLGESDGLAEAGTTLHMLGQRDGFIAYDPQEVIEERPAR
                     "
     sig_peptide     complement(375284..375385)
                     /locus_tag="Noc_0343"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.998 at
                     residue 34"
     gene            complement(375996..376829)
                     /locus_tag="Noc_0344"
     CDS             complement(375996..376829)
                     /locus_tag="Noc_0344"
                     /EC_number="2.1.1.72"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA adenine methylase Dam"
                     /protein_id="ABA56870.1"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR002294"
                     /db_xref="InterPro:IPR012326"
                     /db_xref="InterPro:IPR012327"
                     /translation="MPPNSISVRGYQRPFLKWAGNKYRLLTRIISVLPPGKRLIEPFA
                     GSAALFLNAEYERYWVNDINPDLIALYQILQKEGKEFIHYAGCLFTPHNNTPKAYYRL
                     RARFNTTADVAEKAALFVYLNRHGYNGLCRYSGSGIFNVPFGRYQRPYFPSKEMMAFH
                     IKARRARFTCLDFRKVLARIRRGTIVYADPPYTPLSQTACFTHYSGNGFGPEEQKALT
                     QSAQRLAKRGIPVLISNHDTPSVRQAYRNAQLTGFSVTRLISCKGTQRTPANEVLALF
                     I"
     gene            complement(377087..378046)
                     /locus_tag="Noc_0345"
     CDS             complement(377087..378046)
                     /locus_tag="Noc_0345"
                     /EC_number="1.8.1.9"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Thioredoxin reductase"
                     /protein_id="ABA56871.1"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR000759"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR005982"
                     /db_xref="InterPro:IPR008255"
                     /translation="MSKIKHCRLLILGSGPAGYTAAVYAARAALEPVLITGVEQGGQL
                     MTTTDVDNWPGDDQGVQGPELMERMRKHAERFGTKVILEHINEVDFSQVPFLLKGDTD
                     HYTADALIIATGASAKYLGLPSEGAYMGRGVSACATCDGFFYRGKPVAVIGGGNTAVE
                     EALYLSNMADHVTVIHRRDRFRAEKILANRLLQKAAEGNVTIEWNHTLEEVLGDEAGV
                     TGIRIREVDTNQTKKLPLHGVFIAIGHKPNTDIFTGQLEMEHGYIQVRGGFKGFATQT
                     SVRGVFAAGDVIDPTYRQAVTSAGTGCMAALDADKYLDGLEER"
     sig_peptide     complement(377969..378046)
                     /locus_tag="Noc_0345"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.990) with cleavage site probability 0.923 at
                     residue 26"
     gene            378131..379204
                     /locus_tag="Noc_0346"
     CDS             378131..379204
                     /locus_tag="Noc_0346"
                     /EC_number="1.4.1.1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="L-alanine dehydrogenase"
                     /protein_id="ABA56872.1"
                     /db_xref="InterPro:IPR000205"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR007698"
                     /db_xref="InterPro:IPR007886"
                     /db_xref="InterPro:IPR008141"
                     /translation="MRIGIPREIKTLEGRVALVPEATVELVQQGHEVFIERAAGDPSG
                     YPDAAYQAAGVTLLPDARSLYDTVELIVKVKEPIGPELELLRADHLLFSFLHLAAEPK
                     LAQCLMEIGLTAVAFETVAVGDELPLLIPMSDIAGRLSIQVGATLLHRSQGGKGLLLG
                     GLPGVSRGRVVVLGAGTAGRSAVAVAAALGSEVIVFERRRDRLAQMYHLGQNVTALYP
                     YQEKLKEAIADADLLIGAVLQAGARTPRLVSAEMVRNMRPGSIVVDISVDQGGCIETT
                     RPTTYIEPTYMWEEVVHFAVTNMPGAVPRSASQALSSALLPYVLILSQKGWENHPALA
                     AGINIKAGVVVHAAVQESLAAST"
     gene            379434..381878
                     /locus_tag="Noc_0347"
     CDS             379434..381878
                     /locus_tag="Noc_0347"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA translocase FtsK"
                     /protein_id="ABA56873.1"
                     /db_xref="InterPro:IPR002543"
                     /db_xref="InterPro:IPR003593"
                     /translation="MAQASTVTKRSKRTPVSLHIRHRLKEVAFIVCLALAAYLLLSLS
                     TYTATDPGWSHTGSAEAVHNKGGKVGAWLADLLLYLLGHPAYLLPATMIYGGYFLLAR
                     SGRSQDRGSFQCWVLRIAGFILALGAACGLAALHFPAPPGSLPVAEGGILGEIVGYGL
                     LGMFGPLGTILLLLALLLTGVTLFTGLSWVWLMDTTGHYTLELFWRIGHWGKRISGQF
                     THLPKVLEIKRAPDEKKKGKPKFEKQRSKVRIEPVIGELAVNPTGEEASMQEPASPKM
                     SASIKESVPIKEPAPIRREVEPRAEISPRQARQQPPPVFQPSAGEGLPVLSLLDKPSS
                     FKGGYSKETLESLSRQVEEKLKDFGVEVQVVAVHPGPVITRFELRPAPGVKVSRISGL
                     AKDLARALSVLSVRVVEVIPGKPVVGLEIPNETREIVYLSEVLHSAAYLESRASLTLA
                     LGKNISGHPVVADLAKMPHLLVAGATGSGKSVAINAMILSLLYKTTPQQVRLILIDPK
                     MLELSVYEGIPHLLAPVIIDMSEAGHALRWCVAEMERRYRLMAALGVRNLAGFNRKVR
                     EAIRAGEPLKDPLYSPSPNEEPLLLDPLPLIVVVIDELADMMMVVGKKVEELITRLAQ
                     KARASGIHLILATQRPSVDVITGLIKANIPARMAFQVSSRVDSRTILDQMGAEQLLGQ
                     GDMLYLPPGTAIPGRIHGVFVDDHEVHNVVEFLKQQGTPQYLEEITQGIDEFGEGANG
                     FAGGTEAEDDPLYDQAVRVVTETQRASVSGVQRRLRIGYNRAARLVEAMEHSGVVSAM
                     QSNGSREVLAPPPPEN"
     sig_peptide     379434..379577
                     /locus_tag="Noc_0347"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.997) with cleavage site probability 0.902 at
                     residue 48"
     gene            381835..382545
                     /locus_tag="Noc_0348"
     CDS             381835..382545
                     /locus_tag="Noc_0348"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane lipoprotein carrier protein LolA"
                     /protein_id="ABA56874.1"
                     /db_xref="InterPro:IPR004564"
                     /translation="MEAGKSWLRRRQRIKEGVFIKNFYRSRLGFQGALLGIILSGLAF
                     TLSAEEPGDHLETFLQKTHSLRAEFQQILLDERNQPLEESKGVFFLQRPGKFRWDYHE
                     PFSQTIVADGEHVWFYDPDLAQVTVKNQGLALGDTPALLLSGKRLPAENFSISNLPSD
                     NHLAWVELRPRDKEAAFERLLLAFDDDGLRQMELHDSFGRTTRLVFSKLEINLSLDPS
                     LFVFTPPPGADVIGGDSP"
     sig_peptide     381835..381981
                     /locus_tag="Noc_0348"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.971) with cleavage site probability 0.939 at
                     residue 49"
     gene            complement(382638..383939)
                     /locus_tag="Noc_0349"
     CDS             complement(382638..383939)
                     /locus_tag="Noc_0349"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase/phosphodiesterase"
                     /protein_id="ABA56875.1"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001633"
                     /translation="MPLSALPLPQRDVILAKLHQHLQSPHSQLVGLLIIKLCHFREIN
                     TAFGYQAGDALLIQFAEHICGHMRPQDELARIGDAEFSLILPSLHTGGQALLAANRVW
                     ELAQQYPFTVNGHTPLPHIAMGIALCPEHEKEPELLLRAADLAVAEAQKTGNPYHIYH
                     SQMLATATADLVLEEELEHALENDEFRLFFQPKISFSTNRITGTEALIRWQHPTQGMI
                     PPGKFIPLIEKSALMEPVTLWVLNTALRYRAEWAKKGIPLSVAVNFPPTLLINPEIAE
                     LIRQATRIWGTGQGDLILEVTESAVMTDPKRSLETLRHLAALGIELSIDDFGTGYSSL
                     AYLKNMPVNELKIDKSFVDEMAANQGDSLIVQAVTDLGHNFNLRVTAEGIEDQATLEG
                     LREIGCDYGQGYFLGRPMAPQDLENWIKESPWGMAIETATA"
     gene            complement(383960..385180)
                     /locus_tag="Noc_0350"
     CDS             complement(383960..385180)
                     /locus_tag="Noc_0350"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Metal-dependent phosphohydrolase, HD subdomain"
                     /protein_id="ABA56876.1"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /translation="MEKQVSCEHLKPGMYVSQLDRPWVETPFLFQGFFIQGSEDMDAL
                     RKHCHYVYIDAERGADVEQEIASPASGQKIAAKPALCPNQAVTYEDTVSFEDEFPTAK
                     KNHQQVCTLMNSIMEEVQAGRKLNTAAAREIVNKTMPGILRNPNTFMWLSRLKKQDSY
                     TYTHCVDACTLAIAFGRHLGLPREELETLAQGTLLADIGKMKIPPTILQKKTRLIPEE
                     FALIKKHVHYTVEILKKTEGISEEIIEVAYHHHERYNGSGYPQGLGGDDIPLYARMAA
                     IADCYDAMTSNRPYAKALSPHTAIQKLYEFRNVDFQDELVEQFVQCLGAYPVGTLVEL
                     STGQVGVVLAQNRVRRLRPQVMILLDANKKTCSSYSVINLLHELDDEEGNPLMITNVL
                     EAGAYGINPRDFYL"
     gene            complement(385355..385663)
                     /locus_tag="Noc_0351"
     CDS             complement(385355..385663)
                     /locus_tag="Noc_0351"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56877.1"
                     /db_xref="InterPro:IPR001052"
                     /translation="MKLIYCAPNLLLVKHFQNLLEAHGIGCIVKNENLNSAAGELPPT
                     ECWPELWLTDEANYGEAAQLLFPSANEQIQPSWTCPRCDEWLEGQFNQCWNCGEYRIN
                     "
     gene            complement(385675..387084)
                     /locus_tag="Noc_0352"
     CDS             complement(385675..387084)
                     /locus_tag="Noc_0352"
                     /EC_number="1.1.2.4"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="D-lactate dehydrogenase (cytochrome)"
                     /protein_id="ABA56878.1"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /translation="MNNSAPTATPEFLAALIQIVGEQRVRSDPADCWPYGYDNSRRHA
                     LPEWVVFALTHEEVRDLVRLCNKARVPIVPRGRGTGTTGATVPISGGLVLSLERMNRI
                     RMLDPTNRAMVVEPGVTNQEVQIAAGQQGFFWPPDPTSAAFCTLGGNLAYNSAGPRAV
                     KYGTPRENVLALRAVTGAGEEFRCGTYTTKGVVGYDLTRLLIGSEGTLAIITEATLRL
                     TPLPEAKRTLRAAYKDTESAGQAVADLMSQPLTPCALELMDRQAVTLVQAQGGIELPP
                     GTGALLMIEVDGPATAMEDAVTQLKKAAHNAGLLEIVAARTPQESKQLWAARKALSPA
                     LRTLAPKKINEDVVVPVSHLPALISGLERLAKEFAITIVNFGHAGNGNLHVNLLTDPD
                     EPTERERTKKCLEQVFKLVLSLKGSLSGEHGVGLEKRDFVAQELDPAALNLMERLKAQ
                     FDPQGILNPQKTLPLKTST"
     gene            complement(387074..387676)
                     /locus_tag="Noc_0353"
     CDS             complement(387074..387676)
                     /locus_tag="Noc_0353"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic or secreted lipoprotein"
                     /protein_id="ABA56879.1"
                     /db_xref="InterPro:IPR007055"
                     /translation="MKLSLTILLFCFIIIFQGCVAVVATGVAAGAATGVSTAYDRRTF
                     NTVIDDQSIELKASAALRNDQELHENTHINVTSYNGIVLLTGEAPSKELKKKAAELVK
                     PISDVKQIYNEVDILAPSSLVSRSSDSWITTKVKTKMTARKGLNPARIKVVTERGTVY
                     LMGLVTPQEAERAVAVTSHTGGTQRVVKIFEYLHETALEQ"
     sig_peptide     complement(387602..387676)
                     /locus_tag="Noc_0353"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.998) with cleavage site probability 0.243 at
                     residue 25"
     gene            complement(387680..388312)
                     /locus_tag="Noc_0354"
     CDS             complement(387680..388312)
                     /locus_tag="Noc_0354"
                     /EC_number="5.3.1.-"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoheptose isomerase"
                     /protein_id="ABA56880.1"
                     /db_xref="InterPro:IPR004515"
                     /translation="MMPTNKPNLSTKTAMNSRERIEQHFFSSAQLKLSAMKTLAPGIE
                     RASRHLLESLQHGHKVLSCGNGGSAADAQHFSSELINRFERERPGLPAIALTTDSSAL
                     TSIANDYHYDNVFARQIEALGNAGDILLAISTSGQSTSVIHGIKAAHDCEMTIIALTG
                     GDGGKIAPLLTERDVEIRVPAHSTARIQEVHLLVIHCLCDLLDHGLYPEK"
     gene            complement(388386..388760)
                     /locus_tag="Noc_0355"
     CDS             complement(388386..388760)
                     /locus_tag="Noc_0355"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function UPF0102"
                     /protein_id="ABA56881.1"
                     /db_xref="InterPro:IPR003509"
