LOCUS       CP000084             1308759 bp    DNA     circular BCT 31-JAN-2014
DEFINITION  Candidatus Pelagibacter ubique HTCC1062, complete genome.
ACCESSION   CP000084
VERSION     CP000084.1
DBLINK      BioProject: PRJNA13989
            BioSample: SAMN02603690
KEYWORDS    .
SOURCE      Candidatus Pelagibacter ubique HTCC1062
  ORGANISM  Candidatus Pelagibacter ubique HTCC1062
            Bacteria; Proteobacteria; Alphaproteobacteria; Pelagibacterales;
            Pelagibacteraceae; Candidatus Pelagibacter.
REFERENCE   1  (bases 1 to 1308759)
  AUTHORS   Giovannoni,S.J., Tripp,H.J., Givan,S., Podar,M., Vergin,K.L.,
            Baptista,D., Bibbs,L., Eads,J., Richardson,T.H., Noordewier,M.,
            Rappe,M.S., Short,J.M., Carrington,J.C. and Mathur,E.J.
  TITLE     Genome streamlining in a cosmopolitan oceanic bacterium
  JOURNAL   Science 309 (5738), 1242-1245 (2005)
   PUBMED   16109880
REFERENCE   2  (bases 1 to 1308759)
  AUTHORS   Giovannoni,S.J., Bibbs,L., Cho,J.C., Stapels,M.D., Desiderio,R.,
            Vergin,K.L., Rappe,M.S., Laney,S., Wilhelm,L.J., Tripp,H.J.,
            Mathur,E.J. and Barofsky,D.F.
  TITLE     Proteorhodopsin in the ubiquitous marine bacterium SAR11
  JOURNAL   Nature 438 (7064), 82-85 (2005)
   PUBMED   16267553
REFERENCE   3  (bases 1 to 1308759)
  AUTHORS   Giovannoni,S.J., Tripp,H.J., Givan,S.A., Podar,M., Vergin,K.L.,
            Baptista,D., Bibbs,L., Eads,J., Richardson,T.H., Noordweir,M.,
            Rappe,M.S., Short,J., Carrington,J.C. and Mathur,E.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUL-2005) Microbiology, Oregon State University,
            Corvallis, OR 97331, USA
FEATURES             Location/Qualifiers
     source          1..1308759
                     /organism="Candidatus Pelagibacter ubique HTCC1062"
                     /mol_type="genomic DNA"
                     /strain="HTCC1062"
                     /db_xref="taxon:335992"
     gene            complement(516..1529)
                     /gene="ilvC"
                     /locus_tag="SAR11_0001"
     CDS             complement(516..1529)
                     /gene="ilvC"
                     /locus_tag="SAR11_0001"
                     /EC_number="1.1.1.86"
                     /codon_start=1
                     /transl_table=11
                     /product="ketol-acid reductoisomerase"
                     /protein_id="AAZ20826.1"
                     /translation="MFYEKDADVDLIKSKKIAIFGYGSQGHAHALNLKDSGAKEVVVA
                     LRDGSASKAKAESKGLRVMNMSDAAEWAEVAMILTPDELQASIYKNHIEQRIKQGTSL
                     AFAHGLNIHYKLIDARKDLDVFMVAPKGPGHLVRSEFERGGGVPCLFAVHQDGTGKAR
                     DLALSYASAIGGGKSGIIETTFKDECETDLFGEQSVLCGGLVELIKNGFETLTEAGYE
                     PEMAYFECLHEVKLIVDLIYEGGIANMNYSISNTAEYGEYVSGKKVVDSESKKRMKEV
                     LADIQSGKFTKDWMKECEGGQKNFLKMRKDLADHPIEKVGAELRAMMPWIGKKKLIDS
                     DKS"
     gene            complement(1556..2104)
                     /gene="ilvH"
                     /locus_tag="SAR11_0002"
     CDS             complement(1556..2104)
                     /gene="ilvH"
                     /locus_tag="SAR11_0002"
                     /EC_number="2.2.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase small subunit"
                     /protein_id="AAZ20827.1"
                     /translation="MVKSKSAYSTPSKSGKIDTHIIVVWVDNEASVLSRVVGLFSGRG
                     YNIESLAVAEIDHKKNLSRITIVTTGTPQVIEQIVLQLKKLVPVHNVVNFKREDKKVI
                     FKEMALLKIVANSIKIKKALNACKKYNPVILDQTNKSAVIQITALRREIDSMIKNLKP
                     LGLVSASRTGAVAMTRGAEILN"
     gene            complement(2105..3871)
                     /gene="ilvB"
                     /locus_tag="SAR11_0003"
     CDS             complement(2105..3871)
                     /gene="ilvB"
                     /locus_tag="SAR11_0003"
                     /EC_number="2.2.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase large subunit (ALS III)"
                     /protein_id="AAZ20828.1"
                     /translation="MPKLYSGAEIVFKCLEDQKVEHIFGYPGGAVLPIYDELKNHPTI
                     KHILVRHEQGAGHAAEGYARSTGKPGVVLVTSGPGATNVVTALTDAYMDSVPLVCISG
                     QVPTHLIGTDAFQECDTTGITRPCTKHNWLVKDINDLPRIMHEAFEVATTGRPGPVLV
                     DIPKDIQFAKTKYSKPNKDKKVVTKNLNRFNQKNIDQLIELMSKSKKPIFYTGGGVIN
                     SGPKASELLRELVSLTGFPITSTLQGLGAYPGNDNQFLGMLGMHGTYEANNAMHDCDL
                     LINIGARFDDRITGKIDEFSPKSKKVHIDIDPSSINKIVKVDLSIVGDVSDVISSTTK
                     TLKKKKLNLEKSNKQKISNWWLQIEKWRTKQSLSFVNSDTIIKPQYAVQRLYELTKNS
                     DTYITTEVGQHQMWAAQHYKFDKPNRWMTSGGLGTMGYGLPAAIGVQVAHPKKLVVDI
                     AGEASILMNMQEISTAVQYNLPIKIFILNNQYMGMVRQWQELLHEKNYSESYSKALPD
                     FVKLAEAYGCVGIRAKDPSELDEKIEEMINTDRPVIFDCLVDQGENCFPMIPSGKPHN
                     QMLLGPKDQDANKITGKGKALV"
     gene            complement(3891..4832)
                     /gene="miaA"
                     /locus_tag="SAR11_0004"
     CDS             complement(3891..4832)
                     /gene="miaA"
                     /locus_tag="SAR11_0004"
                     /EC_number="2.5.1.75"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA isopentenyltransferase"
                     /protein_id="AAZ20829.1"
                     /translation="MDKQSKIILISGPTASGKSNFAVKIAKKIEGEIINADSMQVYKK
                     LKILTARPNKQEQKNIKHHLYGFVDLNEKFSTGQWLELTIKKIENIQKKKKIPILVGG
                     TGLYFQSLINGLVKIPEIPLKFRNKVRLMSKKEGQKKFYKKLLKLDPKIKDKFDPNDT
                     QRSIRAYEIKSYTNISMYDWLAKTKSEFNDSDFLKLHIDTKREKLVEKINLRTSSMLN
                     NGAISEVKKFLKLKIKKDQSVNKVIGIAELTQYLNDEITLDEAEELISIKTRQYAKRQ
                     ATWARTRMTSWIKVDPIKLDGYIKKLKKSSLKLDQLT"
     gene            complement(4835..6247)
                     /gene="htrA"
                     /locus_tag="SAR11_0005"
     CDS             complement(4835..6247)
                     /gene="htrA"
                     /locus_tag="SAR11_0005"
                     /EC_number="3.4.21.-"
                     /codon_start=1
                     /transl_table=11
                     /product="probable periplasmic serine protease DO-like
                     precursor"
                     /protein_id="AAZ20830.1"
                     /translation="MNRIKKLFIIFFAISFASQGFAKDAPASFADLAEKLMPSVVNIS
                     TTTTVTTNSNPFPGFQFPPGSPFEDMFKEFGTPQTRKSAALGSGFIIEESGIVITNNH
                     VIQNAEDILVRVDGDKEYKATVVGADPLSDIAVLQIDSKEKFIPVKFGNSDQARIGDW
                     VIAIGNPFGLGGTVTAGIISARNRSIGLSRYEDYIQTDASINSGNSGGPLFDMNGDVI
                     GINTAILGKGGSIGIGFSIPSNDAKRVVNQLIEFGETKRGWLGVRIQVVSEEIAEVEK
                     LDEPRGALVASVAENSPSDKAGIKAGDIILEFNNTKIKEMKELPIIVAQTEVGKTVDV
                     KIWRNKREITKKIKLGRLETSEDFKVEKKETKEETPEISEIKSLKIIVRPLNDEDIEQ
                     RKLPNQTTGLVITNIGKNSPIDYLNVGDVIVEAQKKKIKSTKDLEDIVGTVLKSNQKT
                     ILIVIYNNQNQRRYIGVKLD"
     gene            complement(6249..6434)
                     /locus_tag="SAR11_0006"
     CDS             complement(6249..6434)
                     /locus_tag="SAR11_0006"
                     /codon_start=1
                     /transl_table=11
                     /product="possible ubiquitin binding protein"
                     /protein_id="AAZ20831.1"
                     /translation="MKELIIAFGLFLFIEGILYALFPSKMKSMLKKMEMIKDSQLRSG
                     GLIFAVIGFIIIWYIKS"
     gene            complement(6444..7310)
                     /gene="hflC"
                     /locus_tag="SAR11_0007"
     CDS             complement(6444..7310)
                     /gene="hflC"
                     /locus_tag="SAR11_0007"
                     /EC_number="3.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="probable integral membrane proteinase"
                     /protein_id="AAZ20832.1"
                     /translation="MKVQKILLPIIIAVGALAFLSMFIVKETNQAIVLQFGDPKRIIT
                     KPGLNFKIPFIQNVVFLDTRILNLDTPPEEVIASDQKRLIVDAFARFRIVDPLKFYIS
                     VGNERVARSRLATIINSRLRNVLGQQELQTLLSKDRTKQMALIQEGVNTEAESFGIKI
                     VDVRIKRADLPQANSDAIYRRMQTEREREAKEFRARGAEMAVTITSTADKDVSVILAN
                     ANKESEIMKGQGDGERNKIFAEAFGRDAEFFAFYRAMQAYETALIGGQTSLILSPDSE
                     FFKFFGNIKPKN"
     gene            complement(7310..8410)
                     /gene="hflK"
                     /locus_tag="SAR11_0008"
     CDS             complement(7310..8410)
                     /gene="hflK"
                     /locus_tag="SAR11_0008"
                     /EC_number="3.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="probable integral membrane proteinase"
                     /protein_id="AAZ20833.1"
                     /translation="MSDDFQGRGGSPWGTPPGGGNGSGKGPTPPDVDAIIRDIQSKIN
                     KFLPGGSSSGGKPIILVLIILAFVWLASGLYRVLPDEQGVVLRFGKFIKTTQPGLNYH
                     IPFPVEAVETPKVTKVNRMDIGFRSERESGFSQGGGVADIPQESLMLTGDENIVNIDF
                     SVFWIIKDAGKFLFEVQDPESTVKAAAETAMREVVAKSNIQSILTEGRAKIEIETQEI
                     IQKILDEYNSGIQVTQVQTQKADPPNQVIDSFRDVQAARADMERSKNEAEAYANDVIP
                     RARGEAAKIMQAAEAYKQQVVAQAEGEASRFVSIYEEYAKAKEVTQERMYLETMEKVL
                     ADIDKVIIEKNAGSGVVPYLPLPELGKKKASN"
     gene            8411..9286
                     /gene="mrp"
                     /locus_tag="SAR11_0009"
     CDS             8411..9286
                     /gene="mrp"
                     /locus_tag="SAR11_0009"
                     /codon_start=1
                     /transl_table=11
                     /product="probable ATPase"
                     /protein_id="AAZ20834.1"
                     /translation="MAKYIMSFSQKTSNDKNMTDKKPELSDAMKKKLEPRKFTKNPIL
                     GTKFTIAVSSAKGGVGKSTFATNLALALKQIGCKVGLLDADIYGPSIPKMFDINEKPK
                     SDGQTLTPITKYDIQCMSIGFLADQQTPMIWRGPMVTSAIKTFTQKVGWKDLDFIIVD
                     MPPGTGDTQLTFSQEIKMDGAIIVSTPQEVALLDVKRGIKMFDKLGVKILGLVDNMSY
                     FTGDDGKKYKIFGEGGVKRTAEEFEKEFLGEIPINPEVGKCGDEGKPIVEANPEHEIS
                     KIYLDFARKIKSTYL"
     gene            complement(9267..10301)
                     /gene="thyX"
                     /locus_tag="SAR11_0010"
     CDS             complement(9267..10301)
                     /gene="thyX"
                     /locus_tag="SAR11_0010"
                     /EC_number="2.1.1.148"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase-complementing family
                     protein (Pfam)"
                     /protein_id="AAZ20835.1"
                     /translation="MVITKFVYRRSWQANTITIKAFERDSIKIMKLTKEQSQEIKDQQ
                     GQQNQTKRVTAPALENILYEAMPALDHGFVRVIDYMGDDTSIVQSARVSYGKGTKQVS
                     TDAGLIKYLMRHWHSTPFEMCEIKYHVKLPIFIARQWIRHRTANVNEYSARYSILDKE
                     FYLPSAENLAAQSSSNRQGRGDVIEGEQAKEVLELLKNDAEQTYDNYEMMLNQRFDGS
                     TIDENKKGLARELARMNLTLNTYTQWYWKTDLLNLMNFLRLRADSHAQYEIRVYADIM
                     LDTVKKWVPITYDAFMDYRVGGTEVSAKGKIIIQKLIKGEDVNPDSSGLSKREWNELM
                     VSFDLKDKLI"
     gene            complement(10519..10890)
                     /locus_tag="SAR11_0011"
     CDS             complement(10519..10890)
                     /locus_tag="SAR11_0011"
                     /note="possibly viral"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAZ20836.1"
                     /translation="MSNFNKVKTFMETFGQEVKTKPSFSTDKINSLRYDLIKEELEEL
                     KEAMENKDLLEVADALTDILYVTYGAGHAFGIDLDKCFAEVQNSNMSKLGEDGKPIYN
                     ESGKVMKGPKYFKPDLTKFVN"
     gene            10957..12345
                     /gene="fumC"
                     /locus_tag="SAR11_0012"
     CDS             10957..12345
                     /gene="fumC"
                     /locus_tag="SAR11_0012"
                     /EC_number="4.2.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="Fumarate hydratase class II (Fumarase C)"
                     /protein_id="AAZ20837.1"
                     /translation="MKLRKEFDSIGSINVPSDRYWGASTQRSNKFFNIGKILVNISII
                     KSIAIIKRSAALVHYKEKQINKKITNSIIKASDEVIKGKLDENFPLKVWQTGSGTQTN
                     MNVNEVIANRAIEILGGKKGSKKPVHPNDHVNKSQSTNDVFPTAMHISVAQETISKLL
                     PNLKILEKELAKKSKEFKNIIKIGRTHLQDATPLSLGQEFSGYQVQLKKCIERVELSL
                     KEIYFLAQGGTAVGTGINSKKGFDKKIVKEIAKYTKIPFKPAPNKFAELAAHDSIVNF
                     SGTLNTCAVALMKISNDVRFLGSGPRAGYGELILPENEPGSSIMPGKVNPTQCEAVTM
                     VCAKVMGNHNGITIAGSHGHFELNVFKPMIAHNVLQSIDLIADSTKNFAIYCVKGIKA
                     NKKRIKEHLDNSLMLVTALAPHIGYDNAAKIAKTALKNGTTLKYETLKTGLVDEKDYE
                     KIVDPKKMIYPS"
     gene            complement(12333..13784)
                     /locus_tag="SAR11_0013"
     CDS             complement(12333..13784)
                     /locus_tag="SAR11_0013"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAZ20838.1"
                     /translation="MKQIVKNFNNLINKTIFKLKNKTNNKFHVSTFNKYIITTIIILF
                     TYIFYLLIPLLYDKNWIQNKVVTKLGNEFNINLSNSFDISYRILPKPHYLIRDSKISL
                     AEIKTLNVFISQNNFFNKDSIRINEVVIEEANFSLLSNNLKPLYKDSENKFSKKKIKI
                     NNSNIFLKDNLNEVISIIKISNAFLFFDEKNLFNLFDLNGEIFNIPFTLNYQNTINSQ
                     KNINIKAPDLKLKIIDKFFKKDEDLKSGMNNISILNSSINTKYSIKDQIVIFQSDGSR
                     IYNSKIDYNGQLAINPFDLNLKINLYDYKISNLFTPNSIIYEFIKSGLLFNENISVQT
                     LVNIKSTKKDKIFNEAKLELKVLNGKINFDKSMFINNNIGLLEVSNSDLFLENDRLIL
                     TANLSIDIKDIDKLYSFLNTSKNSRKNIRNIKLNIIYDLLGDEIAFKNIKIDENKVSD
                     QFYNITEGFNDTNFNNLTKSRRLLNELIGLYEG"
     gene            13829..15865
                     /gene="uvrD"
                     /locus_tag="SAR11_0014"
     CDS             13829..15865
                     /gene="uvrD"
                     /locus_tag="SAR11_0014"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase II"
                     /protein_id="AAZ20839.1"
                     /translation="MINSEYLNNLNNAQKEAVLYLDGPLLIVAGAGSGKTKVLTSRIA
                     HIINEKKAFPNQILSVTFTNKAAKEMQNRVSSILNSEAIGLSWLGTFHSICAKLLRKH
                     APAAGLTSNFTIIDTDDQVRLIKNICKAENIDIKQLAPKFILSIIDRWKNKGFHPDEV
                     VINKNDIFERTIRPLYKIYQQKLLDLNACDFGDLILHVVKILEKNHDIRNIYSNNFKY
                     ILVDEYQDTNYIQSRWLNLLSEKHKNLCCVGDDDQSIYSWRGAEIKNFLEFDQVYKNS
                     KVIRLEENYRSSQNILSVASNLIANNQNRVGKTLKTTMEEGDLVKLNCFKNGKDEAIG
                     VSDEIEKKLKKKYSFNNIAILVRAIFQTREFEERFLKIGLPYRILGGTKFYERAEIKD
                     CVAYLRLIHQPKDDLAFDRIVNNPKRAIGESTIKLIHEFSKTNAVSLEIASKKLIEEN
                     LIKPKTKIGLSSFLFLMDKWRNDINIKKINHVKLLQLVLDESGYSSMLKNKKDLENEN
                     RLENIKELLSAMKDFDNLENFLEHVALATSVDQDWDGEKVNMMTMHGSKGLEFDVVFL
                     PGWEEGLFPHQKSIEEKGQNGLEEERRLAYVGITRAKKKALISFAMNRFYQGNWIDSM
                     ASRFIEELPEKFLEKNSFFDDSKDNEEDFEFNQDFEIEEGTRSPGWIRYQKRIK"
     gene            15862..17556
                     /gene="pepP"
                     /locus_tag="SAR11_0015"
     CDS             15862..17556
                     /gene="pepP"
                     /locus_tag="SAR11_0015"
                     /EC_number="3.4.11.9"
                     /codon_start=1
                     /transl_table=11
                     /product="Xaa-Pro aminopeptidase"
                     /protein_id="AAZ20840.1"
                     /translation="MILKKIKILRKKFKQYNIDGYIIPKNDEYFSEYAKNDRLKNITG
                     FSGSAGFTVVLKKQNYLFVDGRYTIQAHQQSSKNFKIIEIHKKLPHTIIKNFNLGYDP
                     TLFTSKLLNKYFKNNNLISIDQNLIDQIFKFKEKPTKPFYSLDTKIAGEPYSYKISKV
                     VRFLKKNKADYCFISAPENVAWLLNIRGYDNPNSPIANARLILNKKKEFFLIANEKKL
                     KNLLLDKKIKKKQILPIKSLPQFLDNLKGKNFIIDNKTCSIFYEKIIKSNFNILKFDD
                     PVYELKSMKNSNEIKHMIEAHKKDGLALTKFIYWIKNVNKKKITEVYAQNKLEKFRKL
                     NKDYLFPSFDTIAGAGSNGAIVHYRANKKTTKKIEQNDILLVDSGGQYHYGTTDVTRT
                     ISFSKQNKFIKNAYTNVLKGHIAVALTNLNKDDTGKKIDIRARKYLKKEGQDYAHGTG
                     HGVGFFLNVHEGPQSISKHNSIKIKNGMILSNEPGFYKKNHFGIRIENLIYAKKTKRS
                     FNFENLTLAPLEKDLINYELLNKIEKDYLFKYHLNIYSEFSSLLNKKERKWLATLI"
     gene            complement(17539..19569)
                     /gene="ligA"
                     /locus_tag="SAR11_0016"
     CDS             complement(17539..19569)
                     /gene="ligA"
                     /locus_tag="SAR11_0016"
                     /EC_number="6.5.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA ligase"
                     /protein_id="AAZ20841.1"
                     /translation="MNDKDLEIEYLKKIDLFQRHNKHYYDKNKPIVSDQEFDLLKKDI
                     IDLERKYKFLKSEYSPTKSIGFKPSKNFQKIKHKVPMLSLGNAFNEEDLKNFEKKIIN
                     FLSLKDVNTIEYSAEPKIDGISASLIYIDGKLTKGLSRGDGNEGEDITQNLKTIKDIP
                     LEITKSNFPKEIDIRGEVFIENNDFKKIKDKFANPRNAASGSLRQKNSLITAKIPLKF
                     IAYTYGYEKKMNIKNQTSFLENLKLWGFKTNPFNKKIIGVKNLMLNHKELEEKRKELA
                     FDIDGIVYKVNDFDLQKRLGFAANAPRWAIAHKFSANSSISEIMNIEIQIGRTGALTP
                     VAKIKPVNIGGVIVSNATLHNEDEIVRKDIRVGDTVTVERAGDVIPHVVSVDLKKRKQ
                     NSKKFIFPLKCPSCGSKTIKDYNETTKRQDAVRRCASEGFECEKIAIERIKHFVSKDA
                     FNIDGFGKKIVENFWNLKLVRLPQDIFKLNYNKIEELEGWGKLSVANLRFSIEEKKNI
                     SLERFIYSLGIRHIGQENAKLIARHLKTASNFFRLSGEKNIESLSNIDGIGITQIQSI
                     KKFFLNKTNLKVLSELEKNLLIKDVILINNNGLLKNKTFMLTGKLNGISRAEAKSLIE
                     QNSGKIISNVNKKLDYLIAGDKPTLKKINTAKEWNIKIINQTEWLKMLNKSG"
     gene            complement(19571..20419)
                     /gene="comL"
                     /locus_tag="SAR11_0017"
     CDS             complement(19571..20419)
                     /gene="comL"
                     /locus_tag="SAR11_0017"
                     /codon_start=1
                     /transl_table=11
                     /product="putative competence lipoprotein ComL"
                     /protein_id="AAZ20842.1"
                     /translation="MLSKLKIILLLITFTFIWSCGDKTKKISEIVEVDMEMQMSDAYK
                     EGYFELQRGDVLLAAKKFNEAELLFPQSPWAAKSAIMAAYAYYTQYYYSDAIFELERY
                     LVTYPNHKDKVYAHFLLGMSFYEQIVDEKKDLKSILDSKEQFETIIRDYPSTEFAMDA
                     KFKIDLINEILAAKEMYIARYYLKKTKWIPALNRFKTVVKDYNTTIYTEEALHRLVEI
                     NYRLGLINESKKYASTLGYNYQSSDWYKNSYKVFNKDYRDGVKELQKDKKKKIGLIKR
                     FKGLFE"
     gene            complement(20458..21378)
                     /gene="lpxC"
                     /locus_tag="SAR11_0018"
     CDS             complement(20458..21378)
                     /gene="lpxC"
                     /locus_tag="SAR11_0018"
                     /EC_number="3.5.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
                     deacetylase (UDP-3-O-acyl-GlcNAc deacetylase)"
                     /protein_id="AAZ20843.1"
                     /translation="MSVLNQKTINRDIIFKGVGLHSGANVTMTVKPAKPNSGILFKRV
                     DLKENNIVVPNIFNVSSAVFCTTIANESGVSISTIEHLMGALYGLGIDNVLVEIDNQE
                     VPILDGSAKIFIEEISKAGIKSSEAPIKIIKIEKRIEFNDGKKTISIEPSKVSLDIDF
                     ELKYENNLIGTQRNLVSVFESDLTDIYNSRTFCLFEDIAKLKEMGLAQGGSLENAIVV
                     KDNEILNEKGLRNKKEFVNHKILDCMGDLYLAGYKIIGKIICSQGGHKLTNQLLRKVF
                     QQDENFSLIEITEKHLPNTFINKSHLRSIA"
     gene            complement(21444..22553)
                     /gene="ftsA"
                     /locus_tag="SAR11_0019"
     CDS             complement(21444..22553)
                     /gene="ftsA"
                     /locus_tag="SAR11_0019"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsA"
                     /protein_id="AAZ20844.1"
                     /translation="MSDKKFQIIIDCGSSKIRAGAFNEESKNNPFFIESNFYTEQFNL
                     KPDIQKVIASLEKSSNEFIDNINLMIDSSKTISIAISVFKKIEELKLRQDDIIFLIQE
                     AKQQIKKYYSDYNIAHIIINNYKIDNVDYSELPDEIDCQFISLDIIFICLPSELVFRF
                     KNIFSELNISINQIICSSYAKSINYKNNLNLTGEVSFIDIAFKKTSIISFYNDKLIFL
                     DVLPIGGNHITKDISLLLKIDINEAEKLKLNFEKNNEHTDNPNFSLEMLQKIAFARTE
                     EILELCDKSLVSNAKVKTQSKMILMGEGSKILDNKFKDKISFSKDIDFLEETLGDVCQ
                     SGYKLRKMYDKQEVVVVPKKQIKQGFFEKLFHFFK"
     gene            complement(22553..23230)
                     /gene="ftsQ"
                     /locus_tag="SAR11_0020"
     CDS             complement(22553..23230)
                     /gene="ftsQ"
                     /locus_tag="SAR11_0020"
                     /note="FtsQ"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsQ"
                     /protein_id="AAZ20845.1"
                     /translation="MHQSIGKKNKIIIYLLFLFILSTTSAKFINDQKKLSSSITKINI
                     TGLSERKNLEILDNLNNLLYKSIFVINEEEIIKILEKHNIIQEFNIKKIYPSTLNIKI
                     KPTKLIARVSNNSQYLVGANGKLIEDKSNNELLPYIFGEFNSQDFLSFKKNIEKSMWS
                     FSNLKELSFFPSGRWDILTDKDILIKLPQEHIVASLNLSKELINNDNFKDFKFIDLRI
                     KSHLVAK"
     gene            complement(23211..24125)
                     /gene="ddlB"
                     /locus_tag="SAR11_0021"
     CDS             complement(23211..24125)
                     /gene="ddlB"
                     /locus_tag="SAR11_0021"
                     /EC_number="6.3.2.4"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine--D-alanine ligase B"
                     /protein_id="AAZ20846.1"
                     /translation="MTKKILILSGGISKERLISLDTGKQVAKELIKNGYKVLISEPDK
                     NLSKNITSFKPDVIFNALHGQFGEDGYIQAILETKKIPYTHSGVIASSIAMDKEISKK
                     IFIKNKILTPKYIKFNHKKNKLNIIKLIEKNLKFPVVVKPINEGSSVHVYICDKTNIL
                     KNLKVLKSYNEILIEEFIPGREIQVAIMNNKSLGAIELEPRRKFYDYEAKYNSSAKTK
                     HLIPVDLSKNNLAKITGIARAAHKIIGCKGVTRSDFKFFNGKFYLLEINTQPGMTKLS
                     LVPEIAKHKGISFIKLIEWILKDASINR"
     gene            complement(24127..25035)
                     /gene="murB"
                     /locus_tag="SAR11_0022"
     CDS             complement(24127..25035)
                     /gene="murB"
                     /locus_tag="SAR11_0022"
                     /EC_number="1.3.1.98"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /protein_id="AAZ20847.1"
                     /translation="MSIEEIRKFSNEISSKINFDYDLKKSNWFNIGGQTKVYFRPDNL
                     PDLILFLKKFGEKEKIHILGAGSNTLISDEKFDGVVIKLGKNFSNISILPNDVIIAGS
                     ACLDKKLSDFALNNGIGGFEFLACIPGTIGGGLKMNAGCFNKEFKDVLVSIQAIDKNG
                     QVFTIPASKVIFKYRSNDLKEDLIFLSASFKGTKKNKEEIENEVLELKKKKDKAQPTK
                     LKTSGSTFKNPIDQTDKKVWKLIKDSVPLDISFGDAHISNKHCNFFVNKNNASFEDMN
                     KLIEFVKISVEKKTGIVLEKEIKILK"
     gene            complement(25035..26429)
                     /gene="murC"
                     /locus_tag="SAR11_0023"
     CDS             complement(25035..26429)
                     /gene="murC"
                     /locus_tag="SAR11_0023"
                     /EC_number="6.3.2.8"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate--L-alanine ligase"
                     /protein_id="AAZ20848.1"
                     /translation="MKIELAKTEIIHFVGIGGIGMSGLALIMKRMGFNVQGSDVLGNK
                     NIERLKKDKIKITISHTKKNIAKATIVVISSAIKNNNPELIEAKLKQLPIYKRGEMLA
                     NIVSLTKNIVVTGSHGKTTTTSLLASIFSKTKLDPTIINGGVLNAIKNSAKLGKSDWC
                     ILEADESDGSFIHVPPTYSIVTNIDREHMDFYNSMKDLKELFIKFINKVPSFGKSFIC
                     IDDKNNKDLLSKLKMKNYYTYGTDNKSNFYIKNIKQEKEYSQYDLAINLPGKKNLTIR
                     KIKLPLLGIHNIRNSTAAIAVAVTIGISQNIIKKGLKEFKGVQRRFNKIFTHRETNFY
                     DDYAHHPTEIREVLNGVRAAYKNEEVICIFQPHRISRLKDLKKEFSLSFKKADVVILC
                     PIYTAGEKIKLGFKYNNFAKDIVKNSKVRLFMVEDQYQLAKFIKNTIFGKKIVVGMGA
                     GTISAWMRQLPELI"
     gene            complement(26419..27489)
                     /gene="murG"
                     /locus_tag="SAR11_0024"
     CDS             complement(26419..27489)
                     /gene="murG"
                     /locus_tag="SAR11_0024"
                     /EC_number="2.4.1.227"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine"
                     /protein_id="AAZ20849.1"
                     /translation="MNKKILISTGGSGGHVIPATIIYKHLEDNFDVSMTSDFRGVKFL
                     NKDEYNLKIFNVRPISKNLLIIPLDFIFMIFLIFKSISFFRKNKIDTLISTGGYMSLP
                     LCLGARILNIKLLLFEPNMVLGRSNKFFLSYCQKIFCYSNNIKKFPIKFKNKIKVIPA
                     LLRKNFYNKRDYNKSLDTINLLIIGGSQGAKIFDDLVKNAIIELAKNYKLKIYQQTNS
                     INFESFKKIYEDKNIQCELFNFNDDVVNFMQKTDLCITRAGASTLAELNFTETPYLAI
                     PLPTAKDNHQFENAHFYNKLGFNWLLNQKEIDEKTLLNKLINIIDNKEEYLVKKKNMK
                     DFNYENTWNNINLKIISVINEN"
     gene            complement(27490..28614)
                     /gene="ftsW"
                     /locus_tag="SAR11_0025"
     CDS             complement(27490..28614)
                     /gene="ftsW"
                     /locus_tag="SAR11_0025"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsW"
                     /protein_id="AAZ20850.1"
                     /translation="MINNSSLNSIYYNWWKNIDKTIFLLIIILFSLGLFFSLVSTSFI
                     ASDKLDTNNYFFFFKHLVYIFIGLLTLVFFSSLSEKNLFRFSIYLFFITLFFLFLVPI
                     FGTEVKGSKRWLNLFFLPQFQPIELLKPFIIIFVATILCSEKNYNIYIKYLLTIISII
                     PTGLLLIMQPDIGQTLLVFLSWVILVFVSGINLLFILLFISLSIISLLYVVFFIPKFI
                     YIKSRILSFFNPDGGTHNFQSDKAIEAISSGGFFGKGIGEGTLKTRVPEAHTDYIVSV
                     ISEEFGVIAIIFLLILFLFFIYSVFKKIYLEKSEKNKLVLTGSISLIIFQALIHLGVN
                     IRLFPTTGMTLPFLSYGGSSIIGVSILSGIILNLTKRKIN"
     gene            complement(28611..29906)
                     /gene="murD"
                     /locus_tag="SAR11_0026"
     CDS             complement(28611..29906)
                     /gene="murD"
                     /locus_tag="SAR11_0026"
                     /EC_number="6.3.2.9"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
                     /protein_id="AAZ20851.1"
                     /translation="MLNLEKNFLKKKILIYGLGKSGLSTYSYLKKNNIISLYDDQIIT
                     KKNIKDTHTTYKEIIKKEFDCIIISPGIDINNCKLSRFLKKNHKKIYTDLDIFYSRYA
                     FNQKITITGTNGKSTTAKLLYDILKDQKKDVRLVGNIGNPVLLEKKIKKDTLFVIEAS
                     SYQLEYSKLFKTNISLILNISPDHLERHKTINKYVSAKFKLIKNQSKNDIAILNTKNF
                     YIKRKLKQKKFAPSILKIEKYISDRFIKKIDNHYFDTDGNKENLTFVLKVSKILKLKN
                     NLLLKSLKNFKGLSFRQEIIHNSKFLKIINDSKATSFSSSEKLLKSLKNIYWIVGGLP
                     KKRDKFLLKKNDCKKIKLYIFGKNQKFFINELKNKMAFKSFLNLKSLIAKVFLDIKNE
                     NNFIKKTILFSPASASFDTFKNFEERGRYFNKLIKNYIK"
     gene            complement(29906..30991)
                     /gene="mraY"
                     /locus_tag="SAR11_0027"
     CDS             complement(29906..30991)
                     /gene="mraY"
                     /locus_tag="SAR11_0027"
                     /EC_number="2.7.8.13"
                     /codon_start=1
                     /transl_table=11
                     /product="phospho-N-acetylmuramoyl-pentapeptide-
                     transferase"
                     /protein_id="AAZ20852.1"
                     /translation="MLYSLITQLIDQYSFLNVFKYLTFRTGLSMFTSMFVVLLIGTPF
                     IKFFSARKILNPIRDDGPTEHIVKKIGTPTMGGVLILLGLFSGILLWGDLSNYHIWFL
                     LFIVSGFGLLGAYDDYKKIKFKNSSGVSFKFKIISQILIAIVGIYGLTQLSQNTELTN
                     LYFPFFKNLIINLGWFFIPFSIFIIVGSSNAVNLTDGLDGLATVPVILVAACFAFISY
                     VTGNIVFSEYLNIPYLEGMGEVSVFCGSIIGACLGFLWFNAPPAKIFMGDTGSLALGG
                     SLGAIGIITKHEIVLAITGGLFVLEAVSVIIQVFSFKLTGKRIFRMAPIHHHFEKKGW
                     AESTVVIRFWIISIILAMIGLATLKLR"
     gene            complement(30981..33827)
                     /gene="murEF"
                     /locus_tag="SAR11_0028"
     CDS             complement(30981..33827)
                     /gene="murEF"
                     /locus_tag="SAR11_0028"
                     /EC_number="6.3.2.13"
                     /note="murE and murF fusion"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoylalanyl-D-glutamate"
                     /protein_id="AAZ20853.1"
                     /translation="MLIGNFLKNIKKEFKNHQFAGLSFNSEDCKKNYIFFAIQGTKSD
                     GTKFIDHAIKKGATVIISEQKFEGIKNKVLFLRSKNVRKILSELSYKTKKNIPKNLIA
                     VTGTNGKSSIADFYFQLLNLGNKKVASIGTLGVKTKNSLKKVSNTTLDPIKLSKILND
                     LKKQKIDNVIMEASSHGLKQNRLDGLKFNTTIFTNLSHDHLDYHKTFNDYLKSKLYLF
                     EKLLKPRGTIITDSKIPEYKNLKRISLNNKLDLQALSKSNNGIDIYSHQFRDDKQIVE
                     IKYNQKHYKLKINLIGKIQLKNLFMAMLAAKKSNLKFDQIVKLASRVKSVIGRFEKIG
                     TLKNNSKVILDYAHTPDALKTCLTNLKEQFENKRIFIVFGCGGNRDKDKRPIMGKIAN
                     QYCDRVYLTDDNPRDENPKKIRLAIKKTIDKSKVFEISSRSKAIHKAILDLKTGDILV
                     IAGKGHEQTQDYGNFVNKFSDRLEILKNIKLKNKILSTNIKINILKEISNSPQINSNI
                     KIKNASINSKTIKKNDIFFAIKGNNKDGNLYVNEAFQNGASLVIANNQKKSKKKIVVD
                     DTLQLLTEASSKLRENLSSKIISITGSCGKTSLKELLGKTLSKISNVTYSPKSFNNKF
                     GVPLSLFNLKKNDEFGIFEIGMDKKGEIDYLSKIIKPDVGVITNISYAHIKNFKNIHQ
                     VALAKSEIINNIKTNGILVLNQDDRFYNLHKKIAKKKNINIFTFSLKNKSANIYLEKI
                     VKERSKYKIFVNVNKKQIYFYVRLIFENNLKNLLATIAIISIFKDTQKLEKNIFLDYE
                     MTKGRGDIIKVKLKKKSIYIVDESYNSNPLSLKSAIKNFDELKIDNSKKKLILSDMLE
                     LGNYSKKLHLEAGKEINKTSLKNINVVGKHILHTYKNLDKHRRGVILKDKSKIIDLIK
                     NDLNNNDYLMIKGSNSTGLNNLVNKLKTGKFNAL"
     gene            complement(33835..35511)
                     /gene="ftsI"
                     /locus_tag="SAR11_0029"
     CDS             complement(33835..35511)
                     /gene="ftsI"
                     /locus_tag="SAR11_0029"
                     /EC_number="2.4.1.129"
                     /note="penicillin-binding protein 2"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsI"
                     /protein_id="AAZ20854.1"
                     /translation="MNNKKNIILEEYENEFSYKKSKTNLDIQFNRIAFIFFVFLVISV
                     IYSIQLLHLGSLKEENTKEFSTINKNYRADILDRNGNYLVKTVKSIDIGINPIEVIDK
                     KKLLINLQLIFPDKNYEEITKKLEKNKFFYLEKKISSDNYEKIMLLGDKSIKSEEKLT
                     RIYPQKNLFSHIIGQIDDDNKGISGLEKSFNEKLKQTNKPLKLTVDTDIQFLIREELV
                     KFQSIFRSKGSTAILMNVNNGEIISMVSYPDFDLNKREKIVDLNFINRATKGVYELGS
                     VFKTFTVAAGLEEGLIDTDTEFLNLEKKLQCGKSSISEYDNKIPSDLTVEQILIRSGN
                     IGSVRIGQKLEIIKLKAFLEKIGILSKINFDIEEVGEPIPFKWGKCKLATVSFGHGIT
                     TTPLQLAKAYAIISNGGFAIEPSLIKKELKDPEKERRIIKAGISEKINPILRKIVNTK
                     EGTAGLVNIEGYEVGGKTGTAQKTIVGGYSKAKVNTFAGIFPTSKPKYVLIVLLDEPK
                     TSSDYVYEYKNKKGSYKGTPFNTAGWTSVEVAGKIIEKIGPILATKHIEN"
     gene            complement(35504..35812)
                     /gene="ftsL"
                     /locus_tag="SAR11_0030"
     CDS             complement(35504..35812)
                     /gene="ftsL"
                     /locus_tag="SAR11_0030"
                     /note="ingrowth of wall at septum"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsL"
                     /protein_id="AAZ20855.1"
                     /translation="MKQLVVAVILVLILITSLIKNSTKEIEDQIFIVKENIRPLKSEL
                     EDVLLEFNYLSSPEKLVQYQTQYFEKDLIKIEIMNIKEIFKNNETLEIKDLISKNGNE
                     "
     gene            complement(35809..36819)
                     /gene="mraW"
                     /locus_tag="SAR11_0031"
     CDS             complement(35809..36819)
                     /gene="mraW"
                     /locus_tag="SAR11_0031"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-methyltransferase"
                     /protein_id="AAZ20856.1"
                     /translation="MIATIIPDVRNHYPVLLSEIISIITPQYGGTFIDCTFGQGGYTK
                     RILNFPETKVIALDRDSESSIKAQELQNSFEDRLLFKNIKFSQLNNLKLKHENIKAVI
                     FDLGYSLNQIKDPKKGLSFDSIGELNMKMGINEFSAKEAINQLDEKELTKIFKYFGDE
                     ADSKRIAHNIVEDRSKREITTEELVRIIESSKRKRNYKTHSATKIFQALRIFVNKEIS
                     ELIYGLINAAKVVKKDGVIAVVTFHSLEDKIVKYFFKSLSENKSISRHMPKTEEKLNL
                     FKSVIKKPIVPSDKEIRENPPSRSAKLRYVIKKEDFFDFETDILDKFKHLIDIENLSK
                     KL"
     gene            complement(36838..38325)
                     /gene="ftsZ"
                     /locus_tag="SAR11_0032"
     CDS             complement(36838..38325)
                     /gene="ftsZ"
                     /locus_tag="SAR11_0032"
                     /note="FtsZ"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsZ"
                     /protein_id="AAZ20857.1"
                     /translation="MTINFKSPEIKELQPRLLVVGVGGAGGNALNEMIDNGLQGVEFI
                     AVNTDAQDLKLSKAKARIQIGLSLTKGLGAGAKHDIGQAAADESLNEIVNTLQGANMV
                     FITAGMGGGTGTGAAHVIARAAKELNILTVGVVTLPFLYEGPSRMRRAQVGLEELRKH
                     VDTIIVIPNQNLFKVANEQTTFEESFNLSNNVLMQGVQSVTDLMVRPGIVNLDFADVE
                     TVMASMGKAMMGTGEAEGEGRAAKAADMAISNPLIDDYTLKGAKGLLVNITGGKDLKL
                     FEVDEVVNKIRAEVDPEAEVIIGAITSGDLDGKIRVSIVATALDGQQPESKSVINMVH
                     RIQNRNPGYSDFNSASSAQSFNFSPTMTSPISHGANALKLENEIIAEPVTNTTSSEMM
                     NEQTVSNQEVESIVENNQSNDYEQSFSEEALTTAKPEENSPMEEEHVSNGLENFGVEG
                     EDAPDLFSSDSATSETEGFLSTETSENTSEDDDLEIPAFLRRQKN"
     gene            complement(38328..38795)
                     /gene="mraZ"
                     /locus_tag="SAR11_0033"
     CDS             complement(38328..38795)
                     /gene="mraZ"
                     /locus_tag="SAR11_0033"
                     /codon_start=1
                     /transl_table=11
                     /product="Cell division protein MraZ"
                     /protein_id="AAZ20858.1"
                     /translation="MFLSTYENKIDKKGRVSVPASFRSHLSNLGYNGVICYPSFNNQS
                     IEACSQDRIEKLSASIDSLSPFEEKRDYFATSILSESMNLQFDSEGRISLSTKLLKHA
                     KIKNSMLFVGQGQTFQIWEPAAFEKFKINARKKANLNRASLKWEKHFNNNEGK"
     gene            complement(39448..40191)
                     /gene="ybjR"
                     /locus_tag="SAR11_0034"
     CDS             complement(39448..40191)
                     /gene="ybjR"
                     /locus_tag="SAR11_0034"
                     /EC_number="3.5.1.28"
                     /note="probable ybjR"
                     /codon_start=1
                     /transl_table=11
                     /product="probable N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="AAZ20859.1"
                     /translation="MALKTILNYSPNFNPKKRTSKQIKFIIFHYTGMKSESDALKRLT
                     EIQSEVSCHYLIKNNGEIVKIVPDLYIAWHAGKSSWKNYKSLNQNSIGIEITNPGHEY
                     GYKNFTQKQITTLVKLSKFLIKKYKINPKNILGHSDIAVLRKKDPGEKFPWEYLAKNK
                     IGIWHTLNKQDLLKNRKLKISKVEENIFFRNLFKIGYSKTFPKNIGRNKYLIELIKSF
                     QRRFRQELVDGKIDQESLLINKSLIKAYN"
     gene            40261..41046
                     /gene="vacJ"
                     /locus_tag="SAR11_0035"
     CDS             40261..41046