                     /translation="MKPATHRDKGEQAEQLACHYLQARGLRLTQRNYHCRLGEIDLIM
                     EDRESLVFIEVRYRRKGRFGDAIDSITPAKQARLIAAAQHYLQRTGGAQNKPCRFDVV
                     GITSEKGADNIMWLRDAFRVES"
     gene            complement(388780..390669)
                     /locus_tag="Noc_0356"
     CDS             complement(388780..390669)
                     /locus_tag="Noc_0356"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="LppC putative lipoprotein"
                     /protein_id="ABA56882.1"
                     /db_xref="InterPro:IPR007443"
                     /translation="MYPLIPMVIFFRKAGNYLPLAGLAILLGLTACTSPSPKVSPQAP
                     SSELVQAKALAAEGRYRAAATAYTQLAADAQSPQRQDYQLHAAAALLQGNYQQEAKML
                     LESIAPESLESPLKLRYHLLAAQLAIAEGEMKRALLLLEGVESLGPSLEQQAALHRLR
                     AQAYELEDNPLAAARERVQLEPLLSDAQALQENQRALWGLLMGLSPYTFGSLPQEPLS
                     PALQGWLELARLFQRYQLDSPDLQQAIENWQARYPGHSASLPLLQAEMATLPTTAYQP
                     SIALLLPTEGQFAASAKAVQNGFFAAYYNDNNGWPSNIRFYEVKIDSETGNSNIYSIY
                     QQAQTEGAYFVAGPLTKQSLAQLVATGDLSLPTLALNYLEKSHEGIEKLYQFTLSPED
                     EAREVAERAWHDGHRNALALIPNTQWGQRVKDAFAERWERLGGTLVKSQAYDPEKEDY
                     SPLIQRLLDLDDSQSRQRALQELAFEPERRHEADFIFLAAFPRQARLLVPQLRFHRAE
                     KLPVYSSSHIYTGYPDPENDQDLNGVLFCDIPWVLDKNAQNDPSYQSLAAAYPRNLEQ
                     LKRFYALGVDAYRIIPHLKALQQNQDMTFDGATGTLQMDAGRHLRRTLNWAQFKKGQP
                     QPVAK"
     gene            390752..391597
                     /locus_tag="Noc_0357"
     CDS             390752..391597
                     /locus_tag="Noc_0357"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function UPF0011"
                     /protein_id="ABA56883.1"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR008189"
                     /translation="MNGTLYVVATPIGNLGDFSPRAQEILRKADLIAAEDTRHSAALL
                     RHFGITTAMISLHEYNERRRAELLIARCREGLSVALISDAGTPLISDPGYRVVRQARH
                     AGIEVLPIPGPCALVAALSVAGLPSDRFVFEGFLPAKTGARQARLLQLAEESRTLIFY
                     EAPRRLLETLQAMIEAFEPDREAVVARELTKRYETVQGGTLSFLLSWARQTPESSRGE
                     LVLLVHGAEKEQDAIQQEALRVLRPLVAVLPLKQAVALAVDITGFKKNRLYQLALELQ
                     AAKKH"
     gene            392061..393788
                     /locus_tag="Noc_0358"
     CDS             392061..393788
                     /locus_tag="Noc_0358"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Cl- channel, voltage gated"
                     /protein_id="ABA56884.1"
                     /db_xref="InterPro:IPR001807"
                     /translation="MFNLFNLKTPLENLRIRVASAEALPQLSLLGLLTGLLAGGGTVA
                     FRLAVDVDQIALLPSHQVDDFESLDWLERLLFPIVGGLSIGLLQELAHTYRAVGVVHV
                     LERIAYYQGRLPWRNALQQFVTGALSIICGHSVGREGPSVHLGAAGGSLLGQWLELPN
                     NALRTLVACGIAAAIAASFNTPLAGVLFSMEVIMMQYQLAGVAPIILAAVVGAAISWA
                     VFGPSPAFFVPPTEMHSLLDFPYLVLIGFVVGILAAVYNRLMRFFSGLEKQRPVWQRC
                     TAAGLLVGLCSIAVPEIMGLGYDTVNAILMGQFGLSALVVITIVKLFATTACVGLGIP
                     GGLIGPTLVIGTAAGGALGIIGTALLPQEASPIALYAMVGMAAMMSATLQAPLAALMA
                     LVELTAGTYILFPGMLAVVVANLVAREGLHQQALFLMLLRTHGLDYHYAPISLRLRQA
                     GVASVMDRHFVELPVITDREAALQALAQNPRWVLVKQDFQPHSVVQAADVARALSDEE
                     QGSLNLMEIPAVREDIQAVSFYATLQEALEILDASQAKMLYVTRRIGPTRIRTYGVLS
                     RQDIESYYG"
     gene            complement(393830..394552)
                     /locus_tag="Noc_0359"
     CDS             complement(393830..394552)
                     /locus_tag="Noc_0359"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF533"
                     /protein_id="ABA56885.1"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR007486"
                     /translation="MSFGNIVGQLLQGMSSQSHSRLERTASPEGLGGLVDIAQKFLSN
                     KQAGGMTGGQVGGLGALAGALLGGGGSAAKGALGGSAMAILGTLAVSALQDKQNTPTS
                     SGNLTSGAQPLPQEQIEALAAPQTEQLMVRAMITAAKADGQLDQKEMDNIFGKISADG
                     VTDEERQLVMDELSRPMDLQALVSAVPNKAVAAEVYAASLFAIDIDTEAERAYLQQLA
                     QALGLDRATVSRLHELTGSPIA"
     gene            complement(394641..395396)
                     /locus_tag="Noc_0360"
     CDS             complement(394641..395396)
                     /locus_tag="Noc_0360"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56886.1"
                     /translation="MKKLIALSLLSGFLLGNVTYPNLTGYLSADLILGDNTFPALRIW
                     DFVDRLINPHLFVSNTARSEGDTPTYLYTYIPADVSGTHTPLAAAVRSEGMAEAAGAF
                     FYGETEGPGPAFGGNSLAATYSGAPAIGFEVNGLNFSGNPLAPVRGIDIVNGGNAATQ
                     WALGIETSTDRPQGKPKVGIMLAGSAHGFPHAPASESGMVIDHIDSGEAIRIQAGDRI
                     SFNNEGTIYMKYNPATQQIEFYNQDELKFAIPM"
     sig_peptide     complement(395346..395396)
                     /locus_tag="Noc_0360"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.910) with cleavage site probability 0.697 at
                     residue 17"
     gene            complement(395480..395884)
                     /locus_tag="Noc_0361"
     CDS             complement(395480..395884)
                     /locus_tag="Noc_0361"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent protease of the PAD1/JAB1
                     superfamily"
                     /protein_id="ABA56887.1"
                     /db_xref="InterPro:IPR000555"
                     /translation="MAEVILPRPLVNQLLHQAQVKPQQEICGLISARNGLPSRCYPIN
                     NIAPEPQRHFFMDPQGQIAAMRRMREEGEELFGIYHSHPETAPLPSKSDLAQAAYPGA
                     LYLIISLNTKGVLEMRGFRLQGEVYEEIELQL"
     gene            complement(395884..396657)
                     /locus_tag="Noc_0362"
     CDS             complement(395884..396657)
                     /locus_tag="Noc_0362"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Adenylyltransferase"
                     /protein_id="ABA56888.1"
                     /db_xref="InterPro:IPR000205"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR007901"
                     /translation="MNDQQLLRYSRQILLPQIDIEGQQKLLDSRILVVGVGGLGSPIA
                     LYLAGAGVGQLTLVDPDEVELSNLQRQILHDSNVIGLPKVESARRRLQALNPEVEVRP
                     IAARLEGKDLEAVIAQADVVVDGSDNFATRFALNIASARVGRPLVSGAAIRMEGQVAV
                     FDSRQPDGACYHCLFQEGGENEEETCSQTGVLAPLLGIIGSVQAMETLKLLLGIGRSL
                     HNRLLLLDGLSMRWRETRIQQDPQCPICNGSRERWRELA"
     gene            complement(396714..397589)
                     /locus_tag="Noc_0363"
     CDS             complement(396714..397589)
                     /locus_tag="Noc_0363"
                     /EC_number="1.3.98.1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotate oxidase B, electron transfer
                     subunit"
                     /protein_id="ABA56889.1"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR006058"
                     /db_xref="InterPro:IPR008333"
                     /translation="MTPQSHRDTILIEEGKILAQDAHPGEQYVLWVAAPGIASRATPG
                     SFAHLQCDSGLPMRRPLSIMRADAKHGWVEFLYKVVGQGTQLLAQRKPGEQISILGPI
                     GQPFRVDPAYPRPLLLGGGVGIPPMVFLADTLRQAGHFNPLVLMGSEIPFPFRQRPSQ
                     FLIPGLPEGVIGAMPLLEGWKIPSRLASLQGYPGCFEGFITDLARHWLHTLAPAQQRE
                     VAIYACGPHPMLAATAQLAREFGLPCQVSLEEFMACAVGGCAGCVVKVQTRQGPAMKR
                     VCVDGPVFDAEAVFT"
     gene            complement(397586..398875)
                     /locus_tag="Noc_0364"
     CDS             complement(397586..398875)
                     /locus_tag="Noc_0364"
                     /EC_number="3.5.2.3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="ABA56890.1"
                     /db_xref="InterPro:IPR004722"
                     /db_xref="InterPro:IPR006680"
                     /translation="MRTTIRGGHLIDPYNKIDGLQDLYLAEGRVVAIGSAPEGFRAEQ
                     EIDAQDQIVCPGLIDLQARLREPGQEQKGTIATETLAAAKGGITTLCCPPDTLAIIDT
                     PAVVDLIAHREAQYQRTRILPLGALTQGLQGLQLAEMGILREAGCVGVSNGLMPIANS
                     QVMRQAMEYAATLGITLFLYSRDPWLGIEGCCHEGIVSARLGLAGIPETAETVSLARD
                     LLLIEQTGVQAHFCHLSSARAVRMVREAQTEGLPISADVTAYHLHLTEHDIGEFDSQC
                     HVIPPLRSLRDRDALHEGLRDGTFSAICSDHQPHEFDAKLGAFPITEPGISGLETLLP
                     LSLRLTQDDTLTLAEVIAYLTCQPAQVLGIEGGHLAPGQRADICIFDPHCHWTFKPEE
                     MASQGRNTPFGGWEFQGRVTYTLLEGRVVFAAADETP"
     gene            complement(398875..399849)
                     /locus_tag="Noc_0365"
     CDS             complement(398875..399849)
                     /locus_tag="Noc_0365"
                     /EC_number="2.1.3.2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase"
                     /protein_id="ABA56891.1"
                     /db_xref="InterPro:IPR002082"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /translation="MSNLQLDQNGQLRHFLSIQGLNRELLTRILDTAESFSTIGAQHV
                     KKVPLLRGKTIVNLFFENSTRTLSTFELAAKRLSADVMNLNVRTSSTQKGESLLDTLR
                     SLEAMHCDMFVVRHSDSGAAYFIARHVPSHVSVINAGDGCHSHPSQAMLDMLTIRRHK
                     GSFPNLRVAIVGDILHSRVARSEIHALATLGTGEIRVIAPRTLLPRNVESLGVHIFHD
                     MRAGLKGVDVVITLRLQRERMEGARLPSEREYFQLYGLTEEKLALARPEAIVMHPGPI
                     NRGIEIESAVADGPHSVILEQVSHGIAIRMAVMAMTMQIPVPEAKEAR"
     gene            complement(399846..400379)
                     /locus_tag="Noc_0366"
     CDS             complement(399846..400379)
                     /locus_tag="Noc_0366"
                     /EC_number="2.4.2.9"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Uracil phosphoribosyltransferase"
                     /protein_id="ABA56892.1"
                     /db_xref="InterPro:IPR000836"
                     /translation="MNIPQPVSLNIDALFRNLATGLNQRMAEQERNKPAMIGIHTGGV
                     WVAERLLNQLDNLVSDPLGVLNIAYYRDDFTRIGMHPQVQPSQLPFSVADRHIILVDD
                     VLYTGRTVRAALNEIFDYGRPASVTLAALVERAGRELPIQADVVGHHLDLAPNEQVKL
                     TGPDPLQFSIQYIDPTE"
     gene            complement(400408..400866)
                     /locus_tag="Noc_0367"
     CDS             complement(400408..400866)
                     /locus_tag="Noc_0367"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction resolvase YqgF"
                     /protein_id="ABA56893.1"
                     /db_xref="InterPro:IPR005227"
                     /db_xref="InterPro:IPR006641"
                     /translation="MSATLDAPSPSKPRIVLGFDFGLRYIGVAVGQEVTHSANPLTTL
                     KAHEGNPDWNQITQLIRQWNPDLLIVGLPLNMDQSEQFLTKAARRFGHRLHGRYGLAV
                     EWVDERLSTVEARERLNIKSSASGRRQGIDQMAAQCILQTWLTEQQTIRH"
     gene            complement(400863..401426)
                     /locus_tag="Noc_0368"
     CDS             complement(400863..401426)
                     /locus_tag="Noc_0368"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF179"
                     /protein_id="ABA56894.1"
                     /db_xref="InterPro:IPR003774"
                     /translation="MKTMCYFRNHFLIAMPALDDVNFARTVTFICEHNQDGAMGIIIN
                     RPLSITLDQMLQHIKVKDCPQEVGEMPVFLGGPIQQERGFVLHRPIGQWETTLRVGDE
                     VGITTSRDILDAITQGKGPPQTLIALGYAGWGPNQLEQELAENAWLSTPANSTVVFDT
                     PYQQRWEAAAALAGVDLSRLSGEIGHA"
     gene            complement(401474..402376)
                     /locus_tag="Noc_0369"
     CDS             complement(401474..402376)
                     /locus_tag="Noc_0369"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-like protein"
                     /protein_id="ABA56895.1"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR006260"
                     /translation="MLSPSAMIPTMNYPLILTLLLSVLFHGILLLGMDQLKFFPPPTP