                     /gene="vacJ"
                     /locus_tag="SAR11_0035"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein precursor"
                     /protein_id="AAZ20860.1"
                     /translation="MKKILITSLISLMLATNVSADTDGENNLSKKNSGEVKDCFENVN
                     RATFKFNQVLDGVIFEPVAKAYRILPSPVRAGTGNALDNLSTLVTIPNNILQGEFKKA
                     GVNTGRFIVNTTVGVVGIFDVAEKIGFPEYEKEDYGQTLGVMGVGPGCYLVLPVLGPS
                     TVRDTAGSFANILGGDAWYNVTVANDTQHFSDFDYYASRASSGIDFRAKNIDSFENLE
                     KNSIDFYASVRSLYLQDRQQKIANSNAITETQNDSDWEEIEAQ"
     gene            41060..41653
                     /gene="yrbC"
                     /locus_tag="SAR11_0036"
     CDS             41060..41653
                     /gene="yrbC"
                     /locus_tag="SAR11_0036"
                     /note="Ttg2 Family, yrbC
                     similar to toluene tolerance protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAZ20861.1"
                     /translation="MRLKKFLIFTFVIINFVGINQSYSIEPDVFVQSTVNRASEALNN
                     KYSKEEKIEKLKQIASETVDINGIGYYTLGAYRKNISDNEINQYEMLFEQYFLKSFSS
                     RLAEYSNPEIEVVSKEKLNENYTMVSSILVGTEQRPEVKIDWRIYTKNPENPLIRDLI
                     IEGLSLARTQKEEFSSIIQSKDGDINALFSILKEFIK"
     gene            41674..41750
                     /locus_tag="SAR11_tRNA_r_31"
     tRNA            41674..41750
                     /locus_tag="SAR11_tRNA_r_31"
                     /product="tRNA-Met"
     gene            41817..41891
                     /locus_tag="SAR11_tRNA_r_30"
     tRNA            41817..41891
                     /locus_tag="SAR11_tRNA_r_30"
                     /product="tRNA-Val"
     gene            complement(41900..43687)
                     /gene="rpoD"
                     /locus_tag="SAR11_0037"
     CDS             complement(41900..43687)
                     /gene="rpoD"
                     /locus_tag="SAR11_0037"
                     /note="rpoD (Sigma-70)"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="AAZ20862.1"
                     /translation="MGRGTHRGFITFDELNKSLGKRNLSDENLEQAFMHILDESVALV
                     EKKSDFKVLRKKENSSKEEGKTIEKSDDPIRMYLREMGGVELLSREGEIAIAKRIEAG
                     KDVMLIALAQSPITAQQFVEWDEKLQSDEILVREIIDIDTNYMEDENTGPSAKQRNSG
                     ETDKNEENNGDDDEFNPTLAAMETEIKPKVLKTVNTLTKEYAKLIKYQKEKLDCILNA
                     VSFSAAKEKGHDKIVSDILENIKSLQLSPSVLEELVQKHYVENKKIVSLEGNLLRLAM
                     DQKIPRNEFIKFYIGNEINPNLKKFLDTNPMWKQFFSKNKDEFKNIRERLIEISHKLG
                     ISVTDYKKIVSRVQKGEKESRIAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNI
                     GLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKIVRTQR
                     LILSEFGREATPEELAQKLRMPLDKVRKVLKISKEPVSLEKPVGDEEDSSLGDFIEDT
                     KALAPLEQAIKSNLSEATTKILSTLTPREERVLRMRFGVGMNTDHTLEEVGLQFSVTR
                     ERIRQIEAKALRKLKHPSRSKQLKSFLES"
     gene            complement(43790..45565)
                     /gene="dnaG"
                     /locus_tag="SAR11_0038"
     CDS             complement(43790..45565)
                     /gene="dnaG"
                     /locus_tag="SAR11_0038"
                     /EC_number="2.7.7.-"
                     /note="probable dnaG"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="AAZ20863.1"
                     /translation="MKYPKEYLDEIKTRLKVSTVVSKSVSLKKRGKEFVGLSPFKTEK
                     TPSFTVNDEKEFYHCFATSEHGNIFDFVMKTQNLKFGEAVKSLANLAGMRPYTFSKQD
                     EEREKNWQEYCSIYNQYVQFYHDEILKNESLTIAREYLKKRNLSKDEVKNFKIGFVER
                     NSNFYEKLKDEFSEKVLVESGLFYLDEKKNTYVERFRDRIIFPINNISGQPIGLGGRT
                     IQENSYSAKYINSPETPFFKKGSNLYNLDLARRLSNKIDHVYLVEGYMDVVGLSKNGI
                     ENVVANLGTSLTDRQILMLNQFFEDIIICFDGDESGYKAALRAAENSIKELQPEKQIS
                     FLFLPDGEDPDSYANKNGKANFIDFTKQAKISIHQFIFNHYKQQTDNNPSSMAIFEKK
                     LRTIAATIKDDFIKKYVLEFFLEKISSLTPHSNIGKKQFYTKKVKSLQSTQKHFNESK
                     LLSGVELKEFSLLYLIMNNLDLFQENIHMIENINLFSEENKLILETLITKLKSGEKLT
                     LDQIPIDPQLTEKIFKFASIKHILNNHQNDQNKMFELLDEVSRDLKNYDLEFRIEELE
                     SKFSKDLSESTFNEIRELKKQKNIN"
     gene            complement(45565..46026)
                     /gene="yqeY"
                     /locus_tag="SAR11_0039"
     CDS             complement(45565..46026)
                     /gene="yqeY"
                     /locus_tag="SAR11_0039"
                     /codon_start=1
                     /transl_table=11
                     /product="YqeY-like protein"
                     /protein_id="AAZ20864.1"
                     /translation="MTLKEKIETNYKNSLKSKNKVEISTYRLILSGIKDLDIVNRSGA
                     NIKETDDDDIKKLLKKMIKQRTESIEIYKKNERMDLLEVEQNEFDLLSSFLPQQLSDE
                     ETRKICVDTISKLGAASIKDMGKVMGELKKSYPDNLDFAKAGPLLKELLNK"
     gene            46155..47351
                     /gene="carA"
                     /locus_tag="SAR11_0040"
     CDS             46155..47351
                     /gene="carA"
                     /locus_tag="SAR11_0040"
                     /EC_number="6.3.5.5"
                     /codon_start=1
                     /transl_table=11
                     /product="Carbamoyl-phosphate synthase small chain"
                     /protein_id="AAZ20865.1"
                     /translation="MIKKAKKISSNKISQIHTGVLVLENKTIFKGVGIGYQGTATGEV
                     CFNTSLTGYQEIISDPSYAGQIINFTFPHVGNVGTNKEDLESDKVWTKGVIFNSEITN
                     PSNYRSLANLDLWLKKNKIVGITGLDTRGLTNYIRDKGAPKGTISFSSKGNFNISKLA
                     NITTKWSGLNNLDLAEQVTTKKNYIWSGFKTWKKETGYLKNKKNSLHVVAIDYGIKKN
                     ILRYFSDLNCKVTVVSCKTSAKDILKLKPNGIFLSNGPGDPAATGKYAIGIIKELVKN
                     NLPIFGICLGHQILALTLGAKTKKMKLGHRGANHPVKNLIKDNVEITSQNHGFEIVRA
                     SLPKNIEVTHKSLFDNCIEGIKLKNKPVFSVQYHPESNPGPQDSVYLFEEFINNIKKN
                     AKKKRS"
     gene            47329..50553
                     /gene="carB"
                     /locus_tag="SAR11_0041"
     CDS             47329..50553
                     /gene="carB"
                     /locus_tag="SAR11_0041"
                     /EC_number="6.3.5.5"
                     /codon_start=1
                     /transl_table=11
                     /product="Carbamoyl-phosphate synthase large chain"
                     /protein_id="AAZ20866.1"
                     /translation="MPKRKDLKTILVVGAGPIIIGQACEFDYSGTQACKALKDEGYKV
                     ILINSNPATIMTDPGVADKTYIEPITLEVLEKILKKEKPDAILPTMGGQTALNLAMEA
                     EKKGILKKYKIELIGANSKAISNAEDRKKFRKNMLDIGLDLPKSKVVSHIRDAAKALK
                     QIGLPAIIRPAFTLGGLGGGIAKTEKEYLKIVKDGLHESPVNQILIEECLEGWKEFEM
                     EVVRDKKDNCIIICSIENIDPMGIHTGDSITVAPALTLTDKEYQVMRNASIACLRKIG
                     VETGGSNVQFAINPKDGRMVIIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDE
                     LKNEITKTTPASFEPSIDYVVTKIPRFTFEKFSTSEAVLGTSMKSVGEAMAIGRNFKE
                     SLQKALVSLEIGFSGLDRIFPLNKKQIEKELKKNIPNRILLAAEAFRKKINLKRVHQL
                     CKIDPWFLQQIKEIVDEENNIQKKGLPKDYNEFNRIKSIGFSDKKLSEITKIPEDLVR
                     KKRTALKVLPVYKKVDTCAAEFKSFTPYMYSTYQRNYALNSECEAEPSSRKKIIILGG
                     GPNRIGQGIEFDYCCCQASYALKDSGFETIMINCNPETVSTDYDTSDRLYFEPLKEEY
                     VYNIIKKEQQKGNLVGIIAQFGGQTPIRLAKFLHDNKLPILGTQYTSIDLAEDRDRFR
                     KLLDRLKLKQAESGIAKTYKQAIQIAEKIGLPLMVRPSYVLGGRAMEIVHEKSQLKNF
                     VEEAFKAAEDNPILIDKFISHAMEVDVDAISDGKQVFVAGIMQHIEEAGIHSGDSACC
                     LPPVSIKPKLISEIEIQTKKLALALNVKGFMNIQFAIKNDEIYVIEVNPRASRTVPFV
                     SKAKGLPLAKIASRVMAGEKLSKFNLKNKNKNLYAVKEAVFPFNKFPNSDLLLGPEMK
                     STGEVMGFDKDFGMAYAKSQIAASNSLPTKGLAFISLKDGHKDEGVDLAKQLIKLNFT
                     LCGTGGTAEYIRKHGIKCKTINKVSGGSPHIVDVLNSKKIALVINTGGGNSEHRLHDA
                     MALRRATLGNKVPYCTNMSTAQACLMGIRSLKTKEITVTALQDI"
     gene            complement(50650..52728)
                     /locus_tag="SAR11_0042"
     CDS             complement(50650..52728)
                     /locus_tag="SAR11_0042"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative secretory autotransporter"
                     /protein_id="AAZ20867.1"
                     /translation="MFTVTQRKVSAISSVYAHINEYDLSTPFNVSTKTYASDDEVCIL
                     NSGDTTSGPISAITDLEFSNDGLMLFVSRGNAKGTANDDRVFRFDLTSPYDVSTCAFA
                     NQTSDLDTGTLQDGSNAGDITEGTNNRLQGIEINNDGTKLFAIFHGATGQDTRLLEYQ
                     LSTAYDLSTISIITDAGIELNDEVSNPQGIRFSPDGKRFWAVDHNGSTQDVTQISLDV
                     AFSTSSFTIDGTVSISSDITQPRGIAFSAVGLKMYIGSDKDENGKDEVFEFDLVCPFN
                     IIEGKCPSITTGVRTGIAIAQIEVATRTIEHSTDTALNRLKWIRRNKDNQNLTNLNLD
                     LNFTNQMLASLTKVVKTSATTKKKDKQQDVFYWSEGSIAVGRVGETNVSSFKKIKTNA
                     ITVGADKFTKNNGIRGLAFRFGKNDVDVGSAGSNLDTNTYNLTHYSSSPIEDDTKFID
                     TVIGVGVLNSDILSVLDGERVTADRKGRQIYGTIKLKDEIKKNNLILIPSGQIDLGYT
                     LLDGYQESGNTAMKFKKQGIRSRNARLSIAAVDELKNEKYKIRKHGKLEYKANLNRSS
                     NIKYSYVSDATSGEFDTKLNSGALHNLNGELGIDIILPDSFSIFLIYERNQALGTGHT
                     DKIHLAIGYLPNRKTNYAFKLAGSENLGSEFKISKNINDFEIDFKLNNQDVLKPNTFD
                     EATINLKKIF"
     gene            complement(52886..53026)
                     /locus_tag="SAR11_0043"
     CDS             complement(52886..53026)
                     /locus_tag="SAR11_0043"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ20868.1"
                     /translation="MVFFLRKLAVGSLVSSFFILMQAQAGIVEVVNKQFKDLSIKLST
                     TF"
     gene            53177..55348
                     /locus_tag="SAR11_0044"
     CDS             53177..55348
                     /locus_tag="SAR11_0044"
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane autotransporter"
                     /protein_id="AAZ20869.1"
                     /translation="MLNLIKKSKKLIIKGALKLKVFLVLFSLFFSSLALAEPTFIANF
                     NVQDKETSPTGITFNPDGTKMFITGINMRKILQYNLTTAFDVTSAAFEKSVLIQVEQD
                     KPQDVKFNSDGTVIFLLGTGTGVIDGVDAARNGIHRWSLSTPYDIGSITPANTTFTEV
                     GGDNPRGLAFNNDGTKMFILDNTAQRVEEYNLSTPYNPDTKGSVANTLGNARSASHQG
                     LGFNNDGSKIFIVKQDNKIDEYALSTAFDLSSATLTGTVSPTFPVTNKRLSGFAFNSS
                     GTKMYHLDWHTLTDADNVNEYSLSCPFAVVSSSTCGAPQKNKDVRGVVDAQINTAKNF
                     AKDSSQSALKRLSILRANKYYNASAQNIELNFQNELLKKVSNNVLSSAQAKLNPLQKL
                     DQILPNDWEVWSEGSISFGKIGESSLSSAQDIDSLGITVGVDTKMDDDKILGVALRVG
                     STDVDVGTFGSKVDTNALSLSLYGINSLENSNYLKHVFGVSYLDSNIARKYDGNTDAN
                     KGEREGKQVFGSLNFGKEYENSDLIITPTGRIDGSYTALNGYTESGIAALSYNDQDIS
                     SLMASLGVLIDQDVDLENSTVRSRINLEYSKEFASSSKVVTSYVSNSESFEYQADNKN
                     RDIYTAGLGLDFKHDQGLIISTDYERQQIKGHGYINKFTLSAGFLYRKETEFALGLDE
                     EMTSSFKISKALGVFDLEFDLENNFSNQENHNANLSILSKF"
     gene            55348..55692
                     /locus_tag="SAR11_0045"
     CDS             55348..55692
                     /locus_tag="SAR11_0045"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ20870.1"
                     /translation="MSKIKIVFYLALAFIFYKGFVAFQNFEIGVDDRVASIEEKADFE
                     KEGEVIGLMMYLGDPPELYEHLLTKNKSRCLEMRQTAEESSSAYYECARVNAVLKGGK
                     IVSIINEIEVIE"
     gene            complement(55701..57719)
                     /locus_tag="SAR11_0046"
     CDS             complement(55701..57719)
                     /locus_tag="SAR11_0046"
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane autotransporter"
                     /protein_id="AAZ20871.1"
                     /translation="MYITNRVANHDAYIVQYSLSTPFDISTATRTFVDGAGTKLTCST
                     DMQLPHAIEFKPDGTRMFITTNKDHSGNPGVAVYQFKLTTAWDTSTLDCEKIFEVDIT
                     GVGNEDQVRTLTFKPDGTRMFVGGKTQDKIREYILTTPFDLRSGVSVGSLSASLASSS
                     DGGMRNIQLHSDGSILYVAGDGNNNIHKYTLSTPWDITTISSTSTEYELGSRVSHMRG
                     FIFTANFTKLFVTNDAGSTASTNKIFEYSLACAGTITCIDASNNNDVKAIIEANVELS
                     KRIIKNNTLPIFHRIEWLRRHKNKDNLSNLNAEIDFTNEKISKLVSALKNSKKENDRS
                     YDSEDWFKWSEGRISLGKNKSINSSSRDFHSYGISVGADKIKDDDRDAMHGYVFQYAN
                     DNVDIGSSGTKLETDAYSFALYDTKLRDDHVFTDALIGVSLLDIDQKRVIYGNILEGN
                     REGQQIYGSFNFGKRIVDEDLNLNPGIKLDLGYTKLKAFRERTVVGDSLADALLYKEQ
                     NIKSALITLGVLLDKTDTDKEEDEIINHHGRLEYIADLSPSSDAEFYYLNSQSTVYNY
                     NVENKSKHNLRIGYGFDVTSITGWSFVGNFERFQSNGKGHSNEIYLSVGYVPIDEMKF
                     VFDLNNFENTSFSYTNNINGFDLKMSSNYNFISDVPDYGANIEISNKF"
     gene            58036..59004
                     /locus_tag="SAR11_0047"
     CDS             58036..59004
                     /locus_tag="SAR11_0047"
                     /codon_start=1
                     /transl_table=11
                     /product="probable transcription regulatory protein"
                     /protein_id="AAZ20872.1"
                     /translation="MIKITNKTNEEQIFKIINENFSQLAPSYYSLVTHWFINAYKNFK
                     GIDKYIILIYLINKDFIHYRKNGLMVDYDTFYKDKTLEIPNINISDIARDLLIPKENV
                     RRKISELEKKGIIKRAGKKIFVERPGFIQTKANITLKDFSSLVSTFSEILKDKKIIKE
                     PLNTDQISNLIKENFSFCWYQFYKFLFIFSNRWKTDTKTQDLETICVGLIVMINTVQN
                     RGFKDKNLDRQKYFKAVQKSNHIGINAFSIADITGIPRATVVRKLQFLIENKFLNISE
                     KKLYNFAMGTQTKQFKVLTKLQDKNMKALGKFLYKVFNQIKIINTN"
     gene            complement(58997..59845)
                     /locus_tag="SAR11_0048"
     CDS             complement(58997..59845)
                     /locus_tag="SAR11_0048"
                     /codon_start=1
                     /transl_table=11
                     /product="Sodium Bile symporter family protein"
                     /protein_id="AAZ20873.1"
                     /translation="MEIVTNIAPIALAIIMLGLGASLTVDDFLRVAKNPKDFFIGFIC
                     QLIVLPIVAYLLIITLGVPIEMALGVMIIAAAPGGVTSNVLTKFAEGDVALSISLTAV
                     MSLLSIVTVPFIVINSINLFDITYVEREITMVSISLKMFFVVTVPVIIGMTIRHFTGD
                     LVIKNLKFIQRFSIALFLLVFAAIYIEEWDKIVSFLTRAGLIALILNVTMMVIGFYVA
                     KFFASGTPQQRAISLECGLQNGTLAVFVATQLFDNIIYMVPTAAYALVMMATSVIFVF
                     ILRKSN"
     gene            complement(60069..62204)
                     /locus_tag="SAR11_0049"
     CDS             complement(60069..62204)
                     /locus_tag="SAR11_0049"
                     /codon_start=1
                     /transl_table=11
                     /product="Ammonium transporter family protein"
                     /protein_id="AAZ20874.1"
                     /translation="MESVKSFVDTLWVIDCAILVFIMQAGFMCMETGLSRHKNSINVA
                     LKNAADFGLSVVVFWIFGFGLMFGTSYNGFFGTDLFFFKTEKADYMTYFVFQAMFVAT
                     AATIVSGAVAERMKFNGYLIITIIATGIIYPIVGHWAWSSSYLNNMNDTVMQLSAVTG
                     EIKNTGWLTELGFVDFAGSTIVHSVGGWIALAAVLILGPRIGKYSESNKGKFTGSSFP
                     LAVLGTLILWFGWFGFNGGSNGAMDETVPLILINTFLSAAFGLLTGLGISFLLFKKPD
                     PFYVILGPLAGLVAITAGCNSMTSVTAIFVGIIGAIVAIFINELLNKYEIDDVVGAVP
                     VHLGAGVWGTISVGLFSDLEKLGTGLTRLEQIEVQVIGILAIGAFAFFGSYIILKILN
                     YFYPLRVTPLQEELGLNIAEHNAVSVEHDLISILEKQSESGDLSVRGPQDPFTAGGVI
                     GLYYNKLMNKLEVSENEKEKWRSRISKEINLAVKVQENFLPKRDLQNYPVQGINIASR
                     EVSGDFFSFYPHNDSINFIIADVAGKGVHAGMVMAKASTLFEVMSRDQVDPDEMMLHM
                     NNDLFLTKTSGMFVTCVLGKYDLITKEVSWVNAGHQPAIIRDKNGKYQNFDSEAPPMG
                     VIHQKNKSIYKINKQVLNGNKFYVFTDGLSESLNAEGQEIGIEGSIEIIEDNYTKDSK
                     KHLSDISKKIIDSSKSGKLSDDLTLISIG"
     gene            complement(62323..64560)
                     /locus_tag="SAR11_0050"
     CDS             complement(62323..64560)
                     /locus_tag="SAR11_0050"
                     /codon_start=1
                     /transl_table=11
                     /product="Ammonium transporter family protein"
                     /protein_id="AAZ20875.1"
                     /translation="MTAADTQILLNKLQSNINQLELTNKGALNALEFRLDAILQANLD
                     TFWLLICAILVFLMQAGFMCLETGLSRNKNSINVALKNVSDFGISVVVFWAFGFALMY
                     GTSVSGLFGTKFFFFTTKVAGYQTYFVFQAMFVATAATIISGAVAERLKFFSYIIITL
                     LVSGLFYPIVGHWSWAFNFENPAEKFGWLGQLGYLDFAGASVVHSVGGWIALSVLLVV
                     GNRTGRFREDDKKKSFQGSNTPMAALGALILWFGWFGFNGGANGAMDLKIPLILINTF
                     LSASFGLIFSSVMGIIVLKKPEPLFMITGPLAGLVSITASCAYVDPTHAIIIGSIGGI
                     ISGSTIVLLEKIKIDDVVSAIPVHLACGIWGTIAVALFANFELMGVEKTRLEQIYIQL
                     IGISSIGAFCFIGSYLILKTINSFFPLRVSKIHEELGLNISEHNASTDTHELLEVLTN
                     QAKSDNYSSRAPQDPFTESGIIGTQYNVIMNKLEQSEKQKNKWKNRVSKEIKLAMNVQ
                     QRLMPKRDIENYPIFGLNIPAREISGDFYDFYLHDDEVYFTLSDVSGKGVNAGMVMAK
                     AITLFKIFAKQKFKPNEILLEMNNDLKETNPVGTFITSIVGRYNLKTDLVEIANAGHQ
                     PTLLKVGKDFKEYPSSSMPLAVIKHKDESVYQLESFKLNGGRIYCFTDGFSECMDENK
                     QEIGIDGVKELILKHTNSSLQKELTSATEEIRLKSLKKEIVEDGVKKDNDILDDDLTI
                     IAIGK"
     gene            complement(64574..64903)
                     /gene="copZ"
                     /locus_tag="SAR11_0051"
     CDS             complement(64574..64903)
                     /gene="copZ"
                     /locus_tag="SAR11_0051"
                     /codon_start=1
                     /transl_table=11
                     /product="probable heavy metal transport/detoxification
                     protein"
                     /protein_id="AAZ20876.1"
                     /translation="MFKKYILFLGFVLFSTNLFAAQTQIAQVNGMMCIKCQKMVTKAL
                     QAASPSATVKVSWPEGVAVSSYPDKSDLSNEDYKKAILGTGFEVIKVVSVDKIITDAG
                     EARKLVD"
     gene            complement(65036..65326)
                     /locus_tag="SAR11_0052"
     CDS             complement(65036..65326)
                     /locus_tag="SAR11_0052"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ20877.1"
                     /translation="MKKIILIFLLIPLLNNCGPYSAALGPSLTLVNSGSILQASASYA
                     GSSTMKKFKKDYINELNVEKICPTVHSSELNEIFFETIDHMDCYFDPMSIHR"
     gene            complement(65399..65836)
                     /gene="pulG"
                     /locus_tag="SAR11_0053"
     CDS             complement(65399..65836)
                     /gene="pulG"
                     /locus_tag="SAR11_0053"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative pseudo-pilin PulG"
                     /protein_id="AAZ20878.1"
                     /translation="MQETKKIKIKSSLGFSLVELLVVVAIIGILASVGVITYSGYISG
                     TKEKSTKNVMLQISLAQTEEYSNSGNYYTQDNDSCTPTSSTSNDIETILFGGGDQIGK
                     DMGYEICVASIGSSNFNIIAKEIDGACQLILSRNGNFTRGDDC"
     gene            complement(65846..66331)
                     /gene="pilA"
                     /locus_tag="SAR11_0054"
     CDS             complement(65846..66331)
                     /gene="pilA"
                     /locus_tag="SAR11_0054"
                     /codon_start=1
                     /transl_table=11
                     /product="Pilin (bacterial filament)"
                     /protein_id="AAZ20879.1"
                     /translation="MKNNKGFTLIELLVVVAIIGILAAVGVVAYNGYTKSAKINASKS
                     NQGAVTKYLAAEIQKCNMGTESTAMSGNLTCSGRTEALIMSGAVAALADFKNTYTPVC
                     KGVTDGSTVPTASDGSTTCLASGKGVTTITGDDAGTITVSTQYGDDATVDVLTNAVAI
                     E"
     gene            66490..66774
                     /locus_tag="SAR11_0055"
     CDS             66490..66774
                     /locus_tag="SAR11_0055"
                     /codon_start=1
                     /transl_table=11
                     /product="Sulfate transporter/antisigma-factor antagonist
                     STAS"
                     /protein_id="AAZ20880.1"
                     /translation="MKYKVTDNENVSTVFLTGEIDMDVADEVREIVFPLIDAGKEVHL
                     NLKDVPYMDSSGISIIIESNQRAREKNTKVELKEVSQPVEKVLAMARKFL"
     gene            66771..67070
                     /gene="spoIIA"
                     /locus_tag="SAR11_0056"
     CDS             66771..67070
                     /gene="spoIIA"
                     /locus_tag="SAR11_0056"
                     /codon_start=1
                     /transl_table=11
                     /product="Sulfate transporter/antisigma-factor antagonist
                     STAS"
                     /protein_id="AAZ20881.1"
                     /translation="MTYKITEEDNISTIFLDGEIDMDKTDEVKGVIFPVIDSGKNVAL
                     NLSNVQYMDSSGISVLIESHQKALEKGTKLVIKDVSKSVLKVIMMAKLEQILNLE"
     gene            67078..67512
                     /gene="rsbW"
                     /locus_tag="SAR11_0057"
     CDS             67078..67512
                     /gene="rsbW"
                     /locus_tag="SAR11_0057"
                     /codon_start=1
                     /transl_table=11
                     /product="Anti-sigma regulatory factor (Ser/Thr protein
                     kinase)"
                     /protein_id="AAZ20882.1"
                     /translation="MSLENFSHSEKKDFLVSSASLKDVRAFSRDVFEKFKIDEDLREE
                     LVLAIAEAAQNIVKHAYKDMPDTQDKMVVRISCNDDVLEISFFDKGKPVEKSKVKHRA
                     IDDIKPGGLGTFFIQQIMDSINFEPGKEPWINNLVLTKKLKN"
     gene            complement(67509..68741)
                     /gene="pilC"
                     /locus_tag="SAR11_0058"
     CDS             complement(67509..68741)
                     /gene="pilC"
                     /locus_tag="SAR11_0058"
                     /note="Type IV fimbrial assembly protein, pilC"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II Secretion System PilC"
                     /protein_id="AAZ20883.1"
                     /translation="MEAFTYKGISEGKYVEGDIEAINLDEASHLLKEKKVIITNIIKS
                     KKKKGEAKKKSGGSSLFGKKKVKVEEILIFSKQFATMVKAGLPILQVLIMLRDQLESP
                     ALKDIIEDIRKSLEGGVNLSKCFEKYPQYFDNIYVNLIKAGEASGKLDVFLLKIVDSL
                     EKKEKIKKKIKGALMYPAIMFTVAITVSAFMLIKVVPVFAKMYDGMGLELPAATATIM
                     AMSDFLSGTGGKVILFGGIGGYFGFNFIVKRNAAIRFRWHKQILKLPIFGDMILKSLL
                     ARIALILGNLSAAGVNLLESLEIAKSVSNNDVITDALESVKKGVFSGDTLTKLFLKEP
                     LFPPTFSQLISVGEQTGQLDEMFNSVSAYYEEEFDTTVDNMSALIEPIMIVFMGVMIG
                     GLMIAMYSPIFNVGALIN"
     gene            complement(68744..70495)
                     /gene="pilB"
                     /locus_tag="SAR11_0059"
     CDS             complement(68744..70495)
                     /gene="pilB"
                     /locus_tag="SAR11_0059"
                     /note="Type IV pilus assembly protein (ATPase) PilB"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II Secretion System PilB"
                     /protein_id="AAZ20884.1"
                     /translation="MFKISRESEINLVNVLIDNDIISGKDLIDIKKVSTENNKSQIDA
                     IFELKLTDEKKIIDLLIKEQNLEIIDLKSVEITEEVKTVLPSNYIKMNFVAPFKIDGK
                     TLHMAIPDSSKLGLMRNLKAITKKNIELHAAKIGDISEYIERLSSETDEVTIASIRNE
                     NRRKTKTFETDLGDAGEVLDNKPEEDIEAIENESEVIKFSTAVVADAIKMGVSDIHIE
                     PYRFSSRVRYRLDGMLQEQETYRQFLHDNYGAVVTRFKIMGKLDIAERRLPQDGAINF
                     KIGNKVVDLRLSILPTANNERIVMRILNKDAGDITLEQLNFEKQDLESLRKGIHGSQG
                     LILVTGPTGSGKSTTLYSILKEVSKPHLNILTAEDPVEYELDGVGQVQIKDDIGFTFA
                     KALRSFLRQDPEIILVGEMRDKETVDIGLKAALTGHLVFSTLHTNDAPSTITRLQNMG
                     TPDYLISAACQLVVAQRLARKNCKDCRVPDDDVNPKVLKDMGFSDEDASKVKAIKGKG
                     CAKCSDSGYKGRQGIYEILVVSKPIKEAILKQATTPELREIAIKEGFRTMQDMGRRMI
                     ASGELNFREYERILSSE"
     gene            complement(70495..72051)
                     /gene="pilQ"
                     /locus_tag="SAR11_0060"
     CDS             complement(70495..72051)
                     /gene="pilQ"
                     /locus_tag="SAR11_0060"
                     /note="Type IV fimbrial biogenesis protein PilQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II Secretion PilQ"
                     /protein_id="AAZ20885.1"
                     /translation="MKFKKRISFLILPFLFIFLTGCAEKFAKNTGSFKHDTPLIKTDI
                     KKTGKLEVEKSVEMGPTPAEGDVVKLKKRKQISSVKERNYLLISEDFKSLKQNVSFKF
                     QALDFKEAMKLMSEVGQINILVGDDVAGSISAELDNVPWDKAFNALLDLKNYAADIDV
                     ASNIIRVSTPANLTSQEGYKSARASAVKKKVELEDSVEPIISEIFRLYYITPSEAKAT
                     ITELFTTVGTNGNFIPIQVTEEATTRSIIVRGKEKDLDIVDKVIREIDKRTKQVLIEA
                     FIVEATSTFEQSLGKRLGAAYTRKSLRMGGTQGGSSVGAASGSGAALSDSTGAFTSGA
                     GTDNLVNFGSAAATSGIGILKKTGSAVLKLELDFLEAQGLSKTVSNPKLFTLDNQQAS
                     INQGETIYIDGGEGEDKPVDASLKLIVTPNIIGDGNVMLSIQVNNDTPNRANAASVGV
                     NKMEINTKLLVADGDIVVIGGIKKNNVANNRQGVPGTSKVPILGKVLSGKSNSDTMNE
                     LLVFIAPRIL"
     gene            complement(72054..72560)
                     /gene="pilP"
                     /locus_tag="SAR11_0061"
     CDS             complement(72054..72560)
                     /gene="pilP"
                     /locus_tag="SAR11_0061"
                     /codon_start=1
                     /transl_table=11
                     /product="type 4 fimbrial biogenesis protein PilP"
                     /protein_id="AAZ20886.1"
                     /translation="MNFFKIIIISVFFMLLSKVSMADSHDKEQNIIDKAKEINKKIKE
                     KQANSQSNISSEIKDEEPLPLNDPFAGDSSLTGGNTILSSNPEEAQNEMSLYKFKLVG
                     IMTSANDDGFVSLINSSGNIITLARFEELSPGVKLVGLNNREAVFEKNENSLLVINFN
                     NKITERTK"
     gene            complement(72547..73224)
                     /gene="pilO"
                     /locus_tag="SAR11_0062"
     CDS             complement(72547..73224)
                     /gene="pilO"
                     /locus_tag="SAR11_0062"
                     /codon_start=1
                     /transl_table=11
                     /product="type 4 fimbrial biogenesis protein PilO"
                     /protein_id="AAZ20887.1"
                     /translation="MDIDLKNINMSDIKDQITKLADKKTLIKIGIIFGAIVFFLIIYY
                     AILNPMVESRKAKLDDMNLKIQETAKFTSEIYSMRARIKKLKPDYEKYSSLFHSKAEV
                     EGLYQTLSEYAGQNDLVITRIEKKVIQEVLKAQALAQADGKKTKKKKNNQVKNVANIA
                     YYLIPVDFEIDGNFIGYIKFKRALSLSNKMLNFDKESIQVVKGNTTGAIKVKGTLTIV
                     GLPNEFF"
     gene            complement(73227..75770)
                     /gene="pilMN"
                     /locus_tag="SAR11_0063"
     CDS             complement(73227..75770)
                     /gene="pilMN"
                     /locus_tag="SAR11_0063"
                     /note="Type IV pilus biogenesis protein, PilM/PilN fusion"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II Secretion"
                     /protein_id="AAZ20888.1"
                     /translation="MDEDNKDKFDYKEEDTLKSDQENQSENDSTDTLNPQETDNNESE
                     KSNENDNLTENSETLQSQDESVEQNVSASNTNNDEETLKSDQENQSENDSTDTLNPQE
                     TDNNESEKSNENDNLTENSETLQSQDESVEQNVSASNTNNEEQKKEHEVIHKKDGRLH
                     IYVRQDKYKGELKSRNWVGRLYIDGKQKISSSGTTNLDDAIPILEKWFDDVHEESKKL
                     KIEENIKPEEGESSQIDISTTNQSNNEAQPQTSSVPLNENSEISTQDQVKSKLSNIFG
                     KIKEIKIKKPDFAKNIKKSSFNNSKVGNYKSKIQNFFKSKLGKSSVQGEEIIGIELAN
                     KEIRIVQVSSNKANQWVLEKLHIHPVDITDDSTPIDNADKFSEELVLAIQKYKITSPN
                     AAIAIPVTSAIIRVVTAPLMKEDELNKAIETNSLWENLVQLTDSLEDYSIFHQVINRN
                     DKENTMDILFVASKLTDINSYTSIIKNAGLNPVIIDVKCFALKSSVDQVNQITNKTED
                     ANLTAVLEFGLDENYLMILYNNNPIITDIFIRGQDRKILQDSQDTEEKEGLVRRYVTQ
                     VKQAIQDFETKYEKRIRNIKVVSDIKNVDEYLGSFRKILMNVGFNTFDPTEGLKIPSQ
                     YQQILDNKLNRSYLSTSVGLAFRKLDVFGYYKFVTAVKNINLLPDRSNVMKQKKMKAI
                     SGFAFKGITAAVVAIYVVLFGLSFWNIASYNKKLKQYETVKIDHAKIIKQKKIVSKEL
                     SVINTSLKLSRTLKSNKELTYRILAQVASSVPNRVKFDQVEFNGSRRLTIQGIAASDQ
                     DILKFIENLGNQKLVEQASLSSMRLPKSTAGGATMKGFRVFVKIKTGKI"
     gene            complement(77115..78461)
                     /gene="rsbU"
                     /locus_tag="SAR11_0064"
     CDS             complement(77115..78461)
                     /gene="rsbU"
                     /locus_tag="SAR11_0064"
                     /note="GAF photoreceptor fused to PP2C"
                     /codon_start=1
                     /transl_table=11
                     /product="Sigma factor sigB regulation protein"
                     /protein_id="AAZ20889.1"
                     /translation="MNNEFHQSQNYQKFNEYQFINNMFFGAKKTETIKVDNTSVKDLE
                     LVTKMSQEFAKTLDLKETLQTSLELIIKRINAQAANIFLIDNDKQNFQCIASKHQAYL
                     EDFEIPITQGVMGKAALMKQCIRVGDVRKDVREIAEFYFDLDNKTNFTTYSVLCSPLI
                     VSDECIGVIHCLNKKTDNKLFEESDRKLLETLSGPAALAIRNAKMAKDLIVKNRIEKE
                     IEIVGEIQKTLLSQNIKENFPIAGINIPAKVVSGDFYNFSELSNGVYGFGVADVSGKG
                     IKSSLLMSKASSLYRCLSKTNFSAAGLLDILNTEICETTSRGMFVTMLVGIYDSNKKE
                     LTLSNAGHEPPLIYSKDGNFSNFEEAGPPLGIAPKFKFKETKINFSNSSMYIFTDGIT
                     EIRDAKGNMLEAEGFKDYIKKYQQIPNHERLNKIIEDIIKSGRIQKDDLTIVTVDG"
     gene            78561..79325
                     /gene="pild"
                     /locus_tag="SAR11_0065"
     CDS             78561..79325
                     /gene="pild"
                     /locus_tag="SAR11_0065"
                     /EC_number="3.4.23.43"
                     /EC_number="2.1.1.-"
                     /note="Type IV Prepilin Peptidase A24A"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II Secretion PilD"
                     /protein_id="AAZ20890.1"
                     /translation="MLYLIAFIFGSIWGSFSNVCIHRIPDDISVVTGRSHCPSCKTLI
                     KWHDNIPLFSYLFLKAKCRGCSAKINIKYFLVELISAINFVVIFHFFGVSLTTLLFFI
                     LSICFVIIFFIDLKHFIIPNELTYPLMIIGLLKSFDPNLNTTLFPNLVNSLIGGLFGY
                     IIIWLIIFIYKKLRNKEGMGLGDAKLLSVIGFWFGWASIPFVIFFSSVIALLSVVPDI
                     IKNKKDLSSQIPFGPYLIIGNLVFLIFNEQIRLFLN"
     gene            79386..80105
                     /gene="fimc"
                     /locus_tag="SAR11_0067"
     CDS             79386..80105
                     /gene="fimc"
                     /locus_tag="SAR11_0067"
                     /codon_start=1
                     /transl_table=11
                     /product="possible membrane-bound pili assembly protein
                     Fimc"
                     /protein_id="AAZ20891.1"
                     /translation="MRMKKFLSIITIFALSFYILVEFIGDRLIKNILEDNISSSLNRE
                     VSIKKLSIDYLSGEARANNIKILNKKFDGNLAEVDFVKVNLDTFSIFSNDILINDVQL
                     NNINLNYYFKFSDRITSDNLRNLQQDLEFKNTDSQSSKYFNIKNLDAKNINLAVLSSD
                     FDFEKTFSINDMNFKDIGNTKDSKNYKDILKKVFKDMVVDVREKIMSNNLLEAVKNLD
                     IKQIEDKVKDKLKNKLKGLIN"
     gene            complement(80345..84916)
                     /gene="pilY1"
                     /locus_tag="SAR11_0068"
     CDS             complement(80345..84916)
                     /gene="pilY1"
                     /locus_tag="SAR11_0068"
                     /note="Type IV fimbrial biogenesis protein, PilY1"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II Secretion PilY1"
                     /protein_id="AAZ20892.1"
                     /translation="MRRTLGDGIPVISSAAIDGNGNRVLTSADKSLGGLYLFNSAGER
                     INFTGTNQSGGSYTRDTWWAGSNTDQRCDYRLRDGSRTTNHLISTTRKYHEARYVTGV
                     TVPGTNISNENLLFAVQFDDGSSSVAVIALDTQYRCRLALTVNSVKHIRGMDISANAA
                     GHIIVGVFGRSGRKNAFQMTCNLNQADCEEITGRGKGQTDVFGRIYDGNRYRLNSDST
                     RMYISDDGNLYEYATRNVGGQNVISYAWGEKKECRASRNSTINQITQFELSSNDDDIF
                     FVGGSGRELVRVQWTAGYNICTRITGLGTASSLSNAGQAAGNLAADSVRVTNALTAIS
                     KSGGRILFSHNSYVDELTEANFTSANRNTAWQIQYGGPKITRLDGAKAAIIAVLTDST
                     LTSGANFGFGHWNAGEGSQGKTGRRGGKYCHGSGTSCNYYGGWSGNHPAGQSRICTGN
                     SCLNVGIGPEGAGNAIPVVERLGVEWGTDSEAFSQIAHDYFFGPVSPHDPNSDCQLNY
                     VIVIGDGEMSGTGTASTSFQGRTAGRLTRMREELGIKTLMVAYGDGIKASGMNRFNEL
                     ALVGSCDAAGGEDCEQTIVATTPLELQTELQQKIRQILAERLAFTAPSITATIQQGGS
                     LYQAQFAYEQFGEWKGTILRKTLNADGTVEHDPNAPGNWDAAARVRTQAAGGPTDPGT
                     ADSRNIWTPIADQSLDYLGNWDNVNEATAPTLEPEMERLGYVLRNYHSSTSKCGGDDT
                     TDDERDGILRFLAGQDFFDYDGDCDTTELRSHVLGDIYHSQLIEIGAPDGNTQFTDNN
                     QEAYFRTINNYQAFKASQQSRRNILYAGSNSGLLHAFSAETGNEEWAFLPPFLIGKLP
                     TLINSRLDGAIDGFKGGSNAVFGVDGSPVVHDVFMKGLTPEGDVEGSASWHTILFQPF
                     GRGGSGFSVLDVTTPLVRDGLGPMHMFSVYNDYINNVVYIMDNEGEVRELEYFSSSAE
                     ISASDEALKAQSNFNEAVTADEAIDSETTTNQDAIAVCQSDADVTGEFKTAGTASCYI
                     GRTFTFSDISFNTPNNQSIPENMINVSEMVDGEFLPVEFSDARMIDGQFVITFDEDKI
                     YNPGGSVNETRETTNIFVQTSCTSSSGIDPFFDYSKLGETWSTPRIVRLPSDIEAERE
                     DPANDKYVAIMGAGMANNNLCAGSALFMVELDNMDEPGKLYGGDQNGGPITIVDTSPS
                     GVALGNDIIETPNGSNINNAVPTSPLVITPDTGFGIPWRGAMVYINDREGKITKINLT
                     DSTKNDAKLFDQTTLFRLNASTTNKRYTFFSMDAGVGVTTKDFWLFGGTGDFNKLGDI
                     DRNMDNILYGIRDFDYPYFKHLNGVTIPSFDDQAFTSTAHQGADNAKSIDDATVCSDV
                     TGDTDASLCPDSAESAWVIHLDTQGDNNSHRKASAPPTLFKGQVYFPVYEPPPGSNRC
                     NIGNAYICVADDECGTNNSHKLVKGAEANGSNCTFIREGVLSELVIFGDKLYANVAGP
                     SEDSDTLYSVIAVPGEILSNTGGWRDTGY"
     gene            complement(85064..85588)
                     /locus_tag="SAR11_0069"
     CDS             complement(85064..85588)
                     /locus_tag="SAR11_0069"
                     /codon_start=1
                     /transl_table=11
                     /product="possible pilX-type protein"
                     /protein_id="AAZ20893.1"
                     /translation="MIMKNIFIGFLSLFLYFSSLSMSGACEFLKEQIGTPVSSIIEKY
                     DNLDEPPGGGDPTATYVKEYDSLNLCENSQLENSVLKVFIKEGKLIGTEIEGALGEAK
                     NNKIIDFAKTHLGYKSEVDFDEEWTGAISLSSFGDDVIYGRVSDSSGIYEMLIITKPE
                     FDSFLFGPNVIKFF"
     gene            complement(85664..86368)
                     /locus_tag="SAR11_0070"
     CDS             complement(85664..86368)
                     /locus_tag="SAR11_0070"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus assembly protein PilW"
                     /protein_id="AAZ20894.1"
                     /translation="MGGALIVISSGDHQSNNTSDQYQQTFYVAEHALIEAEKRIINRM
                     IGPWTEVSTITTPPVGSTPTEITAHNNYIEQLTATAIDGFARNTDGRDTPRNTLTPVE
                     TPCFKSFRNLIRNDSGGNLSLVTDHFTNQNFGSLIEPILNTPSDVGLEADDAEKEKEY
                     LKRYRYEFFSINVGSSTFKGAGASLKKTSTNAQRQGTAYRIYGCGYLMPKGAELGEFE
                     DPEILIPLETLIILSS"
     gene            complement(86437..87291)
                     /locus_tag="SAR11_0071"
     CDS             complement(86437..87291)
                     /locus_tag="SAR11_0071"
                     /note="pilW-like"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilin secretion protein"
                     /protein_id="AAZ20895.1"
                     /translation="MMAAIYTTYSIVNSTYTQVLEKAKVSRSSRDLIELLIRDTRMAG
                     FKYYLGDNDLGFPVESYLEFVGGATTVKDSHDPIVIIPNELGHSLSDAIATPTPKHNL
                     DDTCCDKIHIVYDDFNQNDATQPYKRYKLTYFANPLSDGSNADGPINPRYGIYKSKIS
                     WQQNIGQETGSWVSDCSECYHNELVRDYVEDMEFIALDQNGKVLSPYPSTNSEASRGN
                     LYKIRAVDIRIAFISEKPFFRFESRTGNERQLSGFSRAIRSFSDRNLRDNVVVTVYTR
                     NIVGQDIF"
     gene            complement(87366..88016)
                     /locus_tag="SAR11_0072"
     CDS             complement(87366..88016)
                     /locus_tag="SAR11_0072"
                     /note="similar to PilV"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative pilV-like pilin protein"
                     /protein_id="AAZ20896.1"
                     /translation="MKKQKHNISGLSLIEALVSVVIIGIGFVSILQMTNFSVQSIDNS
                     GDRTKANFLTEMIVEDVIGSKNSFYGVNSDNENIIYSTDGTASLDGDTLNTFSKHLSD
                     NSWSADLSCGGSSSNTTTPVENKQNIYETQQVDAPRNKQAKWNTIFEENRFLKCKSTT
                     EEKKLQVFEICKWDACDYKLDSITDEPLYIGRVEMKLNEGKKRKFIYFQSDYKLKQ"
     gene            complement(88021..88746)
                     /locus_tag="SAR11_0073"
     CDS             complement(88021..88746)
                     /locus_tag="SAR11_0073"
                     /note="pilU-like"
                     /codon_start=1
                     /transl_table=11
                     /product="possible pilin protein similar to PilU"
                     /protein_id="AAZ20897.1"
                     /translation="MRVQDEKIKGFNVLELIVVVVLIGVISAIGYPNFSEWRKDRETR
                     SAVLSIKSLIEGINSQVQRGQYAFVQVHILEEVNGAERNLIVTSKGMKPEKLASLLND
                     GTSDWWAKIGDRCNITDDAYWDDDPDQGADNVEVRQITYDNMATSWEGDDGAICFSKN
                     EKWYSGAGKLQSSLPEEGDVARSIDNTLFICRRTNDRSSCDVDSDGTPASEHDHLYVI
                     EWSRFGNVILEKWDTRNSDWVKQ"
     gene            complement(88721..89734)
                     /gene="pilT"
                     /locus_tag="SAR11_0074"
     CDS             complement(88721..89734)
                     /gene="pilT"
                     /locus_tag="SAR11_0074"
                     /note="Type IV pilus retraction ATPase PilT"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II Secretion PilT"
                     /protein_id="AAZ20898.1"
                     /translation="MFEKLEELAKNNKKISDFHIRTGWPLAFRQTGEIHKIQEIVVKE
                     QDLQDLISTNCNETEMKKFSETHELDSSVTLSGLRFRANFYKTIQGPAAVLRRVESVI
                     PEMDQFDLPQVLYDIVDMHKGLVLVTGPTGSGKSTTLAAIVNEINKTRTSNIITVEDP
                     VEFIHKDLKSIVSHREVGKQTKTFSSALKAALREDPDVILVGEMRDLETVSLALTAAE
                     TGHLVFGTLHTSGAPNTINRIIDVFPPEQQAQIRAQISSSLKMVVTQRLLKTKDGQGR
                     CAAFEVMKCTPPIQNLIREAKIHQIPSIMQTSVRDGMITMTKSLEELVKAGKIDASAG
                     RED"
     gene            complement(89886..90548)
                     /locus_tag="SAR11_0075"
     CDS             complement(89886..90548)
                     /locus_tag="SAR11_0075"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ20899.1"
                     /translation="MSFLNSIQNQAKKHEFPFDHWEYNNALSDGAIEEIIKADIPDVS
                     KHNLNYDGTRAIDGGAAEFREGIASGGEAIKFRCFVTKENEKKFPNLVKFIKELQSKE
                     VHGTISKMIDRDLSNSYVRVEVICDREGFWLKPHCDIKEKLMSGLIFINNANESEDLG
                     TDFYNEKLEKVKTVPYKNNYGYMFTSGPNTWHGMEKKKIVKERRCIQVNYVTFETDWK
                     VL"
     gene            complement(90548..91492)
                     /locus_tag="SAR11_0076"
     CDS             complement(90548..91492)
                     /locus_tag="SAR11_0076"
                     /codon_start=1
                     /transl_table=11
                     /product="Predicted nucleoside-diphosphate-sugar
                     epimerase"
                     /protein_id="AAZ20900.1"
                     /translation="MTKLKGILLTEGMHGMISQVEGLAKALDLDFIHEKIELNNFWKL
                     FPPKLTPVSSNVYKKVESSDFDVIISCGRKSVIPSIHLKKNSNKRVINIHIQNPKVNF
                     KNFDFIVAPEHDGIEGQNVISTKGAIHYLTESEINENKDYLNSFIKKDERKIWALIMG
                     GPTKYYEYSRENIKAIFENLNNLNKQNNFQLVVIPSMRTPKNIIQYVKDYFGENHTVI
                     ETIDKKAYLSALAISEKIVVTCDSSSMISEAALTGKPIYVANISPKKNDKRFQRFRNL
                     FKELNITRNLGEEVENWNYQKLDETNRVANIIKQKINS"
     gene            91514..92458
                     /gene="trxB"
                     /locus_tag="SAR11_0077"
     CDS             91514..92458
                     /gene="trxB"
                     /locus_tag="SAR11_0077"
                     /EC_number="1.8.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin reductase"
                     /protein_id="AAZ20901.1"
                     /translation="MSENPIKHTKVLIIGSGPAGYTAAVYAARAMLNPILVYGVQPGG
                     QLTTTTDVENYPGFSDVIQGPWLMDQMRDQAKAVGTDLIEDHISSVNLKSTPFEAIGD
                     SGQKYTADSIIISTGAQARWLNLESEQAYRGFGVSACATCDGFFFKEKVVAVVGGGNA
                     AVEEAMFLTKFASKVKLIHRRDTLRAEKLLQKKLMENKKIEIIWDSAVEEVIGDSEPK
                     NVKAIKIKNLKTNKIEEMKIDGLFIAIGHDPATALFKEQLEMDKEGYLLTKPDSTETN
                     IPGVYAAGDVKDKTFRQAVTAAGMGCMAALEAEKFLSH"
     gene            92500..93519
                     /locus_tag="SAR11_0078"
     CDS             92500..93519
                     /locus_tag="SAR11_0078"
                     /codon_start=1
                     /transl_table=11
                     /product="possible NAD dependent epimerase/dehydratase
                     protein"
                     /protein_id="AAZ20902.1"
                     /translation="MTDKVLLTGISGWIAKHIAIELLNSGYEVLGTVRSQNSLDETKK
                     TLSEYISTDKLSFVELDLLKDDGWVEAAKDCKYIIHTASPYPMKSSRNREALVPAAKG
                     GALRVLNAGIEANVEKIILTSSIVAMFKKPNRTNPYTFGESDWTDTDWSGSNDYTISK
                     AKAEQAAWELMESKGLKDKLTVINPGGVFGDALDKKTNTSTSYVELFLKGKYPMAPNF
                     GILISDVKDVARAHVLSIKNPKVNGRRLIIGSEVKKMLEVSKIMAEAFPKYAKKLPKK
                     EMPNFVVKLISYLDSSVKIMLPDLGILMQTDTSYSEDLLGMKFKPAKESIVDAGNSVI
                     RLGLV"
     gene            complement(93511..93960)
                     /gene="ytoQ"
                     /locus_tag="SAR11_0079"
     CDS             complement(93511..93960)
                     /gene="ytoQ"
                     /locus_tag="SAR11_0079"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein ytoQ"
                     /protein_id="AAZ20903.1"
                     /translation="MLNVYLAGEIHSNWREEITQLCEKEKLDIKFTFPVTDHEASDNC
                     GVEILGAEEKNFWKDRKGANINSIRTKKSIQDCDVIIVKFGEKFKQWNAAFDAGYATA
                     LNKSMIVIHNDDHQHALKEVDGSAAAVASDQKQAFRILKYILEGSLD"
     gene            complement(93960..95159)
                     /gene="aatA"
                     /locus_tag="SAR11_0080"
     CDS             complement(93960..95159)
                     /gene="aatA"
                     /locus_tag="SAR11_0080"
                     /EC_number="2.6.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate transaminase"
                     /protein_id="AAZ20904.1"
                     /translation="MSIISNSLKKIKPSPTIAVTQKARELKAAGKDVIGLGAGEPDFD
                     TPDNIKQAAIKAINDGDTKYTAVDGTAALKDAIVKKFKRENNLDYTTDQVTVGAGGKH
                     VIYNAMMATLNEGDEVIVPAPYWVSYPDMVLLAGGTPIILECNEKQGFKINPTELEKS
                     ITPKTKWIILNSPSNPTGACYTEGDIKGIADVLAKHPHVHILSDDIYEHVTYEGFKFF
                     TIAQIDSLKERVLTMNGVSKAYSMTGWRIGYAAGPKEIIKAIAKIQSQSTTNPSSISQ
                     AAAVEALNGTQDFIKERAISFQERRNFVVKALNEIDGIECLNPDGAFYVFPSCKGLMG
                     KKDTSGKELKTDTDFVQSLLENSGVAVVQGSAFGLEGFFRISYATSMENLKNALEKIS
                     TFCKSLN"
     gene            95195..97366
                     /gene="uvrB"
                     /locus_tag="SAR11_0081"
     CDS             95195..97366
                     /gene="uvrB"
                     /locus_tag="SAR11_0081"
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC chain B"
                     /protein_id="AAZ20905.1"
                     /translation="MQNTYQDLITEIQSKNPEIHQKLEGGQKFKLVTDFKPAGDQPEA
                     IKQLVKGANKDELSQVLLGVTGSGKTFTMAQVIERTNRPALILAPNKTLAAQLYGEMK
                     SFFPENAVEYFVSYYDYYTPEAYVPRSDTYIEKEASINEQIDRMRHSATRSLLERDDV
                     IIVSSVSCIYGLGSVEAYSKMTLSLKKDYDYNREQLIKTLVHLQYKRNDQSFYRGTFR
                     ARGEYIEIFPSHLEDRAWRLSLFGDKLEKIEEFDPLTGDLLKDLDVIKVYANSHYITP
                     KPTIEQAVIKIKRELEVTLKKFKEQNKLLEAQRLEERTKFDLEMIEATGSCAGIENYS
                     RFLSGRKPGEPPPTLFEYFPDNTLIFVDECHVTVPQLNGMYKGDRSRKSNLAEYGFRL
                     PSCMDNRPLKFEEWDAMRTQTVFVSATPGPWELEQTKGKFVEQIIRPTGLIDPPVEIK
                     PAKNQVDDVMHECKKTIDKNFRVLITTLTKKMAEDLTEYFHENGIRVRYLHSDIDTLE
                     RIEIMRDLRLGVFDVLVGINLLREGLDIPECALVAILDADKEGFLRSETSLIQTIGRA
                     ARNLDGRVILYADKETKSIKKAIQETDRRRTIQVAYNKKHNIDATSIKKEISDVLESV
                     YEKDYLKVGTGDNIGGNLKKHLKQLNKRMKDAATNLEFEEAAKIRDEIRNLEASELEI
                     VLNPKVKHYNQENRVYPKGRSKMGLPGTRAQKGKKKWKQTK"
     gene            97348..98100
                     /locus_tag="SAR11_0082"
     CDS             97348..98100
                     /locus_tag="SAR11_0082"
                     /codon_start=1
                     /transl_table=11
                     /product="probable short-chain dehydrogenase"
                     /protein_id="AAZ20906.1"
                     /translation="MEANKIIITGAATRMGAAIAKKLSGPGVEMVIHYNSSKSEAEKL
                     QKELSKNKTKVYLVKGNLAKEQDLKKIIKFSKLKLKYFDCLINNASLFENDSLKNFSS
                     KSWNQHIDVNLKAPAYLTKEFSKNVKGKNNNIINIIDQRVFKLTPFFFSYTLSKTGLY
                     TLTKTSAMELAPNIRVNGIAPGPTIKNKRQTDMHFKKQYLATPLKQQVNVQDICSAVD
                     FFIKNSSITGQVIAIDSGQSLNWQTPDVIGKE"
     gene            98097..98522
                     /gene="folB"
                     /locus_tag="SAR11_0083"
     CDS             98097..98522
                     /gene="folB"
                     /locus_tag="SAR11_0083"
                     /EC_number="4.1.2.25"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin aldolase"
                     /protein_id="AAZ20907.1"
                     /translation="MKKTNLNIIKIDKNKSLFNYEKKILIKELTLDLKLGYYDFEKEK
                     TQKVKFSLEIDYEDRKPTNDKDIKSIVNYGQVVKLITKLAKNKHYNFLETLAEDVFDV
                     LFKDKRIGKIMLQIEKLEIIKECASVGIQITKKRSHEEL"
     gene            98509..100344
                     /gene="uvrC"
                     /locus_tag="SAR11_0084"
     CDS             98509..100344
                     /gene="uvrC"
                     /locus_tag="SAR11_0084"
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC chain C"
                     /protein_id="AAZ20908.1"
                     /translation="MKSSELGKDVIRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLP
                     NRLKSYVAEKNHIIRTARMLSQTFKLEITTTANESEALLLEANLIKKHKPKFNILLKD
                     DKSFPFVFISNKDQWAQVTKHRGKKDKEGFYFGPFASAGTANWTIKMLQKIFQIRVCD
                     DSTFKNRKRPCILYQIKRCSGPCVDYIDKEDYKKSVDQAIQFVSGKSRDIQKNLSKQM
                     EEASEKLDFERASIFRDRIKSLNIIQSSQRINEANLIDADVIAAYKESGKTCIQVFFY
                     RSKQNWGNQAYFPKHDPDQSLSEIMSSFLMQFYENKNVPKLIIINTEIEDKKLIEETL
                     SKKENSAISINVAKKGTKAKVIAMAEKNAKESLNRKIYETNNNKNLFEGVAKKFDLKN
                     GLNLVEVYDNSHISGTNSVGAMITFGNEGFVKKRYRKFDIKTKGNEQDDFAMLKEVLT
                     RRFKRAMLEKGNYLTLPDLILIDGGKGQYSSAKEVLDEFGLHDLPMIAIAKGKLRNSG
                     DETFFYKGKSFKFDKNDPTLFFMQRLRDEAHRFAITSHRAKRAKGITKSLLDQIDGIG
                     SIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKIYNFFHE"
     gene            100347..100931
                     /gene="pgsA"
                     /locus_tag="SAR11_0085"
     CDS             100347..100931
                     /gene="pgsA"
                     /locus_tag="SAR11_0085"
                     /EC_number="2.7.8.5"
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol"
                     /protein_id="AAZ20909.1"
                     /translation="MLKKIPNILTIGRIIIVPFFVLAFYLPGFYGDLTACVLFVIASF
                     TDFLDGMLARMMGEESKLGELLDPIADKIIVATALILLVMSGTIKHYEVIAAIIILTR
                     EILISGLREFLARGQIKLPVTNLAKLKTFLQMVAIALLLTGETGNKILNFQDYNAQTI
                     GIILLWLSAFLTLYTGYEYLRKGIDHAISEDNKN"
     gene            complement(100928..101809)
                     /gene="ilvE"
                     /locus_tag="SAR11_0086"
     CDS             complement(100928..101809)
                     /gene="ilvE"
                     /locus_tag="SAR11_0086"
                     /EC_number="2.6.1.42"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid aminotransferase"
                     /protein_id="AAZ20910.1"
                     /translation="MIPYDKRSGKIWFNGELVDWADAKIHVLNHGLHYASCVFEGERV
                     YDNSIFKLEEHTSRLFYSAKRMGIKIPYTEEEINLASKKIISVQGVKDGYVRPTIWRG
                     SEMMAISAQQTKIHVAIATWEWGSYFDPKLKIEGIKLNISNWRRPAPNTIPWDTKASG
                     LYMICTLSKHEAEQQGYTDSLMLDHEGNVAEATGANIFFKDKNGEIHTPIPDSFLDGI
                     TRRTVIEIAKSKGIKVNERKIAPAELSNFVGCFLTGTAAEVTPVSCIAENKFKVCETI
                     IDLNESYQALVRKRKAA"
     gene            101880..102317
                     /gene="petP"
                     /locus_tag="SAR11_0087"
     CDS             101880..102317
                     /gene="petP"
                     /locus_tag="SAR11_0087"
                     /note="MarR family (Pfam)"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="AAZ20911.1"
                     /translation="MKELLYLKDTQLKQLIEKLFTSYRESFSDAKKTLDKYSIGIAHH
                     KVLHLLSMYKGITISDLLKKLKVTKQSLNRVLKDLIKLDVVFFEKDQQDTRVKHIFLN
                     EKGEKIFDEIFSIQKKRIYNALLNSSSDQVLNFDNVLKKIINE"
     gene            102310..102987
                     /gene="petR"
                     /locus_tag="SAR11_0088"
     CDS             102310..102987
                     /gene="petR"
                     /locus_tag="SAR11_0088"
                     /note="OmpR family, response regulator, ompR"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system"
                     /protein_id="AAZ20912.1"
                     /translation="MNDFVAHILVVDDDEGIRSLIKQYLNENNFLVTTSNSAENAEEK
                     ISIIKFDLIVLDIMMTGKSGLDFIKQNKSKIDTPIILLTAKGEAENRVEGLEIGADDY
                     LPKPFEPKELILRIKNILNKTKRNDEKRIITFDNIKIDLNKLLIIKNDIEYKINSTEK
                     IILEKMINNPGKTFSREDIGKLTDLDKERSIDVIITRLRKKIEMDPKNPKYLQTLRGA
                     GYVLWIE"
     gene            102968..104287
                     /gene="envZ"
                     /locus_tag="SAR11_0089"
     CDS             102968..104287
                     /gene="envZ"
                     /locus_tag="SAR11_0089"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="osmolarity sensor protein envZ"
                     /protein_id="AAZ20913.1"
                     /translation="MFYGLNNFVKNLLPKRLFYRALLIVAVPIIVLQVVISIVFFDSL
                     WIKTNKGMTRALIGEMKTFITAYDNGKYNNNDLSGLFSIYLDLNVQFKKDDLFEKAQK
                     ERWFSPIDRTLRRELKSNMGTQNFWFDTTSYKELIHINIKHNEGYFEFFIPKDRVASS
                     SARIFALWITIPALLMITIAILFLKNQTRPIINLAKAAERFGKGENIDEYRPSGALEI
                     RQAGLEFDKMRKRIMRHLNQRSEMLSGISHDLRTPLTRLKLQLSFMKDKDLSKKMSLD
                     IDEMEKMLNEYLQFTSSSYLEKDETFDISELIETTINNYNNDKITKEIIPRIYMNGRK
                     NLIQRSINNLIDNSIKYAENINFHLSKKDSNIIITIDDDGVGIPKEEFENVFKPFYKV
                     DKSRGDSKSSVGLGLSITSDIIKSHGGNILLDKSPLNGLRVKIFLPL"
     gene            complement(104265..104519)
                     /locus_tag="SAR11_0090"
     CDS             complement(104265..104519)
                     /locus_tag="SAR11_0090"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ20914.1"
                     /translation="MTKSKFVIDKLTKLFEQGLISYKDLSSEIINVLRSKREEIIFKM
                     KLTSKEEMDILIKRVENLEKKINKFEKKSPNKKSTKVKKS"
     gene            104566..105336
                     /gene="lgt"
                     /locus_tag="SAR11_0091"
     CDS             104566..105336
                     /gene="lgt"
                     /locus_tag="SAR11_0091"
                     /EC_number="2.4.99.-"
                     /note="lgt (umpA)"
                     /codon_start=1
                     /transl_table=11
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="AAZ20915.1"
                     /translation="MFINNFDPVAFQIFSLEIRWYSLAYIVGIALGWLYCKKKLIKDS
                     HILQLFDDFITYLIIGMILGGRLGYTLFYNLKYYLDNPIEILMVWNGGMSFHGALIGI
                     IIASILFSKKHNTNSFIFLDLVALSAPIGIFFGRIANFINSELYGRATDLPWSVQFVL
                     IDNIKRHPSQLYEAFFEGIILFFVLGYFFKKDYLKVPGKISALFLIFYSLFRFFIEFF
                     RSPDPQIGYLVLNLTLGQLISVLFFLTGVYLLSLKNEN"
     gene            105326..106369
                     /gene="cdfA"
                     /locus_tag="SAR11_0092"
     CDS             105326..106369
                     /gene="cdfA"
                     /locus_tag="SAR11_0092"
                     /EC_number="2.1.1.79"
                     /codon_start=1
                     /transl_table=11
                     /product="possible cyclopropane-fatty-acyl-phospholipid
                     synthase"
                     /protein_id="AAZ20916.1"
                     /translation="MKIKNNQSFTLDKFIEESLYNKTSGYYMKKNPFGKKGDFITSPN
                     ISVLFSEMIAIWVVSFWQNLGCPKKFNLIELGAGNGEMMKVLVNTFEKFQIFKNSCHI
                     KILERSKLLRKKQKININKKNIQWLNDLSELDNSPCIFLANEFFDALPIKQFIKKERK
                     WFERHVRFFNNKFEYFDVPFDMEKFVNKIKFKITKQQNFIEYSPQSTEYLEIIFNKIK
                     RNNGGILIIDYAYTDKKMKNTLQAVSKHKYCDVLKGFGNSDITYNLSFSLLNRIVKEL
                     SSLTSMNTTQGEFLTKLGILERAEILSKKMLFSEKADIYFRIKRLIDKNQMGELFKVM
                     LITTHKNKFKLGF"
     gene            106800..107135
                     /locus_tag="SAR11_0093"
     CDS             106800..107135
                     /locus_tag="SAR11_0093"
                     /note="YfiH family COG1496"
                     /codon_start=1
                     /transl_table=11
                     /product="Uncharacterized ACR"
                     /protein_id="AAZ20917.1"
                     /translation="MIKKGCDPKNVTAVIGPCISVKNYEVKKDFIKKLIKKDGKNKKF
                     FKKIQNKDFFDLKKYVLSQLKALNIKKIDIINKNTFNPKNNFFSARRSISRNENDYGR
                     NISVIMINS"
     gene            107142..108074
                     /gene="prsA"
                     /locus_tag="SAR11_0094"
     CDS             107142..108074
                     /gene="prsA"
                     /locus_tag="SAR11_0094"
                     /EC_number="2.7.6.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribose-phosphate pyrophosphokinase"
                     /protein_id="AAZ20918.1"
                     /translation="MKLLTGNSNKPLSKNIAKYLKTKLVNSSIKKFSDGEIYIEINEN
                     IRGNSIFIIQSISSPANDNLMELLLCIDALKRSSAKNITAVIPYFGYARQDRKVVPRT
                     SISAKLVSNLITKAGADRVVTVDLHAGQIQGFFDIPVDNLFATPIFARHAKKNIKSKN
                     IICVAPDVGGTERARALGKILNVELAIVDKRRPKPGQSKVMNVIGNVKGKTCIIVDDI
                     IDSGGTIVNAAKALKDRGAKEVYVYITHGVLSGEAVDKIKKSVIRKLVITDTIDNHDK
                     IKNVKNIEVLPISALMGEAIKRISNSTSVSDLFK"
     gene            108119..108805
                     /gene="rplY"
                     /locus_tag="SAR11_0095"
     CDS             108119..108805
                     /gene="rplY"
                     /locus_tag="SAR11_0095"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal 5S rRNA E-loop binding protein
                     Ctc/L25/TL5"
                     /protein_id="AAZ20919.1"
                     /translation="MNSLDANTRNTKSKGDVRSLRSAGNIPGIIYGGPDQNQKVTVLK
                     KTLKSLIDKGSFLSNIITLNLDGKPQNVLPREITYNVISDEPTHIDFLRVVPGVKIRI
                     EVPVVFINHETSPGLKRGGVLNIVRRKIELKCPSEKIPSAITIDLDGVDIGESFKISS
                     VKLEEGVTPTIIGRDFVIATLAAPTVMKEPEKPAEAEAEAAEDGKEAAPAAEGDKKDD
                     GEKKATEEKK"
     gene            108851..109411
                     /gene="pth"
                     /locus_tag="SAR11_0096"
     CDS             108851..109411
                     /gene="pth"
                     /locus_tag="SAR11_0096"
                     /EC_number="3.1.1.29"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidyl-tRNA hydrolase"
                     /protein_id="AAZ20920.1"
                     /translation="MLLFVGLGNPTPDSENNRHNIGFKLIDALNQKFGLSKQKPKFKG
                     LLTTGNVEDKKVYAIKPLTFMNNSGICIRELIEYFKIDAEDVIVFHDDLDLEFGKVKA
                     KFAGSSAGHNGIESIDKFIGKDYSRVRIGIGRPKTKADVADHVLKDFDEDEMIQLEKI
                     TKNIIDSMAILIDKKLDLFSSTVNNK"
     gene            109411..110484
                     /locus_tag="SAR11_0097"
     CDS             109411..110484
                     /locus_tag="SAR11_0097"
                     /note="probable translation factor"
                     /codon_start=1
                     /transl_table=11
                     /product="Predicted GTPase"
                     /protein_id="AAZ20921.1"
                     /translation="MSFKCGIVGLPNVGKSTLFNALTNSSKAQAANFPFCTIEPNVGV
                     VPVPDERLDKLVEISKSKKKINTTIEFVDIAGLVAGASKGEGLGNKFLSHIREVDAVI
                     HMIRCFDSDDIQNVNPTVDPIRDLEIIETEMMLADLESIQKRLEKNNKKNVDEEQLKI
                     LEIASDCINNSKDIQILYEQFDKKLISQSGLLSLKPKIFVCNVDEASVQNGNKYTQAF
                     IDKYGEKNTLIVSADIENQINQLENEEKENYMEMIGLKRTGLNMLIQKGYNILELDTY
                     FTSGPEETRAWTIQKNCTAPKAAGEIHTDFEKGFIRAETIAYEDFIANDGWVNSKTNG
                     KMRLEGKDYIVKDGDILNFRFNT"
     gene            complement(110461..111240)
                     /gene="fbcH"
                     /locus_tag="SAR11_0098"
     CDS             complement(110461..111240)
                     /gene="fbcH"
                     /locus_tag="SAR11_0098"
                     /EC_number="1.10.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinol-cytochrome-c reductase"
                     /protein_id="AAZ20922.1"
                     /translation="MKNILKISYSIIFLLVGTLTVNAAEKVDLLKTDWSFKGLFGKFD
                     RGSLQRGYQVYTEVCASCHSMKYVSYRNLFEPGGPEFTEEQAKAIAASFEVTDGPNND
                     GEMFVRPAKLSDKFVMPYENVKAAQAANGGAYPPDMSVLAKARTGGVDYIYSLLLGYE
                     DPPSGVTLDDGVYYNKFMYGNNIKMAEPLSDGLVEYSDGTTASKEQMAKDVTTFLMWA
                     AEPHLESRHKMGFKAILYLIILTILVYFSMKKIWSRIESEV"
     gene            complement(111245..112504)
                     /gene="petB"
                     /locus_tag="SAR11_0099"
     CDS             complement(111245..112504)
                     /gene="petB"
                     /locus_tag="SAR11_0099"
                     /EC_number="1.10.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinol-cytochrome-c reductase"
                     /protein_id="AAZ20923.1"
                     /translation="MSDHEYVPSSKFGKWFNDRLPLLSLASHLTDYPTPKNLNYWWTF
                     GGILTFCLITQIVTGLTLAMHYIAHADMAFESVEHIMRDVNYGWLIRYIHANGASMFF
                     LAVYIHIFRSLFYGSYKSPREIIWIIGIIIYLLMMAAAFMGYVLPWGQMSFWGATVIT
                     NLFSAIPLVGEGIVNWLWGGYSVDNPTLTRFFTLHYLIPFLILGLVVLHIWALHVPGN
                     NNPVGIDVKKPSKDTVPFHPYIVIKDGFALLMFMIVFAFFVFYSPNILGHADNYIEAN
                     PMVTPAHIVPEWYLLPFYAILRSVPDKLMGVVAMLSAILILAALPWLDTSKIRSAVFR
                     PLYKQFYWILVVDVLVLGYVGAMPAEGLYLLIARVATAYYFIHFLIILPVLGFKEKTI
                     PLPLSITEPVLGGMPMASAVKKKESLN"
     gene            complement(112514..113023)
                     /gene="petA"
                     /locus_tag="SAR11_0100"
     CDS             complement(112514..113023)
                     /gene="petA"
                     /locus_tag="SAR11_0100"
                     /EC_number="1.10.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b6-f complex iron-sulfur subunit"
                     /protein_id="AAZ20924.1"
                     /translation="MSEKKPERREFLFTASYAVGAVGVGAVVWPLVDQMNPDASVKAL
                     ASTEVDVSSVQPGKTITVLWRGKPVFIKRRTPEEVAEARAVKMEDLKDPQKDEDRAKD
                     PEWLVMLGVCTHLGCVPLNDKGDYNGWFCPCHGSHYDISGRIRKGPAPTNMEVPKYEF
                     VNSNTIKIG"
     gene            113110..113571
                     /gene="spoU"
                     /locus_tag="SAR11_0101"
     CDS             113110..113571
                     /gene="spoU"
                     /locus_tag="SAR11_0101"
                     /EC_number="2.1.1.34"
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA Methylase"
                     /protein_id="AAZ20925.1"
                     /translation="MNLRPKIALYEPDIPQNTAAIIRTCACLGADLEIIEPCGFLFSD
                     KRFKRVVMDYMDEKMIRFYQSSDEFFKSKKNERVILLTTKSADSYTDFKFESNDTLLF
                     GRESAGVPDHVHNLIKYRLKIPMMDNKRSLNIASSVAIILSENLRQTNFNK"
     gene            113571..114398
                     /gene="hemF"
                     /locus_tag="SAR11_0102"
     CDS             113571..114398
                     /gene="hemF"
                     /locus_tag="SAR11_0102"
                     /EC_number="1.3.3.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Coproporphyrinogen III oxidase"
                     /protein_id="AAZ20926.1"
                     /translation="MDKEIKKKLASNWFKLLQNTICNDIEKLEGKKSKFKSKTWNRSE
                     IKDEGGGEFRILKNGKIFEKVGVNFSEVHGKFSKKMSKKIPGASKNPNFWASGISIVM
                     HMKNPHVPAIHFNTRFIYTTHGWFGGGMDVTPCIQDLKEKSFLHTELKKMCDRHDKKF
                     YKKYKKWCDEYFYLPHRKETRGIGGIFFDYKKKDWEKDFKFVTDLGVTFQMLFNSIIQ
                     LKHKKKWTVKQKEIQYIKRGRYAEFNLLYDRGTKFGLQTGGNVEAILMSLPPIAKWN"
     gene            114400..114876
                     /gene="greA"
                     /locus_tag="SAR11_0103"
     CDS             114400..114876
                     /gene="greA"
                     /locus_tag="SAR11_0103"
                     /codon_start=1
                     /transl_table=11
                     /product="Transcription elongation factor"
                     /protein_id="AAZ20927.1"
                     /translation="MDKEPITADGLESLKEELIFLKEKKRPQIVAAISEARSHGDLKE
                     NAEYHAAKEEQSHNEGRITEINDIIARANVIDVTKMSNDGKVIFGSTVDLENLDTGEK
                     ITYKIVGKDEADLQKKLIFFQSPIGRGLIGKNKNDLVEIKTPAGVKNFEIKDVKYV"
     gene            complement(114873..116147)
                     /gene="pcnB"
                     /locus_tag="SAR11_0104"
     CDS             complement(114873..116147)
                     /gene="pcnB"
                     /locus_tag="SAR11_0104"
                     /EC_number="2.7.7.19"
                     /codon_start=1
                     /transl_table=11
                     /product="Poly(A) Polymerase (PAP)"
                     /protein_id="AAZ20928.1"
                     /translation="MNSLLDKIFFRSQNLNHINLGFKNIKKETEVSKIFEAIHSYSSN
                     SEIRYVGGCVRKIINKEAYDDIDLAVNLNPKEVCEALTKKDIKYYESGIEHGTITALI
                     NDIKFEITSLRKDIDTDGRHAKVEFSDSWKEDASRRDFTINSIYADIEGSLFDPFDGK
                     KDLERGKINFIGNVETRIKEDYLRVLRYVRFFLSYSKHSHDPQVIKAIKKNLSGVSSI
                     SSERLIDEFQKLLKSNGFLKLTKDKDCLEIINLIFPQIKNISLFNKMNSFAKKNFLEM
                     DFIFLLSLMIIDGTDNVDYFIYKFNLSKKDQKRLIFLNKFNLEKNTNQTFSEKNLNKI
                     FYFNGREALLDVLYFKIFKSKKVDNKLIKMIEIFKKKEMPVMPFKASTLMEKYKIPEG
                     KELGQKLKAIEEVWTSNDFKISDKELQKIVSN"
     gene            116151..116224
                     /locus_tag="SAR11_tRNA_r_29"
     tRNA            116151..116224
                     /locus_tag="SAR11_tRNA_r_29"
                     /product="tRNA-Gln"
     gene            complement(116257..117102)
                     /gene="ispE"
                     /locus_tag="SAR11_0105"
     CDS             complement(116257..117102)
                     /gene="ispE"
                     /locus_tag="SAR11_0105"
                     /EC_number="2.7.1.148"
                     /codon_start=1
                     /transl_table=11
                     /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
                     kinase"
                     /protein_id="AAZ20929.1"
                     /translation="MNSFKIKSYAKINLALNVTGKKSKLHNIESLISFIDLHDSITIT
                     ESNTKQHKINFIGRFSKNISKINTISKLLKILDNKKLLNNKKFEIKVIKHIPQKAGMG
                     GGSMNAASLLNFFIEKKLIKIKKNDSKKISNEIGSDVILGIKPSLAILLSNGDIKKFK
                     NKIKFHILVAKPNFGCSTKYIYSKVDSFSKPQFNPPKQKLFEAKYLKNLDNDLEKVAL
                     NKYPELKRIKSYLNGLPNTLFVRMSGSGSSIVAYFHSKKACKKACSQYKRKFNNHWCI
                     ESKTI"
     gene            complement(117106..118791)
                     /locus_tag="SAR11_0106"
     CDS             complement(117106..118791)
                     /locus_tag="SAR11_0106"
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat (tpr) family protein"
                     /protein_id="AAZ20930.1"
                     /translation="MLVKFFKFFLILILYQSPLYSKNTSLNDFNARYLSNYFSGIVAY
                     ENLDNTEALKFFNSSKILIKQHDAYLERYVFSLVHDGKVEKAINQVKQNSTKNNSDFF
                     QANLLLAVDSLKKKNFKKSKVYIDRSYEFINNDRLSLIIAETFKQYLSVFEEKKLIKQ
                     KNTFGNFSFINEVFQRCYLNDKDTERYFNTLINSQNDADYSRYVFFLISYLIKKDNYD
                     KAKKVTNNFDYLNSSVLISQGKKWIEDKNLDNFQEIFSCTNSNDIVSELFFLIANLYS
                     SQNDYEKSNFYLNIANYLNPKFIFNLSLLAENYYLSDDYSNTLKTLEAFDKKHEFYYW
                     FKLKKESQIILKKNNKEASLKFINEKFKEIKNPNKKIIFDIANMHKNAKKYIEAINFY
                     DQILLKMNANSDLYAEILYRRGGSYERSGDYVKADKDLLKSLEANPDDAYVLNYLAYS
                     WLEREHKIDTALKMLEKAYEARSNDPYIIDSIGWAYYLVDEYEKAENFLKRAVELMPQ
                     DPVVNDHYGDILWQLDRKIQARYFWQAVLNLDETEDAMKKTIKNKLLEGLKNS"
     gene            118803..119534
                     /locus_tag="SAR11_0107"
     CDS             118803..119534
                     /locus_tag="SAR11_0107"
                     /EC_number="2.7.7.7"
                     /note="bacteriophage-type"
                     /codon_start=1
                     /transl_table=11
                     /product="probable DNA-directed DNA polymerase"
                     /protein_id="AAZ20931.1"
                     /translation="MSKKVINQKTNFDSEFLNSTGSDFIFDEKPINRLKNTSNDLKKD
                     LSIQKIDKVKELANLKEQINSISDCNLKNNSKKIILGDGNINSPIMLIGEAPGVEEDN
                     AGLTFMGEVGDLLKKMLIAINIEKQNIYTTYAVNFRPPEDRKPNSTEIKRYSQFLQKH
                     ISIINPKIIILMGSTAMESLTGLNSKISIERGKWKEVIVKNTSYNVIITFNPSYLLRA
                     PENKKHSWDDLKKIKQKILELNLSV"
     gene            119534..120094
                     /gene="rnhB"
                     /locus_tag="SAR11_0108"
     CDS             119534..120094
                     /gene="rnhB"
                     /locus_tag="SAR11_0108"
                     /EC_number="3.1.26.4"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribonuclease HII (RNase HII)"
                     /protein_id="AAZ20932.1"
                     /translation="MKILAGVDEVGRGSLIGPVYAAAVILNNSIDKKLLKDSKTLTKD
                     KREELEKYIKKNSIWAIGQASTKEIEKINILHASLLAMKRAILKLKIKPSLVLIDGNK
                     LPDLKNYKLEYVIKGDQKIPSISAASIIAKVSRDKFITKLSKEFNNYGWDTNSGYGTK
                     EHLKAIKQFGITKYHRKTFSPISDLL"
     gene            120216..121286
                     /gene="babIM"
                     /locus_tag="SAR11_0109"
     CDS             120216..121286
                     /gene="babIM"
                     /locus_tag="SAR11_0109"
                     /EC_number="2.1.1.72"
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific DNA methyltransferase"
                     /protein_id="AAZ20933.1"
                     /translation="MENNFKNKIINGDSLEELKKIPSETFDLVFADPPYNLQLKNSLT
                     RPDRSKVNAVNDKWDHFESFKKYDEFTVAWLSECKRILKKDGAIWVIGSYHNIFRVGT
                     AIQNLGFWILNDVIWNKNNPMPNFRGTRFTNAHETLIWASKSEKSKYTFNYQSLKCLN
                     DDLQMRSDWNLPICNGAERLKKNGKKVHSTQKPESLLHRVLLASSNKGDMILDPFLGS
                     GTTATVAKKLGRKYYGIEKEKVYFKAAEERLKNTKPLEDNFLDTLKNNRSKPRIPFGS
                     LVELGIIKPGTSIFDQKKKIVAKIMADGSIKHNQAEGSIHKVAATILGSESCNGWTYW
                     HCTVNGVSVPIDNLRQRLISKN"
     gene            complement(121283..122434)
                     /gene="nah"
                     /locus_tag="SAR11_0110"
     CDS             complement(121283..122434)
                     /gene="nah"
                     /locus_tag="SAR11_0110"
                     /EC_number="1.14.13.1"
                     /codon_start=1
                     /transl_table=11
                     /product="salicylate 1-monooxygenase"
                     /protein_id="AAZ20934.1"
                     /translation="MKNIAIIGAGISGLYIANLLSQNSNYKITIYEKNSSVNLEKGYG
                     IQLSVNSIKLLNQINFQKISVKDKFHPHKLDFYSLKNNKKICDLDISMFNSTDRKYTT
                     LQRSTLINFLKDGLHENIIYYNKKVIKINEEAENKEVSFEDGLSVKCDYLIISDGTFS
                     KTKSLIANKETKPKYFNSIALRATIDQDALKGINPDNISLFLGSNLHSVLYPVNSKGQ
                     FNFITIFRKKLSTKELSDYSLFENKDFAASIMSEISKQVPTETINNLKSIKCFPIFVS
                     SDVNEPKNKDTFIIGDAFFALPPTFAQGASQSIEVAHELYKNLENEKTQFNSERIKRV
                     RMINMKSKLNYFAFHLSNPLIIWIRNLIMQKLVKNEKFINSYLGKIYKD"
     gene            complement(122434..123414)
                     /gene="mutY"
                     /locus_tag="SAR11_0111"
     CDS             complement(122434..123414)
                     /gene="mutY"
                     /locus_tag="SAR11_0111"
                     /EC_number="3.2.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="A/G-specific adenine glycosylase"
                     /protein_id="AAZ20935.1"
                     /translation="MTKSILTKKILYWYDNNKRSLPWRKELSQVKREYYTLVSEFMLQ
                     QTQVATVIPYFNNFIKDIPDIKSLSKIKEHKLLKYWEGLGYYSRVKNLKKTAQILEKN
                     FNRRLPNTIDELKLLPGIGDYTSNAIMAIAFNKPFIPLDGNIERVIKRLLNLKLPKEI
                     TKDNLVKSKKILGNSTRASDYAQALMELGALICRPKNPLCYQCPLIKNCKSFKKKDFE
                     TIKERKKKIDKFYLLEVYKKNNKFLLIKNTKFNFLKNLQIFPMKQISKPDNLAKALNF
                     KISNMNMNVIIKFSKLKGTISNSSWIDSSKLEDYTLPTFTKKIFNYLKKN"
     gene            123415..123903
                     /locus_tag="SAR11_0112"
     CDS             123415..123903
                     /locus_tag="SAR11_0112"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ20936.1"
                     /translation="MQFKNNTKQRFKTIQGLRSFKDTLPKNIKKIIKKKGHIFSETLN
                     NWKYIVGDDLFQICYPKSFKNSNKFGVSTLQIMVKRGHEIDLEYSKKIIMDKMNSFFG
                     YAVVEKLKFISFDDAQTKFKKLDTNENHVTNIKYADRINSIKNDKIKKSLLELTKLFK
                     QR"
     gene            123975..124490
                     /locus_tag="SAR11_0113"
     CDS             123975..124490
                     /locus_tag="SAR11_0113"
                     /note="thiol-disulfide interchange protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DsbA-like protein"
                     /protein_id="AAZ20937.1"
                     /translation="MVKRISEGKESAKITIIAYESLTCGHCANFHKDVLPELKKDFID
                     KGLVKIEFRHFPLDLAAFNASKIAQCNNDGNSNILHILYSGQKKWARGKTPEEATGYL
                     KKFLESESVNLDFEKCLSDKAIEDFVLNDRIDGVKKFEVNATPTIIINDKKFDKALNY