                     IPLPLEIILVPFKQEKIPKKPNVLAQAGKISKSEKEERHPLAPSAPSPLAAPPRVPTS
                     PAIQPAPAVSKQKLPPPKQTALSPLLTQKRATPSPSKPQQIPASTSPEIPETTSPRPS
                     ARELIAALEGQLAREIQRYANQPRKRYLDSNTTEYAATAYLDAWRKKIERVGKMNYPE
                     EAKRRGLSGSLILVVDLNPDGTVANIVVRHSSGHQALDKAAIRIVRLAAPFANIPANV
                     LQGHDILSITRTWQFHSGKDFSSR"
     gene            402714..404480
                     /locus_tag="Noc_0370"
     CDS             402714..404480
                     /locus_tag="Noc_0370"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane protein"
                     /protein_id="ABA56896.1"
                     /db_xref="InterPro:IPR000184"
                     /db_xref="InterPro:IPR010827"
                     /translation="MKINKIVLAFPVRIFFCLLLFFVKIGAAWSQVYLETEVEGVKGE
                     ALENVMAYLSIAHQKEDAQLAEGVIRRLHGKAEDEIKTALAVYGYYQPRIEAELQQHP
                     KRWLARYRIDPGPRMRVGEVDLTVTGGGAEDSAFQALQQNFPIKEGEFLNQTHYEQGK
                     SALQRLAAERGYFQANFTQQVLRINLETYSARAILRFDTGPRYQFGPVTFTETVLRPQ
                     LLTRYVPFQEGEFYQSSKVVELQTALVDSDYFAVVEVEPRPQQAAELKVPISVYLQAE
                     KRNRYSVGVGFGTNTGPRLNLGWKNRYVNRYGHRFSFALNTSKINQTLDSSYIIPIGD
                     PRTDQVRIASSIGRRSTVTSNSHIALFGARRIVARPGGWQETLFLDYRWEDFDVGGDS
                     GLAKLLIPGISWFRRQADDPVYPQRGNRLSLELQGAAQELLSNNTFLQLTLQGKIIRR
                     LGRRSRLLVRGDAGATWVSDFANLPPSVRYFAGGDQSVRGYAFSSLGATNERGRVIGG
                     KNILVGSVEYEYRFLDKWAAAAFYDAGNAFNNFSSLEVQQGAGVGVRWISPVGPIRVD
                     FAFALSKSGTPFRLHVNLGPDL"
     sig_peptide     402714..402806
                     /locus_tag="Noc_0370"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.844) with cleavage site probability 0.430 at
                     residue 31"
     gene            404477..408265
                     /locus_tag="Noc_0371"
     CDS             404477..408265
                     /locus_tag="Noc_0371"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF490"
                     /protein_id="ABA56897.1"
                     /db_xref="InterPro:IPR007452"
                     /translation="MKLLRSIGAFILLLLVLLVGGLAYLLLTEVGTRQLLAQVAQVIP
                     GELETQQVEGTLGEALTLTGLRYRTPDFTLEVGYFHFAWRPAALLGATFWVEQLHLGE
                     VSWRQKRPGESTASQEPIVLPEIQIPLKAKAEDVRLQNISLTPLGSSPVVINTIVFKG
                     NFDGQALQVGELGVSAPQGEVQVSGEMAFQEAYPMAFALAWGAPVPELGKVTGIGRVK
                     GDLRQLTLHQTVQAPFHLQFRSRLFELLEQPRWVAALEVPGVELQHLSAQWPAVRFGL
                     DLKGAGSLEQFKVRASYQIQEAQTGEVRGSLSVEQLAMGHWLLDRLTLRQVEGPARLA
                     LRGEVMMAEDQPRMSLAGQWQDMAWPLRGTAQVSSNRGQLTLEGTPAAYRLQLNSALA
                     GQDIPTSEWHLMGTGDTTQFELEKLRGQLLDGVLSGSGNFRWTPALAWDVRVDGEALN
                     LSKEWPEWPGVLSFSSDTNGVLEEDAQDITLDLHALSGSLRGYPVAAQGRVQRQDNTW
                     RIADLKLRSGDSRLSLGGTVNERLALKWHLSSPDLSQLLPEAQGDLLVKGHAKGPLTG
                     PELTFRLQGKALAYQDYQVESVMANVDVDLQGKQSSQVRIDASDFTLADQTLRSVAIE
                     GGGTPLHHKLSLAVKAPERSLDLGFQGSWKEEVWQGEITKTELTDSLMGHWEAVSATS
                     LTLSRSNIDLAPWCWRQQSAQLCLGGSWQEESFWRGSFKLEDFPLAMLGPLLPEKTAL
                     EGVIGGEVQAQGEAHQLVQARMQLAASGVQLTQVTPEGQSLRFPYQDMQARLNLEDRG
                     GKAGFELLSADPGTAPVRASLRLPSAPLDLTALGQLPLDGQISMAFRDLAFLETLIPE
                     LEAVQGQLRADLTLGGQVAAPQLLGEVVLQEGSAQVVPLGLKLIKIRLRAEASEQDRI
                     VFTGGVHSGEGELAVNGQVRLEPEAGWPAKVTVTGERFEAMGTSDIRVLISPQLQITK
                     AEEAIRVEGEVVIPEATLVIKDIESRGGVPVSQDVVIISQEKETEKKAVPIYARVRII
                     LGDDISVRAFGFKGGITGSLLVTETPGKATRGSGELQIVKGEYKAYGQQLNIRQGQVV
                     FAGPIDDPRLSVEAVREVDNGNIVVGARIRGAASEPVLTLFSEPSMDESNILAYLILG
                     RPLAGASGGDGELLTKAATSLGLSGGTLLAKRLGKIFGLEDVGIESADNGNGNGDTQS
                     EMLMLGKQLSPSLYIGYGIGLFERFSSFRMRYILSKNWSVQAETGLETGADLFYSLER
                     "
     sig_peptide     404477..404548
                     /locus_tag="Noc_0371"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.990) with cleavage site probability 0.411 at
                     residue 24"
     gene            408397..409341
                     /locus_tag="Noc_0372"
     CDS             408397..409341
                     /locus_tag="Noc_0372"
                     /EC_number="6.1.1.14"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase alpha chain"
                     /protein_id="ABA56898.1"
                     /db_xref="InterPro:IPR002310"
                     /db_xref="InterPro:IPR006194"
                     /translation="MTSKPRDIAGTMPATFQELILRLQQYWAEQGCVLLQPYDMEMGA
                     GTFHPATFLRALGPEPWNAAYVQPSRRPTDGRYGDNPNRLQHYYQYQVVLKPSPLEIQ
                     DLYLGSLHMLGISPLVHDIRFVEDNWESPTLGAWGLGWEVWLNGMEITQFTYFQQAGG
                     LECRPVTGEITYGLERIAMYLQGVGSVFDLVWAEGPLGRVTYGDVFHQNEVEMSIYNF
                     EQADTESLFAWFNSCETESKRLVEAGLSLPAYEMMLKASHTFNLLDARHAISVTERQR
                     YILRVRALARAVAEAYLARRQALGFPILASVGKEMACG"
     gene            409334..411409
                     /locus_tag="Noc_0373"
     CDS             409334..411409
                     /locus_tag="Noc_0373"
                     /EC_number="6.1.1.14"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase beta chain"
                     /protein_id="ABA56899.1"
                     /db_xref="InterPro:IPR002311"
                     /db_xref="InterPro:IPR006194"
                     /db_xref="InterPro:IPR008909"
                     /translation="MAETRDLLIEIGTEELPPKALRKLSESLLQELSHGLQAAGLIYG
                     DLKGYGAPRRLAVWVQALTVSQPEQVLERRGPALAAAFNEEGKPTAAARGFAGSCGVP
                     VEALESLKNEKGAWLVYRQRQQGAPTRELLPAILAQALQALPIPKPMRWSDLPGEFIR
                     PVHWLVLLFGEEVIPATLLGVQAGRETQGHRFHHPEPLYLTEPAAYATLLETEGKVLA
                     DFAVRREAIYTQVVAAAQQMGGKALIEEALLDEVTGLVEWPVALAGQFDGDFLKLPAE
                     VLIATMQDHQKYFPVQDEQGHLLPCFITVCNIESQRPEVVVEGNERVIRPRLTDAAFF
                     YATDRKESLASRCERLKKITFQEKLGSVFERTERLAKLAWHIAKDIGGNGDWAKRAGL
                     LSKCDLVTEMVTEFPELQGSMGRYYALHDHEPQEVAEALREQYLPRFAGDVLPRTATG
                     QALSLADRLDTLVGLFGIGAPPSGDKDPYGLRRAALGVLRIIIESGLALDLPSLLKRA
                     CETYNDRLTEKNTAVQVHAYLLERLRGYYLEAGFRPDEIEAVLAVRPDQPLDFDRRLK
                     AVASFRKLPEAESLSAANKRIRNILRKSGEKLPAQIESDLLQDPAEQTLATQMYSLER
                     EMMPLLERQDHRATLTALAGLRGAVDQFFDEVMVMVEDPKLRANRLALLARLQTLFLQ
                     VADISRLQA"
     gene            411469..412008
                     /locus_tag="Noc_0374"
     CDS             411469..412008
                     /locus_tag="Noc_0374"
                     /EC_number="3.1.3.-"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alpha,beta-D-heptose 1,7-bisphosphate
                     phosphatase"
                     /protein_id="ABA56900.1"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR006543"
                     /db_xref="InterPro:IPR006549"
                     /translation="MRLVILDRDGVINEDSDEYIKCPAEWVPIPRSLEAIVRLNQAGY
                     QIIVATNQSGIGRGFFDVPTLNRIHSKMHHLLAQMGGGIEAILFCPHVPGEDCSCRKP
                     RPGLFHDLARRLRIQLDGVPVVGDSLRDLQAAQAVGAIPLLVRTGKGKRTAESSDLPM
                     GVEIYDDLGSVADALLKHG"
     gene            412001..412813
                     /locus_tag="Noc_0375"
     CDS             412001..412813
                     /locus_tag="Noc_0375"
                     /EC_number="2.3.1.51"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Phospholipid/glycerol acyltransferase"
                     /protein_id="ABA56901.1"
                     /db_xref="InterPro:IPR002123"
                     /translation="MDKRAPKPSRAMGSTFSPSLETQQQLLWRSLLFSLGQILSTFIF
                     GLVGLCLFFLPFRYRYLFLIQWGRLNFWWLKKTCGVSFRVRGAEHIPPGPAVVLCKHQ
                     SAWETIALQQIFPPQIWVLKRELLWLPFFGWGLALLEPIAVDRKAGRRSLRQIIKQGQ
                     QRLAAGRWVVVFPEGTRMPPGTMGRFGIGGAALAQATGYPVVPVAHNAGRYWPRGGFI
                     KYPGVIDAVIGPPIDTHGKSAAQVNQEAYDWIEKIMKEIDPPDLTESYQAPQ"
     gene            412858..414948
                     /locus_tag="Noc_0376"
     CDS             412858..414948
                     /locus_tag="Noc_0376"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver modulated
                     diguanylate cyclase/phosphodiesterase"
                     /protein_id="ABA56902.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="InterPro:IPR001789"
                     /translation="MLSSKNIVRLLIVDASFEDAEMVTNLLRKMGFAARASRVEKEEE
                     FREAIEGQSWDIIVCAAMLPQFSVARAAQILLQSEKDISLIIVVDEKTDSDDIDEMYV
                     AGVRDVVLKSRPLRLQSVIKRELQDLENRRARRHSEMVLGESERQVRALLESSRDAVG
                     YVHEGMHIYANRAYLELFGYHELDEIEGMPLLDMIAPEEHNRFKAFLKEYGASEGKSA
                     HFTLRAHKADGHTFTAAWEFTPASIEGEFCTQIVIRDKTYDLAAEERIKQVQQRDILT
                     GFFSRPHYLELMEKWVIAARAGDRESSLLYIAIDQFNRVRARVGIGASDLVVVDVARI
                     LQQYCDEKVILARFGDEVFTLLLPHGSDEQEDALAEQLRQAVDRHLVEMDERSINVTC
                     SIGICRIGESAPGGQQILERAHKACLKAQEAGGNRIERYRPVIEDLTDQEKIKQWEVQ
                     LREAMNNKDGFCLFYQPIVSLHGETEEIFEVLLRMTDDAGGYILPEKFLEPAAQLKLM
                     GEIDRWVIAKAMSVLHSRHQVGQLIRFFVKLSDPSIHDKNLLPWLKKHLQESGLDARS
                     LIFEISESSALNYLKRVQQLVEGLRVLGCQFALEHVGTGLDTSNCLKHINVDYLKIDG
                     AFIENLLQDEQNQEAVKIIIEMAKEAGKPTIAEFVSDANTLALLWQFGLDYAQGRYIQ
                     EPNQFLSYEFSGGI"
     gene            complement(414985..415872)
                     /locus_tag="Noc_0377"
     CDS             complement(414985..415872)
                     /locus_tag="Noc_0377"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Heat shock protein, Metallo peptidase, MEROPS
                     family M48B"
                     /protein_id="ABA56903.1"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="InterPro:IPR009481"
                     /translation="MIKRVILFLATNLAVLLVLSISMRLLGIESLLNQQGTDLNLNAL
                     LIFAAIIGFSGSLISLAISKFTAKRLTGAQVIERPRSTTEVWLLETVQRHARMAGIGM
                     PEVAIYASPEPNAFATGWNRNAALVAVSSGLLEQMNQNEVEAVLGHEISHVANGDMVT
                     LALIQGVVNTFVIFLARIIGHLVDRVVFKTERGYGPAFFITTLIAQTVLAILASLIVL
                     WFSRQREFRADAGGAQLAGKEKMIAALERLGRMAQEGLPEQLQAFGIAGGERSQGWKR
                     LFMSHPPIEERIAALRAEH"
     sig_peptide     complement(415789..415872)
                     /locus_tag="Noc_0377"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.893) with cleavage site probability 0.743 at
                     residue 28"
     gene            415916..419596
                     /locus_tag="Noc_0378"
     CDS             415916..419596
                     /locus_tag="Noc_0378"
                     /EC_number="3.5.2.9"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="5-oxoprolinase (ATP-hydrolyzing)"
                     /protein_id="ABA56904.1"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR003692"
                     /db_xref="InterPro:IPR008040"
                     /translation="MRELLAYFKQLVLPFGKVNRPQSWKRQHLWQFWIDRGGTFTDIV
                     ARRPDGRLLTHKLLSENPEHYSDAALQGIRDLLGVAKDQPLPIARIQEVRMGTTVATN
                     ALLERQGERTLLLITQGFRDALRIGYQSRPKLFARHILLPEMLYERVEEVEERLSAQG
                     EVLTPLNLDSARQPLESAYRKGIRSVAIVFLHGYRYHEHERRVAELARKIGYTQISLS
                     QEASPSMKLVGRGDTTVVDAYLSPILRRYVDHVSSELGDTRLLFMQSNGGLADARFFQ
                     GKDSILSGPAGGIVGAVRTAISAGFSKIISFDMGGTSTDVAHYDGEYERVFETEVAGV
                     RMRAPMMRIHTVAAGGGSICQFDGARFRVGPQSAGANPGPACYRRGGPLTITDCNVMV
                     GKIQPEYFPEVFGPNQNQPIDRDIVRQKFETLAAEIKAATGKILSAVEVAEGFLKIEI