                     KNLKKYLEKLI"
     gene            124499..127072
                     /gene="smc"
                     /locus_tag="SAR11_0114"
     CDS             124499..127072
                     /gene="smc"
                     /locus_tag="SAR11_0114"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome segregation protein SMC family"
                     /protein_id="AAZ20938.1"
                     /translation="MEFKKIQLNGFKSFAEKTNFLIEHGLTGIVGPNGCGKSNIVESL
                     RWVMGETSAKSMRGSGMEDVIFNGTSNKSSKNIAEVSISVDNASHDGPMQYKDLDHIE
                     VRRKIEKDKGSKFYINDKEVRARDAQMFFADLSTGAHSPSMISQGRIGALVTAKPTDR
                     RAILEEAANISGLHVRRHEAELRLNAAETNLKRADELRRQQEKQLANLQKQAEEATKY
                     KLISEEIKKIEAGLYYLKLLDIDNEIRIENEINNEAEGEVSNFNQQIAQFENLIKTET
                     DKVSPLREKNIENLSKIQRLNLELQNLDEENVRTQDEIENIKKSLKTIEEDIDREKGI
                     VIDANSNERRLKEEKAELIEIDSKYFETEKLSNEDLEKAKNLLKDEQKSVDEIINIFA
                     DGNINIAIGPIKNVKNTITRAKELINNNEINQALTLLDRCQIEIDGFLDNLEDEESKK
                     KLSNINEKNENIKLLQEKYADSFSKNQSIKKESVKRNERIKAIESEVESWKNLLSNSE
                     KMVTELTERKNKLLSQLNERDQQPKAQAERKGQITEGLRISQNEKIENEKIIEETDKK
                     INSLRLELNDVQERSIQIRERKASSGATVEGLKKRKEDLLERVSSELNLEENDILENS
                     NLNGVEELPDSVAQEDALDKKKNEREKLGSVNLRADEETSKYEIEIKKMEQDREDLVS
                     AIIKLKESINELNQKGRERLLEAFEKVNRKFNEVYTKLFNGGNAKLELVDSDDPLEAG
                     LEMLVSPPGKRLQSITLLSGGEQALTALSLIFAVFLTNPSPICVLDEVDAPLDDANVT
                     RFCGLLDDLTKITDTKFIIVTHHALTMSKMNRLYGVTMPEKGISQLVAVDLQKAESMV
                     A"
     gene            127081..127356
                     /locus_tag="SAR11_0115"
     CDS             127081..127356
                     /locus_tag="SAR11_0115"
                     /codon_start=1
                     /transl_table=11
                     /product="possible transmembrane protein"
                     /protein_id="AAZ20939.1"
                     /translation="MPKDSLKTRLEIAKNKLSKKNLYKNEEAPSSIGTAFKLSTELVS
                     AVAVGTIIGFILDKTFGTKPWLILIFFFVGVVAGIINVFRSAKNMQK"
     gene            127369..128103
                     /gene="atpB"
                     /locus_tag="SAR11_0116"
     CDS             127369..128103
                     /gene="atpB"
                     /locus_tag="SAR11_0116"
                     /EC_number="3.6.3.14"
                     /note="Old name Fo ATP Synthase Subunit A; old EC
                     3.6.1.34"
                     /codon_start=1
                     /transl_table=11
                     /product="H+-transporting two-sector ATPase (subunit A)"
                     /protein_id="AAZ20940.1"
                     /translation="MATNPMNQFEVYRIGPEIKLGAIDISFTNASLFMVISSLAILLI
                     FNLGSKKNSLLPSKMQLLSELSYTFVSKMISDTAGSKAKPYFAFIFSIFMFVLFCNMF
                     GMIPYAFTVTSHIIVTFILASFIFVGVTIIGFMKHGLGYLKLFVPSGVPAVLLPLIVV
                     IEIISYLSRPVSLSVRLFANMMAGHTMMKVFGGFVISLGIVGGWLPLSFSVALTGLEI
                     LVAFLQAYVFAILTCIYLNDALNLHH"
     gene            128123..128350
                     /gene="atpE"
                     /locus_tag="SAR11_0117"
     CDS             128123..128350
                     /gene="atpE"
                     /locus_tag="SAR11_0117"
                     /EC_number="3.6.3.14"
                     /note="Old name Fo ATP Synthase Subunit C; old EC
                     3.6.1.34"
                     /codon_start=1
                     /transl_table=11
                     /product="H+-transporting two-sector ATPase (subunit C)"
                     /protein_id="AAZ20941.1"
                     /translation="MELEAAKMIGAGLAAIALAGAGVGIGIIFGNYLSGAMRNPSAAQ
                     KQFPNLLLGFALAEATGLFGLVVALIILFAF"
     gene            128407..128946
                     /locus_tag="SAR11_0118"
     CDS             128407..128946
                     /locus_tag="SAR11_0118"
                     /EC_number="3.6.3.14"
                     /note="Old name Fo ATP Synthase Subunit b'; old EC
                     3.6.1.34"
                     /codon_start=1
                     /transl_table=11
                     /product="H+-transporting two-sector ATPase (subunit b')"
                     /protein_id="AAZ20942.1"
                     /translation="MEAFAAESGGMPQLNPEFWVSQIFWLIITFGILYVVLSKLILPK
                     ISANLENRKSQILENIEAAEKQREESEQKIEEYEKIVQSSKNEAKNYFKQAREKVLKD
                     IGVKREILEKELDEEVNKAEIEIKTFRDNAPEKIKKIAVETSSDLLQELIGAEVNSSS
                     ISAIVEDLSRKKMDEYYGN"
     gene            128936..129433
                     /gene="atpF"
                     /locus_tag="SAR11_0119"
     CDS             128936..129433
                     /gene="atpF"
                     /locus_tag="SAR11_0119"
                     /EC_number="3.6.3.14"
                     /note="Old name Fo ATP Synthase Subunit b; old EC
                     3.6.1.34"
                     /codon_start=1
                     /transl_table=11
                     /product="H+-transporting two-sector ATPase (subunit b)"
                     /protein_id="AAZ20943.1"
                     /translation="MVIDATFWVAISFLIFIGALVYLKIPQKINELLNKLILDIKNEI
                     DESEKLRQEAKVLLDNAQNKLDTAQTVSNDILQQAKKDSDHLIIEMNDKFHKSSEIKK
                     SLAENKISQMKEAALKEIKDVSIKIAVDSVKKIINTSVDKSKLDGLFEKNLEETKIAL
                     KKISS"
     gene            129473..130930
                     /gene="crtI"
                     /locus_tag="SAR11_0120"
     CDS             129473..130930
                     /gene="crtI"
                     /locus_tag="SAR11_0120"
                     /codon_start=1
                     /transl_table=11
                     /product="phytoene dehydrogenase"
                     /protein_id="AAZ20944.1"
                     /translation="MKSIVIGSGFGGIAAALRLRAKNHKVTLIEKHPDLGGRARVFKK
                     NGFTFDAGPTVITAPYLIEELFTLFNKKSQDYIKLTPLKTWYRFIYEDGGVFDYSGNE
                     DQMKKQIEKINKEDVKGYEQLVKFTKKIFDKGFTELADVPFDKPLVMMKQLPSLLKLK
                     SYKSVYSLVSSYIKNEKLRRMLSMHPLLVGGNPFTTTSIYGLILYLEKKWGIHYSMGG
                     TGNIINGLEKLMIEQEIEVIKGHEVTKIISDNGKISGVKLDNQKEMLSNNVICNADPP
                     AVYEKLLSLNKTSPLFKWKQNRMQYSMGLFVYYFGTKKTYPDVEHHTIKFGDKYKEHL
                     SDIFDNKKLNDDISYYLHRPSATDKSMAPEGNDCFYVLVPVPNNQSKIDWKIEGEKMK
                     NLVIDKMEKALLPNLRENIIEDFYLTPDYFENELNTKFGSGFSIQPKFTQSAYFRFHN
                     KSEIYDGLYFVGAGTHPGAGVPGVLSSAKVLDKIL"
     gene            130930..131781
                     /gene="crtB"
                     /locus_tag="SAR11_0121"
     CDS             130930..131781
                     /gene="crtB"
                     /locus_tag="SAR11_0121"
                     /EC_number="2.5.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Phytoene synthase"
                     /protein_id="AAZ20945.1"
                     /translation="MSKNNYLSIYAKSFNWAGFFLPKNIYEKCSSLYDFCRTIDDIAD
                     DKNELNIKKKNLLIFKNNFINKNFDNLIIKNMWILMEENKISIKIVEDLFDGIESDLN
                     EVVKFNKKKELLIYSYRVAGTVGLMMAKILGVQNKNSMKSAIDLGIAMQLTNISRDVI
                     EDMNNNRFYINHDFETIKNTLSMADLFYESSFASIKEIPFRFRFAILVARRIYRKIGA
                     KILQKENIYNYNRSGKIYVANLGKLYQTFLSILDLIKLIFINEKNHLRNKEHLLINEE
                     IDLNERI"
     gene            131813..132844
                     /gene="crtY"
                     /locus_tag="SAR11_0122"
     CDS             131813..132844
                     /gene="crtY"
                     /locus_tag="SAR11_0122"
                     /codon_start=1
                     /transl_table=11
                     /product="lycopene cyclase"
                     /protein_id="AAZ20946.1"
                     /translation="MSLAYELDLHNKLKDATLAIIEPRLEYKRDKTWSYWKTIDHNFQ
                     DCVQKSWNNFSINIPGKTKFLECNGLPYEAIDSGLFYEKINTRLKKNKNISFYKNTNE
                     IDLNSAFIFNSVPLLDSKEDKLWQHFKGIEIETKKNVFDDEIFNLMDFDCDQRDSVHF
                     FYTLPYTKNKALIETTWLSKIKNDSLKDYDEQLKNYIRNHLNIRDYKVTYSEVGAIPL
                     FHPTISNERNKMNIGTAGGMTRLSTGYTFLNIQEHSKYIRKNIHTIKESKRYEINKKY
                     KFLDKIFLKVLNYHPEKMANIFFDMFNNSPETIIKFLSNKSTLLQDLFIILKMPKWLF
                     IKIFFKNDK"
     gene            132834..133772
                     /locus_tag="SAR11_0123"
     CDS             132834..133772
                     /locus_tag="SAR11_0123"
                     /codon_start=1
                     /transl_table=11
                     /product="possible transmembrane protein"
                     /protein_id="AAZ20947.1"
                     /translation="MINNQIKKINFFHSIIFLFFSTSLALIFDQFKSLSISPIICLLL
                     ILSIGISHGALDNQKGKRLIKLYNINNIYYFYLIYLIIAATIIIIWLLAPTLSLIIFL
                     VVAAYHFGKEDTEFLITKKSNIDIILYFLKGILIIIAPLMFHFVETINIFKLLLIQNE
                     SFYLFLNFIENNYIISFIFLISLLTNIYFFLKDFKLVNLLIFFDFTSILILNYFFTPL
                     VAFTLYFCFLHSFRHSLSLITELDKYNFKNGLLIFIKKAAPLTILTAIFYLLSLYYLS
                     NHYLVNEAIYKVIFIGLASLTFPHILLEYFLEKNEK"
     gene            133762..134706
                     /gene="lytB"
                     /locus_tag="SAR11_0124"
     CDS             133762..134706
                     /gene="lytB"
                     /locus_tag="SAR11_0124"
                     /EC_number="1.17.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /protein_id="AAZ20948.1"
                     /translation="MKNKEIKILLSAPRGFCAGVERAIEIVKKSITKYGAPVYVRHEI
                     VHNKHVVDSLKAIGAIFVEELDEIKDKSRPVIFSAHGVPKSVPQQANGYKMEYIDATC
                     PLVSKVHREAENLYKAGYHIVLIGHINHPEVIGTMGQLPEGSIDLIQDEHDVETYELD
                     DNKKIAYVTQTTLSVDDTKNIIKALKKKFPKIKEPFKEDICYATTNRQSAVKNIAKKC
                     DMFFVLGSRNSSNSVRLVEVAEQSGCPHSELIHSDSEIPFEKLENCKVIGISSGASAP
                     EILVENFINEIKSKFKVKIETVEIIKENIVFKVPGKLN"
     gene            134707..135675
                     /gene="thrB"
                     /locus_tag="SAR11_0125"
     CDS             134707..135675
                     /gene="thrB"
                     /locus_tag="SAR11_0125"
                     /EC_number="2.7.1.39"
                     /codon_start=1
                     /transl_table=11
                     /product="Homoserine kinase"
                     /protein_id="AAZ20949.1"
                     /translation="MAVYTKLIKKDISSLINNYQINKIEKFQGIKKGIENTNYLLKTK
                     QNKFILTIFEKRVKKKDLPFFMNLMEKLNHKKIICPKPLRTKKGTHITNIKTKSACIV
                     TFLEGKDKTILNNKNCFDVGKNIAKFHKVTTKLKLYRQNSMSIHRLNGLLKTIKFKSN
                     QITPNLKNTLNLCLKDIKNKWPKNLPQGIIHGDLFIDNIFFNKNKFSGFIDFYFSSND
                     YLIYEIAICINALCFDKKKNKFVMNSSKIKNLINGYESIRTLSKKEKDALNVMCRGAA
                     LRYLLTRIYDYFNTPKTALIKIKDPIEYLQKLIIHNNLGHYKDYYK"
     gene            135675..136100
                     /gene="rnhA"
                     /locus_tag="SAR11_0126"
     CDS             135675..136100
                     /gene="rnhA"
                     /locus_tag="SAR11_0126"
                     /EC_number="3.1.26.4"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribonuclease H (RNase H)"
                     /protein_id="AAZ20950.1"
                     /translation="MIKIYTDGSCLNNPGNGGWAAIINQNGEVKEISGSVKDTTNNKM
                     ELMAPIMALKQIKQNDQIEIYTDSQYVRLGITEWVHKWIKNNWQTSKKEPVKNKELWI
                     QLYELTNQFEIKWIWVKAHAGNALNEEVDLLAKKAAELN"
     gene            complement(136092..136577)
                     /gene="pmpA"
                     /locus_tag="SAR11_0127"
     CDS             complement(136092..136577)
                     /gene="pmpA"
                     /locus_tag="SAR11_0127"
                     /codon_start=1
                     /transl_table=11
                     /product="peroxisomal membrane protein a (pmp20)"
                     /protein_id="AAZ20951.1"
                     /translation="MKLKENDNIPNSEFFIMEDGNPTKKNTHEFYKDKKIVLFGLPGA
                     YTSVCSAKHLPGYVNNYEKYKEKGIDHIVCISVNDPFVMDSWGKSQNVENKIIMMADP
                     FLEFTKAIGADVDKSARGLGIRSNRYTMLIDNLKVIKLQEEEDAGACEISAAQNFLSL
                     V"
     gene            complement(136574..137953)
                     /gene="thrC"
                     /locus_tag="SAR11_0128"
     CDS             complement(136574..137953)
                     /gene="thrC"
                     /locus_tag="SAR11_0128"
                     /EC_number="4.2.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Threonine synthase"
                     /protein_id="AAZ20952.1"
                     /translation="MKYISTRDNSKEYSFEEVFIKGLADDGGLFIPKKIKKYTTEELN
                     SLSNLSYQDLAKKIIFPFIGDFMTEAELSLIVDKSYSSFRKDNVVDLIKIGDAKILEL
                     FHGPTLAFKDIAMQLLGNFYEYYLSKNSKQINIIVATSGDTGAAAIDAIKGKENINIF
                     VLHPHNKVSQVQRKIMSTVKEKNVFNIAINGNFDDCQNLVKAMFADKEFSNSINMSGV
                     NSINWARIIAQAVYYFYTYFQIRDDRLVNFSVPTGNFGDVYAGYLSKKMGLPINKLIV
                     ATNQNDILHRAITNGKYEAETVIETNSPSMDIQIASNFERLIYDLNDFNDVETGNVMK
                     KIKEEGKYIIPKDKLQKISKDFLSENMSETEVLNIIKDVHNRYNVILDPHSAIGFGAL
                     KKINIEGNNIVLATAHPCKFPDAIDKSIGIKSSLPNELQYIMNEKENYDIISNNINET
                     QKYIKEKLQ"
     gene            complement(137954..138607)
                     /gene="surf1"
                     /locus_tag="SAR11_0129"
     CDS             complement(137954..138607)
                     /gene="surf1"
                     /locus_tag="SAR11_0129"
                     /note="biogenesis of cytochrome oxidase c"
                     /codon_start=1
                     /transl_table=11
                     /product="surfeit locus protein 1"
                     /protein_id="AAZ20953.1"
                     /translation="MRYKFLFSIFVFFFISVFLALGSWQIIRLNWKLELINQIETSLK
                     DIPVNLSNSKHKNYLRVKTRGSIDFEKQIYLYNLNEKGKPGFEVINPLKVGNNNYLLN
                     RGWIPFNKKEDETINVIDENYINGVLRKQIKPNIFKPENDLSENYWFTLDRDDIFKFT
                     GKNFSPYVIYLSGNNEFPKPKSITANISNNHKKYALTWFSLAISILLIYLYLRKKNY"
     gene            complement(138618..139406)
                     /gene="coxC"
                     /locus_tag="SAR11_0130"
     CDS             complement(138618..139406)
                     /gene="coxC"
                     /locus_tag="SAR11_0130"
                     /EC_number="1.9.3.1"
                     /note="similar to subunit III, coxC Rickettsia"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome-c oxidase"
                     /protein_id="AAZ20954.1"
                     /translation="MSAEKKHDYHLVDPSPWPIYVSFSCLILAIGSVYYLHSEVSWGM
                     YLGLALLLYGTYMWFRDVVIEAEHQGHHTPVVQIHHRYGMTLFIASEVMFFVAWFWAY
                     FDASLFPSLAIGGIWPPKDIVTFDPWDIPLINTLILLLSGTTVTWSHHALLEGDRKSF
                     IQGLVLTVILGFSFSLLQVYEYQHATFDFAGNIYGSVFYMATGFHGFHVIIGTIFLAV
                     CLMRARKGHFTEKHHFGFEAAAWYWHFVDVVWLFLFAAIYIWGS"
     gene            complement(139409..139945)
                     /gene="ctaG"
                     /locus_tag="SAR11_0131"
     CDS             complement(139409..139945)
                     /gene="ctaG"
                     /locus_tag="SAR11_0131"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytochrome c oxidase assembly protein
                     CtaG/Cox11"
                     /protein_id="AAZ20955.1"
                     /translation="MKNKTLTPILLAGIFFLMLGLSFAAVPLYDLFCRVTGFGGTTQI
                     SREAPDIILNQKVSVRFDTNVNKLPWNFKAKTNVMDVKIGQVNRIEFEVENYGNETTY
                     GVASFNVSPSSFGKYYSKLGCFCFEKQALKAGEKATYIMTFYLDPEMVNDPNTKNIKD
                     VTMSYTFFSSDYYNQSKL"
     gene            complement(139945..140070)
                     /locus_tag="SAR11_0132"
     CDS             complement(139945..140070)
                     /locus_tag="SAR11_0132"
                     /codon_start=1
                     /transl_table=11
                     /product="possible serine protease inhibitor sgti"
                     /protein_id="AAZ20956.1"
                     /translation="MMIPDKKTKRKNILTAVAIIGFMIFLFFFTLYNTGVFDRSI"
     gene            complement(140067..140933)
                     /gene="ctaB"
                     /locus_tag="SAR11_0133"
     CDS             complement(140067..140933)
                     /gene="ctaB"
                     /locus_tag="SAR11_0133"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase assembly factor"
                     /protein_id="AAZ20957.1"
                     /translation="MFNFSELFKLMKPRVMSLVIFTCAVGLLMAPSTVSTKDAMIAIL
                     LVSIGAGAAGALNMWYESDLDALMTRTCLRPIPMGKVNKNQALIFGTSLSFFSVIALD
                     YFANTISAVLLLFTILFYVFVYTIWLKRKTPQNIVIGGAAGALPPVIGWTIATNSLSL
                     EPITFFLIIFFWTPSHFWALSLYKSDDYKKAKIPMLPLTNGIESTKINILVYSLLMLP
                     MVILPYAIDFVGLVFLVPALMLTLYYNILCFELYKFKINKFNPKKAKTIFGYSILYLF
                     LIFVIFLIDKIL"
     gene            complement(141011..142645)
                     /gene="cox1"
                     /locus_tag="SAR11_0134"
     CDS             complement(141011..142645)
                     /gene="cox1"
                     /locus_tag="SAR11_0134"
                     /EC_number="1.9.3.1"
                     /note="chain I"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome-c oxidase"
                     /protein_id="AAZ20958.1"
                     /translation="MYTKTASHDDHHTPTGWKRWAYSTNHKDIGTMYLIFAIVAGIIG
                     TAFSVLMRIELMHPGDGILGGNYHLYNVLVTGHGLIMIFFMVMPAMIGGFGNWFVPIM
                     IGAPDMAFPRMNNISFWLLPASFILLLLSIFVDGPPGQQGVGGGWTLYPPLSSKAGQP
                     GPAMDFAILSLHLAGASSILGAVNFITTILNMRTPGMTLHKMPLFAWSVLVTAFLLLL
                     SLPVLAGAITMLLTDRNFGTAFFDAQTGGDPVLYQHLFWFFGHPEVYILILPGFGMIS
                     HIVSTFSKKPVFGYLGMAYAMVSIGVVGFVVWAHHMYTVGLSTDTKAYFLAATMIIAV
                     PTGIKIFSWIATMWGGSISFKTPMMWALGFIFLFTVGGVTGVVLANAGVDTAMHDTYY
                     VVAHFHYVLSLGAVFAIFAGFYYWFGKMSGYEYSEWMGQLHFWLTFIGVNLVFFPQHF
                     LGLAGMPRRYADYPDAFAGWNYVSSIGSYIAVAGLLVFFANLIYSFSKKKAAAQNPWG
                     EGATTLEWTVPSPPNFHTFEELPKFEDPDGAEKVSS"
     gene            complement(142648..143463)
                     /gene="coxB"
                     /locus_tag="SAR11_0135"
     CDS             complement(142648..143463)
                     /gene="coxB"
                     /locus_tag="SAR11_0135"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="probable cytochrome c oxidase polypeptide II
                     (Cytochrome aa3 subunit 2)"
                     /protein_id="AAZ20959.1"
                     /translation="MKKFLITIITTMLITSAWADQPKNWQLGFQDSASQSMTEIVSFH
                     NNILLPVIIAISVFVLFLMIYVCIRFRASKNPNPSKTTHNVAVEVLWTLIPCLILIVM
                     AVPSFKILYKQDTIPKADLTIKAVGYQWYWGYEYPDENIIFESYMIKEAELKENQPRL
                     LTVDNEVIVPVNKVVKVLITANDVLHAWALPSFGVKRDAVPGRINETWFKAEKVGTYY
                     GQCSELCGIEHAFMPITVKVVTDEEYAIWLAEAKMKFAKEPIAENEYKKLASK"
     gene            complement(143525..144226)
                     /locus_tag="SAR11_0136"
     CDS             complement(143525..144226)
                     /locus_tag="SAR11_0136"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAZ20960.1"
                     /translation="MSNIRLFFKESLSLNLTAKLDKSQSHYVNKVMRIKVGEVFSLFN
                     NSGEWEAKILTISKSIVEFNITKQLRQKENVKDLWLAFSPIKSNYFNFMIQKATELGV
                     TKFLPIIFDRTIVRKINKERLEKVIIEAAEQSNRINVPLIEDPQSLKSFLNHEKMDLI
                     FTDLNSENKKLDFNKLAHNPTCVIIGPEGDFSEEERGEILAFKGVQPIKINENILRSE
                     TAVISALSIVNYLIN"
     gene            144244..144906
                     /gene="dhlB"
                     /locus_tag="SAR11_0137"
     CDS             144244..144906
                     /gene="dhlB"
                     /locus_tag="SAR11_0137"
                     /EC_number="3.8.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="(S)-2-haloacid dehalogenase"
                     /protein_id="AAZ20961.1"
                     /translation="MKNIKAIIFDAYGTLFDVNSAAEKCKDKIGDKWEGFANYWRTTQ
                     LEYTWLRSLMNRHKDFWQVTEDSLDKSMKAYEIDLSMKNELLNLYKVLSPFPEVPEIL
                     KRLKEKNYKLGILSNGTPSLLDELVKSNNLDNIFDDIFSIEEVGIYKPDSKVYDMPIK
                     KYKIQKEEVAFLSANTWDVSGGGNYGYNSIWVNRNNNIFDNLDYKPEDEVKNLKQLLD
                     II"
     gene            complement(144899..145258)
                     /locus_tag="SAR11_0138"
     CDS             complement(144899..145258)
                     /locus_tag="SAR11_0138"
                     /note="MarR family (Interpro)"
                     /codon_start=1
                     /transl_table=11
                     /product="Transcriptional regulator"
                     /protein_id="AAZ20962.1"
                     /translation="MKNLIDCPAERAVYFLGGKWKIRILFSLLQSKKIRFGELKKGLK
                     TITQQMLSKQLKELEGDGIINRKVIRIMPPKVEYSLTEFGLSVMPILRSFSEWNKRNT
                     RTISVKLNKNFEENRIR"
     gene            145353..145589
                     /locus_tag="SAR11_0139"
     CDS             145353..145589
                     /locus_tag="SAR11_0139"
                     /EC_number="1.4.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glutamate synthetas"
                     /protein_id="AAZ20963.1"
                     /translation="MTKGQNAGNGPIAVDVEKDKSYYWCSCGKSSKQPFCDGSHQGSE
                     FTPLAYKAEETKKVFFCACKQTNNQPLCDGSHSK"
     gene            145619..145999
                     /locus_tag="SAR11_0140"
     CDS             145619..145999
                     /locus_tag="SAR11_0140"
                     /codon_start=1
                     /transl_table=11
                     /product="DoxD-like family protein"
                     /protein_id="AAZ20964.1"
                     /translation="MNNILDLTGRILISLIFLLSGINKIGNYEGTVGWMESLGVPGIF
                     LIPAIILEIGAPILIMIGYKVKVSAALLSIFCIATAVIFHNNLSDQMQFISFMKNIAL
                     AGGFLFLVVNETKDFSLDKKLNNR"
     gene            146096..147634
                     /locus_tag="SAR11_0141"
     CDS             146096..147634
                     /locus_tag="SAR11_0141"
                     /EC_number="1.4.1.13"
                     /note="GltB-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Ferredoxin-dependent glutamate synthase peptide"
                     /protein_id="AAZ20965.1"
                     /translation="MDKPTIADNKPKKVELVQNEEYMFCTCGKSKNQPFCDWSHAGTS
                     FEPINFKAEETGDAYLCMCKHSSTKPYCDGTHKNFTSDQINKSEEVSGTNETKSTEEE
                     PHLAYIHELAKNGLTKLGHHGEMGAMGVPSKDLPKWEDIQILTAQLAKKPLLDNDKVE
                     TDIIIGKNSNKPLTLKIPIFVSDMSFGALSEEAKIALAKGAEGAGTGICSGEGGMLLE
                     EQKNNSKYFYELASAKFGYSEDKLKNIQAFHFKGGQAAKTGTGGHLPGNKVKGKISEV
                     RQIPEGEDAISPSTFKDLTTVDDFLKFSNRVRELTGGIPIGFKLSAQHIEDDIEFAVS
                     ASADYIILDGRGGGTGAAPLIFRDNISVPTIPALARARNYLDKKGYDHVSLIVTGGLR
                     TSADFVKALALGADGIAISNSAMQAIGCVGARMCNTNNCPAGIATQRPELRKKLNIDE
                     SSARLTRFFNASVDLMKILARACGHDHLNKLSINDLTTWKKEMSELSGVSFGGIINNK
                     QNNK"
     gene            147644..148483
                     /locus_tag="SAR11_0142"
     CDS             147644..148483
                     /locus_tag="SAR11_0142"
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="AAZ20966.1"
                     /translation="MSNIEVEKIIEPVAASDGAGVKLKRSIGTHLIDYHDPFLMLDEF
                     GSENKDDYIGGFPPHPHRGIETVTYMLAGDFEHKDSTGGEGIMTAGDVQWMKTGSGII
                     HSEMPAMKEGKLHGFQLWVNMPAKLKMTKPEYIYIDADKMSTHKDDDKTVKVIAGKFQ
                     DAEGPVKGHNVEPVYFDVELEKGKEFNFDLPSTHNSLIYLVEGEIKVGNQDHDAVKDS
                     TLIILTRGEKLKVSSLTKAKFLLISGKPIGEPIARGGPFVMNTKAEILQAVQDYHNDT
                     FVK"
     gene            148483..149457
                     /gene="qor"
                     /locus_tag="SAR11_0143"
     CDS             148483..149457
                     /gene="qor"
                     /locus_tag="SAR11_0143"
                     /EC_number="1.6.5.5"
                     /codon_start=1
                     /transl_table=11
                     /product="Quinone oxidoreductase"
                     /protein_id="AAZ20967.1"
                     /translation="MKTIKIERFGGPEVLEVKDIEIGKPGPKEVVIKNLSIGLNYIDV
                     YHRTGLYPIPLPSGIGLEACGIIEEVGSEVDLFKVGDRVAHSSMPIGSYSEKQLFPQE
                     KLVLVPEGISDEIASCIMLKGITAEYLLHRAYPIKKGDKVLYHAAAGGVGQILCQWAN
                     ALGAEVIGTVGSKEKEAIAKKNGCHHVINYTDTNFVEEVEKIAGKNGVDVVYDGVGIK
                     TFDGSIETLKVRGMMVAFGNASGYVDTIDVKKHINAKGLFFTRPSIAHYTMTREELVE
                     SAKKVFDAILSGKFKVEISKKYSLDDAKKAHEELEARLLTGPAVIIPN"
     gene            complement(149454..149858)
                     /locus_tag="SAR11_0144"
     CDS             complement(149454..149858)
                     /locus_tag="SAR11_0144"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAZ20968.1"
                     /translation="MNIDYTVTALMFPAIPLLMSVYSNRFHSLSKLIRQLHDEHVYEN
                     HIPPEWKKQFINLSGRIVLLKWTIMFAAFGFLFNMLTVFALYLNEIFAARLIFGSCCL
                     SMMISIVVFMREIQVSTNALKLHMSDMDVNLD"
     gene            149911..150774
                     /gene="ubiA"
                     /locus_tag="SAR11_0145"
     CDS             149911..150774
                     /gene="ubiA"
                     /locus_tag="SAR11_0145"
                     /EC_number="2.5.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="AAZ20969.1"
                     /translation="MKQLNLFIELTRLKRPIGYMLLFWPCAWGLTLAYDFSKNLNDYF
                     FYLLLFFLGSVLMRSAGCVVNDISDKEFDKKVSRTKNRPIASNQVSIKLGIFYTLILC
                     LLALLVLINFNNLTILLALGSMPLAFTYPLMKRFTYWPQLFLGITFNYGLILGWTAIQ
                     GEINAVAIIFYFGAIFWTLGYDTIYGFQDIKDDEIIGVKSTSIKFKNKPKNFVSTCYV
                     FLIFSILIVGYMMNYNYFFYASLLITIAHLFFYQIKSFNPKSPSMCLKVFKSNNLVGL
                     LIFCNILIGKF"
     gene            150774..152513
                     /locus_tag="SAR11_0147"
     CDS             150774..152513
                     /locus_tag="SAR11_0147"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="AAZ20970.1"
                     /translation="MNNSEIYKRLYKDYSKKYINKILISVFFGVLVAASTSAIAWLLD
                     PAIKKIFVEKDQSLIIVIPLLIIVAFTIKGFALYFAKAIMIKVAEEIKKILQSQMVKS
                     LIKADTQLIDQKHSGKFISNLTYDVTHITTLLSTAVLNLFKDSLTLFGLLFVMFYQNW
                     KLSLIAIIMIPIAGLASKTLGKRMGKVVTEAQEKSGFLNTHLIELFKNHKLVKIFQRE
                     EYESKRTDEHLDQLKDKNIKINTVYVRMSPIMETLTGIMIAILIFYSGKLALKSEIEI
                     GNFFSFLAAMMLAYQPVRALSTINITLKQGLSAANRILPIIDHKNTIIDLDDSKDLNI
                     TDASIKFNKLNFKYNSNEENVLKNINIDIAGGKMTSLVGHSGSGKSTILNLIPRFYDA
                     QSGDILIDNQSIYKVKIKSLRDKISLVSQDTTLFDDTIKNNIKYAKDNVSDEEVISAA
                     KFSYANEFIEQLPNKYETIIGENGIRLSGGEKQRLSIARAMIKKSPIILLDEATSSLD
                     SETESKIQDALKILTKDKTTIVIAHRLSTILSSDQIYIIDSGNVVANGKHDELLNNSE
                     LYKNFYEKQIRKE"
     gene            152513..153775
                     /gene="kdtA"
                     /locus_tag="SAR11_0148"
     CDS             152513..153775
                     /gene="kdtA"
                     /locus_tag="SAR11_0148"
                     /EC_number="2.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic-acid transferase"
                     /protein_id="AAZ20971.1"
                     /translation="MFFLYQIIITLTLIFSPLIIFFRILKKKEDKKRYKEKFCFPSKK
                     RISGNLIWFHGSSVGELLSILPLVQELEKNKSINQILITTSTLSSAQIFKKFNFKKTV
                     HQFFPIDSIFFSYKFLNYWKPTIAIFIESEIWPSIFKIINKKKIPLTLLNARITKKTF
                     DKWRGVKKFSNSVFQNISIAYPQNEETFNYLKKLNVSKVKKIGNLKFFNNQQSKFTKL
                     DKIFLKNINPKKVWCASSTHPGEEIICANTHIKLKKKYKNLLTIIIPRHIHRVSKIVD
                     EIKGLDLNIVLHSSKPKKLNNTDIYLVDTYGETKKFYQSSNIVFMGKSISGNGGQNPL
                     EPTNLGSTVLYGPHVDNFKDTYKLLNKLKIAYKVNGVKSLTQSIDKLITNPNNKKNYL
                     KIAKIGKKILNETKDEINSLFNNEIKKT"
     gene            153756..154700
                     /gene="lpxK"
                     /locus_tag="SAR11_0149"
     CDS             153756..154700
                     /gene="lpxK"
                     /locus_tag="SAR11_0149"
                     /EC_number="2.7.1.130"
                     /codon_start=1
                     /transl_table=11
                     /product="tetraacyldisaccharide 4'-kinase"
                     /protein_id="AAZ20972.1"
                     /translation="MKLKKPKFWDHKKPSFFSYLLLPFSIILGLITKIKSKPKFSNSK
                     IKTICVGNIYIGGTGKTSLAIKIKEILDKNNIRACFIKKFYPNQTDEQKLLSKNGVLF
                     SNLKRITALNEAISEGFEVAIFDDGLQDSTIKYDLEIVCFNNLNWIGNGLTLPSGPLR
                     ENINNLKSYENVFLNGNEESLIAIKEQIKRINPNININSGKYIPLNIDEFDKDQNYLV
                     FSGIGNHKTFVEMLKNNKLKIVSDLEYPDHYQYSKKDFDEIIINAKKFNAHIITTEKD
                     YLRLENLNKNEIFYVKSSLDISDEKNLTNKLIKLNEKN"
     gene            154687..155547
                     /gene="htrB"
                     /locus_tag="SAR11_0151"
     CDS             154687..155547
                     /gene="htrB"
                     /locus_tag="SAR11_0151"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A biosynthesis lauroyl acyltransferase"
                     /protein_id="AAZ20973.1"
                     /translation="MKKIKYFFEFLIISSLFIIYKFLGLKISSHFSGKLFETFGPIFR
                     SKNLIKTNIQRAIPKINTSKIKSITKDMWNNYGRTLSEYMFLKGFRNDQFRSNINITG
                     KEILQKIKFEKTPVIFVSGHFSNFELMAMEIEKSGVNLSAIYRPLNNIFLNILMERIR
                     KKYICKNQIKKGTSGVRELLKLYKKGYSIALMIDQRVSQGIKSKFFNQEAFTTTIPAQ
                     FIKKFNCKVVPISIKRHNGVNFNIKVEKPIEFSKNSSTEKITRELNIWLEKTILKNPG
                     EWIWSHDRWK"
     gene            complement(155552..155740)
                     /locus_tag="SAR11_0152"
     CDS             complement(155552..155740)
                     /locus_tag="SAR11_0152"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ20974.1"
                     /translation="MNKKLAKLKYLPNNFEIIENGDHVVCAVSGKSISLENLNYWNVE
                     LQEPYFSYVEAHKKKETH"
     gene            155762..157027
                     /gene="purD"
                     /locus_tag="SAR11_0153"
     CDS             155762..157027
                     /gene="purD"
                     /locus_tag="SAR11_0153"
                     /EC_number="6.3.4.13"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoribosylamine--glycine ligase"
                     /protein_id="AAZ20975.1"
                     /translation="MKVGIIGSGGREHALCLSIKKSPRVNKIYCFPGNAGTSDIAENI
                     EIDLSDFNKIKEFSIKNEISLLIVGPEKPLVDGIVDFFKDTEISIFGPDKISSQLEGS
                     KIFTKKICEKHNIPTAKFGIFENANDAISFLDKTQFPLVVKADGLASGKGVYICENKD
                     DANLAIKEVFDGKFGLAKNILIEEFLVGEEMSYFIISDGKEIKGFETAQDHKRVLEGD
                     KGANTGGMGAYSPSRLLNQPLEEKILNKIIKPTINALEEMGSNYKGFLYAGLMIVKDE
                     PYLIEYNVRMGDPECQTILPKLKTDLFEIINACCNENLKDINLEWHEKKSLCIVLCSK
                     GYPDKYNNQILIDNIGNLKLDEDDYFFHAGTKKINDQVYSNGGRVINFVSLSSNFKNS
                     RDKAINLIKNLNWKDGFYRKDIGHKVIDE"
     gene            157024..157590
                     /locus_tag="SAR11_0154"
     CDS             157024..157590
                     /locus_tag="SAR11_0154"
                     /codon_start=1
                     /transl_table=11
                     /product="N6-adenine-specific methylase"
                     /protein_id="AAZ20976.1"
                     /translation="MRIISGNFKGKKILLPKDKLTRPLKDLTKESIFNILKHSKLLNV
                     ELENSNILDLFSGVGSFGLECLSRGARNITFLESYTEVLNILKKNIDNLNQQNQTKII
                     EKDIFSENTLKLLNDKFDIIFMDPPYKEKKLPFLLNAITKLELLNTDGIIIIHRHKKE
                     DDDLPKEFNLILEKNYGISKIIFGNVLT"
     gene            complement(157582..158724)
                     /gene="pgi"
                     /locus_tag="SAR11_0155"
     CDS             complement(157582..158724)
                     /gene="pgi"
                     /locus_tag="SAR11_0155"
                     /EC_number="5.3.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="probable glucose-6-phosphate isomerase"
                     /protein_id="AAZ20977.1"
                     /translation="MIFKNFLNIKSSKIIKKDFLKLLKNQPALFETLKPTYKYSYSKK
                     IIKKYKKLSNLRIIGMGGSVLGSEAIYDFLKPKIKKKITFVNNLNSNADYFNNKNINL
                     NLIISKSGNTLETIANANALITKKEKNIIITESKNSYLTNLASKLKAEIFEHKNYVGG
                     RYSVLSEVGMLPAELMNLNEKKFKQFNNLIKNKNFINNLVSNVSTTLNLIKSGKQTSI
                     ILNYDELSENLFKWYQQLIAESLGKKSLGLLPVVSSMPKDNHSLMQLYLDGPNKYFYT
                     FFNVIENRNIKIKNDSVLNTHKFLKNLSIEKIKQSQMIATEKVFISKKIPFRSFRILK
                     RNEQSLGELFCFFILETILLGRALNVNPFDQPSVELIKIETKKILS"
     gene            complement(158728..159066)
                     /locus_tag="SAR11_0156"
     CDS             complement(158728..159066)
                     /locus_tag="SAR11_0156"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ20978.1"
                     /translation="MVEKKSPLVLPPSFGELPEPGKEPEENIISDKKDTSDIEDIINQ
                     SSSISTSEKSDDAKNSIEQSIIKKINEKKVNLIETTEINLDEAIEENEKPKKKGFFKR
                     LKDKFNKSDS"
     gene            complement(159167..159667)
                     /gene="lspA"
                     /locus_tag="SAR11_0157"
     CDS             complement(159167..159667)
                     /gene="lspA"
                     /locus_tag="SAR11_0157"
                     /EC_number="3.4.23.36"
                     /codon_start=1
                     /transl_table=11
                     /product="Lipoprotein signal peptidase"
                     /protein_id="AAZ20979.1"
                     /translation="MNKINLKNFYLNLVIILVVFIFDRTTKLYILKLAEVETSVDIYI
                     TPFLNLFLIWNKGIAFGLFSIDGSVIYNSITILIGLIIIAIIFMMLKNDNIQRYFFAL
                     IAGGAFGNFYDRIVYTAVPDFIDLHFYGFHWFVFNVADIFITIGVFCLILVELFFNNK
                     KTNEKN"
     gene            complement(159680..162397)
                     /gene="ileS"
                     /locus_tag="SAR11_0158"
     CDS             complement(159680..162397)
                     /gene="ileS"
                     /locus_tag="SAR11_0158"
                     /EC_number="6.1.1.5"
                     /note="IleS"
                     /codon_start=1
                     /transl_table=11
                     /product="Isoleucyl-tRNA synthetase"
                     /protein_id="AAZ20980.1"
                     /translation="MSKENINLPKTAFSMKANLQNKEPEILEYWKKIDLYKELRKSNK
                     GKEKFILHDGPPYANGNIHMGTALNKILKDIIVKFHQMDGKDSVYVPGWDCHGLPIEW
                     KIEEQYKKNKKNKNEVPITEFRKECREFAEKWIEVHKTQFKRLGVVGDWENHYATMSF
                     EAEAQIVRELGKFLKEGSLYRGFKPVLWSTVEKTALADAEVEYQDHKSDTIYTAFPVK
                     KTNIKELENTDVIIWTTTPWTIPANKALAYNEALDYLIIELGDEGDFKNKKIVVAEAL
                     LESVIKDCEIKSYKEIKKFKGKDFKDTICSHPFLELGYDYDIPMLEARFVTTEQGTGI
                     VHCAPSHGPDDFNLCLKYGIKAIETVDGDGKYTKNLPLFEGTHIFKANPIVIEKLKEQ
                     KKLLSNGELVHSYPHSWRSKAPLVHRATPQWFISMESHGLRKKALKALDDTKFYPDKG
                     RERIKAMIETRPDWCVSRQRVWGVPLPIFVHKTTKEILVDDNVNENIASIYEKEGSDC
                     WFSDSPQRFLGDKYKAEDYEKISDIVEVWFDSGCTHAFVLEKREDLQWPASMYLEGSD
                     QHRGWFHSSLLESCGTRGRAPYESILSHGFVVDGKGLKMSKSVGNVIAPEDILKKYGA
                     DILRIWVASSNYAEDLRIDYSILEQHADSYRKIRNTFRYLLGNLNDDFQKIDLESLDI
                     KQLPELERYMLHRVYELNNNFKNYFKSYDFHNLYKELLNFCTVDLSSFYFDIRKDALY
                     CDSKNSDRRKSSIVVLNIILESLVKWFAPILSFTTEEIFTLINKEQKSIHLEQFMKYP
                     ESFQDEELHKKWIELKKIRDICNISIEAKRASKEIGSSLEASLIINLNKSLFEISKNV
                     DFSEICITSSALVHQSNTDEIIIKTIKAEGNKCPVCWKINKVKCERHSD"
     gene            complement(162399..163316)
                     /gene="ribF"
                     /locus_tag="SAR11_0159"
     CDS             complement(162399..163316)
                     /gene="ribF"
                     /locus_tag="SAR11_0159"
                     /EC_number="2.7.7.2"
                     /EC_number="2.7.1.26"
                     /codon_start=1
                     /transl_table=11
                     /product="Riboflavin biosynthesis protein"
                     /protein_id="AAZ20981.1"
                     /translation="MKLYKDFNISNNHKKSIILIGNFDGVHLGHQKLFKLANTYKKKF
                     NLKIGVLTFEPMPKMFFNKNFKNFRISNINQKKIILDHLGVDFIITKKFDKKFSAIKS
                     DFFIKEILSKKLEAQYIFVSNNFRFGNKREGDVRQLIKNEGRYHYKIVKPQPLILNKK
                     VISSTYIRSLLEKGQLKKTNKLLSRNWSIEGIVQKGRQQGKKIGFPTCNIDIKDYVIA
                     MPGVYAVKVKQKNSNKSLKAIANLGYRPTFNQKKILLEVHIFNFSGNLYNKYLSVEFT
                     KFIRKEKKFKNVDQLKKQIQSDLKVAKKS"
     gene            complement(163320..164138)
                     /locus_tag="SAR11_0160"
     CDS             complement(163320..164138)
                     /locus_tag="SAR11_0160"
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase-like hydrolase"
                     /protein_id="AAZ20982.1"
                     /translation="MTKNLDKDGLRSIVENYDIFYIDLWGVVHNGITLHKNAIEALEE
                     ITKANKDYVLLTNAPRPNKIVNNFLEKMGMNKEIREKVYSSGEAALNYLKKNSLEEKF
                     YHVGPPRDFDLFLDFKKNKTNNIKESSYLLCTGLFEEQGEDLKYYKELFNDHMDKKMI
                     CTNPDLIVDRGEKRELCAGSVALVFEKMGGEVIYFGKPFPEVYNQAINNEGKRVLSIG
                     DNLNTDIKGANLLNFNSLIISNGVHKDEIKKEGIDVISKKYEVVVNFIQTELKW"
     gene            164262..164552
                     /gene="groES"
                     /locus_tag="SAR11_0161"
     CDS             164262..164552
                     /gene="groES"
                     /locus_tag="SAR11_0161"
                     /codon_start=1
                     /transl_table=11
                     /product="10 kDa chaperonin"
                     /protein_id="AAZ20983.1"
                     /translation="MKFKPLHDRVLIEVLDSSEKTAGGIIIPDTAQEKPQEGKVIAVG
                     GGAKTEDGKLIPMDVKVGDKVLFGKWSGTEIKIDGKEYSIMKESDIMGISGK"
     gene            164576..166240
                     /gene="groEL"
                     /locus_tag="SAR11_0162"
     CDS             164576..166240
                     /gene="groEL"
                     /locus_tag="SAR11_0162"
                     /codon_start=1
                     /transl_table=11
                     /product="60 kDa chaperonin"
                     /protein_id="AAZ20984.1"
                     /translation="MAKVVKFDSEARAAMIRGVDILANTVKVTLGPKGRNVVIDKSYG
                     APRITKDGVSVAKEIDLEDKFENMGAQMVKEVASKTNEEAGDGTTTATILAQAIVKEG
                     VKYVTAGMNPMDVKRGIDAAVEHVKASLIASAKKVKDTDEIAQVGTISANGDKEIGNM
                     IAKAMQKVGNEGVITVEEAKGVETELDVVEGMQFDRGYLSPYFITNADKMTTELENPF
                     ILLHEKKLTNLQPMVPLLEAVVQAGRPLMIISEDVEGEALATLVVNKLRGGLKVVAVK
                     APGFGDRRKSMLDDIAILTGGQVISEDIGVKLENVKLTDLGSCKRVKVDKDNSTIISG
                     NGKKSEIEARCAQIKQQVGETTSDYDREKLQERLAKLAGGVAVIKVGGATEVEVKERK
                     DRVEDALNATRAAAEEGIVVGGGCALLYASQSLDTLKVKGDDQKAGVALVAKALQAPI
                     RQITLNAGVDGSVVVGKLLEQNKKNMGYDAQNEEYVDMFAKGIIDPVKVVRTALQDAA
                     SIAGLLVTTEAMIADKPDDKDSGAGGMSGGMPGGMGGMGGMGGMGM"
     gene            166322..166435
                     /locus_tag="SAR11_0163"
     CDS             166322..166435
                     /locus_tag="SAR11_0163"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ20985.1"
                     /translation="MSKRYSGKSFKDSSTAKKPKLSLKEKRKNKKEKSKKS"
     gene            complement(166432..168180)
                     /gene="rlhE"
                     /locus_tag="SAR11_0164"
     CDS             complement(166432..168180)
                     /gene="rlhE"
                     /locus_tag="SAR11_0164"
                     /note="rhlE"
                     /codon_start=1
                     /transl_table=11
                     /product="probable ATP-dependent RNA helicase"
                     /protein_id="AAZ20986.1"
                     /translation="MENFKLLKIEDSLKNSLEKMKFTKPTPIQAMAIPVALEGKDILG
                     TAQTGTGKTLAFSIPLINKLILDKNAFALVMCPTRELATQVMAAIKSIISDKINIKTA
                     LLIGGEAMQKQLRQLGNRSRIIVGTPGRINDHLKRKSLNLSATKYLVLDETDRMLDMG
                     FTPQIELILKFVPKDHQTLLFSATLPQNIVRISERYLNEPQRISTGSTSVPIAKIKQE
                     TLQVFKENKYDQLVDQFIARKGSILVFVKTKRGADKMVKRLKEEGHSADAIHGDLRQS
                     KRDRVITSFRKGLKRILIATDVAARGLDIPLIQHVINFDLPQVPEDYVHRIGRTARAG
                     TEGSALTFLTPDDRSMWNEISKLIDPNFKPAPRGARGDSRGGKRGKAPYNKKRKFRDE
                     KKSFGKGRPDRSSRDGEKKSFGYKGKSSFGDKSKPSSYGRPDRSSRDGEKKSFGYKGK
                     SSFGDKSKPSSYGRPDRSSRDGEKKSFGYKGKSSFGDKSKPSSYGRPDRSSRDGEKKS
                     FGYKGKSSFTKKDNSKPTGFTNNPKYFGKKTSESSSTSEEKKNSSFDGKKKFKSRSDR
                     PKSFTFKKHSQKRAKV"
     gene            168376..170202
                     /gene="typA"
                     /locus_tag="SAR11_0165"
     CDS             168376..170202
                     /gene="typA"
                     /locus_tag="SAR11_0165"
                     /note="TypA"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="AAZ20987.1"
                     /translation="MSNNIRNITIIAHVDHGKTTMIDNLMKQSGSFRENEVVDERLMD
                     SGELEKERGITILAKPASIDWQGTRVNIIDTPGHRDFAAEVERVLSMADGALLLIDSA
                     EGVMPQTKFVLAKALKQGLKPIVVINKLDKADQRANEVLDETFDLFVSLDANEEQLDF
                     PVMYASGRSGWADKEVDGPRENLHPLLDLIIEHVKPADLDKTKPFAMLSTLLYADSFL
                     GRSLVGKISQGTAKANQAIKAINLKGEKVDEGRLTKIFRYEGTKKVPIEVGEAGDIVV
                     IAGLEKANVADTICDLEVNDPLPATPIDPPTMSITISVNSSPLAGTEGKKLTSTQIRD
                     RLVTEAQNNVGISFSQNANVDAFVISGRGELMLEILLTQMRREGFEMTVSPPKVLYQK
                     DDNGNRLEPIEEITVDVDEEFSSKIIDSMNRRKGKLLDLKDTGKDKKRLIFHAPTRGL
                     MGYTSRFLTLTKGTGVINRIFHGYGKFEGEMDGRKNGALISMANGKAVAFAIFNLQAR
                     GEMFVTHNDPVYEGMIVGLAPKPGDMIINVMKGKQLTNMRTQGTDENVVLTPVRQMSI
                     AEQLSMLNTDEALEITPKSLRLRKAILNPNDRKKNEKSGTPL"
     gene            complement(170199..170846)
                     /locus_tag="SAR11_0166"
     CDS             complement(170199..170846)
                     /locus_tag="SAR11_0166"
                     /note="putative"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="AAZ20988.1"
                     /translation="MFLKIKDIPKVYWSSEKPLNLKPKISTFFFLCLGLVLFGLGEGL
                     LIVSFAGASPWSILAQGIALNVDLSIGIITVLISIGVLFLWLPLKQKPGIGTILNAII
                     IGLMIDVCIKFIPTPENYLNQLILATIAVLTVGLGGGIYLVANLGAGPRDGLMVGLQK
                     KTNLPIATVRAFLEITVMSIGWYLGGTVGIGTLLFAFGIGPSVALGLYLVGKTFN"
     gene            170900..171580
                     /locus_tag="SAR11_0167"
     CDS             170900..171580
                     /locus_tag="SAR11_0167"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ20989.1"
                     /translation="MKKFFIIIFFLAYSLSSNAHMAHYNKFNKIEMEILKDGEVIGYN
                     YYFFKKDGDKTIVTNQIKFTVKLFGATIFEVEGFGEEKYVKDQLISFNSKTLQNDKKK
                     YVNLEFNKQTNKFDIQGSSYSGIASINNVVGNWWSHKILQTDSQISPISGSIKEQVVT
                     FVAKEKIELYGKTYDVDHFKLTSKDMSLPKDKRLNFDIWFDKKNSLILKVAYSRLGNW
                     EYKVKKFE"
     gene            complement(171583..172554)
                     /locus_tag="SAR11_0168"
     CDS             complement(171583..172554)
                     /locus_tag="SAR11_0168"
                     /note="flavin-containing (Fugue)"
                     /codon_start=1
                     /transl_table=11
                     /product="amine oxidase"
                     /protein_id="AAZ20990.1"
                     /translation="MKDFCIIGSGISGATIANILNKKYSLDVYDKARGVGGRSSNKKL
                     NKNESFDHGVQYISPKSIQFKKFIKSLILKKIVKKWPGKHLFLNTDKQEDKKHTKIIG
                     KKGNNAISKYLLKDINCNFNSEVIKIFNKNKVWEIYFSDGSKKLYKSLILTCPFPQLK
                     KLSKKYIKHSFINQKIKMDANITVMMATKKSKLNVSSYFFNDKILGWAGNENSKMRFK
                     SKNDLWTLQSTYSWANKKIDKNRENKKLNTKIMIEQFFKLTGIKKTKVLFSLNHGWKY
                     SSNSKPLRIKSYWNSSLNLGVCADWFVGPRLESGWISAQDLFNKINK"
     gene            complement(172551..173870)
                     /gene="pmbA"
                     /locus_tag="SAR11_0169"
     CDS             complement(172551..173870)
                     /gene="pmbA"
                     /locus_tag="SAR11_0169"
                     /codon_start=1
                     /transl_table=11
                     /product="protein for maturation of antibiotic MccB17"
                     /protein_id="AAZ20991.1"
                     /translation="MVKDQDYLKKTASFCIDLAKKLGATDSTAAVMHSISETVNFRNK
                     KLDESDRSDSLGVSLTTYIGKKKSSISSSNLTEENIKILVERCIETTKITPEDEYNSL
                     PDKDLLANKINDLNLYDDDHIENDEKIEYLKEVEEAAFQKKEIINTETGFSESKSNFI
                     LASSDGFLNGYKSSSFSASCVAVAKDSNNKMERDYEFTSTCHLNDMLKPSQIGEMAAK
                     KTLQKLDPRKIESEKISIVFDRRISKGILSTFASAISASSIARGTSFLKDKINEEIFT
                     SSINIFDKPNIVKGLGSRYFDSEGVKTDELKLVDQGVLKHYLVDTYNGKKLNLKSNGR
                     SGGTSNLYFEKGSISYKDLLKLNQRTLYITETIGHGSNLVTGDYSVGATGFMVENGVF
                     KYPVSEITIAGNFKDIFKNITLADDLEFKYSTNAPTMLIEGMVVAGK"
     gene            complement(173876..175288)
                     /gene="tldD"
                     /locus_tag="SAR11_0170"
     CDS             complement(173876..175288)
                     /gene="tldD"
                     /locus_tag="SAR11_0170"
                     /note="TldD"
                     /codon_start=1
                     /transl_table=11
                     /product="protein that suppresses inhibitory activity of
                     CsrA"
                     /protein_id="AAZ20992.1"
                     /translation="MNDFFTKTDLSRKDAESIISETLNSCDDGELYLENSKSESIVLD
                     DDKIKSSSYSSDLGYGLRAVTGEVVAYSHSNEISKKSLKQSASNLSSTLKSQKGIYNH
                     EIPQTNEKFYKDVNPIEEKSLQSKLDLLKEVNNYTRAKGGMVKQVTASFAGEHKSIEI
                     IRSGGEVLTDVRPLIRFNVSVMLEKDGKKETGVYGIGGRQSYDEYLKDDNWKKVCDEA
                     FRIASVNLESKPAPAGEMKVVLGSGWPAILIHEAIGHGLEGDFNRKKTSAFHNLMGQR
                     VASEGVTIVDDGTLHNRRGSLTIDDEGTPTEKTVLIENGILKNFMQDRLNARLMNTRS
                     TGSGRRESYKHVVLPRMRNTMMLNGKYSQEEMIKSVDKGIFAVSFGGGQVDITSGKFV
                     FNCTEAYEIINGKIGSPIKGATLIGDGPSILKEVSLVGNNMMLDPGIGTCGKAGQGVP
                     VGVAQPSILIDKMTVGGTQL"
     gene            175399..175761
                     /locus_tag="SAR11_0171"
     CDS             175399..175761
                     /locus_tag="SAR11_0171"
                     /codon_start=1
                     /transl_table=11
                     /product="possible Rhodanese-related sulfurtransferase"
                     /protein_id="AAZ20993.1"
                     /translation="MKKFDELMNVSSEIKNISVDEAKEKLNDPNVQFIDVRDKNSFES
                     ETIGNAVNLERGLLEFYLADGSPLENEMFKKNPDKEYIVFCGLGGQSTLATKTMQDMG
                     IKNVKNMTGGMTAWKDKK"
     gene            175765..176112
                     /locus_tag="SAR11_0172"
     CDS             175765..176112
                     /locus_tag="SAR11_0172"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ20994.1"
                     /translation="MKVYFNNSCKICRAEINLYKKQNIKDIEWVDITNNKSAEIETQR
                     NAKNLLRRLHIKDGEKVIGGAEAFLLVWKKIPKYKFLYSFFKTPIIFTLFSFFYEIIA
                     FFLFLKNKKQLLK"
     gene            176158..176700
                     /locus_tag="SAR11_0173"
     CDS             176158..176700
                     /locus_tag="SAR11_0173"
                     /EC_number="3.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="possible 2-hydroxy-6-oxo-2,4-heptadienoate
                     hydrolase"
                     /protein_id="AAZ20995.1"
                     /translation="MKVFILFVFIFSFVSSAQSSQKVILNNLFDQLQIIDNSKSAALL
                     EQKIWSVWNEHPSDFKLTEKLEFGTELMQYGDYNYALKVFSNILENDPKWSEAWNKRA
                     TVYFLMSQFKNSLNDIDKVLDIEPRHFGALSGQARIFIKLQEYEKAIKSIESALEFYP
                     SFKSRELIPEIERLIKEDSI"
     gene            complement(176702..177877)
                     /locus_tag="SAR11_0174"
     CDS             complement(176702..177877)
                     /locus_tag="SAR11_0174"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ20996.1"
                     /translation="MKKIKKNLAKKKPLAKKKVKKTTNKKQKKNLKIKKNIYNKKKIS
                     KNTKTNKKKQKTYSKKKATLISRVVELQNSLKPEFNFKINFSLERYIQAFFDNIANRI
                     SEYKTLKAEEKRRRQLEEIEKKEQEKLQIQKQKVKEEQEQTKLKEKALKEEIKLEKER
                     ARDIKLFLRKEQALLRIEHAERQKQFLKQLQLEKQIEKFRIREIKELEKLEKISLKEK
                     RDDYAGLQARIEKLKDKYRIIRDQKIRERVEALGVKIQGDEDRDTLLQKEKDYKVARQ
                     KIELSLESFYRSASSLVFQLNKRHITRHMSIFRCIDQRFETGEIFIKWDEAPDEEWLL
                     LIYIKNNSPDEGIVIEDKSDPEKNLSHEFKSNEIFKASDLMVDSLTQLISRKRAKKD"
     gene            complement(177954..178838)
                     /locus_tag="SAR11_0175"
     CDS             complement(177954..178838)
                     /locus_tag="SAR11_0175"
                     /EC_number="4.3.3.7"
                     /codon_start=1
                     /transl_table=11
                     /product="dapA-like protein"
                     /protein_id="AAZ20997.1"
                     /translation="MKKIKGIYAAGMSVFNDDLSLNIAKTINHAERIIDQGCHGVAIF
                     GSTGQAQLISISEKISLLNELSNSKYKEKYLIGTGLNSLNETINLMKVANSLNFSDFL
                     IMPPAYYKYGDSEVIEFYSKVVEAVPDSKIILYNFEKLCGYKFSVECVKELVKKFPKQ
                     IVGVKDSSYNLYENLKIDNFSVMPGSELKLLKGLELGCDGIITATCNVTANLSRKVYD
                     DFNEKKQQTVNEILGKVRGTFDQYNLISGLHSFMSDQDDCYKNVIPPVSLLNKKDKKQ
                     LVEDLGKLNFTIDSLKID"
     gene            178883..179818
                     /gene="gmdA"
                     /locus_tag="SAR11_0176"
     CDS             178883..179818
                     /gene="gmdA"
                     /locus_tag="SAR11_0176"
                     /EC_number="4.2.1.47"
                     /note="GmdA"
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-mannose 4,6-dehydratase"
                     /protein_id="AAZ20998.1"
                     /translation="MKKNNSIIIGSGVIGSYLAKFLLSKRQKIIVTSRKRKKAYTNYN
                     KLNIENKIIFEKLNFLKKDEILKLLKKYTPKNIFYFSGQSSLTKSIKLKKVTNDSNYI
                     GAKKILEILHKYELKTNFYKANSGYIFEPNKGLVNIKSKISKNNNPYIQSQIKAHKEV
                     KKFRKKGVNCSSIFFLQVESPLRNNDFFIKKICTHAKLKKNITVGNLNTIRDYSWAPE
                     IVEGIYHLTKIKPRDLMLSSGQGISGYEILKTAYEQNKLDYRKYFSINKKFIRPDEVE
                     VMMGSKKNYEILNKKFKYQIKIGGAKLVKKIFNSI"
     gene            179815..180753
                     /locus_tag="SAR11_0177"
     CDS             179815..180753
                     /locus_tag="SAR11_0177"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycosyltransferase family 9
                     (heptosyltransferase)"
                     /protein_id="AAZ20999.1"
                     /translation="MKTCIYLSYKGLGANLLHLAYCHEIAQKYGPVTIITLCNNLEAA
                     LKDDPLIDKIIFINKYHKRFIDILRLRNFFNSFNFDQIFIFYPSVRIYLASVLSNIKK
                     VFCYPLFKKNKLHLVDAAKKFTEKSLGITDCSTETNYFIKENKIQNIKKNIDTKKFTI
                     VIGAGSSGPTTKWGAKNYSNLINKLNNNGDYYFFILCGPKDKDLSNEITNNIKSNNYV
                     SLYDKKIEEVIPFLCSANMYVGNDSFGSHITVQSGIKSLVILLDSPKAYTDYSKNYQR
                     IFPENIKIENITHGSNLNPNDVSVEKVYQEILNNKF"
     gene            complement(180750..181256)
                     /locus_tag="SAR11_0178"
     CDS             complement(180750..181256)
                     /locus_tag="SAR11_0178"
                     /note="DnaJ N Terminal End Only"
                     /codon_start=1
                     /transl_table=11
                     /product="Heat shock protein"
                     /protein_id="AAZ21000.1"
                     /translation="MNIIIYTLIFLGITYFLLKLVANTSSKKISKHLRKLIFLGLIIL
                     AILLFVAGKFLLSIPLTLLSLALVKLKGFSIFQLIGLFRLIQTLRNSGRFSFNQNQNI
                     KNSSTITIEEAYKILNLDIKKKITKDDVQKAYIKIQKKIHPDISPETTRLSMIVNEAK
                     EVVLKNLV"
     gene            181274..183349
                     /gene="ptrB"
                     /locus_tag="SAR11_0180"
     CDS             181274..183349
                     /gene="ptrB"
                     /locus_tag="SAR11_0180"
                     /EC_number="3.4.21.83"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptidase B"
                     /protein_id="AAZ21001.1"
                     /translation="MKIPHLKKKSEIKTCHNISWEDDYSWIHQDDILEVLKDSKKLNP
                     EVRKYLEEENSYTDFHLSDTKTIQKKLFDEIKGRIKLDDESLPFKDFDYEYWSKTTTK
                     GNYSIKLRKKIGTNNIEEIWNGDEEKEKLKVEYFGVGDLEVSFNDKYLGYSLDTKGSE
                     YYTIYIRDINTKKLVTEKIEETSGSITFSLDDQYVFYSKLDENHRPRKIYRHKLGTKV
                     SEDQLIFEEKSEAFTVGIGLSADDKYFFINSSDHNTSEQYYFDVNEKDPKPKLIKKRQ
                     RGILYSVNSWDGKFYNHTNENAEDFKIDISNSLEKPDWKTFIAAKDEVLIGGLTFLKN
                     WIIRSETSDALDKLFVKNITTGIEEELIFSDETVYVPGASLMQRDKNTDEIYISYSSP
                     KTQSRVYSYNLSTKEKKLVKEQEIPSGHNPDDYIVERVDCKSHDGRLVPLTITRHKNT
                     KMDGSAQLLLYGYGSYGSSMSPSFSTTRLSLINRDIIWVTAHIRGGMERGMKWWKEGK
                     LLNKKNTFEDYIASAKYLIENKYTSKNQIIGMGGSAGGLLMGAVVNQAPELFLGIIMA
                     VPFVDSLTTNLDHSLPLTVGEFDEFGNAKDKKDHFDYIYSYAPYNNIKKMDYPHMLIT
                     TSLSDNRVLFDEPAKFTAKLREYKTDNNLLLLKTEMNAGHGGKSGRDGAIEEIALDYA
                     FALKISKKI"
     gene            183448..183894
                     /gene="ibpA"
                     /locus_tag="SAR11_0181"
     CDS             183448..183894
                     /gene="ibpA"
                     /locus_tag="SAR11_0181"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein a"
                     /protein_id="AAZ21002.1"
                     /translation="MTSRDLSIFNTLRPFSIGFDDMFDQFENMLGNGGLTMQSNYPPY
                     NIRKTGKDNYAIEVALAGFNKNDVEVEFEDNLLTVRTKQVDKSEDKSDDGEIIHKGIS
                     QRQFARSFTIAEDVKVNGAELKDGLLTIACERIVPEYKKKKLIEIK"
     gene            complement(183941..184246)
                     /locus_tag="SAR11_0182"
     CDS             complement(183941..184246)
                     /locus_tag="SAR11_0182"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ21003.1"
                     /translation="MHKLKFILISLFFLTLVAGCQTIKNKTDAIVEKENAKLSEYIGK
                     TSSNLQMELGKPDEDFKNDKGNLELVYNTKKYGILCERRFEVDSNSIVIGFVSNGCF"
     gene            184378..185688
                     /locus_tag="SAR11_0183"
     CDS             184378..185688
                     /locus_tag="SAR11_0183"
                     /codon_start=1
                     /transl_table=11
                     /product="Xanthine/uracil/vitamin C permease family
                     protein"
                     /protein_id="AAZ21004.1"
                     /translation="MLEKYFDYKKHKTDFKTEVIAGVTTFLTMAYIMFLNPFILSGEF
                     AGPEKGFFEFGAVYTATIVATALACFIMAFYGKTWPIGLAPGMGINAFVAFGVCAGMG
                     YTPQEALGAVLVAGVLFLIISLTPIRAWLINSIPRSLKLGIGAGIGLFLAIIGLQIME
                     VVVDNPVTLVQLGDLSDPLVLLGCAAFILMVVLEKMKVKGNIIIGILLFSIIAWATGL
                     AKFNGIASSPPPMTYLFDFDLSAALTAGMTTVVFTLLFVDFFDTAGTLTSVANVAGKV
                     DKNGKVKDIEKAMMADSVGTVAGAMMGTTTVTSYVESGAGVKAGGKTGMTSLVIGLLF
                     LACIFFAPLATSLPKQIDGAALVFVSVLFVRNITDIEWDDIGEAAPAILAMIAMPLTY
                     SISNGIALAFVSYALIRLFTGKFSSTSPAIWIIAILSVVSFAVA"
     gene            complement(185722..186258)
                     /locus_tag="SAR11_0184"
     CDS             complement(185722..186258)
                     /locus_tag="SAR11_0184"
                     /codon_start=1
                     /transl_table=11
                     /product="probable phosphoribosyltransferase"
                     /protein_id="AAZ21005.1"
                     /translation="MIMNFMAEKLIITFDQYTKIVEKLAIEIHNNYKPTVLVGIMRGA
                     APILDILSRILKLPIAYIVIQSYSGKGMEDKQGQLMFAREISSLAENKDFNKVLLVDD
                     LSDTGLTLNKSIEWLKNYEPTKDYINEVKTACLWKKKSSTFEPDFCPVKLDSDPWIVQ
                     PTEHYEEMSMEEIIKKNK"
     gene            186287..186583
                     /locus_tag="SAR11_0185"
     CDS             186287..186583
                     /locus_tag="SAR11_0185"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAZ21006.1"
                     /translation="MKAYWIALYKRIDSQENLKNYGAKVTGIIKSYGGKPLVRGGKFE
                     TLEGETYPRTVIWEFPNYEQAMKCHDSKEYQDGWAIARDTTERNLQIVEGFSTE"
     gene            complement(186570..187142)
                     /gene="tag"
                     /locus_tag="SAR11_0186"
     CDS             complement(186570..187142)
                     /gene="tag"
                     /locus_tag="SAR11_0186"
                     /EC_number="3.2.2.20"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase I"
                     /protein_id="AAZ21007.1"
                     /translation="MSSLINKYKSPSEAVLTSRKDIFFSLCKSIIGQQISVAAANSVF
                     LKFKKKCKNKINAKTVSKLSSVQLKSCGLSGQKVRGIKSLAKQILDKSFNPRLIPKMS
                     DEEAIIYLSQLRQIGRWSAEMILLFTYNRSNIWPIQDIGLLRGISKNYKKKYLPPESY
                     VKLLNKRFSPYCSVATWYLWRSIDPEPIQY"
     gene            complement(187198..188082)
                     /locus_tag="SAR11_0187"
     CDS             complement(187198..188082)
                     /locus_tag="SAR11_0187"
                     /codon_start=1
                     /transl_table=11
                     /product="drug/metabolite transporter (dmt superfamily)"
                     /protein_id="AAZ21008.1"
                     /translation="MLTKNQLGFLYMFLSVCTFSVMDLLVKWSSDYPTGEVLFFRGFF
                     GLLPTYFLIPKGKLKTFYTTERSKEHLFRCLMGLMALIAIVVALRELPLAVVVSLSYA
                     APLFITVLSIFLLSEKVGIFRWLAVLIGFIGVIIIAEPGFKGMNYLYFLPLIFCIGMA
                     FVTITIRKLSTTEPIWLISIFFTITISIAGLATIPMGWKMPNFQDFILLALIGVTGGS
                     ANLFLTQSYKLSEVSLVAPLKYLALVFAIFFGYFIWNEIPTIKTLIGASLVVLASLII
                     FRREIYHKQKIPSTTRHE"
     gene            188118..188561
                     /gene="msrB"
                     /locus_tag="SAR11_0188"
     CDS             188118..188561
                     /gene="msrB"
                     /locus_tag="SAR11_0188"
                     /EC_number="1.8.4.11"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptide methionine sulfoxide reductase"
                     /protein_id="AAZ21009.1"
                     /translation="MEIAVLGLGCFWGPEIKFSKLEGVIKTEVGYCGGDSKTVTYKEV
                     CTCNTNHAEVVKLDFDPKIISYEKILNFFFEIHDPTTLNSQGPDFGTQYRSEIFYLSD
                     RQKEIAESVIKKVNLKLSGNVVTKSSLLKNYCPAEEYHQRYLEKR"
     gene            188563..189375
                     /gene="sseA"
                     /locus_tag="SAR11_0189"
     CDS             188563..189375
                     /gene="sseA"
                     /locus_tag="SAR11_0189"
                     /EC_number="2.8.1.1"
                     /note="rhodanese-like, sseA (KEGG b2521)"
                     /codon_start=1
                     /transl_table=11
                     /product="probable thiosulfate sulfurtransferase"
                     /protein_id="AAZ21010.1"
                     /translation="MSLVDTNWLEKNFDKVKIIDCSWHMPQTERNGFDEYKNIHIKNA
                     IFFDLDKNSKKDTDLPHMLTDAKSWENIVSSMGIKNDDQIVIYDNSDVISSCRCWYNF
                     IYFGHNPELIHVLDGGLKKWIKEDKATTSDIIKIIPTNYIANEKRELVKDINQINKNI
                     LENDFNVIDARSLERFEGKVPEPRKGLRSGSIKNSFCLPFSELINEDHTFVSKEKILE
                     KFKSTGYEMGKNIVFTCGSGVTASVLALAYSLIDNKYMPNIYDGSWSEYGKN"
     gene            189379..190248
                     /gene="yhil"
                     /locus_tag="SAR11_0190"
     CDS             189379..190248
                     /gene="yhil"
                     /locus_tag="SAR11_0190"
                     /note="YhiI"
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family-related protein"
                     /protein_id="AAZ21011.1"
                     /translation="MKRSTKIGTAILAFFLIITIVIVGRTMIGNHFKKKFSKRPPPGI
                     IVTEVVAKNFSQKVSTYGTAIPFRTKSYKIEKYEIVNPIEFNRKLKKGDLITKLKTRN
                     LIASFDGVVTKRDFSNDIKVSESSLLIQLEDTSIIYVDVDIPELYASFIKENLNVDVK
                     FSGNSEKIYSGVVDSTAGRIDVDTRSLAIRIKLENDNFEILPGSLLEIIVKYNERNSM
                     SIPDTSLIMEGNKTYVYKVAEDNVTNKTEIVIGIRDSGFIEVVSGLANGDNIVAEGLK
                     KVRPRGKIKPIKK"
     gene            190248..193370
                     /locus_tag="SAR11_0191"
     CDS             190248..193370
                     /locus_tag="SAR11_0191"
                     /codon_start=1
                     /transl_table=11
                     /product="AcrB/AcrD/AcrF family protein (Acriflavin
                     resistance)"
                     /protein_id="AAZ21012.1"
                     /translation="MFITDVSIRRPVVAWVMSLILIVFGIFVFSQLPVRELPEGLQPP
                     VVQVKVDYKSASAPIIDQEVTQVIEDVIGGVEGIKNINSTSENGSSSINVEFNPDIDL
                     DNAANDIRERVARVVDRLPSEAAAPQILKQSAGFSTTMWLAVSSATWSDLELGDYVER
                     YLVDQFSSVKNVGTISTGGLRDLSVRIWIDPIKLAANNLTIQEVEGAIRKENVSLPAG
                     TLEATNIDLILNLDKSYNDIEKLKTLPIKKNQNSVVRLSDIANVELGPVSEKNLFKAQ
                     SKDALDLKTVGIGIYAKSGASTVELSKEISKKIEEVKKTLPDDLNIEVAFNRATYVGT
                     AIDEVYKTLIIAFILVVIIIYLFLGNIKAVIVPAVALPVSLIASFLGLYLFGLSINIF
                     VLLSFILAIGIITDDSVIMTDAIYRRIENGESPLIAAYKGSKQISFAIIATTLILVAV
                     FIPLIFIDGIAGTLFRETAIALSVSVAVSSFVALTLSPMLASKFLKKEPKQNFIVTKF
                     DKFFKSLLKFYEETLGYWLNKKKIIISFIVFTIIISGVLFSITKKELLPLEDRGVYLV
                     LGFTDEGSSFEYTEKRAEDVEKRLIPLLQAEDSPYKRFIMRVPGFGSNKNSFNSFIII
                     ALLDEWAERDKSSQTIMREAIGKIVTVPETVAFPISPQSIRVSSYNKPVQMVILGSTY
                     EELEEIQSKVINKLRQNKNLSRIESDYSRDKPEVKLVINKNKAKDLSVSTDSIGKTLE
                     TLYGGKTVTKFNRLGKEYPIILQQYLADRRSQEGLSKIFVRSESSGKLISLSNLVEFS
                     EIGSAKKLARYNRQRAVTISANISESYTLTEAIAYLEETMEEIGSSNQIAWKGKSEEI
                     KETSNELFIIFGLAFLTAYLVMAATFNSFIHPFIIMLTVPLALFGGLVFILFLNSSIN
                     IFSQIALVILIGISTKNSILIVDYANQLRTAGKNIETSVKEACQLRFRPIMMTSISTM
                     IAMMPLVIGNIGPGAGEASRLAVGATILGGMIISTFFTLYVTPTMYLVLAKNTKRIDA
                     VDIELKKQLR"
     gene            complement(193367..193966)
                     /locus_tag="SAR11_0192"
     CDS             complement(193367..193966)
                     /locus_tag="SAR11_0192"
                     /note="similar to slt domain (Fugue)"
                     /codon_start=1
                     /transl_table=11
                     /product="soluble lytic murein transglycosylase"
                     /protein_id="AAZ21013.1"
                     /translation="MSKLKNHFLILLIIFIAGCSSIPQNTSNSCSIFNERYLWYKHAK
                     KTEQKWGTPIYIQLAIIKMESDFDWLAKPPRQKLFKIIPFKRPSSSFGYSQAVKGTWE
                     QYKNETGNKLATRTRFKDSVDFIGWYTDKTESLLKISKKDAFRQYLAYHEGWGGYKDY
                     KNNQKVIGLAKKVEKQSNKYKSQLQDCQKRLNKNKYIIF"
     gene            complement(193953..194342)
                     /locus_tag="SAR11_1720"
     CDS             complement(193953..194342)
                     /locus_tag="SAR11_1720"
                     /codon_start=1
                     /transl_table=11
                     /product="unknown membrane protein"
                     /protein_id="AAZ21014.1"
                     /translation="MNKLKNFSRIGFYSSNIILIIFYLFPGSILGCFLYNDCYKQPQI
                     TQDFIISSNHFYAFLLLTSLGVLSFHNTKKINLLSVYLILLSIFLELFHIIIPNRGFE
                     MSDLFGNIVGVILVILIYKIVIRYVKT"
     gene            194401..195117
                     /gene="gpmA"
                     /locus_tag="SAR11_0193"
     CDS             194401..195117
                     /gene="gpmA"
                     /locus_tag="SAR11_0193"
                     /EC_number="5.4.2.1"
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-bisphosphoglycerate-dependent
                     phosphoglycerate mutase"
                     /protein_id="AAZ21015.1"
                     /translation="MTHLILVRHGQSEWNLEKRFTGWVDVDLTGQGKLEACKAGEYIK
                     ETKIDIDYFYSSFQLRAINTLKFIQDTLRDKREPVKAWQLNERHYGALTGLNKDEMKE
                     KLGEDKIHAFRRSWDIKPDPLNRNNPYHPLNIEVYKSIPKENIPDTESLKDTYDRVMK
                     FYIDEIQMKLKNDKNILISAHGNSIRALCKFLFKLDNQRITLLEIPTGNPLLINLDSK
                     QNIKECTYLDQDRAKDLLVF"
     gene            complement(195106..195795)
                     /locus_tag="SAR11_0194"
     CDS             complement(195106..195795)
                     /locus_tag="SAR11_0194"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase family protein"
                     /protein_id="AAZ21016.1"
                     /translation="MKIKTALILCAGYGKRLNPITLRTPKPLLRINEITLLENCINLI
                     HSLGINKILINTFYLSEKIEKFLNNKKFNLEIKIINDGSNILDTGGGILNLINSSNET
                     DFMIFNPDTVWNENYKKYIKDMEKFYFLNKIKNILLLANENLSFDKNLKGDFNLKKNI
                     IKKDELNHLIYTGCQIINKSLFDSYEVGNFSISNIWNKLIDKDDLYGFESFEDFRHLT
                     DLNIYKKLLKN"
     gene            complement(195792..196757)
                     /locus_tag="SAR11_0195"
     CDS             complement(195792..196757)
                     /locus_tag="SAR11_0195"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphotransferase enzyme family protein"
                     /protein_id="AAZ21017.1"
                     /translation="MLQTNDKLKKIKGDASFRSFYRKSLSKKKSIIVFASKEKEKNLL
                     IYDAINSLLIKNKVLAPKLYSENYKKNYIEIEDFGDDSVFSLLKKNKNQKETLYKKSI
                     DLLGVIQKIKQNRSKNFKGKTYKIPIYDNVKLFNEANLFCEWYAKKFVKQNKLAKFKI
                     DIKKQIRFLLTHLQSKEKVFVHRDFHVSNLMKFKNKIGVIDSQDALIGNRAYDLASLI
                     DDVRFRTDEIFKNKIYRYYLKLNKKRVNKATLLSDFEILSILRNMKIIGIFTRLAMRD
                     KKKQYLKLIPYAWKLIELRISNNKKFSELKSLLELNFSKKIRNQK"
     gene            complement(196761..197219)
                     /locus_tag="SAR11_0196"
     CDS             complement(196761..197219)
                     /locus_tag="SAR11_0196"
                     /codon_start=1
                     /transl_table=11
                     /product="possible cell division control protein 6"
                     /protein_id="AAZ21018.1"
                     /translation="MLIATNSEKIDISLEDKTSELAKSFSRTLQKGDVAYFHGEIGVG
                     KTTFIRHLINNLQQLNKVNLTEVTSPTFNLVNEYDVGNFIIQHYDLYRLTDYSAIKNI
                     GLFENREEVVTLIEWPEKIKETIDSKIDLHFEYNDDLNKRYLTIKGVKNK"
     gene            complement(197203..198489)
                     /gene="ahcY"
                     /locus_tag="SAR11_0197"
     CDS             complement(197203..198489)
                     /gene="ahcY"
                     /locus_tag="SAR11_0197"
                     /EC_number="3.3.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Adenosylhomocysteinase"
                     /protein_id="AAZ21019.1"
                     /translation="MDDFKVKDISLADFGRKEISIAESEMPGLMALREEYSGKAPLKG
                     ARILGCLHMTIQTAVLIETLVELGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGE
                     TEEEAVWCIRQTIEGKKDWKANMLLDDGGDLTAMMHSDYKDLLKEVKGVSEETTTGIK
                     ALNKMEKDGTLMIPAINVNDSVTKSKFDNLYGCRESLVDGIRRATDVMMSGKVAIVAG
                     FGDVGKGSAASLRQSGARVMVTEADPICALQAAMEGYEVVLMDEAISKADIVVTATGN
                     IDIVTADHMRNMKDRAILCNIGHFDNEIQVEALKNYKWTEVKPEVDEIELVDGKRIIL
                     LAKGRLVNLGCATGHPSFVMSASFTNQVMAQIELWHNHKNYENKVYVLPKSLDEKVAM
                     LHLKKVGAKLTKLSKDQADYISVETEGPFKPDAYRY"
     gene            complement(198533..200071)
                     /gene="chvG"
                     /locus_tag="SAR11_0198"
     CDS             complement(198533..200071)
                     /gene="chvG"
                     /locus_tag="SAR11_0198"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor histidine kinase"
                     /protein_id="AAZ21020.1"
                     /translation="MFSNFLKSLSILKKFLFINLVIFLIIGILTALYISNAKPNLIKN
                     KTSKHIQIINNTIEHILRLNIKFEEEDIRKFLFSTRFLFQNLDRVILFDNQFNLVGDT
                     DTLDLDPRSFSSRLDIVELEILDEEKSKKIVETKNINKEKTVSFKDVLTNYSWSKDYG
                     KPFTFIQEGYDQFLLTTVKNITLNGVNIGYLAISENANDVKSAIDERKTFILRTAIFI
                     IIVIFVFSFVLNRYFLKPIKNLVAYTKIIKEKSKKKTNINELKSRNDELGTLSNSLDD
                     MTSELQKRISHAENFSTDLVHEIRNPLTSLKSASEILNETDDQSQRSKLISILNHDVQ
                     RIERLITDYSQILKDEVALSKEKMKKINLKLIARSVVDDFNNIYEAKRGIKIMLNDQD
                     DQEEYFINGIENRIEQIIANLLDNSISFSDDNKKILVEIYKGDKDKIIFKVIDEGKGF
                     KETDTKKIFNRFYSNRPDTFGEHSGLGLNIVKNLVELHSATINASNNVTQEGANVEIV
                     FPKV"
     gene            complement(200071..200778)
                     /gene="chvI"
                     /locus_tag="SAR11_0199"
     CDS             complement(200071..200778)
                     /gene="chvI"
                     /locus_tag="SAR11_0199"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system response regulator"
                     /protein_id="AAZ21021.1"
                     /translation="MQTQTIALIDDDRNILTSISIALEKEGFKVQTYIDGESALIGLT
                     RNPPDLAVIDIKMPKMDGEELLKKLRKKTSLPVIFLTSKDDEIDELLGLKLGADDFIK
                     KSGGFSIKVLIERIRVQLRKKDINNNLEDTKNIISHGKLKLDPSQLECEWDNKQLPDK
                     LTTTEFLIVKELAKRPGIIKERAQLMDIAYREDTDIEDRTIDSHVKRIRKKFKKVDPD
                     FTAIETRYGSGYRWNVS"
     gene            complement(200829..203603)
                     /gene="polA"
                     /locus_tag="SAR11_0200"
     CDS             complement(200829..203603)
                     /gene="polA"
                     /locus_tag="SAR11_0200"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="AAZ21022.1"
                     /translation="MDKIKKTDHFYLIDGSGYIFRAYYALPPLTRKSDGLPVGAVSGF
                     CSMLFKLLEDSKSNENLQKPTHFAVIFDAARKTFRNEIYSDYKANRSEAPDDLAPQFE
                     YIRKSVVAFNLPSVDLPNYEADDLIATYVEQILAKGAKVTIVSSDKDLMQLYRKDVRI