                     ENMANAIKQISTQRGYDVTEYALCCFGAAGGQHACRVADALGIKTVFIHPLAGVLSAY
                     GMGLAELRVIKQQPIEALLSASLVAHMEAAFQELESTGRMEMRQQGVKESSIRVKKKV
                     HLRYEGSDTALIVGFGDLQAIRMGFEQAHQQYFGFIASEKDHIVEAVAVEIIGGAQAA
                     EDKIRGMFPYWGKARPVDITVMFADGTSYPTSIYKREELGADAYICGPAILIESNATT
                     VIEHGWQAEATKGHHLILTRMEPLPKRFAVGAEVDPVMLEVFNNLFMAIAEQMGVTLA
                     NTAYSVNIKERLDFSCAVFDKDGQLVANAPHIPVHLGSMGESVQTVIRRNRGHIRPGD
                     VYVLNAPYDGGTHLPDVTVITPVFDEQGTEILFYVGSRGHQADIGGITPGSIPPDSKT
                     IEEEGVIIDNFKLVDQGCLREEEFIELLTSSPYPVRNFKQNLADLRAQIAANEKGIHE
                     LRQMVKHFSLEVVHAYMGHIQNNAEEQVRQVLAALKSGEFSYEMDNGSRIHVIITINR
                     QQRSARVDFTGTSPQQANNFNAPVAICQAAVLYVFRTLVEEDIPLNAGGLRPLEIIIP
                     EGCLLNPRYPAAVVAGNVETSQCIVDALYGALGVMAAAQGTMNNFTFGNERYQYYETI
                     CGGSGAGPDFDGTSAVHTHMTNTRLTDPEVLEWRFPVLVDGFYIRADSGGGGRYRGGD
                     GVVRRIKFREAMTASILSNRRQVPPFGLAEGQPGAVGCNYVLRANGAREVLSSTGSVE
                     MQPGDVFVIETPGGGGYGFQEP"
     gene            complement(419630..421213)
                     /locus_tag="Noc_0379"
     CDS             complement(419630..421213)
                     /locus_tag="Noc_0379"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56905.1"
                     /translation="MAGQIDTLIEHLQQPGIYHHAVENLTMIETHISWVVLTGPYAYK
                     IKKPLDLGFLDFSTLDKRRHYCDEELRINRRLAPEIYLEVVPITGSTAQPHLGGTGIP
                     IEYAVKMIQFPQQTRLDYCLQRGDLSPKQVEDLAGKVAAFHQNVAIAPQDSPYGAPKT
                     IGQPALENFQQMEIFLKEAEDQKKLARLRHWTEKKWQQLQAEFTGRKKAGFVRECHGD
                     LHLGNIALREGKFIIFDGIEFNENLRWIDVMSELAFLIMDLENRGRPDLAHRCLNSYL
                     EHSGDYPGLAVLAYYQVYRALVRAKVTAIRLGQTPPETQAIKERCRDYLNLALHYIQP
                     ARSFLLITHGLSGSGKTTLSQPLIERFGTIRLRSDIERKRRHGLKPRERLNKGIGIGM
                     YSAESSHKTYQHLQQLAQTILKAGYPLIVDAAFLKQQQRQIFQDLANKLNIPFAILDF
                     HCDPQQLQQRIRERQHKNQDASDADLAVLEHQQATQEPLTKAEQAITLAIDTSQTQAM
                     ETVIQQLQVLTGEKAPRVK"
     gene            complement(421262..422377)
                     /locus_tag="Noc_0380"
     CDS             complement(421262..422377)
                     /locus_tag="Noc_0380"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56906.1"
                     /translation="MESVTEERLWEEWLLRTDEPSGEIIGGWFAGVVDPEVWRHGYAM
                     QHLLRRVGKELLAPVAEHLGEAKRLLLVTHGGLHLLPLEAAPFPAGNGAMTTLSERMA
                     VSVTPSAVFLAENRQHARGSEQSWRLVALENPRNDPQLPYTSLEVARIAHYAGAERTT
                     RLRGKEATLPALAENLAGATFNHFSCHGRYHWGSPLLSALELHPAEGEPTVEGGEPGH
                     LTLLHLYQGKVDFTGARLVTLSACQTGITEVREQAEEAVGLPGGLLGAGVPTVVASLW
                     SVADLSTAFLMSRFYYHLLCQAHPPDRALQQAQADTRTATWKQIREELEEQAVLNASD
                     KLGDEGELDQRPFAQPYHWAAFQVWGDGWTPIIQEDA"
     gene            complement(422365..423633)
                     /locus_tag="Noc_0381"
     CDS             complement(422365..423633)
                     /locus_tag="Noc_0381"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="TPR repeat protein"
                     /protein_id="ABA56907.1"
                     /db_xref="InterPro:IPR001440"
                     /translation="MPSEAVPLQLTRIQALEDVLRQLKDEKPELVASLQGELGNALAT
                     SSMGSSRAYNLEQAIQAYQAALEIRTRNDFPEQWATTQHNLGNAYGKRIRGVGAENLE
                     KAIQAYQAALEIRTRNDFPEQWAMTQHNLGNAYGKRIRGAQAENLERALEAYEAALTI
                     YTRDAFPEDWAMTQHSLGNAYRDRIRSAGAENLERALEAYGEAARIYTTDTNPEAARQ
                     VRLGQSAALLKAGRWQAALDASEEGLAASRILFDISLHDPEVREREIGTSEMLYAHCA
                     FAQAQLGRPDKALAILEEGRARELRYRAGRDRADLEDLPEQRRAAFLQAAQRVRDLEA
                     EWRRPEEERPADLADKTRQARQGLEQEAQQIRVLKPNFLRASVDLHDIRAVLPGQDAA
                     LVEFAVTEAGTLALVLPAGQGALKRSGWRA"
     gene            complement(423973..425256)
                     /locus_tag="Noc_0382"
     CDS             complement(423973..425256)
                     /locus_tag="Noc_0382"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56908.1"
                     /translation="MTAATRASNPGALVQYVFFLADQDQAREEKSPGYQSAKAFVTQA
                     SAALGLDTTRDSGFRAHKYNDHAGHELVWIEAHEAEIVILTLDRPPDFTTAKAVWDEA
                     LATIAPLLESIAPEHLQGKAHVLIGLGEAERLMPQAEHTLASALTLSAQAPWGSLWAP
                     KIEGPFLLALKAECLQAGEQFISWEIFAHALYHLTKGMDQWQDYQRHRKALAQLEQQL
                     ERDIGQAYAAATSSHQPLLPALTRAGRALNGLLKPVSLASINLKKARLNLQRALAGVF
                     RSDQGLIAEMKNSLLGFEEILDAEAGILRERTAELERMTQQAQREMQLETARRSEMLL
                     AAAHTVEFVVVLYYVLAAWGLVIGKHSQQSIHPLGKLLWGLGVSGAAVFATYYALSKW
                     GERAALGLLIGVVVMAVALAGVLQWGPGWLAQIIY"
     gene            complement(425253..425639)
                     /locus_tag="Noc_0383"
     CDS             complement(425253..425639)
                     /locus_tag="Noc_0383"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56909.1"
                     /translation="MNEATPVFFWLIGLQKADLEEIINNLSVEQRARLRRVLEDAGAG
                     RDLRFEAAVQVSEKVLDIIGQEARQLGFDMPRPNPVHTPVRITDTPPSDPKNFPENRR
                     IRFAEVVQKAKACLADKKENKHEHKK"
     gene            425856..426236
                     /locus_tag="Noc_0384"
     CDS             425856..426236
                     /locus_tag="Noc_0384"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56910.1"
                     /translation="MLLARCAKSSGAPIRPVPHLIQKRDKHPCVMIRATLDQYLEEDR
                     VSAKTLHDEAKQRHGDDYRTPGYYLRLYRHRAERTQAELAEKTGLRQHHLSEMEHHKG
                     VIGNANANAKKLAPILDCDYRKLL"
     gene            complement(426788..427312)
                     /locus_tag="Noc_0385"
     CDS             complement(426788..427312)
                     /locus_tag="Noc_0385"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase of IS630 family insertion
                     sequence ISY100h"
                     /protein_id="ABA56911.1"
                     /translation="MTGYTQRCNMKRKSFLRLRERYRRRGKRFVYLDESGFEPEVSRR
                     YAYAPKGRRVYGLISGHRRPRTSLLAARMDEGFEAPFLFEGTCNTAVFNAWLEKELCP
                     LLNSNHIVIMDNVPFHKAVSSREIIKKTGAGILFLPPYSPDFNPIEKDFGNIKKIREY
                     NEHETLENIVAAYQ"
     gene            complement(427287..427622)
                     /locus_tag="Noc_0386"
     CDS             complement(427287..427622)
                     /locus_tag="Noc_0386"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="ABA56912.1"
                     /db_xref="InterPro:IPR002622"
                     /translation="MMRCSIDLRKRVIDFVRGGGSKAEAARRFQVGRASIYRWLSQDD
                     ALCYERPGPRRSHKLDWEALRVHVEDKAALTYKERARHFGVSYYCIWHAMHKMGLTRK
                     KNDGVHAAL"
     gene            427761..428171
                     /locus_tag="Noc_0387"
     CDS             427761..428171
                     /locus_tag="Noc_0387"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase IS200-like protein"
                     /protein_id="ABA56913.1"
                     /db_xref="InterPro:IPR002686"
                     /translation="MHHSQMSRYAKNAGAVFSLKLHLVWCPKYRRGVLVGEIAERLCA
                     LLHKKADELEMTIHALEVMPDHVHLFVEFDPRWGVAEMVNRFKGSTSKELRKEFPILR
                     SRLPTLWNRSYYAGTVGHVSESTVRAYIENQKGK"
     gene            428172..429293
                     /locus_tag="Noc_0388"
     CDS             428172..429293
                     /locus_tag="Noc_0388"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ABA56914.1"
                     /db_xref="InterPro:IPR000221"
                     /db_xref="InterPro:IPR001959"
                     /db_xref="InterPro:IPR010095"
                     /translation="MINAFKYRLYPNAHQARELETMLETHRRLYNECLAQRKERYEIA
                     QKSVKYTQQSAWFKSERGVNEWYARLNFSSAQATMRRLDKAFQAFFRRIKAGEKPGYP
                     RFKARGRFDSWTYPAHGDGARLLDGQLRLQHVGLVKVRQHRPVEGAVKTVQVKNEAGK
                     WFVIASCNIGDGPAPRAEDTSVGLDVGLAYFLSTDQGEHVDNPRYQKEALRQLRIAGR
                     AVSRKRKGGRNRAKAVARLRAIHARVANKRRDYHHKVARDLVSRYAFIAAESLTVSNM
                     VRNRRLSRSISDAGWRQFLNILRAKAESAGSVWVEVPPQGTSQACSGCDTLVRKSLSV
                     RQHHCPECGLRLQRDVNAARNILARGQARMEPVRLNVAQ"
     gene            complement(429381..430601)
                     /locus_tag="Noc_0389"
     CDS             complement(429381..430601)
                     /locus_tag="Noc_0389"
                     /EC_number="2.7.7.72"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Polynucleotide adenylyltransferase"
                     /protein_id="ABA56915.1"
                     /db_xref="InterPro:IPR002646"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /translation="MEVYLVGGAVRDKLLGRPVKERDYVVVGTTPANLLAQGYRPVGK
                     DFPVFLHPQTQEEYALARTERKTGPGYKGFEVDAAPDVTLEEDLQRRDLTINAIAEAA
                     DGSLLDPFGGQQDLARGILRHVSPAFAEDPVRILRAARFAARFNFKVAPETLALMEAM
                     VTAGEADHLVPERVWRELERALGESYPRRFFEILRACGALARIFPEIECLFGVPQPRR
                     YHPEIDTGIHTLKVLEIAAHLSSDTQVRFAALTHDLGKGQTPSHEWPHHYGHGERGVA
                     LVLTLCQRLRVPKAYQALAVQVARYHNLVHQAQELRPGTILKLLNRVDAFRRPSRFEQ
                     FLLACEADARGRSGLENRPYPQANQLRLAFRAAAAVTARPLVAAGLRGEAIAEQLQQQ
                     RIKAIKQAVHTERG"
     gene            complement(430928..431890)
                     /locus_tag="Noc_0390"
     CDS             complement(430928..431890)
                     /locus_tag="Noc_0390"
                     /EC_number="1.1.1.219"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="ABA56916.1"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR005913"
                     /db_xref="InterPro:IPR008030"
                     /translation="MNIQTVCILGGTGFVGRWLSSHLVEQGYKVRVLTRHWQRHRDLL
                     VLPGLRLMETDVYDPAQLAAQFNGCQSVINLIGILNEKGRNGHGFRQVHADLPEKVAQ
                     ICLDTGIKRLLHMSALNADANQGASYYLRSKGEGENRVLALARQGLEVTIFQPSVIFG
                     PGDSFFNRFGSLLKLSPFIFPLACPEARLTPVYVGDVARAFARALSDKEDFSQSYELC
                     GPKIYTLKQLVEYTAKVLELKRRVIGLSDKLSRIQASIFEYVPGKPFSKDNYASLQVP
                     SICHRNGLHELGIEPTAIDAIVPGYLGQVSQRSQYLELRRHAQR"
     gene            432095..433459
                     /locus_tag="Noc_0391"
     CDS             432095..433459
                     /locus_tag="Noc_0391"
                     /EC_number="1.2.1.16"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Aldehyde dehydrogenase"
                     /protein_id="ABA56917.1"
                     /db_xref="InterPro:IPR002086"
                     /db_xref="InterPro:IPR005829"
                     /translation="MAFESVNPATGQSLKTFDAWDQNAIDGVLQQVQEASPLWAARDL
                     SERCRLLRAAAQQLRERKEDLARLITLEMGKLLGEARAEIEKCAWVCEYYEEHAPRFL
                     ADEVIESDARRSYVALQPLGTVLAIMPWNFPFWQVFRFCAPALVAGNTAVLKHAANVP
                     QCGLAIEQTLLEAGFPPGVFRTLLVSSSQTAKVIADPRVQGVTLTGSEAAGRKVAECA
                     GRHLKKTVLELGGADPFIVLADADLEQAVPVAVQSRFINGGQSCIAAKRFIVMEEIAD
                     EFIARFQADLEALQPGDPLDEQTTLAPLARLDLRAGLHQQVTASIQQGAVAVAGCQPL
                     PGTGTYYAPSILDRVQPGMPAFDEELFGPVAAIIRVANEAEAVAMANASRYGLGGSVW
                     SQNTSRAERLALELRCGAAFVNGLVKSDPRLPFGGIKCSGYGRELSWHGMREFTNQKT
                     LWIK"
     gene            433621..434676
                     /locus_tag="Noc_0392"
     CDS             433621..434676
                     /locus_tag="Noc_0392"
                     /EC_number="3.1.1.61"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Response regulator receiver"
                     /protein_id="ABA56918.1"
                     /db_xref="InterPro:IPR001789"
                     /translation="MALHTALVVDDSKVARLAMSKLLKSRDFDVDDAASGEEALEYLE
                     HHRPDIVFMDVMMPGMGGLEATRTILSREATRSLPVVMCTGKEGAADRSAALEIGARD
                     VLAKPTGEENLDRVLKEMIAEANPETTISASGVLDTSIQEKASAMMETDAERSAATLA
                     TQEVVEQAVAEASAAAQTMAERIARETADQVSRQLIEELVTELAERIARETAEAVSQG
                     IADRVLEVAQERTEKKALAITETATLKANQEMASKAEETIKTMRSVSAQTVAAFLEQQ
                     QAQFHASLQMTVEQGVAAAAEKQMAAHFSHYMQAQGRAAIQGIMDEIIQEEDAAYAAE
                     QAQKARSGFWKWPWGRA"
     gene            435130..435981
                     /locus_tag="Noc_0393"
     CDS             435130..435981
                     /locus_tag="Noc_0393"
                     /EC_number="2.1.1.-"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="[protein release factor]-glutamine
                     N5-methyltransferase"
                     /protein_id="ABA56919.1"
                     /db_xref="InterPro:IPR000051"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR004556"
                     /db_xref="InterPro:IPR007848"
                     /translation="MTLNFSIAEAIEFAGNRLVSGDGGRLEAERLLAYLLKVERSYLY
                     AWSDRRLTPTQWVSFQRLLQRRAKGEPLAYIRGWQEFWSLNLQVTEATLIPRPETEQV
                     VELALQRLDLERALNVADLGTGSGAIALAMGSERPRARVIATDVSAETLEVARENGRR
                     LGLCNVTFRLGDWFVPLVGERFHLIASNPPYIAEGDPHLTQNGLAFEPDIALIAKDKG
                     LGAARHIAMTAREHLLDGGWLLLEHGYEQGPSLLALFTQLGYQQVADFCDLAGLPRVV
                     AGQWRAC"
     gene            436047..437045
                     /locus_tag="Noc_0394"
     CDS             436047..437045
                     /locus_tag="Noc_0394"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF523"
                     /protein_id="ABA56920.1"
                     /db_xref="InterPro:IPR007553"
                     /translation="MDPLSARGEIPPSLSSPEIPRLRLAISSCLLGERVRFDGGHKRD
                     TYITEALNAYFDFVPVCPEVAIGMGTPREPIRIVKTSQGLRARGVRHSELDVTDPLRQ
                     FGEVMAEELGDIDGYILKKDSPSCGMERVRVHGTGGAPSRTGTGLYAQVFMARRPWLP
                     VEEEGRLNDPVLRENFFERVFVHYRWRQIGAAGITPAALVEFHSRHKFMVMAHSQAAY
                     RRLGRLVAKAGSESLETLAPTYEAELMSALRRRATRKGHTNVLMHLLGFLRAQLDKAD
                     RAELLESMESYRLGLVPLIVPMTLLKHHFRRHPNPYVNQQYYLNPHPPELMLRNLI"
     gene            438539..439903
                     /locus_tag="Noc_0395"
     CDS             438539..439903
                     /locus_tag="Noc_0395"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56921.1"
                     /db_xref="InterPro:IPR011652"
                     /translation="MRNRLITIGTLIVVLSGCMANQPKVSGTPTKKIQSQNQIEPAQP
                     EIETKRTYNDDGSVKNIQYSKNGKEIEKFTFSYYPSGAIKIKLRTVNDILNGQSEAYF
                     EDGTVSENANYVNGLHYGKFENFHENGKLRKSGTYKNDKLNGTVKTYNKLGNILSRVI
                     YTDGVEGISIYYGYKDNNLEWEKKYKNKTLVQSKKYYLNGNVELKAGIKNGEINGFLE
                     EYYNNGNIKKKTTYKDGKKTGLELGYFKNGELSWETNLIEGRIDGIYKEYYENGALKL
                     IQNYTKDEPNGLKKRYFDNGKPEYEAVIKNGKVNGVYKEYFESGGIKFTKNYKNGEMV
                     GEGKGYYQNGNLNWLVTYKNGKLFTDKSYTKTGKISADLTYKDGKKTGIERDYFEKGN
                     LSWETWFKNGKRTKAKQYYQGGNLAKEIDFKDGKAIKGFQYTYEGKKTEMTNAHFHNL
                     GYEY"
     sig_peptide     438539..438601
                     /locus_tag="Noc_0395"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.990) with cleavage site probability 0.981 at
                     residue 21"
     gene            440144..440548
                     /locus_tag="Noc_0396"
     CDS             440144..440548
                     /locus_tag="Noc_0396"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56922.1"
                     /db_xref="InterPro:IPR008613"
                     /translation="MNKIIVTAMIIIAGWYGSLLYRQGELTVIREFANGFGSNEPVKC
                     MTKDGRVLYGDIPQGIICEKVEPVEGSLTVQKFSTLKRDDHKASGFRCDGRQYCSQMK
                     SRAEAEFFARNCSNTKMDGDHDGVPCENDSQF"
     gene            440764..441813
                     /locus_tag="Noc_0397"
     CDS             440764..441813
                     /locus_tag="Noc_0397"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase domain protein"
                     /protein_id="ABA56923.1"
                     /translation="MSNKSYVMWNNKGGVGKSTITFHIASVYAENNPDRDVVVIDMCP
                     QANSSSMLMGGGKDSELKLQQLISMNEPQTIVGYITEATLNGDADIAKYSTKLREVNP
                     NLSNNMYLISGDGNLELIAPLLSERAEATPLSAADNPWIKIHSIVRFLTKKPINSERP
                     CTFFIDTNPSFSIYTQLAIVGGEKLLVPINADDSSIFAITGLFNLIWGTAIIHPVYGK
                     YTFASKAKSHGLVLPKISFLLGNRFTQKKGAAHAFKALSNEAIDKMYSEYKKNPDKFE
                     DPVEHINNLQDFESAYSIELRDFNSAGVVAANQGLPLSKMDKHTYEVYGERIQVAKEQ
                     REKCREAIELLVTKL"
     gene            complement(441899..442186)
                     /locus_tag="Noc_0398"
     CDS             complement(441899..442186)
                     /locus_tag="Noc_0398"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56924.1"
                     /translation="MAKATRVLQSPTFKKAVKKLKANQKKDLDTAVKDLMADPALGEQ
                     KKGDLSFLRGYKFKMNKHLILLGYSFDDGALVLELMALSSHENFYRNIKQR"
     gene            complement(442179..442400)
                     /locus_tag="Noc_0399"
     CDS             complement(442179..442400)
                     /locus_tag="Noc_0399"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56925.1"
                     /translation="MATNSIRLDQHLIERATIIAKALNRTPPKQIEHWAKIGEMMEDN
                     PDLPYEFVKQAIIAKAEREAGKLETYDFG"
     gene            complement(442512..443507)
                     /locus_tag="Noc_0400"
     CDS             complement(442512..443507)
                     /locus_tag="Noc_0400"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56926.1"
                     /translation="MKFVVSYPQTNWDYVKFRLSRIIRGEDRSNDVFKGSMGGKIQLL
                     EHDGSFGGIRSIGEIYCDKPFGSQFVEGEGLYFLTGLPCPEDGTPGNEHIVRLNEQGQ
                     IDLEIRSPLFSQLRSIRRTENGLLVTSSGVDAILEVDFQGNILWSWWATEHGYDHAHG
                     GGMRVIDKTIDHRLKCYPGRLQTTHMNSAIIDPYDPAKIITVLFYQGALARIDRETLK
                     TEVVAEGLSGPHHIRPHSKGYIISNSRKGQVILFDRNFKSRKTIQATNQYFPIKWVQD
                     AIETPFGTHLIADCNTFRLRERSADGEEKTFKTHLPNRIFQIEPVSDSFALPNLV"
     gene            444098..445306
                     /locus_tag="Noc_0401"
     CDS             444098..445306
                     /locus_tag="Noc_0401"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="ABA56927.1"
                     /db_xref="InterPro:IPR001959"
                     /db_xref="InterPro:IPR006025"
                     /db_xref="InterPro:IPR010095"
                     /translation="MKLLSKIQDNLRKLECKSMLLAHKIELRPKASQAEYLNKSCGSR
                     RHCYNQLLEHFSKPDNKWSKAAAYQYYIKVIRPAYPWYNEVSSRVTRNAIDDLDDAFK
                     HFFRRVKKGGKPGFPKFKKKDINDSFALREKTKFEVKGRKLRIEKLKTLIPMRQRLRF
                     EGTPKQVAMSKQAGKYFASVLVDTTDYKDYSQNRSPSVGVDFGVKSLAVTSDNEVIPS
                     NNKLKKSLKKLKHLSRSLSRKRKGSNRRAIAKQRLAKLHYRIAQQRKAVLHELSHSLT
                     ANYDRIAIEDLNVKGMVRNRTLARSIADAGFGMLRQLIEYKAFLRGCTVELVDRFFPS
                     SRMCSGCGQLHDITLADRALACDCGLTIDRDLNAAINLNRYRRDTLKPDVKRTQEPSK
                     TALAASVWTV"
     gene            445303..446892
                     /locus_tag="Noc_0402"
     CDS             445303..446892
                     /locus_tag="Noc_0402"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase M48, Ste24p"
                     /protein_id="ABA56928.1"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR001915"
                     /translation="MNKPRFSEIILGFYERRVSFALWLLAAALLSACAINPVTGEREL
                     SLVSETQEIQMGEENYLTMRQMQGGDYTADPALTAYVSQVGQRLAAVSDRSLPYEFSV
                     INDSTPNAWALPGGKIALNRGLLTELNNEAELAAVLGHEIVHAAAGHSAQGMERDLLL
                     KGAVLGSVLATGVSEYTPLVLGGAQAAAQLVNRKYSRDAEREADLYGMRYMSRAGYDP
                     WAAVSLQETFVRLSEGQQENWLSGLLASHPPSLERVEANEMTARTLPAGGELGAERYQ
                     AKLAPLRQVETAYAAYDQGRKALQEGNLEQALSLAERAITEEPREALFYGLRGDVYLA
                     RKRYQEALADYNRAIKRNDHFFYFYNQRGLVNKALGHSEKARQDLQQSIALLPTESAN
                     KALGDLALTQGDRQGAMTYYQKAAASQTPLGLEARRALVYLDLPNNPQKYLAAQVKLN
                     RRGYLVVRVTNQAPLPVRDIGIEVRYLDSQGHVQSHKQAFQGILAAGQTARLKTNLGP
                     LSDPRALERIEAKVIQARIAN"
     sig_peptide     445303..445407
                     /locus_tag="Noc_0402"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.950) with cleavage site probability 0.654 at
                     residue 35"
     gene            446917..447942
                     /locus_tag="Noc_0403"
     CDS             446917..447942
                     /locus_tag="Noc_0403"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Metallophosphoesterase"
                     /protein_id="ABA56929.1"
                     /db_xref="InterPro:IPR004843"
                     /translation="MMKQTTYEYAASAGRAEAQEAEETSPLDQELLALKQLEQRVGAF
                     HFKRRLGTEGNYKTHASSQEQDSFHIENWYSIHFFIRTTLRCLALHGRGKRNALALRV
                     RHNDIPIKGLSPSFEGYTLLHLSDLHLDMNGQLPQVLIEQVQKVKYDICVITGDLRAK
                     TYGPYQPAIEAMAQLRTHLEAPVYGVLGNHDSLRMVPGLEAMGVRMLLNEAVPIERDG
                     EVGFYLAGVDDPHYYRADNPEKACAQIPESVPRILLAHSPEIYKRAAHCDFDVMFCGH
                     THGGQICLPGGIPVMVNARCPRRICAGPWRYRQMQGYTSVGSGVSIVDVRFNCPPEIT
                     LHRLRCT"
     gene            448476..449093
                     /locus_tag="Noc_0404"
     CDS             448476..449093
                     /locus_tag="Noc_0404"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56930.1"
                     /translation="MQLPDFIKDVVLLLLGGVGTAVWFFWRRRTEQAPVFENIHKAEK
                     LLSLRKELDNTNYTFEDLKSLEDALMERADVAKVLSISYEEEAKQVREIEMSTAMTQA
                     EMNIVAGNAYQSAERKLDAILEQIKEFLSPEESALLDEANQAWRTYQKSHADFSASQY
                     EGGSIQPLIYASTMETVTVARIVELEAELKFMKDTRVPNAEQDAL"
     gene            449181..449738
                     /locus_tag="Noc_0405"
     CDS             449181..449738
                     /locus_tag="Noc_0405"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56931.1"
                     /translation="MNESKSTTEVAISAFIHELSRMPATLSGEDSSLDSVWEEIKAQV
                     QNEESIYWDAYVETMSVLVEAYVEGLSADVLENLRDELYLDDDGDVGEGLFEALLDRA
                     GEEDVAYEPFDFEFFYYDVMGTTTYGQVLKRTSIWTAQVRVWSQVLPKGGEIGLISTS
                     AIECEISEDVFNFAKRAAWPKLSAK"
     gene            450015..451019
                     /locus_tag="Noc_0406"
     CDS             450015..451019
                     /locus_tag="Noc_0406"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56932.1"
                     /translation="MTGVRIDDALADWGNLAKENWQSLLLGNGFSINVWSGFNYDSLL
                     QVARQDDLEHQLNEESVTLFDHVGSSNFEDVLRILFHARMVDEQLGRPQGDEIEAIYQ
                     NTKRALADAVNYSHVAYGQFNAAAINEQLGGYDDVFTTNYDLIPYWSIMHEGVDRFRD
                     FFWGADGVFELCNTEVFPRRTKIHYLHGAIHLVELPDGRTKKLATNQNGNLLELFDLN
                     ARDQFPLFISEGHWQQKLSRICKNDYLRFCFSNLSGLEGNAVIIGHSLHRDYDQHIID
                     AISQSSVDRLAIGVWPHQRAEVILDFKARIIEQLHQKSLDFFDSESHPLGSEVLRVEK
                     "
     gene            451070..451612
                     /locus_tag="Noc_0407"
     CDS             451070..451612
                     /locus_tag="Noc_0407"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56933.1"
                     /translation="MSQAKSSFEHGIKDAEELLAHFDAINCNPPPANAEVLKRAGLVM
                     ALTAWETYVEDRITEAMDKRLNVVSGSYVGEFIQKKLQQELKQFHNPTSDKTKKIFQD
                     YLGLDVTSAWFWANVTPEKARKSLNQWISKRGDAVHRSKPINNGSSAAHLIKKDELEK