                     FDPMKNKFITPEDIVTKFGVGPEKVIDVQSLAGDSSDNVPGVPGIGVKTAAELINKYG
                     TLEKLLDNAQEIKQNKRRETLIENKDKAIISKKLVTLMKDAPVERKLEEFHLKKIDKN
                     KLYKFLREMEFNRLLSSVISAYGEPLLEETAKETKPEKKHQNISKKNYHLITNEKEID
                     EWINEAEEAGELAIDTETSSLDAHQTDLVGISLSTKIGQACYIPIGHKFKGCLKKETV
                     IKKLKPLLEDKSVKKIGQNIKFDFIVLYKQGINMNSMEDTMLMSYVLDAGKNRHNMDT
                     LSEIHLQHKTISFKEIVGTGKKEINFSDVELDKAMEYAAEDADITYRLYKIFSKNLKL
                     EKLTNIYEIFEKPLIKILAFMEIEGIKIDNKFLKVLSEKFEKKISKLEKEVFKISKKE
                     FNIASPKQLGEIIYNDLKIAVLKKTRKGSFATNASVLEDLAFKGHEFPKLILDWRQVS
                     KLKNTYSDALPEHINPNTKRVHTSFLLAATTTGRLASSDPNLQNIPIKSEDGKDIRKA
                     FIAEKGFTLISADYNQIEMRILADLAEVKELKKAFSNNEDIHSLTASQVFNVDIKKVD
                     QDMRRKAKAINFGIIYGISQYGLAKQINVSNHEADEFLNAYFLKFPEIKIYMDNTIKF
                     CRKSGYVTNIFGRRSHFNGINDKNFNVRNFQERAAINAPIQGSASEIMRLAMIRLNKK
                     FESIKNNKSKILLQIHDELIFEVPVKEVKNITEIIKDEMTSVTESDLHTFSTPLTVDV
                     NTGDNWGILH"
     gene            203654..204583
                     /locus_tag="SAR11_0201"
     CDS             203654..204583
                     /locus_tag="SAR11_0201"
                     /codon_start=1
                     /transl_table=11
                     /product="YadG-like ABC transporter protein"
                     /protein_id="AAZ21023.1"
                     /translation="MEQKNILSVKNLKKIYSNKQAGDNLALNDLNLDVKEGEIFGLLG
                     PNGAGKTTFINILAGTVVKTAGRVSVWGFDLDKNPRQVRASVGIVPQEVNLDPFFSPR
                     KLLELQAGLYGIKEKDRITDTILKLVSLEKQANSYARSLSGGMKRRLLMAKALVHQPP
                     IVILDEPTAGVDVELRQNLWKNVKLLNELGVTIILTTHYLEEAEEMCGRIAILNKGNI
                     VALDSTKNLLDRIQTKKVTFKTDIKININDDDLESLKIVSHLDNEVCVSYEKNKINIE
                     ELINLIKKNNVKIIDISTDDGDLEDVFLRLIKN"
     gene            204616..205167
                     /locus_tag="SAR11_0202"
     CDS             204616..205167
                     /locus_tag="SAR11_0202"
                     /note="BioY family (Pfam)"
                     /codon_start=1
                     /transl_table=11
                     /product="probable biotin synthase"
                     /protein_id="AAZ21024.1"
                     /translation="MDLLKTNTIQKVLKTFILIFIGTMALTVSAKLKIPFYPVPMTMQ
                     TFVVLFLGIAFGYKIGLASVAVYLLEGILGMPVFSNSPEKGIGIVYFTGPTMGYLIGF
                     LFASFFAGYLNLNKNIFIIFGKLIFSVSVIYVFGAIWLGTLIGWDKPILQLGVTPFLL
                     AELFKICLLAILAKQIIKFRKFI"
     gene            complement(205160..205723)
                     /locus_tag="SAR11_0203"
     CDS             complement(205160..205723)
                     /locus_tag="SAR11_0203"
                     /codon_start=1
                     /transl_table=11
                     /product="Response regulator consisting of a CheY-like
                     receiver domain and a Fis-type HTH domain"
                     /protein_id="AAZ21025.1"
                     /translation="MVEAANLKKLSDFDNKSLLIVDDDNPFRDRLARAMEKKGFEVFQ
                     AEGVQKGILSVKEKKPAFAVVDLRLADGNGLEVVKQIQISNPSSRIIMLTGYGNIPTA
                     VAAIKEGAIDYLAKPADADDVEKALLADPEKKAEPPENPMSADRVKWEHIHRVFELCN
                     RNVSETARRLKMHRRTLQRILSKRSPR"
     gene            205872..207050
                     /gene="speC"
                     /locus_tag="SAR11_0204"
     CDS             205872..207050
                     /gene="speC"
                     /locus_tag="SAR11_0204"
                     /EC_number="4.1.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="Lysine/ornithine decarboxylase"
                     /protein_id="AAZ21026.1"
                     /translation="MQKFKTVDELINQLKPEKPIYCIRKKSIQSASTYFRNKFPGKVL
                     YAVKTNSHPEVLKTIVESGIENFDVASIQEIKDIRAISPDAKCSYMHTVKSRESIKEA
                     YFNYNIKAFSLDTKDELIKIIEATNQAKDLELFVRVAVSNEHAEIDLSKKFGVLTSEA
                     TGLLRLTKQYAKKIGLSFHVGSQCMHPISYAKGIGEIGNIIKKTKIIPDYINIGGGFP
                     AIYPNLVPQPLENYFEEIKKSLTNLELEKLPELLCEPGRAIVAESGSTIVRVNLRKKQ
                     KLYINDGTYGTLFDAGTPNMVYPSRLIKSSKIISKKLTAFDFYGPTCDSMDYMKGPFL
                     LPNNIKENDYIELGQLGAYGLTFRTQFNGFYSNEIYDVEDEPIMTMYGKDSNKAILVA
                     "
     gene            207050..208093
                     /gene="dys2"
                     /locus_tag="SAR11_0205"
     CDS             207050..208093
                     /gene="dys2"
                     /locus_tag="SAR11_0205"
                     /EC_number="2.5.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Deoxyhypusine synthase-like protein"
                     /protein_id="AAZ21027.1"
                     /translation="MSENKNLTHNSKKSFLQNPVEHIDITSFDARKIISSMEKMSFVS
                     RETANAANIFNEMIQDKDCTIFLTLAGSTSAAGCMNIYKDLVKYNMVDAIIATGASIV
                     DMDFFEALGFKHYQGSQFQDDTELRKNYIDRIYDTYIDEDELQECDQKICEIADTLDP
                     KSYTSREFIYEMGKYLKKNSKKKDSLIETAYDNNVPIFCPAFTDSSAGFGLVTHQENN
                     PKNHITIDSIRELRELTEIKIQSKGSGLFMIGGGVPKNFVQDTVICAELLGKEVEMHK
                     YAVQITVADSRDGACSSSTLKEASSWGKVDIAKEQMVFAEATSVLPLIASDAYHKGDW
                     KNRTRKNFSKIFK"
     gene            208096..208971
                     /gene="speB1"
                     /locus_tag="SAR11_0206"
     CDS             208096..208971
                     /gene="speB1"
                     /locus_tag="SAR11_0206"
                     /EC_number="3.5.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="arginase"
                     /protein_id="AAZ21028.1"
                     /translation="MKYLSNKNGFLGIDNDVNFKEKVVVVPFGLEKTVSYGGGTRNGP
                     KEIIKASHQVELYDEELHCEPYKKIGIKTLKPFKIDKDIKKALKKMSDINQEILDKKL
                     FPITFGGEHSITPGCIAPFVKKYKDICLLHFDAHADLRESYNGEKFSHASAIKRCLDH
                     KNVSIISFGIRNISQSEIPFLKKNSSRINIFWAKDKNKWDLKKFKKMIKNKTVYLTFD
                     VDGLDSSIMPATGTPEPGGLLWDETLDIIRIAAKNSNIVGADINELSPIKGFNSYNFL
                     VAKLAYKILSYKFLY"
     gene            complement(208968..209522)
                     /gene="yhhQ"
                     /locus_tag="SAR11_0207"
     CDS             complement(208968..209522)
                     /gene="yhhQ"
                     /locus_tag="SAR11_0207"
                     /note="YhhQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Uncharacterized ACR"
                     /protein_id="AAZ21029.1"
                     /translation="MKKFFILLSFIMGVVVLTSNYLVQFPINYYGLEEILTYGAFSYP
                     VAFLITDLGNRSYGKVVARKIVYVGFIIGIVFTLFFSTNFADLISVRIAIGSGIAFMV
                     AQLLDVQIFDYLRKKKWFIAPLTSSLIGSTVDTFLFFSISFYATGIPWVTLSLGDLAV
                     KIFVALAMLIPFRLLLGTFKASKA"
     gene            complement(209522..209845)
                     /gene="rpmB"
                     /locus_tag="SAR11_0208"
     CDS             complement(209522..209845)
                     /gene="rpmB"
                     /locus_tag="SAR11_0208"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="AAZ21030.1"
                     /translation="MSKKCELTGKIPMKGHNVSHANNKTKRRFLPNLKKAKFTSELLK
                     RSLTLTVSNAGVRSVDKKGTFDQFLKTVKNKNISPRLKKLKKSILIKSPFIKKAPKAS
                     PSKSA"
     gene            complement(209899..210951)
                     /gene="pyrD"
                     /locus_tag="SAR11_0209"
     CDS             complement(209899..210951)
                     /gene="pyrD"
                     /locus_tag="SAR11_0209"
                     /EC_number="1.3.98.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Dihydroorotate dehydrogenase"
                     /protein_id="AAZ21031.1"
                     /translation="MFSKFRSLIFKIDPETAHNLAIKSLKLNILPNIADQNKGDPIFK
                     TNLFGKNIDNPIGMAAGFDKNAEVYNPLFKLGFGFVEVGTVTPLEQYGNPKPRVFRLV
                     EDQALINRLGFNNLGAENISHRIRSNSHKGLLGINIGPNKDSEDRLNDYLIGLRNFYD
                     IADYIAVNISSPNTENLRAFHDETKFDELLNAIEKEKVKLKSKIPIVVKISPDISDEQ
                     IELISKILIKHKVSAIIVSNTTAKNREKLNNILKHQKGGLSGKPLEEEANKLISKFYK
                     LLKGKIEIIGVGGVDSGESAYKKFQAGASYVQLYTGMVFQGPNIVGKIKKELKEILID
                     EGIKNFKEIIGKKLTN"
     gene            complement(210951..212528)
                     /gene="lysS"
                     /locus_tag="SAR11_0210"
     CDS             complement(210951..212528)
                     /gene="lysS"
                     /locus_tag="SAR11_0210"
                     /EC_number="6.1.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="lysine-tRNA ligase"
                     /protein_id="AAZ21032.1"
                     /translation="MLLNKVIEKDNLDKTNAWPFVEAKKLLRERKSFIDKKGKIILQT
                     GYGPSGLPHIGTFGEVARTSMMVNALKQLTDIPTEIITFSDDMDGFRKVPENVPNQEL
                     LNNNLHKPLTQVPDPFEKFSSFGEHNNEMLKDFLNKFNFEYNFQSSSVLYKSGFFNPT
                     LQIILENYQGIMDIILPTLGKERQKTYSPFLPICPDTGKVLEIPVLEILKEKSKIIFD
                     NNGKKLEVSIFDGNCKLQWKVDWAMRWYALDIDFEMYGKDLIESAILSSKIIKLIGKT
                     NPSGFAYELFLDEKGEKISKSKGNGITIDQWLEYASPESLSLYMYQNPKRAKKLYKEI
                     VPKTVDEYLDFIEKAKTQNELQLLMNPVWHVHNGLIPKEDTIMSFSMLLNLVETSNAD
                     SKELLWKFVKKYKKNLLEKEHPIFDNLIGYAIKYFNDVIKLQKKYKTPDANEKVALEA
                     LVKSLDSCNDKMLPEDIQTLIYSTGKENGYAENLRDWFKLIYEVVFGDENGPRMGFFI
                     SFFGVNETKELIKEKIK"
     gene            212604..214049
                     /gene="trkH"
                     /locus_tag="SAR11_0211"
     CDS             212604..214049
                     /gene="trkH"
                     /locus_tag="SAR11_0211"
                     /note="TrkH"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium uptake protein"
                     /protein_id="AAZ21033.1"
                     /translation="MSNYKTVFFTLGVLQIILGISMMIPIIAQLIYSEIDSSFIGGSI
                     ISIIFGVLFFLTNLNHDKKLNLQQAFLLTALSWLSIAIFGSLPFIFSTLELSITDSFF
                     ESMSGITTTGSTIISNLESAPRSILLWRAMLQWLGGIGIIVMAITLMPIMNVGGMQLF
                     KISSNDSSEKLLPKSKEISLRLIYVYLGLTVLCASTYKIFGMNIFDSLTHSMTTIATG
                     GFSNYNESIGYFNSLPIEISSMVFIILGSLPFIAYIKFLNGDRKILISDVQIKSFLKI
                     IIFSIIILFIYLLFHNKDFSQINIRTICFNVISILSGTGYVTGEFDGWGNFPLIFFLT
                     LMFIGGCAGSTTCGIKIFRIQILYLFIINQLKKIIYPKGIFIIKYDKNNVDDKFMASI
                     ISFIFLYLVIFFLITAFLSLSGLDFVTSISGAATSISNVGPGLGSTIGPNGNFSSLPE
                     ISKWILSLGMILGRLELFAILVLFLPSFWRN"
     gene            214052..215428
                     /gene="ampG"
                     /locus_tag="SAR11_0213"
     CDS             214052..215428
                     /gene="ampG"
                     /locus_tag="SAR11_0213"
                     /note="AmpG"
                     /codon_start=1
                     /transl_table=11
                     /product="muropeptide permease"
                     /protein_id="AAZ21034.1"
                     /translation="MIEIKKQSLSETFAVYFDKRMLRILLLGAISGFPWVLIGSSLSL
                     WLKEEGLSRSTIGWAGLIFAVYAFNYLWAPLIDRFQIPYLTKKLGHRRGWIVLMQIAI
                     LACLVTWSFINPTENLALLITVGLIIAIASATQDITVDALRIEQIGEHESKSMAAGAA
                     MAVVGWWSGYKLGGVIALFTAEYLENMGVTNYWQITFLILGILVILMNIGLMFVHEPL
                     YTDRQKKQKETDKLIEGKLGSKNIITNFITWISSTLGGPIISFFRKNGFTIAVGILSF
                     IFLFKIGEAFLGRMSIVFYKEIGFSKGDIAIYSKTLGWITTVMFTLLGGLFVIRSGVL
                     KAMFVAGILMAATNLLFTVLAWSDKSELLFAVAVIFDDIAAAFATVAFVAFISLLVDR
                     TYTATQYALLASIGTAGRTTLASSSGALVDWLNGDWGVFFIITAIMVIPSLICLWLIK
                     DKLKLHER"
     gene            215418..216164
                     /locus_tag="SAR11_0214"
     CDS             215418..216164
                     /locus_tag="SAR11_0214"
                     /note="SH3 and NLP/P60 domains (Pfam)"
                     /codon_start=1
                     /transl_table=11
                     /product="multi-domain protein"
                     /protein_id="AAZ21035.1"
                     /translation="MKDNYFYKKPLSNIYKKPNAFSEVTSQILYGEKFKIISKNKNWI
                     KIKVSFDNYTGYIKNKYYTKDHQPTHKIFTLKANIYNKQKNKTKNFLPFASRISMIDE
                     NKKFIEFEKNKWIKKKDIKKINHIEKDYLKVLKMFLKIKYLWGGKTYRGIDCSAILQL
                     FFYYNNKFYPRDTKDQIKYSAKKNKSKVFKKGDIIFWKGHVAVCINAQKLIHAYGPEK
                     KVLIMNIKETINRIERTAKLTVKKISPIKY"
     gene            complement(216161..217057)
                     /gene="tyrA"
                     /locus_tag="SAR11_0215"
     CDS             complement(216161..217057)
                     /gene="tyrA"
                     /locus_tag="SAR11_0215"
                     /EC_number="1.3.1.12"
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydrogenase"
                     /protein_id="AAZ21036.1"
                     /translation="MKNILIIGCGLIGSSLLRAISEKKIAKKIFVYEKSKSNILKIKK
                     LKLPCEITNDLKQIIPNLDLIIFCTPLGEYEKIILKINRYLLPKTIITDVGSSKEKSM
                     DLIKRKLKKGIFWTSSHPIAGSEVSGPENGVKNLFLKKWCILIKEKNTNRKHLLILTK
                     FWKKIGSKVAIMDSKKHDTIFSMTSHLPHLIAYNLVKTATDFEKQQRYELIKFSAGGL
                     RDFSRIAASNEIMWRDIFFNNQKNISKVIDLFIKNLRSFKRDIQFKNNKSIIKKLVNT
                     KKVRKKIIKLKQDINKPDFGRN"
     gene            complement(217060..218142)
                     /gene="hisC"
                     /locus_tag="SAR11_0216"
     CDS             complement(217060..218142)
                     /gene="hisC"
                     /locus_tag="SAR11_0216"
                     /EC_number="2.6.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="Histidinol-phosphate aminotransferase"
                     /protein_id="AAZ21037.1"
                     /translation="MTVPKFKKFKIEAYKPGKSNIAKIRNIIKLSANESALGVSPRVK
                     KILQNKKLLISKYPDGKAKNLRKEISKKFKCDFERIICGAGSDEIIQMICQLYLKPSD
                     EVIVPQYSFLMYRIYAQIVGAKVVFSKEKNFKVSINEIIKKVTRKTKLVFIANPNNPT
                     GTYLTRAELIDLRKKLNKNILLVLDDAYFEYMKNKDYKSGLDLFKNKDNVVVIRTFSK
                     IYGLASLRVGWGHGPKKIISAMNLIRPPFNVNQVAQMAAIEALKDRKFINNSVKHNIR
                     EANKVRNALQKLKILSNEVTANFLLLNFDRCKFSANYIFNKLQSKGIILRSTEDGYNI
                     KNKLRLTIGSTKENMRFITTIKAIFN"
     gene            218334..219452
                     /gene="metX"
                     /locus_tag="SAR11_0217"
     CDS             218334..219452
                     /gene="metX"
                     /locus_tag="SAR11_0217"
                     /EC_number="2.3.1.31"
                     /codon_start=1
                     /transl_table=11
                     /product="Homoserine O-acetyltransferase"
                     /protein_id="AAZ21038.1"
                     /translation="MNINVNIKNIIIDKPLKLDCGQTINNYSLAYETYGSLNENKDNA
                     ILIFHALTGDQFVSGINPITKKEGWWSYAVGSGKAIDTDKYFVICANVIGGCMGSYGP
                     SEINPDTNKKYGTTFPVITINDMVNAQFNLLNFFNIEKLFAVMGGSMGGMQTLQFVNN
                     FPDKAKVAIPIACTASHSAQNIAFNELGRQSIMADANWENGDYSNQNKNPNKGLSVAR
                     MAAHITYLSKNGLQEKFGRKLQERDDLKFGFDADFQIESYLRYQGSVFVDRFDANSYL
                     YITRAMDYFDLVKEHHGNLSKAFEKTKTKFLIISFTSDWLYPTSENKEIVIALNAIGA
                     EVGFVEIESDKGHDSFLLKVPKFLNTLGDYIKTAYSKN"
     gene            219455..220051
                     /gene="metW"
                     /locus_tag="SAR11_0218"
     CDS             219455..220051
                     /gene="metW"
                     /locus_tag="SAR11_0218"
                     /note="MetW"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine biosynthesis protein"
                     /protein_id="AAZ21039.1"
                     /translation="MKQEFKIIFDLIEKNTRVLDVGCGDGILMEYLKYNKEIDIRGIE
                     ISKDNVQKCLSKGLTVIEGDAEKDLLQFPDSSFDFVILSQTLQAFLNPEIVIKELLRV
                     GKKAIVTIPNFGFWKVRLHLLIKGTMPITKNLPDEWYNTPNLHMCTIKDFYNFCENRK
                     IKLDKSLALHNEKISSINRLNLNTKNLSAELGIFLIES"
     gene            220052..220771
                     /gene="gloB"
                     /locus_tag="SAR11_0219"
     CDS             220052..220771
                     /gene="gloB"
                     /locus_tag="SAR11_0219"
                     /EC_number="3.1.2.6"
                     /codon_start=1
                     /transl_table=11
                     /product="Hydroxyacylglutathione hydrolase cytoplasmic"
                     /protein_id="AAZ21040.1"
                     /translation="MEIQIIRCLQDNYSYLIVDKAKNIACVIDPSEAKPVIKYLEDKN
                     IHLKYILNTHHHYDHVGGNKELKEKYGASVIGYKGDKDRIPEIDILVGDQDIWHEENF
                     QAKIFHIPGHTLGHICFYFYNEESVFTGDTLFSLGCGKIFEGTYSQMYNSLMKIKALP
                     EKTKIYCGHEYTKQNSKFCIAHDQDNENLKVKIKLIDEKLEKNLPTIPSTIKEELECN
                     IFLRSGTEENFSKLRDLKDNF"
     gene            220837..221241
                     /gene="rplU"
                     /locus_tag="SAR11_0220"
     CDS             220837..221241
                     /gene="rplU"
                     /locus_tag="SAR11_0220"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L21"
                     /protein_id="AAZ21041.1"
                     /translation="MSYAIIQTGGKQYKVKAGEILKIERLEDSKPETKIEFKEILAYG
                     DDKTIEVGSPVVEGAKVEADLVENGKNRTILIFKKRRRQNSRRKNGHRQQYSLIRISK
                     IFSKDGKVLSEAEKMVKPTKKVEKVETEVASK"
     gene            221254..221508
                     /gene="rpmA"
                     /locus_tag="SAR11_0221"
     CDS             221254..221508
                     /gene="rpmA"
                     /locus_tag="SAR11_0221"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L27"
                     /protein_id="AAZ21042.1"
                     /translation="MATKKAGGSSRNGRDSAGRRLGVKKYGGEVVIPGNIIVRQRGTK
                     IFPGENVGMGKDHSIFSVVEGKVVFKKGKSDRTFVSVKPN"
     gene            221539..222522
                     /gene="cgtA"
                     /locus_tag="SAR11_0222"
     CDS             221539..222522
                     /gene="cgtA"
                     /locus_tag="SAR11_0222"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="AAZ21043.1"
                     /translation="MKFLDQVKIYVKAGNGGHGSPSFRREKFIEYGGPDGGDGGKGGT
                     IYLRSERNLNTLIDYRFQQHHKAGRGVNGSGQNRTGHSGEDLILKVPIGTQVFEEDNK
                     TLIYDFKKEGEEFIVANGGKGGLGNTRFKSSTNRAPKKFTKGAPGEEYVIWLQLKTIA
                     DVGIVGLPNAGKSSLLASITNAMPKIANYKFTTLNPNLGVASYDDKEITLADIPGLVE
                     GAHEGVGLGIQFLKHIERCKTLMHLIDITDEDLENTYKQVRNELGSYSKDLLEKKEII
                     VLNKTDLLEEEEVKEILKNFSKNKDSEVVTLSTLEKGSISRIKAKLLSYVS"
     gene            222512..223618
                     /gene="proB"
                     /locus_tag="SAR11_0223"
     CDS             222512..223618
                     /gene="proB"
                     /locus_tag="SAR11_0223"
                     /EC_number="2.7.2.11"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutamate 5-kinase"
                     /protein_id="AAZ21044.1"
                     /translation="MYLKDSKIIVIKIGSSLLIDDKKKVRRKWLTEFAKDIQELIKQN
                     KKVIIVSSGAIAMGCKKLNISKKNLKIDKSQAVASIGQIELMNLFSETFVKLKINISQ
                     ILLTLEDTEQRRRALNAKRTFDNLFKLGFVPIVNENDTIATSEIKYGDNDRLASRVAQ
                     ISGADSLILLSDVDGLYTHNPKIYKNAKLIKEIRNIDKDIEKIATKSISEHGTGGMKT
                     KIDAAKICQLSGCQMVIANGLVNRPIKKITEENKCTWFLPKVSKLDARKKWIISSVSP
                     KGALIIDDGAKQALSNGKSLLAAGIKKVSGRFSKGDHIKVLDKNNYECARGLSSFSSN
                     EIEKIMGHHSKEIEKLLGYISKSEVIHKDDIVEV"
     gene            223620..224870
                     /gene="proA"
                     /locus_tag="SAR11_0224"
     CDS             223620..224870
                     /gene="proA"
                     /locus_tag="SAR11_0224"
                     /EC_number="1.2.1.41"
                     /codon_start=1
                     /transl_table=11
                     /product="Gamma-glutamyl phosphate reductase"
                     /protein_id="AAZ21045.1"
                     /translation="MSRYMRLIGQNARKVSLDKVNSKTKNKVLKKYAFLLGKEKKSIF
                     KANQKDIQFALNKGLKSNLIERLTIDEKKLIGIKNSINKIAKLKDPVDATLEKWSRPN
                     GLTISRVSIPIGVIGVVYESRPNVTADVASLCFKSGNAVILKGGSEAINTNKILAKLF
                     RKSLKETRVNENFIQFIDSKDRKMVDFMLSKMKDYIDVIIPRGGKNLVKRVQQFSNVP
                     IIGHLEGLCHTFIDKDANLKMATNVTYNAKLRNTSICGATETILMHEKIVKKFCNPIL
                     KKLEENNCKIYGDRFLKKYYKGKIYPAKEKDWSTEYLSSTVSVKTVKDCDDAISHINK
                     YGTMHTDSIITKNKKTANKFLKNVKSSIAMHNTSTQFADGGEFGFGGEVGISTNTLPP
                     RGPVGLGQLVSYKYEIISNGKTRK"
     gene            224851..225393
                     /gene="ybeN"
                     /locus_tag="SAR11_0225"
     CDS             224851..225393
                     /gene="ybeN"
                     /locus_tag="SAR11_0225"
                     /EC_number="2.7.7.18"
                     /codon_start=1
                     /transl_table=11
                     /product="probable nicotinate-nucleotide
                     adenylyltransferase"
                     /protein_id="AAZ21046.1"
                     /translation="MVKPENNLNQKKTKIGILGGTFDPAHKGHLEISKQAKKILELKN
                     IIWAITKQNPFKNTSKTDLKNRIKFAKKIIGKNNFIKVKFYEEKVLSNKTIDLINYLN
                     KDKKFEIYFIMGADNLINFHKWYKWKSIIKKCNLLVFDRQGYKAKSLKSVTYNGVNKN
                     RLSFINFKKVNISSSQLRKI"
     gene            225411..225761
                     /gene="ybeB"
                     /locus_tag="SAR11_0226"
     CDS             225411..225761
                     /gene="ybeB"
                     /locus_tag="SAR11_0226"
                     /codon_start=1
                     /transl_table=11
                     /product="iojap-related protein"
                     /protein_id="AAZ21047.1"
                     /translation="MEKNIDLKDLILKTLDSNKALDIISIDLKNKSSMADYMIIASGT
                     SSRHIQALSEMVLEKLKTNGIKNSKIEGKESGDWKLVDGIDLIVHIFHPDKRKFYELE
                     KIWSEIIPKEKVMI"
     gene            225758..226897
                     /gene="ctpA"
                     /locus_tag="SAR11_0227"
     CDS             225758..226897
                     /gene="ctpA"
                     /locus_tag="SAR11_0227"
                     /EC_number="3.4.21.-"
                     /codon_start=1
                     /transl_table=11
                     /product="tail-specific proteinase"
                     /protein_id="AAZ21048.1"
                     /translation="MILTKRFFLFFIILLFTFQKSFSENTDLYKKIDLFGEVLEKISK
                     EYVDEVDQSKSMDSAINGLLQSLDPYSAYMTPESFEGMQTETSGEFGGLGIEVGMEAG
                     VVKVISPIDNTPASKAGLKAGDYIVKINNTQVQGKTLMQAVDLMRGPVGSSIEITVRR
                     RGVKKALIFNITREVIQVQSVKSELIDNNIGYIRLTSFNENSSEQIKDKINELNKKKD
                     LKGYILDLRNNPGGLLSQAIKISDFFLENGEIVSTRSRQASENRKWFAKKGDLTNGKT
                     LIILINYGSASASEIVAGALKDHKRAIILGENSYGKGSVQSIIPLKNRGAIRLTIAKY
                     YLPSGKSISEVGVTPDIEVAEGSDDFKFNSETDNQLNFAIKLFNG"
     gene            226898..227374
                     /gene="nudH"
                     /locus_tag="SAR11_0228"
     CDS             226898..227374
                     /gene="nudH"
                     /locus_tag="SAR11_0228"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="probable (di)nucleoside polyphosphate hydrolase"
                     /protein_id="AAZ21049.1"
                     /translation="MSDNKVNLPLRNGVGIVVLNKDNKVFVAKRIDNQKNFWQMPQGG
                     VDKGEDYLTAAYRELEEETSIKNVELIKECDGLISYELPKNLLGIIWKGKYRGQEQKW
                     FIMRFLGQDNEIDIKTKHPEFSEWKWIDLENITDLVVDFKLHVYKDVKEKVKEILN"
     gene            complement(227367..227759)
                     /gene="atpC"
                     /locus_tag="SAR11_0229"
     CDS             complement(227367..227759)
                     /gene="atpC"
                     /locus_tag="SAR11_0229"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase epsilon chain (ATP synthase F1
                     sector epsilon subunit)"
                     /protein_id="AAZ21050.1"
                     /translation="MSEEFKIEIVNPEKSFLSKEDVTEVVVPAFEGEMGILKDHISII
                     SFLKPGIIKIFSKSGEDNYYVEDGIVEFKNNNLSVLTSSIFNIKDIDKDKISELLTQA
                     EENSKNSDITDQNKYLVDQKIDVLKTLN"
     gene            complement(227759..229177)
                     /gene="atpD"
                     /locus_tag="SAR11_0230"
     CDS             complement(227759..229177)
                     /gene="atpD"
                     /locus_tag="SAR11_0230"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /transl_table=11
                     /product="F1-ATP Synthase Beta Chain"
                     /protein_id="AAZ21051.1"
                     /translation="MSKGKITQIIGAVVDVKFDGELPEILSALECKNGDNRLVLEVAQ
                     HLGESSVRTIAMDATEGLKRGDEVTATGAPIQVPVGPETLGRIINVIGEPIDEKGEVK
                     TKEKWPIHRAAPEFSDQSTETEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIM
                     ELINNVAKAHGGFSVFAGVGERTREGNDLYHEMIDSGVIKPEGPGSKAALVYGQMNEP
                     PGARARVALTGLTVAEYFRDQEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
                     TLATDMGNLQERITTTNKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAE
                     IGIYPAVDPLDSTSRILDPRIVGDEHYRVAREVQKILQTYKSLQDIIAILGMDELSEE
                     DKLTVARARKIQRFLSQPFFVAEVFTGSPGKLVDLESTIKGFAAICNGEYDHLPEAAF
                     YMVGTIEEAVEKAEKMAKDAAA"
     gene            complement(229180..230055)
                     /gene="atpG"
                     /locus_tag="SAR11_0231"
     CDS             complement(229180..230055)
                     /gene="atpG"
                     /locus_tag="SAR11_0231"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /transl_table=11
                     /product="H+-transporting two-sector ATPase (F0F1-type ATP
                     synthase) gamma chain"
                     /protein_id="AAZ21052.1"
                     /translation="MATLDDLKKRIASVKSTQKITKAMKMVAAAKLRRAQENAEKGRP
                     YSEKMNNIILNLSSGISDKENAPKLLSGTGEDKVHLCIVLTSDRGLCGGFNTNIIKKA
                     KTYFQKISDEGKTLKIITVGSKGYDQLKRVYKDAIVERISFKDSKTINYLDAEKVGKM
                     IIENFEKEEFDVCTIFYNKFKNVITQIPQEQQIIPLKTSEAEENSSEDNYEFEPDEDE
                     ILSNLLPKNISTQIFKAMLENSASEQGSRMSAMDNATRNAGEMVDKLTIEYNRSRQAA
                     ITKELIEIISGAESL"
     gene            complement(230059..231594)
                     /gene="atpA"
                     /locus_tag="SAR11_0232"
     CDS             complement(230059..231594)
                     /gene="atpA"
                     /locus_tag="SAR11_0232"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /transl_table=11
                     /product="H+-transporting two-sector ATPase (F0F1-type ATP
                     synthase) alpha chain"
                     /protein_id="AAZ21053.1"
                     /translation="MDINPSEVTKILKEQIKKFGDKAEVTEVGQVLSVGDGIARVYGL
                     DNVQAGEMVEFSDGSKGMALNLESENVGVVIFGDDRKIKEGDVVKRTGSIVDTPVGKE
                     LLGRVVDGLGNPIDGKGALDKATKRSRVEVKAPGIIPRQSVSEPMQTGLKSIDSLVPV
                     GRGQRELIIGDRQTGKTAVAIDAIINQKKINESGDEKQKLYCIYVAIGQKRSTVRQIQ
                     KTLEEAGAMEYTTIVAATASDAAPLQFLAPYTGCTMGEYYRDNGMHALIIYDDLSKQA
                     VAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDEHGGGSLTALPIIETQGGD
                     VSAFIPTNVISITDGQIFLETELFNQGIRPAINVGLSVSRVGSAAQTKAMKKVSGSMK
                     LELAQYREMAAFAQFGSDLDASTQKLLNRGSKLTELLKQKQYSPMTVAEQVISVFCGV
                     KGYLDDVELKDIAEFESKIIEKCKSEKPEILESVLSSGKLEEDTEKSLVDTIMELKKN
                     FNS"
     gene            complement(231595..232152)
                     /gene="atpH"
                     /locus_tag="SAR11_0233"
     CDS             complement(231595..232152)
                     /gene="atpH"
                     /locus_tag="SAR11_0233"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /transl_table=11
                     /product="H+-transporting two-sector ATPase (F0F1-type ATP
                     synthase) delta chain"
                     /protein_id="AAZ21054.1"
                     /translation="MSKNKGFSETSAGRYSLALYELAVEANNLNEIEVHSASIINLIT
                     SSEDFKSLIKDPTNNKEDQLNALSKISEQYKLNELLTKFLSFLISKRRFFYVDKILKS
                     FVETCSVKRGELKAELTSAKDLTENEINNIKEELTKNFSSKIKLNYKHDASLIGGLIV
                     QVGSTMVDTSIKNKLQQIENRMIEA"
     gene            complement(232263..234218)
                     /gene="priA"
                     /locus_tag="SAR11_0234"
     CDS             complement(232263..234218)
                     /gene="priA"
                     /locus_tag="SAR11_0234"
                     /codon_start=1
                     /transl_table=11
                     /product="probable primosomal protein N"
                     /protein_id="AAZ21055.1"
                     /translation="MKVPILIPNIFNHPFTYNSDLNLKVGDYVAVPFGKSEVTGVVWD
                     DFEKKTNKNFAIKKVLRKLDVPPLKKNTIKFLNWFSEYNMTPKGMALKLLLLSSGAIE
                     KLPIEAYEPFKIDIKENEIKLSKEQKNSLKKMNVLNQKFRVHVLQGTTGSGKTMVYFE
                     ALKEIIDKGFQGLILLPEIGLTGQFQNKFIEFFGFKPAVWHSGITKKNKEIIWSGIAN
                     DKIKVVIGARSSLFLPFKKLGLIIVDEEHDQSYKQDEGVTYNARDMAISRASFENIPI
                     NLITAVPSIETYDNIKKGKYSLSKLDQRYLNASLPKYEIINLNNSKLESQSWIAKETI
                     EKVKFHLEKKDQVLFFLNRRGFSPHVLCKKCFTSYSCPNCSINLVYHKNKQNLLCHYC
                     GYKTLLNRDCSKEGKCDFIFSGPGVERISEEVKKIFPTNETTIFSSDTMNKKSSADVL
                     EKIIDNKIQILIGTQLISKGFHFPSLNCIVVVDIDLSSQGHDLRGAEKNLQLYHQLSG
                     RAGRTGKPATVYFQTYNLDTKMITDITNKDPDIFLDKELEIRRENNLPPFQRFIALII
                     TGNNERELEKEAYKFKSFIESAVDGRVLGPVNAPIFRLKRRFRVRLLIRGRKSLKVQN
                     SLSKVIEKFKFPAGMKLTVDVDPINFN"
     gene            complement(234241..235641)
                     /gene="pdhD"
                     /locus_tag="SAR11_0235"
     CDS             complement(234241..235641)
                     /gene="pdhD"
                     /locus_tag="SAR11_0235"
                     /EC_number="1.8.1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="Dihydrolipoyl dehydrogenase"
                     /protein_id="AAZ21056.1"
                     /translation="MSDKFQAVVIGGGPGGYVCAIRLAQLGLKTACIESRGSLGGTCL
                     NVGCIPSKNLLNISENYHKAQNFSKLGIEVGEVKLNLQKMMQNKDKAVTILTKGVEFL
                     FKKNKVTYFKGTGSFKSANKISILDDQKKETIIETDKTVISTGSVPVALPGIEFDEKI
                     IVSSTGALTLETVPKKMVVVGGGYIGLEMGSVWSRLGAEVHVVEFLEHITPSMDREIS
                     TEFMKILKKQGINFHMQTKVEGIKKNANGAIVSTSDKDGKKADFDCDVVLISVGRKPN
                     TTNLNLEAIGVELDEKKRIKTDKTFQTNVKNVYAIGDVIDGPMLAHKAEDEGIAVAEN
                     IAGQSGHVNYDIIPGVVYTTPEVASIGKTEEQLKEANTKYKIGKFSFMANSRAKAIDE
                     AEGFVKILADEKTDRVLGAHIIGPHAGELIGEIGVAMEFGASAEDIARTCHAHPTFSE
                     AVKEAALSVDKRAIHS"
     gene            complement(235642..236919)
                     /gene="sucB"
                     /locus_tag="SAR11_0236"
     CDS             complement(235642..236919)
                     /gene="sucB"
                     /locus_tag="SAR11_0236"
                     /EC_number="2.3.1.61"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate dehydrogenase complex E2
                     component"
                     /protein_id="AAZ21057.1"
                     /translation="MSEKILVPVLGESITEATVAKWLKKEGDTVVADEAIVELETDKV
                     NLEVPSPIDGVLSEINSKDGETVEVGALLGMISQNGAQPSEKKIITKIEPKKTENNVV
                     NLEIKKEAPKVLKEPEEEEPLVLTNEVKEEKTNSSNNNNEILSPAVRKIVVENKIDLK
                     KVSGSGKEGRVLKGDLISMMGENPQPSERKIKYGQEERIKMSRLRQTIAKRLKQAQEN
                     AALLTTFNEVDMTGIMEMRKENQEDFQSRYGIKLGFMSFFVKACVAALKMYPSVNAEI
                     DGDEIIYKNYYNMSFAVGTEKGLVVPVLRDADQLSFADIEKNIKTISEKARDGKITIE
                     DLQGGTFTISNGGVYGSMLSTPILNLPQSGVLGMHNIVERPMVVDGEIKIRPIMYLAL
                     SYDHRIIDGKESVSFLKMVKENLEDPRRLFLNI"
     gene            complement(236922..239825)
                     /gene="sucA"
                     /locus_tag="SAR11_0237"
     CDS             complement(236922..239825)
                     /gene="sucA"
                     /locus_tag="SAR11_0237"
                     /EC_number="1.2.4.2"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate dehydrogenase E1 component"
                     /protein_id="AAZ21058.1"
                     /translation="MSSSKNLEFEKTSFLSKSNSAFIEQMYLKFINKDKDLPESWQNY
                     FEGMSEDLSMIAKEINGPSWNIKKKIDIDEVEKRIEEDEKKLSNEGNIAKVNSKDLVK
                     SNINSIRAVALIRAYRQRGHLLAKLDPLGMMETEYLDELHPEHYGFKKENYDEKIYLD
                     GVINKEHSSIKEILNFLNKTYCGPIGYEYMHISNPTERKWLRDRIEQDENSLQFTKNG
                     KEAILMKLIQAEGFEKFLHKKYVGTKRFGLDGGEGLIPALEQIIKIGGQAKVKEVKIG
                     MSHRGRLNVLANVLQKSYKRIFNEFAGDIQTSGEEGAGDVKYHLGASSNREFDGNSVH
                     VSLTDNPSHLEAVNPVVLGQTRAKQFFHKDKERNKVIPILIHGDAAFAGQGVVTECFA
                     MSGLPGHNTGGTIHIIVNNQIGFTTSPRFARSSPYPSDVAKMVDAPILHVNGDDPEAV
                     VYATRIATEFRLKFNRDVVVDLICYRRFGHNEGDEPSFTQPLMYKKIRSHPTPVEMYG
                     KKLVNENTLSESELSKFKTDFKNLLDDQYKNAKDYKPKIEWYEGTWSRYKPEKGKDKR
                     GVSGYDQQKLLEISEKINATPEKLKLHKTIVKILDARKASVSNGKGIDWSTAEALAFG
                     SLLEEGYPVRLVGQDSGRGTFSQRHSVLRNQEDNSRYIPLNNISKNQMRYEIVDSFLS
                     ELAVLGFEYGYSLVEPNTLTIWEAQFGDFANGAQVVIDQFIASGERKWTRASGLVMLL
                     PHGYEGQGPEHSSARLERFLQLCANDNLQVLNCTTPANYYHALRRQMHREFRKPLIIM
                     TPKSLLRNKHCVSNIEDFGKDNFFHRILWDHALDEENGFIKLKESSKIKKVILCSGKV
                     YFDLLEAREKLKKDDVVLYRIEQLYPFPVKSLVREIKKYAKNANFYWCQEEPKNMGAW
                     FSVRDYIQWTLETINANNTGISYIGRSPDASPATGYAKRHLAQQQEIIKKVFE"
     gene            complement(239860..240735)
                     /gene="sucD"
                     /locus_tag="SAR11_0238"
     CDS             complement(239860..240735)
                     /gene="sucD"
                     /locus_tag="SAR11_0238"
                     /EC_number="6.2.1.5"
                     /codon_start=1
                     /transl_table=11
                     /product="Succinyl-CoA synthetase alpha chain (SCS-alpha)"
                     /protein_id="AAZ21059.1"
                     /translation="MSVLIDKNTKVICQGFTGTHGTFHSEQALKYGTNLVGGVTPKKG
                     GQKHLDRPVFNTVAEAKQEVGADATMIYVPAKFAAAAIIEAIDASIELIVCITEGVPI
                     QDMLRVKQKLNNSKSRLIGPNCPGIITPDECKIGIMPGNIHKKGSVGIVSRSGTLTYE
                     AVAQTTENGLGQSTCIGIGGDPINGTNFIDCLDLFLNDAETESILMIGEIGGSAEEEA
                     AEFVKNHKIKKPMVGFVAGITAPPGRTMGHAGAIISGGKGGAEDKIKKMEECGITIAK
                     SPSELGKTLFNKLSN"
     gene            complement(240737..241897)
                     /gene="sucC"
                     /locus_tag="SAR11_0239"
     CDS             complement(240737..241897)
                     /gene="sucC"
                     /locus_tag="SAR11_0239"
                     /EC_number="6.2.1.5"
                     /codon_start=1
                     /transl_table=11