                     VIRFLRELVRATDDYLEQNL"
     gene            451696..452286
                     /locus_tag="Noc_0408"
     CDS             451696..452286
                     /locus_tag="Noc_0408"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56934.1"
                     /db_xref="InterPro:IPR000413"
                     /translation="MKALSIEEIESARAKLLSNAESLFAESQLLYKHGFFPRAYCLAH
                     LCCEELAKIPMLVGAGLDLVNGEEVDWEKLHHRLKRHQDKINAMHVHDYFQSEIRADD
                     SDVREHEAALKTTPHLNDMKNNSLYAGLVDSVFREPREVVTQDDAIKLMNITHERLKY
                     IQAVEQVSLGKISTSKTGAKMRRFLKEYNKLRKADA"
     gene            452359..452760
                     /locus_tag="Noc_0409"
     CDS             452359..452760
                     /locus_tag="Noc_0409"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56935.1"
                     /translation="MYAGEPARQLPDYVLGEKMSFINTEVIRGITGVSEEDQASIKSF
                     LQGAVYCWCKNRKDEWFSLRDLMGGENFYWQGTPLISLYEKHEAKGSEDPVKDAGKDA
                     GWLLKAVIGSDLRQFDTKKEDLIRKYRWAGE"
     gene            453624..453887
                     /locus_tag="Noc_0410"
     CDS             453624..453887
                     /locus_tag="Noc_0410"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF497"
                     /protein_id="ABA56936.1"
                     /db_xref="InterPro:IPR007460"
                     /translation="MYTFEFDERKSNGNRRKHGIDFVEAQALWSDPYLMEIPALTSDE
                     ERFLVIGKIEGKHWSAVITPRNGNIRIISVRRSRVEEVAIYEG"
     gene            453877..454110
                     /locus_tag="Noc_0411"
     CDS             453877..454110
                     /locus_tag="Noc_0411"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix protein, CopG family"
                     /protein_id="ABA56937.1"
                     /translation="MKAKSFDAKFEKGEDVTKSLDLSKARRPLQEQRRVNVDFPAWMV
                     ESLDREAGRLGVTRQSVIKVWLAERLEQIASNK"
     gene            454435..454638
                     /locus_tag="Noc_0412"
     CDS             454435..454638
                     /locus_tag="Noc_0412"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56938.1"
                     /translation="MARKIRELVQDLKEVGFYEISGGGKGSHRKFTHTKYAGAVTLSG
                     KSGDDAKPYQEKQVKQAIETVKK"
     gene            complement(455465..455866)
                     /locus_tag="Noc_0413"
     CDS             complement(455465..455866)
                     /locus_tag="Noc_0413"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="PilT protein-like protein"
                     /protein_id="ABA56939.1"
                     /db_xref="InterPro:IPR002716"
                     /translation="MILADTGVWIDYFNGAVNEKTDLLDFALDEGTIAMGDLILLEIL
                     QGFREDSEYKKAKRTLTTLDQYELFGHHMVDKCADNYRFLRKKGITIRKTADLIIATF
                     CIENRFQLLFSDKDFAPFADYLNLEQFQPKT"
     gene            complement(455863..456141)
                     /locus_tag="Noc_0414"
     CDS             complement(455863..456141)
                     /locus_tag="Noc_0414"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56940.1"
                     /translation="MSPAAVCCGFIFASLYNVYLLTNYTHTPMRTNIVIDDKLMAEAL
                     KATGLRTKKEAVEEGLKLLVKRNKQQAIRKLRGKLHWEGDLEELRGGK"
     gene            456683..456919
                     /locus_tag="Noc_0415"
     CDS             456683..456919
                     /locus_tag="Noc_0415"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="putative plasmid maintenance system antidote
                     protein VapI"
                     /protein_id="ABA56941.1"
                     /db_xref="InterPro:IPR002197"
                     /translation="MGLSVTEAARHLGISRKTLSKVLNGRGVITPEMALRLEMAFGKP
                     NAAHWLRLQNAYDLWQTRQHCADMHVTPVKTHVA"
     gene            457148..457426
                     /locus_tag="Noc_0416"
     CDS             457148..457426
                     /locus_tag="Noc_0416"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Plasmid maintenance system killer"
                     /protein_id="ABA56942.1"
                     /db_xref="InterPro:IPR007711"
                     /translation="MILSFKCKDTEKLANGRRIRRFVNFERVALRKIRQLQAASQLDD
                     LKVPPGNMLEALSGDRQGQHSIRINRRFRVCFRWAKAGAEDVEIIDYH"
     gene            457440..457754
                     /locus_tag="Noc_0417"
     CDS             457440..457754
                     /locus_tag="Noc_0417"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, XRE family"
                     /protein_id="ABA56943.1"
                     /db_xref="InterPro:IPR001387"
                     /translation="MRNIDAVTPGELLKEEFLEPMGISQYRLAKEIGVPAQRISQIIA
                     GKRSITADTDLRLCRFFGLSNGYWLRAQAAYDTEIAKDALEDQLKNIRPWDSVPEIGP
                     RA"
     gene            457791..458272
                     /locus_tag="Noc_0418"
                     /pseudo
     gene            complement(458787..459503)
                     /locus_tag="Noc_0419"
     CDS             complement(458787..459503)
                     /locus_tag="Noc_0419"
                     /EC_number="2.1.1.72"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase N-4/N-6"
                     /protein_id="ABA56944.1"
                     /db_xref="InterPro:IPR001091"
                     /db_xref="InterPro:IPR002295"
                     /db_xref="InterPro:IPR002941"
                     /translation="MSVYSHARGIGDLPSVSEKKSIPFDRKIKMDGLKFLGRLVDNSV
                     PAAFFDPQYRGVMDKLKYGNEGSRQQLRAQMKQMPEETIFDFVSEIARVLCPSGHLFL
                     WIDKFHLCEGTSSWFDGTPMKTVDLITWDKERIGMGYRSRRKAEYLLVAQKKPVRAKG
                     VWTNHSIPDVYQEKFQRDMSFAHPKPIGLQAKLIDAVTNSGDVVIDPAAGSFSVLAAA
                     QQTGRKFLGCDIALGEFEWS"
     gene            459864..461609
                     /locus_tag="Noc_0420"
     CDS             459864..461609
                     /locus_tag="Noc_0420"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Amidohydrolase-like protein"
                     /protein_id="ABA56945.1"
                     /db_xref="InterPro:IPR011550"
                     /translation="MKVSMRIPSKLLLSLMAVTLLITLAFSSTKAAPDTGSSTLYYGG
                     SILTMEGSAPSYAEALVVKDGRILFVGTKTQAEHLAGAAAKKVDLDGRALLPGFIDAH
                     GHVFNAGFQKLAANLLPPPDGGGKDVASLVALLKEWQDKNAAAIKKSGWIIGFGYDDS
                     RLAEGRHPTAKELDQVSTELPVVIIHQSGHLAAMNHKGLELAGITAETNDPVGGVIRR
                     QADGKTPNGVLEEMASFGPIFKILGALDSEANEKIALAGVDAYTQHGFTTAQEGRANK
                     AATETWRKLADERKLKIDVAVYLDLQSEIEYIKQVGIHEDYTHHFRVAGVKLSLDGSP
                     QGKTAWLSKPYLNPPPQKPDSYTGYPAIPSDKERQALFNLAYQKNWQLLVHCNGDAAA
                     EAMIDAVAVASEKYGKDDRRTVMIHAQTVRESQLERMKKLGILPSFFSMHTYYWGDWH
                     RDETLGPERAARISPTASALKRGMRFTEHHDAPVALPSAIMILHTTVNRTSRSGEVIG
                     PDQRVSPYQALKSITDWAAWQYFEQDSKGTLTKGKLADLVILDQDPTQVDPATIMNIR
                     VLETIKEGQTVYKAQ"
     sig_peptide     459864..459959
                     /locus_tag="Noc_0420"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.901 at
                     residue 32"
     gene            complement(461778..462260)
                     /locus_tag="Noc_0421"
     CDS             complement(461778..462260)
                     /locus_tag="Noc_0421"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56946.1"
                     /translation="MDLLSPLLLLMVANGAPVVTALLLKNRFNQPLDGNLHLPDGYPL
                     FGASKTIRGIVAALLATAFIAPLFNFSFITGALVGFWAMVGDLLSSFIKRRLGRQPSS
                     AHMPGLDHIPEALLPLCFLRSQMLLSWPEVALIILAFTLLDLFLWFLLNRLYSLFHSR
                     "
     gene            complement(462337..463131)
                     /locus_tag="Noc_0422"
     CDS             complement(462337..463131)
                     /locus_tag="Noc_0422"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF980"
                     /protein_id="ABA56947.1"
                     /db_xref="InterPro:IPR006025"
                     /db_xref="InterPro:IPR010384"
                     /translation="MLIISLARTLKAYWRRRIINRHPIPLAHWEAAVACLPLLQGLSL
                     AELSHLRDLSTLFLHHKSIYGAQGFKVNEKMRLVVAIQASLLILCLDWDDYRHWRTVL
                     LYPGAFVAKREERDESGIVHAVQHPLIGESWDRGPVILSWDDVAHTMAPSESPSNVVI
                     HEFAHLLDMGNGAANGMPPLHRTMNRRTWTSVFFQAYKNLNERWAAGEPIPLDSYALE
                     SPAEFFAVASEVFFVSPQKLQTALPQIYHQLQLYYRQDPASRTLLF"
     gene            complement(463191..463691)
                     /locus_tag="Noc_0423"
                     /pseudo
     gene            464030..464764
                     /locus_tag="Noc_0424"
     CDS             464030..464764
                     /locus_tag="Noc_0424"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56948.1"
                     /translation="MLTDFLLVLTYALLPAGGNLIGVALAEHLRSPRWVIGAALHGAA
                     GIAIALVAVDLMPRILETIPMWVIVIAFLCGAGFSLLLWQGARALRGQFGGTRTGALM
                     VYIVIGADLFSDGLMTGAGSAITSDLGLLIGMTQAVANIPGGFATTKNLQDNKVPRGR
                     RWLLCFFMFLLVAASATMGFWLLGGQNDFVQHAALAFIVGLLLLATIEDMIPEGDRPQ
                     PSRWISTLSFAGGFVGLSLAVAYLSL"
     gene            464775..465050
                     /locus_tag="Noc_0425"
     CDS             464775..465050
                     /locus_tag="Noc_0425"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleic acid-binding protein contains PIN
                     domain-like protein"
                     /protein_id="ABA56949.1"
                     /db_xref="InterPro:IPR002850"
                     /translation="MDQPPARPERYCCEGCGSYSGMIRLLGGIVRVVPITYRVAACRD
                     PKDDKFLNVALNGEAEIIVTGDADLLTLNPFHEVDIIAPAAFLKRAE"
     gene            465199..467142
                     /locus_tag="Noc_0426"
     CDS             465199..467142
                     /locus_tag="Noc_0426"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycosyl hydrolase, BNR repeat"
                     /protein_id="ABA56950.1"
                     /db_xref="InterPro:IPR002860"
                     /translation="MRYVWIVLLLVATFGTASYGGKSAIHTEEVDPSVLPPIYVDEDE
                     WGNLFRTSLTFDPESGTYTIEEVYLDEADIAELRAEGFRIGISPAEPSTTQAAPWRPL
                     CPEEVSCVEPQIFMTPGRSELLPPALAPLVRTDSVWLQYSDKFKFEPYQNRPRGIFRL
                     HPPQTALEILLPLKDSPLETPNPDPDSSDVDEVFDPPNIQPTYLNVSDFNAIEAEDGS
                     TLVFGLYGMFRLSPEGELIDALNWAGRSIVGLNNAAFTGPPVRVQDSLFVGIRGAGGQ
                     YIYHSEDDGLTWQEQLASHRLGDDRYNLVANPEGTGLWAITSEFFDRPAELRESLDLG
                     ATWQRVDDGSFPAHTVRVAHDPGDPQVAYALSGQGLYRSEDRGVSWHLTALQEPVHGL
                     AFVPQEAPLPPLLVAGTDTGVKVTPAPFSDWKAWKPLSNGLLAIPHTVVYTDGLLIGV
                     SAAGYFVCPQTDCFGEGQVVPAEEARGEAKVTEFFNVDLGHYFMTASPEDVATIEAGG
                     AGPGWERTGHTFQAWSLLGSNVGVYLCRFYGSVSPGPNSHFFTPSPQECGLLLDLQAQ
                     TPPTAPRWNFEGYAFMAIPAQGKGEAQHCPEAFAPVYRAYNNGFARGEESNHRFVTDR
                     TLLTPLVAGGWVEEGIAFCVPPQ"
     sig_peptide     465199..465261
                     /locus_tag="Noc_0426"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.859) with cleavage site probability 0.747 at
                     residue 21"
     gene            complement(467199..469688)
                     /locus_tag="Noc_0427"
     CDS             complement(467199..469688)
                     /locus_tag="Noc_0427"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF214"
                     /protein_id="ABA56951.1"
                     /db_xref="InterPro:IPR003838"
                     /translation="MKILAFSLATLKRDWRSGEIRLIAMALIIAVSAVTTVNFFVERL
                     RQAMETEAGTVLGGDLVVESREPLPETFTTQAHTLGLKTSQTVSFRSMVPAGDRLQLT
                     EIKAVEENYPLRGRLMVGEDPFTEPGATKQTPPPGTVWMDPQLTQTLQRTVGDEIDLG
                     QLRLVVDKLLFLEPDRGTQVFNIAPRLLINFKDVERTGLLLPGSQARYRLLLAGPQRE
                     ILSYKHWAGIHAPDHARVMGVRDGRPELRTALQRADQFLTLAALTSVFLAGVAIAIAA
                     RRYADRHQDNCAIMRCLGATQRWIIQTYAMTMLWLGLITSLLGCVVAWLAQSVLAYLM
                     IQLFQSELPPASLLPLLTGTLTGLIALLGFALPPLMRLKDVSPSRVLYRDRESAQQGG
                     YKVYLGAFIAIAALIPWRSGEMTLTLYVLGGSLLTVSVLAACSWLLINGLKLLRPRVG
                     VAWRYGLASLARRAGSSIVQTIALGLGIMVMLLLTVVRSDLLANWQANLPPDAPNHFV
                     INIQPDQVEAVQTFFAEQGQPVPRLYPNIHGRLIAINGTPIAERSYRDPRAQRLSQRE
                     FHLTWAAKLQTDNHIVAGDWWSSQPSPPPQFSVEVDLAETLGIKLGDSLTFQVAGKKI
                     EAPVSSLRAIEWNSFNPNFFVMASPGLLDDSPGTYLTSFYLPEGNNALPTALVKQFPS
                     VTILDVKALMAQIRTIIDRVTLAVEFIFIFTVAAGLVVLFAAIQSTNDERRHESAVFR
                     TLGASRGTIVRGLAAEFLSLGAVAGTVAAIGALAIGYVLAERVLHTGFHFNGWLLILG
                     LLAGSLGVSLAGLLGTRSVLQVPPSETLRQV"
     gene            complement(469685..470404)
                     /locus_tag="Noc_0428"
     CDS             complement(469685..470404)
                     /locus_tag="Noc_0428"
                     /EC_number="3.6.3.25"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, ATPase subunit"
                     /protein_id="ABA56952.1"
                     /db_xref="InterPro:IPR001687"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MANNLIIRAEHLTKRVESPEGLLTILDDISFSIAPAEALAVIGA
                     SGSGKSTLLGLLAGLDTPTSGRVILDGVDLQTLDEDGRAQLRSDRVGFIFQSFHLLPN
                     LTALENVMLGLELGGHTQPREAALAELAAVGLGSRTGHYPNQLSGGEQQRVAIARAFA
                     PRPSILFADEPTGNLDSQTSAKISDLLFTMKREHGATLVLVTHDKTLTKHCDRTLALD
                     NGRLLPSSSNRRSLLPWKQTS"
     gene            470424..471032
                     /locus_tag="Noc_0429"
     CDS             470424..471032
                     /locus_tag="Noc_0429"
                     /EC_number="3.1.1.2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Arylesterase"
                     /protein_id="ABA56953.1"
                     /db_xref="InterPro:IPR001087"
                     /translation="MGLLLQPIVPGAAAQPAIIILGDSLSASYGLSLEQGWVARLQER
                     LLRKGYPYQVVNASISGETTRGALARLDSLLAAHQPEIVVVELGGNDGLRGLSLTEMR
                     RNFSRIIEKSQQSGAQVLLVRMRLPPNYGPLYTERFEQLFTDLKDEYGVATAPFILRG
                     IATQAELMQADGIHPRAEAQTLMLDNIWPALTPLLQVDKAEK"
     gene            471114..471539
                     /locus_tag="Noc_0430"
     CDS             471114..471539
                     /locus_tag="Noc_0430"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Class I peptide chain release factor"
                     /protein_id="ABA56954.1"
                     /db_xref="InterPro:IPR000352"
                     /translation="MITVTPHIQLREEELHFQFVLASGPGGQNVNKVATAVQLRFDAA
                     HSPSLPEDVRQRLMKLAGNRLTKEGELLITAKRFRSQERNRQDAIKRLVALLQQAAEK
                     PKPRRLRKPSRAAKQRRLEEKRRRGEQKQARRSVKVLPD"
     gene            complement(471644..471820)
                     /locus_tag="Noc_0431"
     CDS             complement(471644..471820)
                     /locus_tag="Noc_0431"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56955.1"
                     /translation="MEKERYVEPGYVEEEYVPEPLKVRLTPEEEKAIGQNPVELIWLA
                     EQVYEYWRANTPSA"
     gene            471992..472432
                     /locus_tag="Noc_0432"
     CDS             471992..472432
                     /locus_tag="Noc_0432"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56956.1"
                     /translation="MKDNTITPDPTYKTYLLSNEWHSVIIGFFIGIFMITIYFWMASG
                     FINLLIHLYHSYPDNWTHEAENMIKDTVVILASFELIRVFQSYLLIGRVKVTFILDVA
                     LVVLIGELISLWYVENDANEVLLNIFVIASLIAFRIITTKFSPD"
     gene            complement(472856..473125)
                     /locus_tag="Noc_0433"
     CDS             complement(472856..473125)
                     /locus_tag="Noc_0433"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56957.1"
                     /translation="MYAIVVHRRAARYLRKLPQDQQVKIKHVLAQMKNGPLGLSGIKS
                     MVGDWAGYRRIRVGNVRIIFWIDELKNVVYVDHIGPRGDVYKDKT"
     gene            complement(473128..473394)
                     /locus_tag="Noc_0434"
     CDS             complement(473128..473394)
                     /locus_tag="Noc_0434"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56958.1"
                     /translation="MISKPEESCQVRRPVRRCGVNALMNIHKKIVVDEQGNPQEVIIP
                     WDEFQELAEILGLDLDSEDLEDLRQAREDRESGKRDAYIDLDSI"
     gene            complement(473378..474433)
                     /locus_tag="Noc_0435"
     CDS             complement(473378..474433)
                     /locus_tag="Noc_0435"
                     /EC_number="1.1.1.2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Zinc-containing alcohol dehydrogenase
                     superfamily"
                     /protein_id="ABA56959.1"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /translation="MKAFVMLNIGQVGVVEKDRPTCGPLDAILRPTKGLICTSDVHTV
                     HGAVGERENLTLGHEAVGVVEEVGALVANFKQGDRVAVGAITPDWGSDAAQGGHSSQS
                     GGALGGWKFANIKDGTFAEYVHVNEADANLALIPKGVPDESAVYVCDMMSTGFMAAEN
                     AKIPIGGNVVVFAQGPVGLMCTVGARLQGAGFVIAVESVPKRQELARHFGADEVVDFT
                     KVDVVERILELTNGEGVDAAIDALGTSQVLQQCVKVTKPGGMISNAGYHGDGEFVEIP
                     RVEWGVGMAEKDIATGLCPGGHLRLSRLLRLLETGRIDPTPMTTHTFGFDEIEKAFRM
                     MEKKEDGMIKPMIDFEA"
     gene            complement(474660..474935)
                     /locus_tag="Noc_0436"
     CDS             complement(474660..474935)
                     /locus_tag="Noc_0436"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56960.1"
                     /translation="MGKETRLFKSEESKKRAEVSEFLRQIAERIEKGKIVLRQGTEEL
                     VLQIPENLILEVQVEDEDKKTKGIQHSLEIEIKWFDNDGPSGSLELG"
     gene            complement(475351..475638)
                     /locus_tag="Noc_0437"
     CDS             complement(475351..475638)
                     /locus_tag="Noc_0437"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Plasmid maintenance system antidote protein"
                     /protein_id="ABA56961.1"
                     /db_xref="InterPro:IPR001387"
                     /translation="MHNPPHPGEFIREVYMEPFHITGRTLSRKLGVSPSTLNRLLKGS
                     SGVSPEMALRLSKTLGRSAESWLTMQNNYDLWQAKRTVNLDIVEKIEFDAA"
     gene            complement(475644..475922)
                     /locus_tag="Noc_0438"
     CDS             complement(475644..475922)
                     /locus_tag="Noc_0438"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Plasmid maintenance system killer"
                     /protein_id="ABA56962.1"
                     /db_xref="InterPro:IPR007711"
                     /translation="MIKSFRHKGLQRYFESGSKAGIQPKHAKRLRMQLVALDTATTIE
                     DMDIPGFKLHSLKGSNEGRWSIWVNGNWRVTFEFRDRNAFILDYEDYH"
     gene            complement(476041..477645)
                     /locus_tag="Noc_0439"
     CDS             complement(476041..477645)
                     /locus_tag="Noc_0439"
                     /EC_number="2.1.1.72"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Type I restriction-modification system M
                     subunit"
                     /protein_id="ABA56963.1"
                     /db_xref="InterPro:IPR000051"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR002296"
                     /db_xref="InterPro:IPR003356"
                     /db_xref="InterPro:IPR004546"
                     /translation="MTRDQLSQLGKTLWAIADDLRGAMNADDFRDYMLSFLFLRYLSD
                     NYEAAAKKELGPDYPKLADDDRRAPLAVWYEDNAEDVAAFEKQMRRKMHYVIHPDYLW
                     SSIAELARTQDEELLQTLAGGFKHIENESFASTFQGLFSEINLRSEKLGRTLADQNRK
                     LCTIITKIAKGIARFSTGSDILGDAYEYLIGQFAAGSGKKAGEFYTPQSVSTILSRIV
                     TLDSQEPSTGKKKKLNRVLDFACGSGSLLLNVRNQMGPRGIGMIYGQEKNITTYNLAR
                     MNMLLHGMKDTEFQIHHGDTLENDWAILNERNPAKKLQCDAVVANPPFSYRWEPDEAM
                     GEDFRFESHGLAPKSAADFAFLLHGLHFLSDEGTMAIVLPHGVLFRGGAEARIRTKLL
                     KDGHIDTVIGLPSNLFFSTGIPVCILVLKKCKKPDDVLFINASEHFEKGKRQNALRPV
                     DIDKIVDTYQYRKEEERYARRVSREEIEKNDDNLNISRYVSTAKPEPEVDLDDVHKKL
                     TAIEQRISQTTETHNQFLKALGLPIL"
     gene            complement(477642..478046)
                     /locus_tag="Noc_0440"
     CDS             complement(477642..478046)
                     /locus_tag="Noc_0440"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="PilT protein-like protein"
                     /protein_id="ABA56964.1"
                     /db_xref="InterPro:IPR002716"
                     /translation="MLRYLLDTNICIFTIKNRPARVRERFKQFADQLCISSVTWMELV
                     YSVERSANPQHNLAIAEGLAARLSVLDYDVEAASHTGQIRAELARRGTPIGPYDQMIA
                     GQARSRGLVVVTNNTCEFARVPGLRCEDWTKP"
     gene            complement(478046..478276)
                     /locus_tag="Noc_0441"
     CDS             complement(478046..478276)
                     /locus_tag="Noc_0441"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="putative plasmid protein"
                     /protein_id="ABA56965.1"
                     /translation="MEHTKLFKSNRSQAVRLPKAVAFPADVTDVDIVAIGRARLITPA
                     GDAWDVWFDGPAVSPDFMDDRDQPDEQEREAF"
     gene            complement(478400..479554)
                     /locus_tag="Noc_0442"
     CDS             complement(478400..479554)
                     /locus_tag="Noc_0442"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase"
                     /protein_id="ABA56966.1"
                     /db_xref="InterPro:IPR001959"
                     /db_xref="InterPro:IPR010095"
                     /translation="MIIQCAYKFRFYPTPTQKRQLALEFGHARYVWNWALETRTKAYQ
                     AQGESSNTISLSRQLTALKKTQCPWLSEATASCHTQKLRDQDTAFRNFFAGRAKYPRF
                     KKRHHTQSVRYQLDQRHVAKNFNAESKLLKLPKLGRVKLRWSRGIEGIPKMVTVSQAP
                     AGRYFVSLTCEVEILPLPVRRNAIGVDVGVKDVVITSEGWKSGAPKYTYHYARQLKMA
                     QRRLSKKKKGSQRRRQQQQRVARIHARITDSRRDFLHQQSSKIVNENQVICLEDLNIQ
                     GMLRNRRLSKAIADCGLYELRRQMEYKAAWYGREVLIVDRWAPTSKTCSACGAVQESM
                     PLKVRAWACECGATHDRDINAAKNILFFGTAGSAGTSKARGAVKPPRAVA"
     gene            complement(479823..479963)
                     /locus_tag="Noc_0443"
     CDS             complement(479823..479963)
                     /locus_tag="Noc_0443"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56967.1"
                     /translation="MSKDQLSQLGKTLWAIADDLREAMNADDFRDYDTSVYPIDISKQ
                     FP"
     gene            complement(479999..480274)
                     /locus_tag="Noc_0444"
     CDS             complement(479999..480274)
                     /locus_tag="Noc_0444"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Plasmid stabilization system"
                     /protein_id="ABA56968.1"
                     /db_xref="InterPro:IPR007712"
                     /translation="MNKALQNLDAEAAYIAQDNPAAARRVVQTIVDAINLLSDNPALG
                     RPGRVPGTRELVVADTHYLVPYRVRPRLQQIEVLRVFHTSRRLPEHW"
     gene            complement(480279..480521)
                     /locus_tag="Noc_0445"
     CDS             complement(480279..480521)
                     /locus_tag="Noc_0445"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Helix-turn-helix protein, CopG"
                     /protein_id="ABA56969.1"
                     /db_xref="InterPro:IPR002145"