                     /product="Succinyl-CoA synthetase beta chain (SCS-beta)"
                     /protein_id="AAZ21060.1"
                     /translation="MNIHEHQAKQILKKYGAVVPEGVFAFTVDELIEKAKSLKTEKFV
                     LKAQIHAGGRGKAGGVKILNTIDELSVAAKELLGKTLVTHQTGPAGREVKRLYVEESS
                     NIDKEFYLSCLVDRASSKIVFISSDQGGMDIEEVAEKTPEKIITTKIDITDEISDADC
                     EKIIAIYALADDAKKQAIALIKSVYKMFLGTDANMVEVNPLILTKEKKIICLDAKVNF
                     DSNALFRHPEIIELRDLNEEDPTEIDASKHDLAYIKLDGSIGCMVNGAGLAMATMDII
                     KLYGEEPANFLDVGGGASKEKVSAALKIILSDKNVKGILINIFGGIMRCDVLAQGVVD
                     AAKEINISVPLVVRLAGTNFKEGKEILDNSGLKLISAENLDDAAQKIVEAIK"
     gene            complement(241897..242859)
                     /gene="mdh"
                     /locus_tag="SAR11_0240"
     CDS             complement(241897..242859)
                     /gene="mdh"
                     /locus_tag="SAR11_0240"
                     /EC_number="1.1.1.37"
                     /codon_start=1
                     /transl_table=11
                     /product="Malate dehydrogenase"
                     /protein_id="AAZ21061.1"
                     /translation="MKKISLIGAGQIGGTLAHLIGTKEVADEVVLFDVASGIAKGKAL
                     DIAQSSSVDGFNVKFSGTDNYEDIKDSDVIIITAGVPRKPGMSRDDLLGINLKIIKQV
                     AEGIKKNAPNAFVICITNPLDVMVMAFQKFSGLPANKVVGMAGILDSSRFKLFLSLEL
                     NVPVKEIEAMVMGGHGDTMVPLPRFTKVSGKPLLDLVKEGKISPERLEEINQRTRDGG
                     AEIVKYLEKGSAFYAPAASGVQMAEAYLKDEKKLLPCAVHLNGEYGVSNVYAGVPVII
                     GKDGVEKIEQIDLDEKEKKEFMHSIDAVKALWEAASKIDPDLSK"
     gene            complement(242868..244361)
                     /gene="mmsA"
                     /locus_tag="SAR11_0241"
     CDS             complement(242868..244361)
                     /gene="mmsA"
                     /locus_tag="SAR11_0241"
                     /EC_number="1.2.1.27"
                     /codon_start=1
                     /transl_table=11
                     /product="Methylmalonate-semialdehyde dehydrogenase
                     [acylating] (MMSDH)"
                     /protein_id="AAZ21062.1"
                     /translation="MNLLEHFVGGKLISGSSDRKSKVFNPATGEQESEVRLASKTDLD
                     KAVEVAQKAFETWSLKPSLQRARVMFKFKELIEKNADELTKLIVSEHGKVYEDAKGSL
                     TRGLEVVEFACGIPHLLKGEFSENVGTNVDSWSMRQPLGVVAGITPFNFPAMVPMWMF
                     PIAIACGNTFILKPSEKDPSCPLRLAELLTEAGLPDGVFNVVNGDKEAVDAILTNKDV
                     KAVSFVGSTPIAKYIYENSAKNEKRVQALGGAKNHLVVMPDCDLDGAVNGLMGAAYGS
                     AGERCMAQSVAVAVGDIGDELVARLSKKAEALKVGPGMDKTSEMGPLVTKEHLEKVKS
                     YVDLGVEEGAKLVVDGRNIKLQGYENGFFIGGCLFDHVKKDMRIYKEEIFGPVLSVIR
                     VKTFEEATKLINDHEYGNGVSIYTRDGDAGRTFASKIQVGMVGINVPIPVPMAFHSFG
                     GWKRSLFGDSAMHGAEGIKFYTKLKTVTSRWPSGIRSNAEFVMPTMK"
     gene            complement(244386..245159)
                     /gene="sdhB"
                     /locus_tag="SAR11_0242"
     CDS             complement(244386..245159)
                     /gene="sdhB"
                     /locus_tag="SAR11_0242"
                     /EC_number="1.3.99.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Succinate dehydrogenase iron-sulfur protein"
                     /protein_id="AAZ21063.1"
                     /translation="MVQINLPKNSEVQKGNYYQDKTGSKNIRKVNVYRWDPSNGENPR
                     VDTYEVDMDNCPSKVLDILNKIKNEIDPSLAYRRSCAHGVCGSCAMNMDGKNGLACTK
                     PHSEIEGDINIYPLPHLKVKKDLIGDLSGLYKQYESIEPWLKTNTKVETTEILQTKED
                     RVKLDGAYECIMCACCSTSCPSYWWNGDKYLGPAVLLQAYRWIVDSRDDEKKERLKKV
                     ADELKLYRCHTIMNCTNACPKGLNPAKAIAELKKMLATS"
     gene            complement(245159..246931)
                     /gene="sdhA"
                     /locus_tag="SAR11_0243"
     CDS             complement(245159..246931)
                     /gene="sdhA"
                     /locus_tag="SAR11_0243"
                     /EC_number="1.3.99.1"
                     /note="flavoprotein chain, sdhA"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase"
                     /protein_id="AAZ21064.1"
                     /translation="MSSYKIIDHEYDVIVLGAGGSGLRAAVGLSEAGLKTACISKVFP
                     TRSHTSAAQGGISASLGNMGEDDWRWHMYDTVKGADWLGDQDSIEYLCKEAPAAVIEL
                     EKYGVPFSRTDDGKIYQRPFGGMTKNYGNGIVQRTCAAADRTGHAILHTLYGQALKHN
                     TEFFIEYFALDLLMKDGECKGLIAWNLNDGTIHRFRAHSTIIATGGYGKAYYSATSAH
                     TCTGDGNAMVLRAGLPLQDMEFVQFHPTGIYGHGTLISEGVRGEGGYLVNSKGERFME
                     RYAPKAKDLASRDVVSRSMSIEINEGRGVGKEQDHVHLHLSHLDKNIIESRLPGITEA
                     ARLFANVDVTKEPIPVVPTVHYNMGGIPTNYKAEVLTGNDSETVPGLMAIGEAACVSV
                     HGANRLGSNSLIDLVVFGRAAAKRAAELVKPGTPHEDIGEAETEKCLERFDKLRNSNG
                     ENSTAELRLSMQKTMQSKCAVFRTEKTLKEGVDNIRKAYDGMESISVKDKSLVFNTDL
                     VETLEFDNLIRQAITTVDSAYNRQESRGAHAREDFPKRDDEKFMQHTIAWCNGKDSKI
                     GYRPVTKTTLTNEVQYFPPQERVY"
     gene            complement(246931..247257)
                     /locus_tag="SAR11_0244"
     CDS             complement(246931..247257)
                     /locus_tag="SAR11_0244"
                     /codon_start=1
                     /transl_table=11
                     /product="possible membrane portion of succinate
                     dehydrogenase"
                     /protein_id="AAZ21065.1"
                     /translation="MNSVTKKWLFMKISSVILVPLMIWFILNLVSIFDKDYIEVVNFF
                     TTQPSKILVSLTLVFAYFFSTLSISEVFEDYIQNEKIKNAANKVLNIFAIIMPIITIT
                     VILNLN"
     gene            complement(247259..247642)
                     /gene="sdhC"
                     /locus_tag="SAR11_1721"
     CDS             complement(247259..247642)
                     /gene="sdhC"
                     /locus_tag="SAR11_1721"
                     /codon_start=1
                     /transl_table=11
                     /product="Succinate dehydrogenase cytochrome b"
                     /protein_id="AAZ21066.1"
                     /translation="MDNNNPLSPHIQIYRWHISSLVSISHRITGIVNIFAITVICLWI
                     FSLLLGESSYDLTKLFLQSIFGKFIIICLTWSFSFQVLSEIRHLVMDLGYGFELKTTK
                     ITGLFVIFGSIFFTILFYLLGRNFI"
     gene            complement(247635..248636)
                     /gene="asd"
                     /locus_tag="SAR11_0245"
     CDS             complement(247635..248636)
                     /gene="asd"
                     /locus_tag="SAR11_0245"
                     /EC_number="1.2.1.11"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="AAZ21067.1"
                     /translation="MNIAIVGASGNVGRKMLEVLEQKKISIEQLFLVASSRSAGQKVN
                     FNGKEHEIFNLETYDFSKAEITFFAAGGKISEKYAEKAAKHTTVIDNSSFFRMDQDVP
                     LIVPQVNPEAINVLKKNIIANPNCSTAQLVIALKPLHDEFNIKRVVISTYQSVSGGGK
                     ASMDELIEQTKLSLDKKKINSKNFTKQIAFNAIPHIDVFADDGYTKEELKMVNETKKI
                     LDDKIELTATCVRIPVLVSHAESVNIEFEKPFSLQTIHSLLDSAEGCEVYDKREDGGY
                     ITPLEAEGKNETYISRIREDKTKKNTLNMWIVSDNLLRGAALNAVEIAELLIRKNNG"
     gene            complement(248657..249766)
                     /locus_tag="SAR11_0246"
     CDS             complement(248657..249766)
                     /locus_tag="SAR11_0246"
                     /EC_number="2.1.2.10"
                     /codon_start=1
                     /transl_table=11
                     /product="GcvT-like Aminomethyltransferase protein"
                     /protein_id="AAZ21068.1"
                     /translation="MKNFSIAKSRRLRSTPYTSRIEKQGVTAYTIYNHMLLPAAFGSI
                     EDSYKHLKEHVQIWDVAAERQVEISGKDSAELVQLMTCRDLSKSKIGRCYYCPIIDEN
                     GNLVNDPVVLKLDENKWWISIADSDVIFFAKGLASGHKFDVKIVEPVVDIMAIQGPKS
                     FALMEKVFGKKITELKFFGFDYFDFEGTKHLIARSGWSKQGGYEVYVENTQSGQKLYD
                     HLFEVGKEFNVGPGCPNLIERIESALLSYGNDFDNNDNPFECGFDQYVSLDSDINFLG
                     KEKLKEIKLKGPQKKLRGVKIDIKEISLTGSKNIYDENNNVIGELRSACYSPHFQKVI
                     GIAMIKKSHWEASQGFKIQINDNTINGNVCDLPFI"
     gene            complement(249763..250539)
                     /gene="mhpC"
                     /locus_tag="SAR11_0247"
     CDS             complement(249763..250539)
                     /gene="mhpC"
                     /locus_tag="SAR11_0247"
                     /note="alpha/beta hydrolase fold family"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="AAZ21069.1"
                     /translation="MIFQVDNKKVFASDSGQGIDKKKSTIVLLHGSGLSHIVWSLTEQ
                     YLSNQNYNVLAIDLPGHGNSEGDCLKSIEEISDWLEKVFKKLNVSELTIIGHSQGCLE
                     ALEYSLRYSKRVKNLIFIGGSYRMPVNQDLIDLAENGDDKAVQLMMKWSYENYKKFIG
                     GNPVEKIINSPRNIREVLAIDLIACNNYKNGSEALKSIKCPTLFIFGELDKMVNIEKG
                     KKFAELVLNSKTHIIKNCGHMIMFEKAFEMREKISEFLKK"
     gene            complement(250536..252164)
                     /gene="fadD"
                     /locus_tag="SAR11_0248"
     CDS             complement(250536..252164)
                     /gene="fadD"
                     /locus_tag="SAR11_0248"
                     /EC_number="6.2.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Acyl-CoA synthetases (AMP-forming)/AMP-acid
                     ligases II"
                     /protein_id="AAZ21070.1"
                     /translation="MSHYDTNLDKNEANYVPLSPLTFLERTKDIYPNYEALVYESRSY
                     TWEEVYKRCVKFASALDKLGVKTGDTVSIMAFNTPEIFEAHYSIPMVGAVINAINTRL
                     DPNTISYILQHSDAKVLIVDRQFHDVIEKALKNVKNKITIIDIDDQDIDTSSFKRIGE
                     LEYESFLNTGNENYEWKKPKDEWEAISLGYTSGTTGNPKGVVYHHRGSYLMATGSVTA
                     WNMPNKLNFLCVVPMFHCNGWCYPWTLAMLHARVICLRNIDVKKMFELIDKYEVTHFG
                     GAPIVLNMIVNAPKEDQKALKRKVNVLTAGAPPPSIIFEKMENLGFEVMHVYGLTETY
                     GHMLQCAWNDDWNSLEKDKKNEIKARQGVRYPNTEGAIVMDPETMKPVPKDGKTMGEI
                     MIRGNIVMKGYYKDKEATDKSMAGGWFHSGDLAVTHPDGYIKIQDRSKDIIISGGENI
                     SSIEIENAIAKHPSVSLAAVVAKPDEKWGETPCAFVELIKDKPATEKEIIDFCRETLA
                     GFKLPKSVIFCDLPKTSTGKIQKFELRKKVKELS"
     gene            complement(252166..253929)
                     /gene="mmgC"
                     /locus_tag="SAR11_0249"
     CDS             complement(252166..253929)
                     /gene="mmgC"
                     /locus_tag="SAR11_0249"
                     /EC_number="1.3.99.3"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="AAZ21071.1"
                     /translation="MPNYTAPVEDMMFLFDKLRNNKNYNDLEKYKEVNSELVKDILEE
                     AAKINQNLILPLAKSGDENPTVLENGVVRTPPGYKEAYSKYIEDGWTSLSCDPKYGGQ
                     GMPKTVSAFFDEMLSSASLSFKLYSELSIGAYNCISHHATDEIKEKYLPKMVEGKWSG
                     TMCLTEPVCGTDLGLLKTKAIEQSDGTFKLSGQKIFITSGDQDLTENIIHLVIARAAD
                     SPAGTKGISLFLVPKFLVNEDGSIGARNGVSTGSIESKMGIKGSATCVLNFDDATGYM
                     IGLKNKGLNAMFTMMNLERIVVGIQGLGISEIAYQNSLSYAKERKQGKTNNTKSTNGA
                     DFIIEHADIRKSLLNMKSIIEGERALCFWLSQQTEVSLYHPDEKIKQEASDLVSLMTP
                     VVKTMFSDMGMEITSEAMQVHGGYGYTKDQGIEQLYRDNRITPIYEGTNSIQAADLVF
                     RKLVNKNGDIIDKYLELIKNDCSTENEKLKPFIKELKTHLEILSTFTDWIKEKVQNSK
                     DDASAACNDYLKALGFVSIAHSWIKVLEVSFKDYEQNKDFYEDKIQTANFYFKRVLPR
                     AESHFKTATSGSDYIMNFKFS"
     gene            complement(253956..255062)
                     /gene="leuB"
                     /locus_tag="SAR11_0250"
     CDS             complement(253956..255062)
                     /gene="leuB"
                     /locus_tag="SAR11_0250"
                     /EC_number="1.1.1.85"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="AAZ21072.1"
                     /translation="MIKIKKRKILLLPGDGIGPEVIQEVKKVILWLNSNKSLDFEIDE
                     DLAGGCSYDKHGTPITDEVFYKALESEFVMLGAVGGPKWDNLEFSKKPERALLKLRKE
                     LKLFANLRPAICFEQLVDASTLKPEIVSGLDIMIVRELTGGIYFGEPRGIKPIENGER
                     KGINTHSYTTSEIVRVAKVAFDLARKRSNRVTSCEKSNVMEAGQLWKEEVQELHDKEY
                     KDVELSHMLADNCAMQLLKNPKQFDVIVTDNLFGDMLSDQASMLTGSLGLLPSASLGA
                     KNKDGEMRAMYEPIHGSAPDIAGKEIANPIASILSFAMALRYSLDLDSEADALEKAVQ
                     DVLNDGLRTKDILSQGKKEVSTSAMGDAIISKLQ"
     gene            complement(255049..255660)
                     /gene="leuD"
                     /locus_tag="SAR11_0251"
     CDS             complement(255049..255660)
                     /gene="leuD"
                     /locus_tag="SAR11_0251"
                     /EC_number="4.2.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase"
                     /protein_id="AAZ21073.1"
                     /translation="MQKFNSLTSIPAYLPIVNIDTDMIIPKQFLKTIKRTGLGKNLFF
                     EMRYDDNGNEIKDFILNQKPHNQSKILIAGKNFGCGSSREHAPWALLDFGITCVISSS
                     YADIFYSNCFKNGILPITLPEEKIKELSEYSKRKEEISIDLNEEKIIFGNSEIKFDID
                     PFKKKCLLEGLDDIALSLAKKEKIITFEENLKNNKPWIFNDKN"
     gene            complement(255662..257065)
                     /gene="leuC"
                     /locus_tag="SAR11_0252"
     CDS             complement(255662..257065)
                     /gene="leuC"
                     /locus_tag="SAR11_0252"
                     /EC_number="4.2.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="AAZ21074.1"
                     /translation="MPLTLYDKIWNDHLVDQQDDGTALLFVDRHLVHEVTSPQAFEGL
                     RNSNRKVRQPGLTLAVADHNVPTTDRSKGIADAESKIQVDTLESNCKEFGVQYLGMND
                     KRQGIVHIIGPEQGFTQPGTVIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLVQ
                     KKAKNFRINVNGKLPIGVTSKDVILQIIGQIGTAGGTGSVIEYAGSLISSLSVEQRMT
                     ICNMTIEGGARAGLIAPDEKIFEYLKGKPMSPKNENWDKAMKYWESLKTDDGAKFDKE
                     INLVAEDILPMITWGTSPQDVITIDGKVPNPKNEQDEDKKNSLERSLNYMGLKADTLA
                     TDIKIDKVFIGSCTNGRIEDLREAAKILKDKKKASHVQAMVVPGSGLVKEQAEQEGLD
                     KIFIASGFEWREPGCSMCLAMNADKLKPGERCASTSNRNFEGRQGRGGRTHLVSPGMA
                     AAAAISGNLDDVRKYQN"
     gene            complement(257077..257571)
                     /gene="rplS"
                     /locus_tag="SAR11_0253"
     CDS             complement(257077..257571)
                     /gene="rplS"
                     /locus_tag="SAR11_0253"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L19"
                     /protein_id="AAZ21075.1"
                     /translation="MKTIEEINQLNVKKILSEKKIPDFFPGDVIKVGVRITEGKKDRI
                     QYFEGVCIARKNRDINSSFTVRKISFGEGVERTFPLYGTVIDTITVIRHGKVRRAKLY
                     YLRDRTGKSARIAEKIRKKIGIEVDVKPEMVTEETLAPVAAEAEKQTEVQAEPKIEKS
                     EEKK"
     gene            complement(257588..258274)
                     /gene="trmD"
                     /locus_tag="SAR11_0254"
     CDS             complement(257588..258274)
                     /gene="trmD"
                     /locus_tag="SAR11_0254"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (Guanine-N(1)-)-methyltransferase"
                     /protein_id="AAZ21076.1"
                     /translation="MWQAQIFTLYPDFFPGPLNKGLYGKALTNKIWDLKVVNFREAAE
                     DKHKTVDDTPFGGGSGMLLKADILAKSLDENKKEGERIFYLSPKGKKLDQKLALELSK
                     EKSISLICGHFEGVDERLLSTRNIEELSIGDFILSGGETAAFVVLDSVLRLLPGVLGN
                     EQSKNDESFENGLLEYPQYTKPQIWEEKSVPEVLLSGDHNKIKDWRLSQSEAITRVRR
                     PDLWEKYKKN"
     gene            complement(258283..258816)
                     /gene="rpsP"
                     /locus_tag="SAR11_0255"
     CDS             complement(258283..258816)
                     /gene="rpsP"
                     /locus_tag="SAR11_0255"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S16"
                     /protein_id="AAZ21077.1"
                     /translation="MIKIRLSRGGTKKRPVYKVVIADSRRARDGRFIEKVGFFNPLLP
                     KDKKERVGLEAERIKYWLGQGAQPTTRVARILGENGIIAMPANGSNPSKAIPKKERKK
                     EGDEAAPAAAPKAEAAPAAEAPKEEAPKAEAAPAAEAPKEEAPKAEAAPAAEAPKEEA
                     PKAEAAPAAEAPKEEAK"
     gene            complement(258831..260189)
                     /gene="ffh"
                     /locus_tag="SAR11_0256"
     CDS             complement(258831..260189)
                     /gene="ffh"
                     /locus_tag="SAR11_0256"
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle protein"
                     /protein_id="AAZ21078.1"
                     /translation="MFENLTNKFEEIFSSLKKAPSLDEKQVDEGLRAIRQALLEADVS
                     LDVAKDFIAKVKPKVLGQEIIRSTSPGDMVVKIVYDELVSLLGESNTDINLNAVPPVP
                     MMLVGLQGSGKTTTTAKLAKYLEKNKKKKIMMVSLDVYRPAAQEQLRSLGEQNNILTL
                     PIIEGQLPADICRRAVSAASLNGAEIILFDTAGRTQIDLQMMSEIKQIENIINPTETF
                     LVADSLTGQVAAEVAKEFKNTVNLTGIVLTRADGDARGGAALSMKYVSQVPIKFLGVG
                     EKIENLEVFHPDRIANRILGMGDIVSLVEKAAEDLGEENLKKAEENLKKGQFSMEDYL
                     SQLRQMKKMGGIEGIMSFMPGVSKMKSQMDAAGIDESIITQNEAIILSMTKKERGNPK
                     IIDGSRKKRIANGSGTDAATINKLLKQFKMMSEMMKKMSKGNLKGMSDKGIPPELLNQ
                     LK"
     gene            260349..261173
                     /gene="dapF"
                     /locus_tag="SAR11_0257"
     CDS             260349..261173
                     /gene="dapF"
                     /locus_tag="SAR11_0257"
                     /EC_number="5.1.1.7"
                     /codon_start=1
                     /transl_table=11
                     /product="Diaminopimelate epimerase (DAP epimerase)"
                     /protein_id="AAZ21079.1"
                     /translation="MDIKAFKMDGLGNDFVIIDQRSQDFNLDKDQIIKICDRSFIGCD
                     QLILIKKNKEIDANVEFFNSDGSISGACGNGTRCVADLLSKESGKKEITLLTTSGSLK
                     SKILGNNLVETEIGIPKVNWQEIPLSKQLDTQDLKIEIIDRNNTKHIGGIAINVGNPH
                     IIFFVDDIEAFDLKNIGPKIENHPLFPEKCNVTLAKVINRNLIKVKVWERGAGLTKAC
                     GTAACATAVAANINNLVEKTTDIEFVLGSLTISIDERNSIHMKGPVSDIKNINIKL"
     gene            261173..262090
                     /gene="ftsY"
                     /locus_tag="SAR11_0258"
     CDS             261173..262090
                     /gene="ftsY"
                     /locus_tag="SAR11_0258"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division particle"
                     /protein_id="AAZ21080.1"
                     /translation="MGIFDKFKIGFKKSASTFTSGLRDIIVKKEIDDKTLDQIEEYLI
                     QSDVGLVAAEEIKKIIAQEKIDPKKDIMHEVNLILRNYIVTLMKPLENENFFNKKEKL
                     NAVLVSGVNGVGKTTTIGKVGKILKSNGNKVMFSACDTFRAAAIEQLESWANKIDVQI
                     TKSTQGSDPASVAYKAIEEALKNDFNHVLIDTAGRLQNKKNLMEEYKKIAHVTKKIDP
                     DAPHDVILVLDATSGQNVISQVEEFNKIIPLTGLIMTKLDGTAKGGILLALAKKYKLP
                     IIALGLGEKEDDLQIFNAEKFAEAFTQIN"
     gene            complement(262083..262646)
                     /locus_tag="SAR11_0259"
     CDS             complement(262083..262646)
                     /locus_tag="SAR11_0259"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ21081.1"
                     /translation="MKKIVRTLFIIIFVANFTYADEKDYSADNFFHIGQMNSHDENFS
                     LYFKTREKPILARGEESNYITDFPQDLYIYNYKTKTSLPLISYEWFPSKAKFFLEEYD
                     FPVFPEDFAYYLLKDNNTLVMISAIKNINKNFQFDITNKKLNQYPSSGKFEFIISSIA
                     KNCGHSQLKENYKCNYYKPLISNNLIN"
     gene            complement(262705..263598)
                     /locus_tag="SAR11_0260"
     CDS             complement(262705..263598)
                     /locus_tag="SAR11_0260"
                     /note="Drug/Metabolite Exporter family"
                     /codon_start=1
                     /transl_table=11
                     /product="Transporter"
                     /protein_id="AAZ21082.1"
                     /translation="MNNSKNSYLPFLLLFIQPIFMASNLIVARGGVEYVPPISLAFWR
                     WTAVFLILLPFTYSSLKKNFKFVKQEYKRIFFIGSMGCGVCGAFPFLAGQTTTVTNMG
                     IIYSSSPIFIIIISSLFFKEKINLLRIIGLVSCLIGVFAIIIKGDLSLLISLKFTIGD
                     LWMLASAIGWALYSIYLFYWKTNLKIFDRFTLIAFFGVVSLLPFYLIEEAFFVRTVFN
                     SDFFMWVLFAAISPGIIAFTLYTMAQKKLGASITGFTLYIFTVYSAIYGVLFFNEQLE
                     YYHYIGTALVFGGVYIVKRKV"
     gene            complement(263611..263790)
                     /locus_tag="SAR11_0262"
     CDS             complement(263611..263790)
                     /locus_tag="SAR11_0262"
                     /codon_start=1
                     /transl_table=11
                     /product="possible transmembrane protein"
                     /protein_id="AAZ21083.1"
                     /translation="MLNKITTLIGSGLATLFLIGLATTLTRSSMIGFWDILPVFILMA
                     VAIFMMFYEAFFDKN"
     gene            complement(263780..265117)
                     /locus_tag="SAR11_0263"
     CDS             complement(263780..265117)
                     /locus_tag="SAR11_0263"
                     /note="unknown specificity; similar to gatA"
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="AAZ21084.1"
                     /translation="MLNIFTLTTNKLVEHLKSGQISSVEVCNQYIERIEKFEKDVKAW
                     EYFDKKKLLEKAAEADEYRKSGKPLGSLHGLPIAVKDIIGTFEMPTECGSPVRKKMPS
                     SQDSEVVNLLKIEGAIVMGKTVTTELAYFHPGKTTNPHDNSRTPGGSSSGSAAVIAAH
                     MAPLSIGSQTNGSIIRPASYCGVVGYKPSYGLISRSGVMRQSDKLDHIGVFGKTVEDV
                     ALFAKSLIKKDLYDPSTIHYAADEMLTVCKKGPLYEPKFIFYKTKNWKNIDKESQKSF
                     EFFIKTFKKNIEVFDTPSYFDDIPKYHKIIHETDMANNFQGYYKKSKKHLSKEMVSAI
                     ERGLKYSAKEYAEAIDFMKRSYESYKEVFEDYHGVLTPSSAGVAPKGLKSTGSPEFCT
                     IWTYMGLPSISLPLLVGENNLPLGIQLIGDKLDDLRFLGVANWLEKNCKKYAK"
     gene            complement(265128..266489)
                     /locus_tag="SAR11_0264"
     CDS             complement(265128..266489)
                     /locus_tag="SAR11_0264"
                     /note="large chain"
                     /codon_start=1
                     /transl_table=11
                     /product="mannitol transporter"
                     /protein_id="AAZ21085.1"
                     /translation="MLFSLTNPEVAIFMMGIFLFAVLLGFPIAFTLMAMGIGFGYYAY
                     YDPALMDHIFDNRIFSLFVKNTYTVMDNNVLTAVPLFLFMGYLVERAGIVSKLFFAIR
                     LAAHRLPASMAVAALITCTLFSTATGIIGAVVTLMGLLAWPAMVKAGYDKKFASGVIC
                     AGGCLGILIPPSIMLIVYSVIAQLSPLRLFAAAIFPGLLLAGLYIAYAVGRAWLQPSI
                     APKPRAEDIPPRAEILKEVLVSFVPLFGLIMLVLGTILAGIATPAEAAAAGAFGAILL
                     SWFYKTLKWQSFKESVFLTAKTTAMIMWLFIGSWTFSSVFSYLGGHEIFEHFFTSIEI
                     STWQFLIITQVIIFLLGWPLEWTEILIIFVPIFLPLLEVFDVNPYFFAMLIALNLQTS
                     FLTPPMAMSAYYLKGVQKKNVELMEIFAGIMPFLGIVIFAMFLMYMFPGIALWLPETL
                     FAN"
     gene            complement(266479..267063)
                     /locus_tag="SAR11_0265"
     CDS             complement(266479..267063)
                     /locus_tag="SAR11_0265"
                     /note="small chain"
                     /codon_start=1
                     /transl_table=11
                     /product="mannitol transporter"
                     /protein_id="AAZ21086.1"
                     /translation="MRAYIKLADTLSTSIGKAFSWCIVILMGGTCYEVMMAYVFNKPT
                     LWNFDFSMQMYGAILMMSGAYCLATESHVRGDVIYRLFKPRTQGYIDLVLYFIFFFPG
                     VVSLAFYGYEYAALAWKIKETSWSSPAQINIYMVKSLIPAAGVFLVIQGIAEVFRAII
                     CIKTGHWPARMVVAEETEQILMRTAQDEDQKDVI"
     gene            complement(267155..268312)
                     /locus_tag="SAR11_0266"
     CDS             complement(267155..268312)
                     /locus_tag="SAR11_0266"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP dicarboxylate transporter - DctP subunit
                     (mannitol/chloroaromatic compounds)"
                     /protein_id="AAZ21087.1"
                     /translation="MIKDKKSLKASTPSRRKFFKAAAVTGAAAATAVAMPNIATADGH
                     VTLKMQAAWPSGANIFFEMAQDYCNMVSDMSGGSLKIDLQPVNAIVKTSEIGAAVSDG
                     IVDMGHWVTAYWYGKNAAASLFGTGPSYGMSSQEVMGWMEYGGGRKLYEEAVASVGYN
                     YTGFFHMPMPAQPFGWFKKNVTKVSDVKGMKYRTVGLATNVLTAMGMVVRQLPGGEIQ
                     PAMKTGLIDAAEFNNPTSDSQFGMQDVSKHYHLGSFHQSQEMFEIPMNTKRLNSLSPA
                     HQAILKNAAYAANSDNYFKALVRYSDSLADLMNTHKVNVYQTSDAILAEQLKGWDKVV
                     GEFSGKDAFFKKVVDSQKAYAKKVMKYLLMNQPNYKLAYENEFGPIGKVKI"
     gene            complement(268433..269506)
                     /gene="msmX"
                     /locus_tag="SAR11_0267"
     CDS             complement(268433..269506)
                     /gene="msmX"
                     /locus_tag="SAR11_0267"
                     /note="ATP-binding protein, molybdenum/tungsten binding"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC sugar transporter"
                     /protein_id="AAZ21088.1"
                     /translation="MSKINLNKISHSYNPNDPNPTYALNPFSMTWEDGKRYAILGPSG
                     CGKTTMLNIVSGLVRPSSGKILFDDKDVTDLKTESRNIAQVFQFPVIYNTMTVYDNLA
                     FPLRCRDFSKDIVEERVNSVAETLNLKSFLNLPARKLTADQKQLISLGRGLVREDVAA
                     VLMDEPLTVIDPDLKFKLRRNLKEINEQYKTTLVYVTHDQNEAMTFADNIIVMSEGEV
                     VQTGTPKELFERPNTTFVGYFIGSPAMNLFKTEALSNDSVMINDTLIKTTTDLTKLKD
                     KNIKLGIRSEYIKLAENQKDNVLAATVDKVEDLGNYKLLTAKVGNLTIKSKINREIEV
                     PSDSVKLHIPADRCCVYEDEKLI"
     gene            complement(269499..270578)
                     /gene="msmX2"
                     /locus_tag="SAR11_0268"
     CDS             complement(269499..270578)
                     /gene="msmX2"
                     /locus_tag="SAR11_0268"
                     /note="ATP-binding protein, molybdenum/tungsten binding"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC sugar transporter"
                     /protein_id="AAZ21089.1"
                     /translation="MNLVGENISYKLTEELQLRKISFNFEKGKLYTILGRTLSGKTTL
                     LKTIAGLLMPDSGTIKFEDKNFLEVPVWERNIAMVYQQFINYPHLNVFENIAFPLKQR
                     RLDPQKIKDEVFKSLKLVGLEGYEKRKIQELSGGQQQRVSVARSLVKNAKILLLDEPL
                     VNLDYKLREQLREEFKNIFINGLSEESIVIFSTTDPREAMELNGEVIVLDEGRVLQVG
                     AAKEIFENPKNLKVAAISNDPPMNILKADINSNKIKFEDIEIDIPDHLSKIESESFNF
                     GIRASDVELNDNGFEFEVELAEISGSETLLHLTRGNAKIITSIEEVMDFKIRDKVKIN
                     FKSNKAYAFDETGNLASSPFGGSNV"
     gene            complement(270578..271426)
                     /gene="ycjP"
                     /locus_tag="SAR11_0269"
     CDS             complement(270578..271426)
                     /gene="ycjP"
                     /locus_tag="SAR11_0269"
                     /note="inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transport protein"
                     /protein_id="AAZ21090.1"
                     /translation="MGKLYTFLKYFFITIWTVFVVAPFLWALTTSFKDFNSVNGGVTY
                     IPWVDFEPNLEGWRVLIKSPAQGGVDIVEPYFNSLFVTCTASLISIILGTLSAYALSR
                     YTFKAGPIKNNDITFFFISQRIMPPIVLSIPFFLFLGAVNLLDSLIGLIVVYIVLLMP
                     IAVWIMVDFFNKVPREIDETALIDGCNPYQAFFKVVLPNSIPGLIVAGMFCIIFGWID
                     FFFAFILTFTEVQLLPVKIVALNSSITPWWSLSASALVSVAPLIIVAFIVERYLSKGN
                     LSGAIK"
     gene            complement(271429..272289)
                     /locus_tag="SAR11_0270"
     CDS             complement(271429..272289)
                     /locus_tag="SAR11_0270"
                     /codon_start=1
                     /transl_table=11
                     /product="Binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="AAZ21091.1"
                     /translation="MNFKHKYIFLFPGLFVLIGILIFPIIFVVRLSLSGWNSYNGLNF
                     IGLENYIRLFTDDPRFWESFFRLSFLSVTTVVLQYVIGFALAHMVWKEIKFQRFFRVL
                     FLIPMMTTPVIMTVIWRTFFHESLGPVNDILGNFGLSPKWLTDPTLAKFTVIIVEVWQ
                     WTPFMFLLLLAGLLSLPKEPFLAAAIDGASPVRKFIYVTFPLMAPISIGAIIIRLIEA
                     SKIMDTVYVLTSGGPGTSTETSSFYIFIKGLREFQMGYAASMSFTYLIIMIISLTVIA
                     KVLTKLLLKD"
     gene            complement(272358..273893)
                     /locus_tag="SAR11_0271"
     CDS             complement(272358..273893)
                     /locus_tag="SAR11_0271"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter solute-binding protein"
                     /protein_id="AAZ21092.1"
                     /translation="MKIIKTCLSAMISGILIFSPAYADKWSDQFPHIKATGDIPGDCS
                     YEEISKKNYKGKTLKINTHAVPVIGQPTALHAEQFAKLTGATVDVTHTPAGDLYAKAM
                     VPFKAGQAPYDIVFGFSNFINDWRQYLAPVPKKYMNTKEMKDVTKSHVGVSSWDGTMY
                     QYPVDGDRHYLKYRKDVIDNPEMQKKYKADTGKELKVPTTWKEYGEMAKYFNGWDWDG
                     DGEKEYGSAEVMKKDDLMFAAFFSRSVAYAKNPRTPGGFFFDLETMKPNVNNPGFVEA
                     LTDWVEATKYVPPGGINFGLGDEIGSFGGGQTLFSFSWDDAFIAAMQDDSPIKNKVGT
                     APLPGADKVWNRVTGKWENQYNQAPYIVWGWAVGVAKKSKVQEMAFDYLCFFSNGANH
                     QADLAIGNFGVNPFKNSDFDPNLYIDTMGWDKEIAESYTKTLKDMEKSKNRVFPLRVR
                     GVFEFTSAVATGTSKALAGQLSPQEALDEVAKEWEAIVKRVGKSAVQEDYAVGVKMED
                     NKL"
     gene            complement(273915..274772)
                     /gene="adhP"
                     /locus_tag="SAR11_0272"
     CDS             complement(273915..274772)
                     /gene="adhP"
                     /locus_tag="SAR11_0272"
                     /EC_number="1.1.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase (Zn containing) (adh-5)"
                     /protein_id="AAZ21093.1"
                     /translation="MVMGHENAGWVEEVGKDVVGFKKGDPVILHPIISGTDGTCLSCR
                     RGLDQHAEEGAFPGLNIKEGGYAELLKTSVRNLIKLPTILAPKDVAPFSDAGLTAYRV
                     VKKATRHLLPGQTCVIIGAGGLGHIAIQCLKAMCAANIIIVEKSAEALKHAMSLGGDE
                     GVLIDGNEVERVLELTKGKGGEAVIDFVGEKGSTAMGIKMTAGSGYYYIVGYGEEIRV
                     LAVDVIISEKTIVGNLVGTWSELYELMELANKGLVTLSMQEYKLGDANKALHDLNEGK
                     VKGRAVLVP"
     gene            275137..276219
                     /gene="stc"
                     /locus_tag="SAR11_0273"
     CDS             275137..276219
                     /gene="stc"
                     /locus_tag="SAR11_0273"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="AAZ21094.1"
                     /translation="MPNLTSVEKEFSNLTKKRGFLSSLIDKDIADSWKRCISTGLDPL
                     KKPKRTILSSKELDELKEKNEYIRRLINPELELLYSQIAGTNFMVAYSDSTGSVMDTI
                     YDKTCLKTDVGKIVIPGSIWREEIGGTNGLGQVVTLNKDSIVSGKEHFFESHGKLSCF
                     ASPILNHEGKTIGIIDASTDVHSREQHTLALVKLATKSIETKLFINQFKDELILSFHP
                     RQEYLSTNSVGLLAINGDGFVVGSNSNARIMLHGLAPLKNENFNNIFTTSFSSIANEL
                     LQNKILKISDHLGSSVFIIKSQNFKKKISKETGIKTYACNNCKGSKFKEERCVLIKSA
                     FIETGNISAASRKLGVSRTTIYKHLK"
     gene            complement(276222..277439)
                     /locus_tag="SAR11_0274"
     CDS             complement(276222..277439)
                     /locus_tag="SAR11_0274"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily transporter"
                     /protein_id="AAZ21095.1"
                     /translation="MNKVILPKQKAITIFLVFALSYYISNLLRAITATISPNLISEFD
                     LSAGDLGLLGGGYFLGFAAVQIPLGYLLDNKGPKKIVSYFLLIAVLGMISFSLSENFI
                     TLLISRILIGIGVGACLMGPLTAYRIWYQDETQQRANSWMLMVGAIGMLSSSLPVQFF
                     LPIIGWRMIFITLALLTIFCIILIIFFIPNWNKANIQSNSNDNGSLKEIWNNSFFKSL
                     VPMGFFNYGGLFAIQTLWAGPWMIKVSGYTPEQSANGLFLIYFSLLISFLSWGYLVPK
                     ISKNVSDAIRLLKFGAPLNLIVLAFIIYLGPKAGAYHWAFFAVSSVFLSLTQPAVGMA
                     FSLSNAGKALTSFNLLLFIGAFALQWIIGVIIDLTMNLGYSEISGFRFAMIFFLLTSF
                     FSYLFFLIRNYKN"
     gene            complement(277460..278413)
                     /locus_tag="SAR11_0275"
     CDS             complement(277460..278413)
                     /locus_tag="SAR11_0275"
                     /codon_start=1
                     /transl_table=11
                     /product="probable dehydrogenase"
                     /protein_id="AAZ21096.1"
                     /translation="MKKIIITRRLLKESEEKASKTFDAKLNGNDELYSQSKLIELSEG
                     HDAILTSLTDKMDEETISKLPDSIKVISNFAVGFGNIDLEAAKKRGIAVTNTPEVLSD
                     ATAEIGILLILGACRRVPEGVQAAKESSWKWSADYLIGKQLTGTRLGILGMGRIGQKI
                     AKIAKSLGMIIHYHNRSKLSDEKEQGAIYHDSIKSLFGVSDVLSICCPATKETENLIN
                     KETLEYFPTGAVITNVARGDIVEDEALIDALNRRKIYAAGLDVYKGEPNLNPGYLKIK
                     SVFILPHLGSATKHTRIAMANLAIDNIDEFFKTGNCKNKVN"
     gene            complement(278416..279711)
                     /gene="glcF"
                     /locus_tag="SAR11_0276"
     CDS             complement(278416..279711)
                     /gene="glcF"
                     /locus_tag="SAR11_0276"
                     /EC_number="1.1.3.15"
                     /codon_start=1
                     /transl_table=11
                     /product="(S)-2-hydroxy-acid oxidase"
                     /protein_id="AAZ21097.1"
                     /translation="MQTNFTEKQLKDSDNAETEKIFKKCVHCGFCNATCPTHQIFGDE
                     LDGPRGRIYLIKDMLENQKKPTAKTVKHIDRCLSCYSCMTTCPAGVNYMHIIDHGKKY
                     IEKNYERSFFDRTIRNFLSVVLPNTGYFRLASYMVKLAKPFQFLMPSKIKDMISLMPT
                     SFPKKTIKQKEVYSVSAKNKIARVALLTGCVQKEISPQINEATIRLLNRHGVEVVVPK
                     KIRCCGSLNHHLGKEDDAHHDFRNNINTWYDEHQKGNLDAILSNTSGCGTTMKDYGFI
                     FKDDEEMKKKAKVISDLTKDVSEYLDTNLKLNFKTKEKKYKIAYHSACSMQHGQKVHS
                     QPMSLLSKTNNEIMEIPEGHICCGSAGTYNILQSEIAKELLSKKVKNIESLKPDFIST
                     GNIGCITQISNGTKTPILHTIEILDWYTGGPKPKILQKN"
     gene            complement(279711..280979)
                     /gene="glcE"
                     /locus_tag="SAR11_0277"
     CDS             complement(279711..280979)
                     /gene="glcE"
                     /locus_tag="SAR11_0277"
                     /EC_number="1.1.3.15"
                     /note="GlcE"
                     /codon_start=1
                     /transl_table=11
                     /product="(S)-2-hydroxy-acid oxidase"
                     /protein_id="AAZ21098.1"
                     /translation="MKKNSQIFQDSNNTYYPEDELQVSNLVQELYKKNQPTEIIGTGS
                     KNFIGNNIQSAKKLSMSKLSGVIEYLPEELYIKVKANTPLELVEKELEKNNQELAFEP
                     IDFGFIENGKSNKGTIAGHLACNFAGSRRFKVGSLRDHILGFRGVNGKGDIIKSGGTV
                     VKNVTGYDLSKLVTGSFGTLVALTEITLKVLPKKKLSNTITIHTDDKKLVKNLFDKIS
                     SSSSEVSGAVYIPEEPKDENYDQNKEMVFKFNDLKYKGSFLALRIEGDKIAIDEKIKA
                     LTNELELSKLNTTVLDVHQSTPFWKKINNLELFKQTKNNLLRVVVPPSKGPKLIQFLG
                     NKYKYYIDWCGSLYWIEVQSKKNSKVSDIKKLTKELGGYLTIIKTSDEYDYEETIFTV
                     DDIRLLISEKIKKSFDPKRIFNPGKMYRGI"
     gene            complement(280945..282441)
                     /gene="glcD"
                     /locus_tag="SAR11_0278"
     CDS             complement(280945..282441)
                     /gene="glcD"
                     /locus_tag="SAR11_0278"
                     /EC_number="1.1.3.15"
                     /note="GlcD"
                     /codon_start=1