                     /translation="MTTTMTLRLDPELKNRLDQLAKAMHRSKSFLAVQALQDFIELNE
                     WQVGEIESAIKEADQGDFASQQAVSQTLSKWRVGGS"
     gene            complement(480607..481911)
                     /locus_tag="Noc_0446"
     CDS             complement(480607..481911)
                     /locus_tag="Noc_0446"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Restriction modification system DNA specificity
                     domain"
                     /protein_id="ABA56970.1"
                     /db_xref="InterPro:IPR000055"
                     /translation="MSKAMKNDKQMRVPKLRFPEFRDAGEWEKVALSTQVELLSGLHL
                     SPDGYTDTGDIPYFTGPSDYTNDLALVSKWTTRSANVGRAGDTLITVKGSGVGELLNL
                     ELDEVAMGRQLMAVRARTAHGEFIFHFLITQRLRLIALASGNLIPGLSRGDILSLKVP
                     VPSHEEQQKIADCLSSLDALIAAQTEKLDALKTHKKGLMQQLFPRAGETVPRLRFPKF
                     RDGGRWTSKKMSDVYRFLSTNTYSRDKLNYEKGEVKNIHYGDIHTKFSTLFDVTQEYV
                     PYINRTESLERIKDDSYCLEGDIVFADASEDVEDVGKSIEIVNTGNEKILSGLHTLLA
                     RQKNNDLVIGFGGYLFKSGLIREQIKRESQGAKVLGISSGRLSKIKVCFPYEKREQQK
                     IAHCLSSLDALIAAQAEKIDALKTHKKGLMQQLFPSLEEVHA"
     gene            complement(481904..482395)
                     /locus_tag="Noc_0447"
     CDS             complement(481904..482395)
                     /locus_tag="Noc_0447"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system
                     endonuclease"
                     /protein_id="ABA56971.1"
                     /translation="MLFSSALIDYDYIMGLAARFSQEKPGKQTMSREQLVSMLAASSN
                     LMEERDHIIAYINSLQAGEGLSEEAIRDGYQAFKAQKADSELSNMAARHNLQAGTLKA
                     FVEAILDRMIFDGEQLSDLFAPLELGWKARSKAELALMEELAPFLKKQAQGREISGLA
                     AYE"
     gene            complement(482374..484992)
                     /locus_tag="Noc_0448"
     CDS             complement(482374..484992)
                     /locus_tag="Noc_0448"
                     /EC_number="3.1.21.3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Type I site-specific deoxyribonuclease HsdR"
                     /protein_id="ABA56972.1"
                     /db_xref="InterPro:IPR004473"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR007409"
                     /db_xref="InterPro:IPR011545"
                     /translation="MIQKESDIEEKLIHKLQELKYTYRPDIRDKTALEQNFREKFEAL
                     NHVRLTDAEFARLRDEIVNADVFQAAKTLREYAHFQRENGTSLDYMLVNLKDWCKNDF
                     EVINQLRINTDNSHHRYDVILLLNGLPVAQIELKTIGINPRRAMEQIVQYKNDPGNGY
                     ANTLLCFMQLFIVSNRGNTYYFANNHSQHFAFNADERFLPIYQLASEDNRKITHLDDF
                     AEQFLAKCTLGQMISRYMVLVASEQKLMIMRPYQIYAVKAIVDCIHQNRGNGYIWHTT
                     GSGKTLTSFKASTLLKDNPDIEKCLFVVDRKDLDRQTRQEFNKFQEGCVEENTNTETL
                     VRRLLSEDYADKVIVTTIQKLGLALDENSKRNQQRKDRGKSTYKERLKPLGDKRMVFI
                     FDECHRSQFGDNHKAIKAFFPKAQLFGFTGTPIFEDNANHKQIDGTIGSYRTTQDIFE
                     KQLHAYTITHAIDDRNVLRFHIDYFKPESARTKESAHAANNGKKQPKAKPGEAITQQA
                     VVESILDKHNAATHQRRFNALLATSSINQAIAYYKLFKAEQAAPQEQDPAFQPLNIAC
                     VFSPPADGNKDVKQLQEDLPQEKADNQQEPEKKKAALKTIMADYNAQYGGNHSISEFD
                     LYYQDVQQRIKDQQYPNSDYPHQNKIDITIVVDMLLTGFDSKYLNTLYVDKNLKHHGL
                     IQAFSRTNRVLNDTKPYGNILDFRSQEKAVDEAIALFSGEETSRSREIWLVDPAPKMI
                     EKYEQAVAGIKQFMAQQGVPNHVANEEENNKVLEPKAVYNLKGDAARAEFVNRFKEVQ
                     RLKTQLDQYTDLDEAQAEKINRLLPEEALRALRGSYLETAQRLKDQQGKSGRKPAMPR
                     KPSSSSILSLCSFPRR"
     gene            complement(485289..485585)
                     /locus_tag="Noc_0449"
     CDS             complement(485289..485585)
                     /locus_tag="Noc_0449"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56973.1"
                     /translation="MAEKFSHYDSADYLETEEDIRLYLEACQDEGGDDPAFIVHTLGV
                     VARARNMSQLARDSGLTRAGLYKALSPEGNPSFATVQKVAKGLGLKLTIQPISQ"
     gene            complement(485588..485884)
                     /locus_tag="Noc_0450"
     CDS             complement(485588..485884)
                     /locus_tag="Noc_0450"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF891"
                     /protein_id="ABA56974.1"
                     /db_xref="InterPro:IPR009241"
                     /translation="MIEVVKSETFNCWLKKLRDRRAAVRISARIDRLAFGNPGNVQPI
                     GEGLSEMRIDYGPGYRVYYMQQGKVLVLILCGGDKRTQQEDIAKAKRIAEEWKG"
     gene            complement(486289..486705)
                     /locus_tag="Noc_0451"
     CDS             complement(486289..486705)
                     /locus_tag="Noc_0451"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutathione-dependent formaldehyde-activating,
                     GFA"
                     /protein_id="ABA56975.1"
                     /db_xref="InterPro:IPR006913"
                     /translation="MTISGRCLCGTVSYECSSDPVLQFNCHCHDCQKSTGAAYAPVMF
                     FKREDLHINGPLSYFESFGGSGKKIRRGFCPKCGAQVIGDAEIAKPLISIRAGTLDDT
                     SLYNPRADIYCSQAANWDCMSKDLPKYPAMIESQNV"
     gene            complement(486789..487001)
                     /locus_tag="Noc_0452"
     CDS             complement(486789..487001)
                     /locus_tag="Noc_0452"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function UPF0150"
                     /protein_id="ABA56976.1"
                     /db_xref="InterPro:IPR005357"
                     /translation="MKYAVVIEQGESSYGAYVPDLPGCVAAGETREEAIKLIQEAVEF
                     HTQGLKEDGEDIPASTSSIEIIEVAA"
     gene            complement(487012..487200)
                     /locus_tag="Noc_0453"
                     /pseudo
     gene            complement(488237..489145)
                     /locus_tag="Noc_0454"
     CDS             complement(488237..489145)
                     /locus_tag="Noc_0454"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein, putative"
                     /protein_id="ABA56977.1"
                     /translation="MREFARFIMRGRLYAIATAGLFGALAVALPPLSLFSGATVGLTT
                     LRHGMKEGLSITAGATLVVAAIFLAITGRADLSLLLLLGLWLPNTLGCWILRITQSQA
                     STLLMVGGFSALFVVSMHALTGDVTAWWQQWIEQAMTRANIEGVTVEEIAQEGALTLM
                     NGLVAMIFGLNLMLTILLARWWQSLLYNPGGFAKEFYELRLPRILTYLTVLLSAPVLT
                     GALGERGHILTDLFIVAVMMYLFQGLAAMHSMTAARNLSQWWLLPIYLGLFLLPPHFI
                     IGLALVGVVDGLINLRGNPPPPPTKA"
     sig_peptide     complement(489035..489145)
                     /locus_tag="Noc_0454"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.986) with cleavage site probability 0.400 at
                     residue 37"
     gene            489943..490914
                     /locus_tag="Noc_0455"
     CDS             489943..490914
                     /locus_tag="Noc_0455"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Patatin"
                     /protein_id="ABA56978.1"
                     /db_xref="InterPro:IPR002641"
                     /translation="MISENVGHGLEITTPNSSQSPPCIGIALGGGAARGWAHIGVLRA
                     LAEKGIVPDVVAGSSIGALVGAAYGAGTLDNLERWVRSLTWRDTVGFFDIRLRGGLIE
                     GKKLFKFLARYFPYEEIQDLPMPFAAVATNLENGREVWLQQGSLLEAVRASAALPGLL
                     TPVNWNGHWLVDGGLVNPVPVSVCRALGATRVIAVDLNAGLLGRRVVVRSADQPRLLA
                     APNPRGLGSALTQALWASFGSESEGQNESQGMDIPPSLLDIVANSINIMQVHITRSRL
                     AGDPPDLSITPRLNDLALLDFHRAEEAIAEGQEAVARVRAELATLIR"
     gene            490951..491496
                     /locus_tag="Noc_0456"
     CDS             490951..491496
                     /locus_tag="Noc_0456"
                     /EC_number="2.4.2.8"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoribosyltransferase"
                     /protein_id="ABA56979.1"
                     /db_xref="InterPro:IPR000836"
                     /translation="MGDSLEKIQLLYREADRLYTQSQVEAALDRLAGEITAELSRHNP
                     LLLCCMVGGMIPCGCLLPRLDFPLQLDYIHVTRYQGAIKGGALHWLRKPRVSLRDRVV
                     LVVDDILDEGHTLTAIREYCQGEGAKVYSAVLVDKRHGRKQGAPADFVGLETGDRYLF
                     GYGMDYKEYLRNAPGIYAVKG"
     gene            491510..492250
                     /locus_tag="Noc_0457"
     CDS             491510..492250
                     /locus_tag="Noc_0457"
                     /EC_number="2.4.2.28"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="methylthioadenosine phosphorylase"
                     /protein_id="ABA56980.1"
                     /db_xref="InterPro:IPR001369"
                     /translation="MTDLAIIGGTGLATLKNLEVTWRQVVHTPFGEPSCPLTYGHLCG
                     KEVVFLPRHGSGHTIPPHKINYRANLWALKKTGATRVIAVAAVGSISTELVVSELALP
                     DQIIDYTWGRGHTFFEEDLRGVVHVDFTYPYCSKLRSLLLKAAAAAGLSMADWVTYGA
                     TQGPRLETAAEIDRLERDGCHVVGMTGMPEAALARELELSYAAIAVIANQAAGRSENL
                     IEMASVEQNLNRGMEKVRRLLEQLIPLA"
     gene            492683..493315
                     /locus_tag="Noc_0458"
     CDS             492683..493315
                     /locus_tag="Noc_0458"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABA56981.1"
                     /translation="MNNRDYYGLYGLILGGLVDVTIFLQSASADVRAVLIKEGGFVES
                     LSAIGYFVGAILVILIRRKFIYYTYAAFILILFGLRELDFHNRFTTMSVSKIKFYVSP
                     EVLLLEKVIAIAIVLLLLYILIRLIKTHFNGLINAIKKGEPSALGVGGGILLILITKT
                     LDGLSRKLASVNIIVSDNMAKLVETVEEVFELGIPLMFIIAAAARFRTAR"
     gene            493348..493986
                     /locus_tag="Noc_0459"
     CDS             493348..493986
                     /locus_tag="Noc_0459"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABA56982.1"
                     /db_xref="InterPro:IPR006662"
                     /translation="MSSILYYAHDPMCSWCWAFSPVWQETHAALAESIPIQYVLGGLA
                     PDTNQPMPFELQRKIQGIWKTIKKQVPGTTFNFDFWTQCQPRRSTYPACRAVIAATKQ
                     EASCGETMILLIQQAYYLQARNPSDDSTLMELAMELGLDQQRFMADLNSAATQEELFR
                     QIQFTRRIGAQGFPSLILHQAGRYHPLRFSYQDASTTLIQIKELSDAQQAGG"
     gene            complement(494039..494914)
                     /locus_tag="Noc_0460"
     CDS             complement(494039..494914)
                     /locus_tag="Noc_0460"
                     /EC_number="1.1.1.100"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Short-chain dehydrogenase/reductase SDR"
                     /protein_id="ABA56983.1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /translation="MTNENQEPKPPFPEQHQERPGQESELQPQPRYSAPLYKGANKLQ
                     GQVALITGGDSGIGRAVAVLFAREGANVTIIHLAEENTDAQETRQAVEAEGQKALLVC
                     GDVSDSAFCRSAVEQTIQEFGQLNILVNNAAYQQHRKELDELTEEQWDHTFKTNIYGY
                     FYMVKAAVPHLKSGSAIINTGSITGLEGNGALLDYSSTKGAIHAFTKSLAQKLVEARI
                     RVNCVSPGPVWTPLNPADRPAEEVSQFGAQTPYQRPAQPEEIAPAYVYFASTADSSYV
                     TGEVLTLLGGSTRAG"
     gene            495278..495508
                     /locus_tag="Noc_0461"
     CDS             495278..495508
                     /locus_tag="Noc_0461"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative cation transport regulato, ChaB"
                     /protein_id="ABA56984.1"
                     /db_xref="InterPro:IPR009317"
                     /translation="MPYQSLRELPDSVKDNLPKHGQEIYKEAYNNAWEQYADPAKRRG
                     DESREEVSHKVAWAAVKNEYEKKDDRWVRKNK"
     gene            complement(495784..496167)
                     /locus_tag="Noc_0462"
     CDS             complement(495784..496167)
                     /locus_tag="Noc_0462"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF202"
                     /protein_id="ABA56985.1"
                     /db_xref="