                     /transl_table=11
                     /product="(S)-2-hydroxy-acid oxidase"
                     /protein_id="AAZ21099.1"
                     /translation="MSELVLPKIDKATINKKEYIFKNLAKIINPENVLSHADDIKPYE
                     TDALAAYTQTPLAVVMPENTEEVSNILKFCHKENIKVVPRGAGTGLSGGALPLNDAIL
                     LSLGKFNKIIEIDFENKCVVTQPGVTNLGITHAVQHKNFYYAPDPSSQLACSIGGNVA
                     ENSGGVHSLKYGTTTNNILGVEMVMMDGTVCRVGGKTLDQEGYDLMGLICGSEGLLGV
                     ITEVTVKILKNPQVVKAALIGFPTIEEGGNAASEIISSGIVPAGMEIMDKALIEATDN
                     FSKAGYPRDAELLLIVELDGTESEVDELLKQVRSICEKNNCSSLKLSKNEKERLSFWA
                     GRKAAFPACGAMAPDYYCMDGSIPRGKLAEALLEIKRLSEKYKLPVANCFHAGDGNLH
                     PLIMFDGSDKEQLRKTEEFGAEILKTCVRLGGVITGEHGVGVEKRELMCEMFNNTDIQ
                     QQLDIKKSLDEKNLLNPGKVYPILRKCAEEGRVHVHRNEEKFPDLPRF"
     gene            complement(282447..283610)
                     /gene="aspC"
                     /locus_tag="SAR11_0279"
     CDS             complement(282447..283610)
                     /gene="aspC"
                     /locus_tag="SAR11_0279"
                     /codon_start=1
                     /transl_table=11
                     /product="probable aspartate transaminase"
                     /protein_id="AAZ21100.1"
                     /translation="MKLAKNLQRLGTESAFSVLAEAKKLEAQGKPMIHLGLGQPDFKT
                     PQHVVDAAKKALDEGHHGYVLSNGILECRQAVTRKIKKLYNKDIDPERVLIMPGGKPT
                     MYYAIQCFGEPGAEIIHPTPAFPIYESMINYTGSTPVPYDLTEDKDLKFDPEKILSLI
                     TDKTRLLILINPNNPTGSFVEKSAIDVLAEGLKKHPHVAILSDEIYSRQIYDGKEMPT
                     FFNYPDLQDRLIVLDGWSKAYAMTGWRMGWSVWPEELIPHVNKLIINSVSCVNAPSQF
                     AGIAALDGPDDAIHEMMVKFDQRRKLIHEGLNSLPGVECSLPGGAFYAFPKVIGTGMN
                     GSEFAKKCMHEAGVAIVPGTAFGKTCQDYVRFSYAASQDNISNALENIKKMLG"
     gene            complement(283684..284835)
                     /gene="ildD"
                     /locus_tag="SAR11_0280"
     CDS             complement(283684..284835)
                     /gene="ildD"
                     /locus_tag="SAR11_0280"
                     /EC_number="1.1.2.3"
                     /note="IldD"
                     /codon_start=1
                     /transl_table=11
                     /product="l-lactate dehydrogenase"
                     /protein_id="AAZ21101.1"
                     /translation="MNLKDCYNFNDFRKLAKKRLPSPIFHYIDGGADDEKTLKRNTDS
                     FDDCDLIPNILASVGKPDLSTTVFGKKIDMPIFLSPTAMQRLYHHEGDKASARAAEKF
                     GTFYSMSTMANNTIEEVADISNGPKLFQLYVHKDQSITDDLIDRCRVSGFNGMCLTVD
                     TLVAGNRERDHRTGFTTPPKLTLQSLMSFAMRPEWVFNYFTHKKFELSNVKNKTDKGT
                     NISKSVIEYINEQYDPAMNWKDAEYCVKRWNGPFALKGVMSIEDAKRAIDIGCTAIMI
                     SNHGGRQLDGSRSPFDQVNAIREAVGDKLEIILDGGVRRGTHVLKALAAGATACSFGK
                     MFLFALSAGGQPGVERLLQNMHDEINRNMVLMGCKTLKELDASKLIYRK"
     gene            complement(284844..285353)
                     /locus_tag="SAR11_0281"
     CDS             complement(284844..285353)
                     /locus_tag="SAR11_0281"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ21102.1"
                     /translation="MKHYKLISRFIFIIFFSLLSSVVYAEENSSKFNVYSGMFDFSDT
                     GKKSTLIGFQHQNEDLNRDTFLGNISPITGALVTADSAAYIYTGVQAQYKLGKINFTP
                     SFAPGLYSKGDGKDLGHILEFKSELQISVDFVSNSQLGFSYNHLSNASLGTKNPGANS
                     YMFNFFKTF"
     gene            complement(285354..285734)
                     /locus_tag="SAR11_0282"
     CDS             complement(285354..285734)
                     /locus_tag="SAR11_0282"
                     /codon_start=1
                     /transl_table=11
                     /product="Uncharacterized protein involved in biosynthesis
                     of c-type cytochromes"
                     /protein_id="AAZ21103.1"
                     /translation="MKVLKIFIILFVVANFSELKSAETNDILKNKILKNVRCLICQGQ
                     SVYDSESEFASSIKLIVDRKINEGLKEKQIYQFLREKYGDWVIFDPQLNKNTYVLWLL
                     PLLLFLFGGAIIYKKIILNKNNKI"
     gene            complement(285731..286252)
                     /gene="ccmG"
                     /locus_tag="SAR11_0283"
     CDS             complement(285731..286252)
                     /gene="ccmG"
                     /locus_tag="SAR11_0283"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytochrome C biogenesis protein ccmG"
                     /protein_id="AAZ21104.1"
                     /translation="MKNKFSLFVVVIFLSFCFVIFYKGLNTPNNYTPKVNEKKNIPTF
                     KAKDFYSNNYVNSEKIFEENIFYIVNIWASWCVPCRTEHPLLMQLSKNQSIKLIGLNY
                     RDNFNNAKKFINDLGNPYSRILIDKDGTLGVEFGAYGVPETFLIDKNKDIIKKFVGPI
                     NQEIVSEIKLIIK"
     gene            complement(286249..288126)
                     /gene="ccmF"
                     /locus_tag="SAR11_0284"
     CDS             complement(286249..288126)
                     /gene="ccmF"
                     /locus_tag="SAR11_0284"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytochrome c-type biogenesis protein"
                     /protein_id="AAZ21105.1"
                     /translation="MLANQIGYYSLILGLLLSVLLCGVSIKDFNKTNKQINQNILSLS
                     FLQLVFVIVSFLSLIVSFINSDFSNETVFNNSHTTKPLFYKISGTWGNHEGSLLLWLL
                     VLTLFIFLFLIKSREQPKKYRILTLLFQQIIIIGFFLFVLITSNPFNYLFPIPNEGLG
                     LNPILQDPALAIHPPILYLGYVGTSIIFSSSLAAVTQNYVTKEWGQHIKKWVLVSWIF
                     LTIGIMLGSIWAYYELGWGGFWFWDPVENVSLMPWLTLTALLHCIVVLERRASLTSWV
                     VILSITTFTLSMCGTFLVRSGILNSVHTFANDPARGIFILIFLFALIVLSLGIFFIFH
                     KENNKSSNNFFWLSRETSILINNWFMMYFLAVVLIGTVYPIFLDVISSEKISVGPPFY
                     HKLIVPFLIPFLLFMSLGPRLKWIKSKIENKNSLIITFIISVMLTFFIIKNLTADLLF
                     YTVLISAAFFLFFTTLKELFIKKFNNISQTVSHFGFSLLILSILFNSILSSEIITNIK
                     IGERYDYNKGEIFFKKVEERKESNFNSIIASFEIKDKNGKTIELKPEIRIYNQPIIIT
                     SEADIRTTLLEDKFLVMNLVKGNEYFNIRYQIKPFMVWIWVSVLLLSLGGLMSLFKKE
                     I"
     gene            complement(288128..288547)
                     /gene="ccmE"
                     /locus_tag="SAR11_0285"
     CDS             complement(288128..288547)
                     /gene="ccmE"
                     /locus_tag="SAR11_0285"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytochrome c-type biogenesis protein"
                     /protein_id="AAZ21106.1"
                     /translation="MYGKKVKLRFIFLALILASVILTVFLVLQSLKENVVYFQSPSEI
                     KSLIELNKKKIRVGGMVKEQSIFIDSDKVNFVITDFKNEINIVYTGAVPNLFAEGKGV
                     VAEGFLKDKNYFTATKILAKHDENYMPPEVKEALGDK"
     gene            complement(288558..288785)
                     /gene="ccmD"
                     /locus_tag="SAR11_0286"
     CDS             complement(288558..288785)
                     /gene="ccmD"
                     /locus_tag="SAR11_0286"
                     /note="CcmD"
                     /codon_start=1
                     /transl_table=11
                     /product="Heme exporter protein D"
                     /protein_id="AAZ21107.1"
                     /translation="MINEIISMNGYGAYVWSAFSFTLISFTALYFVTKLQLSKEQKRF
                     ASKFGSLNVEKARAARSQNINREILSNTSNI"
     gene            complement(288782..289492)
                     /gene="ccmC"
                     /locus_tag="SAR11_0287"
     CDS             complement(288782..289492)
                     /gene="ccmC"
                     /locus_tag="SAR11_0287"
                     /note="CcmC"
                     /codon_start=1
                     /transl_table=11
                     /product="heme exporter protein"
                     /protein_id="AAZ21108.1"
                     /translation="MFKYFEPNKIFAITSKAPKYVLFLFIIVLTIGLTEALILSPEDY
                     KQSDAVRIMYVHVPAAWISLGIFTSLAFLSVGSFVFKNKNFALIAKSLAPSGFIFNII
                     ALGTGSIWGKPTWGTWWAWDARITSMLILALFYGMYLLAWRIYEDKEQVIKVTSLIAI
                     LGVVNVPIIKFSVDWWNTLHQPASINILSTNTAIHPSMLVPLGIMTAAFALFSLLIFL
                     MKYNTELIKVKNKGLDRL"
     gene            complement(289675..289995)
                     /gene="ccmB"
                     /locus_tag="SAR11_0288"
     CDS             complement(289675..289995)
                     /gene="ccmB"
                     /locus_tag="SAR11_0288"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAZ21109.1"
                     /translation="MAIQKAKFSIGDIVKHKHFEFRGVIYDVDFEFNNSEEWYQSIPK
                     NVRPRKDQPFYHLLAENDEITYEAYVSEQNLLMDDSEDPIKHPLIEEIFSGKRGSSYF
                     KPSN"
     gene            290074..290625
                     /gene="yciB"
                     /locus_tag="SAR11_0289"
     CDS             290074..290625
                     /gene="yciB"
                     /locus_tag="SAR11_0289"
                     /codon_start=1
                     /transl_table=11
                     /product="intracellular septation protein A"
                     /protein_id="AAZ21110.1"
                     /translation="MNKSFLKFATDFGPLAIFFYYYYNNDKNLAVAIPPLIVATLTAL
                     AVVWFFEKKIPMMPLISGILITFFGGLTIYFDDPVFIYVKPTIINILFALALYFGKYF
                     TKEPVLKKIMGKSIALTDMGWELLNKRWMYFFFFLAILNECVWRTQTEEFWVNFKVWG
                     MLPITLVFTAFQISLINKYKLDE"
     gene            290618..290962
                     /locus_tag="SAR11_0290"
     CDS             290618..290962
                     /locus_tag="SAR11_0290"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAZ21111.1"
                     /translation="MNRNLKLVVNNPHKQIEERQFFEKNELKIILDLYAKMVSEGSWK
                     DYGLNISNRQVSFSVFKNAAENALYKICKNFKPSNKNLKYLITDSNGKVLKNSFDLEI
                     LLKNTNWKNLKK"
     gene            complement(290968..291666)
                     /gene="ybhL"
                     /locus_tag="SAR11_0291"
     CDS             complement(290968..291666)
                     /gene="ybhL"
                     /locus_tag="SAR11_0291"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein"
                     /protein_id="AAZ21112.1"
                     /translation="MDEGLRAYMLKVYNYMASGILLTGLISLIFFKLSVVTDANGSIT
                     ALTSLGNTIFLSGFKWIVMLAPLGVVFYMSARINKMTASTAQTTFWVFASLMGLSLSS
                     IFLVYTGASITRVFFITSITFGAMSLYGYTTKRDLTKLGSFLMMGLIGIIVASVVNMF
                     LKSSMMDFVISILGVLIFVGLTAYDTQKIKNMYVSSDTGELMGKKAVMGALTLYLDFI
                     NLFIMLLRLFGQRR"
     gene            291790..292827
                     /gene="tas"
                     /locus_tag="SAR11_0292"
     CDS             291790..292827
                     /gene="tas"
                     /locus_tag="SAR11_0292"
                     /codon_start=1
                     /transl_table=11
                     /product="probable aldo/keto reductase-family protein tas"
                     /protein_id="AAZ21113.1"
                     /translation="MNYKKLGNTDLKVSTICLGTMTWGEQNTQNEGFEQMDYALDQGV
                     NFWDTAEIYSVPPRQETFGHTETIIGNWFEKTKKRDKVILASKVCGPMREYVRGGGNQ
                     FGEKNITEALEGSLKRLKTDCIDLYQLHWPERKTNFFGKLGYEHDDSNEWTRFEDILG
                     NLKKFIDQGKIKYVGVSNETPWGLSKYLELSKDKNLPRMLSVQNPYNLLNRTYEIGLA
                     EMSIREQAGLLAYSPLACGYLSGKYRNKQLPKNSRMERDGDFWSRYNNQNAEKAIELY
                     YEISKKHNLDLAQMSLKFLEIQPFVTSVIIGATTMEQLKTNIESIGIDLSEDVIKEIN
                     EVQKIYPNPCP"
     gene            292818..293324
                     /locus_tag="SAR11_0293"
     CDS             292818..293324
                     /locus_tag="SAR11_0293"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAZ21114.1"
                     /translation="MSIIKNFIILILVSLFAVSVNSQEVKKVGKFKDWETIIITEQTG
                     KVCFAQSVPVLQAPKSNPREARMFVSFRPAEKINDEISVTGGYEFNNQNSIIATSGKS
                     KYKFDIAQEGFAWIADNKLENKMIKTMKKGSRIMITGHNQKGSQTIDHYSLLGFTKAY
                     NAAKTSCS"
     gene            293329..294516
                     /gene="argG"
                     /locus_tag="SAR11_0294"
     CDS             293329..294516
                     /gene="argG"
                     /locus_tag="SAR11_0294"
                     /EC_number="6.3.4.5"
                     /codon_start=1
                     /transl_table=11
                     /product="Argininosuccinate synthase
                     (Citrulline--aspartate ligase)"
                     /protein_id="AAZ21115.1"
                     /translation="MKSKKKIVLAYSGGLDTSIILKWLQENYDAEVICYTADVGQEID
                     RKKIIKNAKRLGVKNIIIEDLKDTFVKDYVFPMIRGHAIYEGVYLLGTSIARPLIAKR
                     QIAAAKKFGAYAVSHGSTGKGNDQVRFELGYHYFGPKVKIIAPWRIWKLNSRTDLIKY
                     AKKNNIPIPTDKKGAPPFSIDDNLYHTSTEGKVLENPKNSAPEFLFQRTVSPEKAPNK
                     ASFVTIGFKNGDPITVNGKKLSPGNLLEKLNNVAGKNGIGRVDLVENRFIGIKSRGVY
                     ETPGGTLLMSAHRAIESITLDKETMHKKDEIMPKYAELIYNGYWYSKARFKLQKIVDL
                     KKNKVNGSVKLKLYKGNITIMSRQTKSNAYSMKKVSFEENKTFNKSNVERFINFHKQK
                     LRS"
     gene            294521..295138
                     /gene="frnE"
                     /locus_tag="SAR11_0295"
     CDS             294521..295138
                     /gene="frnE"
                     /locus_tag="SAR11_0295"
                     /codon_start=1
                     /transl_table=11
                     /product="Predicted dithiol-disulfide isomerase involved
                     in polyketide biosynthesis"
                     /protein_id="AAZ21116.1"
                     /translation="MKIKVFADTICGWCFIGQTRLNKALKNFPETKFEIEHVPFQLNT
                     DMPKEGIERNKYLEIKFGGKEFAQPMYDRMTEEANKENLNFNLDKIKKTPNTVFSHLL
                     IKLAEQSNVHNEIKEKIYQSYFIEGLDIGDKEILINIGKEFNINGDTINDFFNLKNIE
                     EINSYILVAREKEINGVPFFEIGTDFISGAQSSANLESVIKSNLS"
     gene            295195..295653
                     /locus_tag="SAR11_0296"
     CDS             295195..295653
                     /locus_tag="SAR11_0296"
                     /codon_start=1
                     /transl_table=11
                     /product="possible transmembrane protein"
                     /protein_id="AAZ21117.1"
                     /translation="MEALKNWMKDAANILFDDSKNDLRSLPRSVRLQILLVLSFVWTT
                     VFSLYIFSYTTFAFGWAGLYVAHIGLIFAVYMTFKHFHKAEAQSSSVFKTKNFDPFKI
                     MVIVFVIVFIFVFSKGIEILTSPNPSSYSIPYDGPVKSVFEKWLPFSKDK"
     gene            295653..296033
                     /locus_tag="SAR11_0297"
     CDS             295653..296033
                     /locus_tag="SAR11_0297"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphate-starvation-inducible E"
                     /protein_id="AAZ21118.1"
                     /translation="MDKIAKILQLALMCIILVSTVIAVGMEINNMFLNQSVMLADLLL
                     MFLYLEVLAMVRVFWNQQSISITLPLLIAITALARFIILQGKEMDPSALVYEAIAIVL
                     IASAIVILRLRHSDKLGLKKRKSK"
     gene            296040..297182
                     /locus_tag="SAR11_0298"
     CDS             296040..297182
                     /locus_tag="SAR11_0298"
                     /note="possible blue light photoreceptor cryptochrome"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA photolyase-like protein"
                     /protein_id="AAZ21119.1"
                     /translation="MIFEASRAKAVDKLNTFVEQNLSDYSKLRNFDFGPSNRSNVSCL
                     SPYITHGIINELEVINKSLKKFSFANNEKFIQEVLWHVYWKGWLELRPDVWSDYLIEL
                     DKIKKEFKNNQSYLDATEGKTNVDCFNQWVSELKENNYLHNHTRMWFASIWIFTLELP
                     WQLGAEFFMQHLYDGDAASNTLGWRWVAGIQTQGKHYLASEWNINKFTNNRFKNIKLN
                     ENAKPISNDKIYSVISKGFKNSEILEDKTLLIFENNMTFEFSDFKEHKFKKILLVSNK
                     TDRTIKLSEKVLKFKANLLEDQKIRLKEKSINCETINTNDLKNITEEVYALYPTVGEN
                     LNFIQNNQLKNIRFLYRKLDQFSWQYCNKGFFNFKNYIPKIIANFN"
     gene            complement(297179..297400)
                     /locus_tag="SAR11_0299"
     CDS             complement(297179..297400)
                     /locus_tag="SAR11_0299"
                     /codon_start=1
                     /transl_table=11
                     /product="possible transmembrane protein"
                     /protein_id="AAZ21120.1"
                     /translation="MNNKFFEWAGVITAILYSMFVALNIGIEFLGFCLLLLSAILIGI
                     WAYRGGHKGILVLQFFYATAGIIGMIRWF"
     gene            complement(297397..298116)
                     /locus_tag="SAR11_0300"
     CDS             complement(297397..298116)
                     /locus_tag="SAR11_0300"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutamine amidotransferase class-I"
                     /protein_id="AAZ21121.1"
                     /translation="MNIIVLQHIKIEDPGYIKDLMLADGFNLTTIELDEGEKIPSDLR
                     KFDGMFCMGGPMDTFMEQEYPWLIEEKKAIKEFVVNLKKPYLGFCLGCQLLGEVIGGK
                     VVKSNPAEIGIMDINFTKEKKEDILFSKFPDQIKSLQWHSYEVQGIDNNKDVTLLASS
                     PITKYQIFKYQNHAYAIQFHIEIKDTTVNEWGCVPEYKKALESQLGEGALDKFDQAAK
                     NNMPDMNNYSKILYENFKRLL"
     gene            complement(298160..298768)
                     /gene="marC"
                     /locus_tag="SAR11_0301"
     CDS             complement(298160..298768)
                     /gene="marC"
                     /locus_tag="SAR11_0301"
                     /codon_start=1
                     /transl_table=11
                     /product="marC family protein"
                     /protein_id="AAZ21122.1"
                     /translation="MLEIFIQTFFLYFIVIDPLGNTPLFLAVTQNMSSQQRVKTALSA
                     TIIASIILLFFAFLGSTLLNYLNISFPAFTIGGGIILLIISMEMLFDKRQQRKEDDID
                     FNSENVSVFPLATPIIAGPAAITSVIVSVSDMGSNFTNQSVGMIALASVLLLTFIFFF
                     TASKFSQIINKKVISVISRVIAIILVGLSVQYILDGIKTFLA"
     gene            complement(298810..299223)
                     /gene="yqaA"
                     /locus_tag="SAR11_0302"
     CDS             complement(298810..299223)
                     /gene="yqaA"
                     /locus_tag="SAR11_0302"
                     /note="DedA family, yqaA"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="AAZ21123.1"
                     /translation="MIYLSLFAISFLAATILPFSSELTLAGLIATSNFDSLLLLIVAS
                     FGNILGSVVNWVLGFYSRNLSTKKWFPFKDKQIESSSKWFNKFGKWSLLFAWVPIIGD
                     PLTLVAGLLRVRFLDFIILVAIGKVSRYVLIYYLF"
     gene            complement(299342..300832)
                     /locus_tag="SAR11_0303"
     CDS             complement(299342..300832)
                     /locus_tag="SAR11_0303"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribodipyrimidine photolyase-related
                     protein"
                     /protein_id="AAZ21124.1"
                     /translation="MKLFFILGNQLFPLKYVDRFKKDHSFYMAEDYELCTYEKHHKQK
                     ILLFLSSMRSYADMLRANKYKLEYSKIEDKGFKDTYFKKLKIIINQKKITEISSFEVE
                     DKSFEKKISQFLKKEKINWNIVQTPMFLNSRDEFKNYLVKSKKPFMATFYKEVRKKSG
                     ILMGADGNPIGGKWSFDEDNRNKLPKDISIPKFPKINETNHTKKLKPIIEKLFKDHPG
                     STNDFWLATEYNDVVKLLDFFIKEKSNLFGDYEDAVNQKDNILFHSALSPYINLGLIT
                     PEIIIQKILEFHKKHKIRMNSLEGYIRQIIGWREFMRGIYQGYSDEMETKNFFNHERK
                     MKKSWYEGTTGLPPLDHAIKNAVNHGWSHHIERLMILSNIMNLCEVKPTIVYKWFMEM
                     FVDSSDWVMVPNVYGMGLFSDGGIFATKPYICGSSYFMKMMDFKKGEWCNTMDGLYWR
                     FINKNRKFFLKNPRLSMMVYVFDKMKDERKKMILSEADKFIKQNTI"
     gene            300899..301570
                     /locus_tag="SAR11_0304"
     CDS             300899..301570
                     /locus_tag="SAR11_0304"
                     /note="unknown specificity"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase"
                     /protein_id="AAZ21125.1"
                     /translation="MGSSLAEQLKNSGNDIHLIARNENEVKTIAEKLGCTYTVADVLE
                     EGFIEKVKSDISEIKGIAYCVGSIDLKPLRMVTEADMNKCMKLNLYSAIEAIKGFQES
                     LKKNKGSVVLFSTVAAQRGFTNHTIIASAKAAVEGLTVTLAAEFAPHIRVNCIAPSLS
                     KSKIAEPMLKNPAIAEGIAKAHPLKRLGEGKDSAALAKFLITEESSWITGQIIAVDGG
                     RSKLS"
     gene            301545..302636
                     /gene="yliI"
                     /locus_tag="SAR11_0305"
     CDS             301545..302636
                     /gene="yliI"
                     /locus_tag="SAR11_0305"
                     /EC_number="1.1.5.2"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose dehydrogenase (pyrroloquinoline-quinone)
                     precursor"
                     /protein_id="AAZ21126.1"
                     /translation="MVVDQNFLKVKKYFLLIIFFLLFASKSYSNNYTFTKIIELDEPW
                     GSSFINNDEIIITEKSGKIKIVNIISKEVTEIKHNLNFLEVGQGGLLDIIHQDNTLWI
                     SYSEDRGNLKTSTSIAKAQLNKQELNFKNIFQANPPIDSGYHFGSRLAIKDNYIYASA
                     GERGQGMIAQDPTKHPGSIIRIHTDGRIPKDNPKFTGKPDWLPEIYQIGVRNPQGLTL
                     SDYDGKIYLSNHGARGGDWFGEAKKGENYGWKILGWGGKNYSGIPIGPKWKPGFTKAI
                     QYWVPSIATSAITIYRGNEFKEWNGHALVTSLKDRSLRKLIFNDPTNVKENVIFKDNV
                     GRIRDIQVHPSNGKIFFLSENALWLMEKK"
     gene            complement(302639..303691)
                     /locus_tag="SAR11_0306"
     CDS             complement(302639..303691)
                     /locus_tag="SAR11_0306"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein SC5C7.08 SC5C7.08"
                     /protein_id="AAZ21127.1"
                     /translation="MAKFIIFIFIIIAYNSSLIAMEKKPYHHLPDGTFRNPEGSPVRT
                     SQAKFSYTQFIKLKKKIDMTVPKEHVVDKEKVLTDLEKYKNEDYIAWIGHATYLIKLG
                     DTTIITDPVFSKNAGPLIFGPDRFTEPALNLNEIPKTDLLLLTHNHYDHQDMGTIRKY
                     PFKNTKVLAPLNLGKYFTKNKFKDVNEMDWYEEIQVNDDLKVTLLPAVHWSKRSLTDM
                     NKTLWGNFLIEYKGKKILFACDTGYGNIYKELGEKYGPIDLTMINIGAYDFKPMFDKS
                     IYHTTPEEALNVAKDLRSKKVMGTHWGTFVLSLEPIMEPPVRFKASAEEYGFKKDDAI
                     IFKIGEINSLKNILTN"
     gene            complement(303706..304551)
                     /gene="folD"
                     /locus_tag="SAR11_0307"
     CDS             complement(303706..304551)
                     /gene="folD"
                     /locus_tag="SAR11_0307"
                     /EC_number="3.5.4.9"
                     /codon_start=1
                     /transl_table=11
                     /product="methylenetetrahydrofolate dehydrogenase"
                     /protein_id="AAZ21128.1"
                     /translation="MILIDGKKIAAELREQLRQEVVELKAKHNKIPGLTVILIGEMAP
                     SQIYVRMKEKAANEVGLKSEVIRYPEAVEEKTVLDKIEELNKDESISGILVQLPLPKH
                     IDKQKVIETILPGKDVDGFHPMNVGNLSSGYESSVPCTPLGCYLMIKKIEPNLSGKKA
                     VMIGRSNLNGKPMAQLLLKENCTVTITHSKTKDLKAECLEADIIVAAVGIPELVKADW
                     VKKDAIVIDVGINKTENGIVGDVAFEEVSKVARALTPVPGGVGPMTIACLLKNTIECF
                     KRSQK"
     gene            complement(304560..304850)
                     /locus_tag="SAR11_1722"
     CDS             complement(304560..304850)
                     /locus_tag="SAR11_1722"
                     /note="similar to Rhodopseudomonas palustris CGA009
                     gi|39647338|emb|CAE25859.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Family of unknown function YGGT"
                     /protein_id="AAZ21129.1"
                     /translation="MIAIFYLVLQILKLYSYVVIANVVISWLVAFNVLNTQNRFVYSI
                     LEVTYRLTNPALNKIRSFLPNLGSIDISPVILLLLIWFIEMCMKLYIAPMIF"
     gene            complement(304847..305932)
                     /locus_tag="SAR11_0308"
     CDS             complement(304847..305932)
                     /locus_tag="SAR11_0308"
                     /codon_start=1
                     /transl_table=11
                     /product="Mechanosensitive ion channel"
                     /protein_id="AAZ21130.1"
                     /translation="MDIFNNFSDLFFSVWSKGIHGIDIFQILIGIGIFFIFLIFRGII
                     SKVIIKRLESISKRTTNKLDDTFVHAMVGPARFLPIVLGFFIASYYMSFGEDGKVAID
                     TINRTLITIFIFWVIHQIVEPISYILSGLDKMLTRELIGWIIKSLKILIFILGLAAVL
                     ELWGIKIGPIIAGLGLFGVAVALGAQDLFKNLISGILVLVEKRFKIGDWILVEGTIEG
                     IVEKIGFRSTVIRKFDKSLAIIPNFQFAENSVVNISETTNWRIRWSITLQYDTTVAQL
                     KKVREEIENYINKSEDFSQSVGVAVRIEKFSDSSIDLLVRCFTASNSWSDSLLVKERL
                     AIAIKEIVEGNKASFAFPSQSIYIEKK"
     gene            complement(305935..306633)
                     /gene="hemD"
                     /locus_tag="SAR11_0309"
     CDS             complement(305935..306633)
                     /gene="hemD"
                     /locus_tag="SAR11_0309"
                     /EC_number="4.2.1.75"
                     /codon_start=1
                     /transl_table=11
                     /product="Uroporphyrinogen III synthase HEM4"
                     /protein_id="AAZ21131.1"
                     /translation="MHILFTRPLEDCHEMILKFQSLGHEISHLPLINIEGLKYEAPNY
                     SEFKAIIFTSANAVKFLDIKNIDKKLKCFCVGSATEKKARSVGFQNVFAAEGNVSNLK
                     ELILQNFKPSDGKLIYISGEIISSDLDKELISSGYTIERLINYRANPIEKYDESFIEK
                     LKLKMPEITYIYSQNSAINFLKVIKNYQLETLWMNTNLMCIGEKTSSILNEIKWKKIF
                     LFNPGEEEFLLYKI"
     gene            complement(306635..307558)
                     /gene="hemC"
                     /locus_tag="SAR11_0310"
     CDS             complement(306635..307558)
                     /gene="hemC"
                     /locus_tag="SAR11_0310"
                     /EC_number="2.5.1.61"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylbilane synthase"
                     /protein_id="AAZ21132.1"
                     /translation="MKNRKIIIGSRGSKLALIYAEKAREKILKHSKDFGIEEVIIKEI
                     VTKGDQVQDKRLSEVGGKGLFSKTIEVELLEKKIDIAVHALKDMPSEETRGLLTDCFL
                     ERNDPREILISKDNKHLKDLASNSIIGTSSYRREFQIKKIRDDLNCKLIRGNVDTRIR
                     KLKENLYDAIILSYAGIDSLGLNQNISQTFSTSEIIPCAGQGVIALQCRDNDESLIEL
                     LKQVDHQSTHSSIKAERNVLKVLEGDCETAVGAFANIEGNKINLEVELFSLDGSKRFY
                     LKSSESVNKAEELGIEMGKTLKKMSNNSYKK"
     gene            307618..308691
                     /gene="ygjD"
                     /locus_tag="SAR11_0311"
     CDS             307618..308691
                     /gene="ygjD"
                     /locus_tag="SAR11_0311"
                     /EC_number="3.4.24.57"
                     /codon_start=1
                     /transl_table=11
                     /product="O-sialoglycoprotein endopeptidase"
                     /protein_id="AAZ21133.1"
                     /translation="MNKKPIILGIESSCDETAASIITENEQGMPTILSSIVSSQVDVH
                     KEFGGVVPELAARSHMEKIDLITKKAFDKSGVKMEDLDAIAATAGPGLMVCLSVGLSF
                     GKAMASSLNKPFIAVNHLEGHALSPKLNSELNYPYLLLLISGGHTQFLSVQGLGNYKR
                     LGTTIDDAVGEAFDKTAKLLGIEFPGGPQIEVYAKKGDPNKYELPKPIFHKGGCNLSF
                     AGLKTAVLKISKQIKTEQEKYDLAASFQKTIEEILYKKSKIAFEEFKKMNTINKNKFV
                     VAGGVAANKRIREVLTNLCKEEEFEAIFPPINLCGDNAAMIAMVGLEKFKLKQFSELD
                     SPAKPRWPLDADAAFLKGAGVRL"
     gene            308772..309617
                     /locus_tag="SAR11_0312"
     CDS             308772..309617
                     /locus_tag="SAR11_0312"
                     /EC_number="2.8.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="potential Sulfotransferase domain"
                     /protein_id="AAZ21134.1"
                     /translation="MIIWIASYPKSGNTYLRSFLASYYYSEDGNFNFDQLLKIHQFPN
                     IKFSKFDPKTNEEASKNWMFNQNTFFSKNKLNLVKTHNCLYPYEGNNFTSKNQTLGAI
                     YVVRDPRNLITSLTHHYVIGYKEAIEKMSDENSSLLEKSHDNDYSNFTYLSSWSNHYK
                     SWKNNSEFKTLFIKYEDLRKNKIEIFKKIIFFINEVTGDNKKIDEQKFYNSIKTTSFS
                     NLKNKELNEGFEESVYSKKTGKKINFFNLGFNNRWQKILPLEIKNQINEIFKKDLHEL
                     DYPYV"
     gene            309643..310056
                     /locus_tag="SAR11_0313"
     CDS             309643..310056
                     /locus_tag="SAR11_0313"
                     /codon_start=1
                     /transl_table=11
                     /product="Uncharacterized conserved protein"
                     /protein_id="AAZ21135.1"
                     /translation="MNYWLMKSEPDVWSIDQQKKAGAKGAPWDGVRNYQAAKNLRAMK
                     KGDLCFFYHSNIGKEIVGTVEVIKEAFLDKTDKDGRFVAVQVKFKEKLRKSVTLEEIK
                     KTKSLSHLSLIRQSRLSVMPIDSKSWKILNKMSSI"
     gene            310070..312115
                     /gene="acsA"
                     /locus_tag="SAR11_0314"
     CDS             310070..312115
                     /gene="acsA"
                     /locus_tag="SAR11_0314"
                     /EC_number="6.2.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA synthase"
                     /protein_id="AAZ21136.1"
                     /translation="MPKKKSISKAKKKTSKKTKAKKKVKPFIKKVLKKIEEKELIIKT
                     KPEWVKSALVNKAKYQKKYSDAIKKNDDFWKNEGKRITWIKPYKKIKNIKYSKKEVKI
                     KWYEDGTLNASANCIDRHLKDKKDKTAIIWVGDDPKDTKKISYKQLHNEVSKAANGLR
                     KLGIKKGDRVTIYLTMIPELAVTMLACARIGAVHSIIFGGFSADSISGRVNDCESEYI
                     ITADEGVRGGKTIPLKQITDEALRSCPNVKKCIVVKRTGNKVSWVKGRDVWFDDLIKD
                     MSTKCEPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYMVYASMTHQYIFNYKPKDVY
                     WCTADIGWVTGHSYIVYGPLANGATTIMFEGIPTYPDSSRWWQIIDKYKVNIFYTAPT
                     AIRALMREGDKPVKKTSRKSLKLLGTVGEPINPEAWMWYYKTVGNSKCPIVDTWWQTE
                     TGGILISPQTGAMNLKPGSASKPFYGIKPSIVDKDGKEIKGAGEGRLCISQSWPGQMR
                     TVYGDHQRFIDTYFSQFDGKYFTGDGAKRDKDGYYWITGRVDDVIIVSGHNLGTAEIE
                     SAFVAHPKVAEAAVVGYPHDIKGNGLYCYVTLNVGEKSDLDLERDLKLWVRKQIGALA
                     TPDIIHFSPGLPKTRSGKIMRRILRKIAANEHDQLGDTTTLADPSVVQSLVDNRKNI"
     gene            complement(312112..312735)
                     /locus_tag="SAR11_0315"
     CDS             complement(312112..312735)
                     /locus_tag="SAR11_0315"
                     /codon_start=1
                     /transl_table=11
                     /product="potential esterase"
                     /protein_id="AAZ21137.1"
                     /translation="MQKYKLSWKDISFDDFKVYLFAMFRAFIPKKKIKNLDELEHFIQ
                     TKSAWVTQVTLYSYLKTRMGTRYVLHFDNDVFMASLDIARWNIYSVALQDLTLFTFSY
                     LKVNFNYQNLDQSKEIFSKILDDEISNKMPLDIIEEAKKTFNERLQNINWEIYYKDLP
                     FNPSALSLYEWAPIAEELKTLDRKIVLNSMILKWDIIKKEFEKLIEF"
     gene            312873..313133
                     /locus_tag="SAR11_1723"
     CDS             312873..313133
                     /locus_tag="SAR11_1723"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function (DUF997)"
                     /protein_id="AAZ21138.1"
                     /translation="MSNATKHWEKTRSLLFVTLAIWFVFSIGIFLFAAEMNEVTGPFG
                     YPWTYWFTCQGSLGIFVILCFWFANRQEKIDEEFGFNERGDQ"
     gene            313133..314941
                     /gene="yjcG"
                     /locus_tag="SAR11_0316"
     CDS             313133..314941
                     /gene="yjcG"
                     /locus_tag="SAR11_0316"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/solute symporter (Ssf family)"
                     /protein_id="AAZ21139.1"
                     /translation="MIKGKFIDNLPKVYGIYTGGFIGFIILMAIGEQMGMTAKAIGVA
                     FVAFTIFIYALIGYLSRTAQADAYYVAGRQVPTVFNGMATAADWMSGASFVAMAGGIY
                     FKGYGYMALLVGWTGGYILVATLLAPYLRKFGCYTVPDFVGTRYGGNLARLCAVIVLT
                     VASFTYVTAQINATGTIASVALDIDFKYAVYIGLISILLCSMLGGMRAVTWTQVAQYI
                     VLIIAYLLPIFWISNKMGAGFFPHFMLADEVARIGELEQQFGFVKNSAADLATVPKGL
                     AGITKAHSAVNATPWAFISLALAMMMGTASLPHVMMRYFTTPSVKAARKSVGWSLFFI
                     FLLYSSAPMLATLSKLSLIDPTLPTGIIGKSFAEVQSIDWFQNWNQANLMFISDFNGN
                     GTLELNEFFMGGKAVVLATPEIAGLPYVISGLVAAGGMAAAMSTADGLILAIANAISH
                     DVYYKMIDPKAETAKRLLVARVLLVIIGFAGATIAAMEIQGILGSVIWAFDFAMSGLF
                     FPLVLGVWWKRANREGAIAGMVLGLGSAIWYLVWVRNGGSGFLGLTQLTFGIFGAAVS
                     FVSMVVVSLMTQEPDKSIQKMVDEVRIPSGKTVTGK"
     gene            315020..315376
                     /locus_tag="SAR11_1724"
     CDS             315020..315376
                     /locus_tag="SAR11_1724"
                     /codon_start=1
                     /transl_table=11
                     /product="YGGT family"
                     /protein_id="AAZ21140.1"
                     /translation="MSANFHPLIYFIDYLFGMIMWTLIGRVAMNIFQKEDSEFFFMKI
                     FVKYTDPLIKIFKPITPSFIIGPLVPLYVAWFFYMIRFYFMPWVLGYSVMGMLSFPLE
                     SEISKQIYQLFNSIKF"
     gene            315405..316064
                     /gene="rpe"
                     /locus_tag="SAR11_0317"
     CDS             315405..316064
                     /gene="rpe"
                     /locus_tag="SAR11_0317"
                     /EC_number="5.1.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribulose-phosphate 3-epimerase"
                     /protein_id="AAZ21141.1"
                     /translation="MKKIQISPSILSADFSQLRNEIKRLEEGGADMIHVDVMDGHFVP
                     NLTMGPPIIKSLRKFTKLPFDVHLMISPVHKYIKDYADAGADIITIHPEATENLAVSI
                     DHIKSLGKKVGVSLNPESKINLITDLLNQIDLVLIMSVNPGFGGQKFMPEVLEKIKEL
                     KKIRDQKNIDFDIEIDGGINFDNNKLAIEAGANILVSGTTIFKNNNGDIKKNIDLLKS
                     S"
     gene            316069..317679
                     /locus_tag="SAR11_0318"
     CDS             316069..317679
                     /locus_tag="SAR11_0318"
                     /codon_start=1
                     /transl_table=11
                     /product="Conserved hypothetical protein"
                     /protein_id="AAZ21142.1"
                     /translation="MILNNSFSLIKKKIRHFYLNSYLYNKKITPSSIELLEYQPSPSL
                     LDGLIKYDKKKINIENYSLNEIWDNPNLKEKDQQNLNSFFWLFSLDLRSSKKDTQNVI
                     NQWINTNDRYNSKNWKIDIIGKRIIAWISNSRLTYEDGNIDYKDKFNGTIKKQINHLI
                     NEIETSELIDNKIIGCAAIILTGLSYPQNNNYLNTGLSLLKKLAKYSLDNDGFPKSRN
                     IRQLSFYLKYFILIREWFKESQNEIPDFINENIYYLGQAYAFIWQNNKIDFLFNGNHK
                     TNNHNFDLYLKRLGYNFKNQNNELGGYVVLNNKKNSLIMDIGSSPNKKLSSDYQAGAL
                     SFEIISNNKKLISNCGYFQKIDHQLNEISKSSAVHSTLILDDKSSCNFNKVRGKKSKI
                     NQELRILKKKVVFEKNYWKINASHDGYSKPLGIVHDREIEFYPEQLKFIGHDKIISNK
                     GIKNLKFDIRFHLEPNIRLMKTQDEKSILIDLDGEGWKFSSENSKINIEEGLYFGEKN
                     SFTNNQNIFISGMTNEENQTIRWEITKL"
     gene            317679..319214
                     /gene="purH"
                     /locus_tag="SAR11_0319"
     CDS             317679..319214
                     /gene="purH"
                     /locus_tag="SAR11_0319"
                     /EC_number="2.1.2.3"
                     /EC_number="3.5.4.10"
                     /codon_start=1
                     /transl_table=11
                     /product="Bifunctional purine biosynthesis protein"
                     /protein_id="AAZ21143.1"
                     /translation="MKKIKKALISVSDKKDLGSLLRVLAKYKIELISSGGTFKEIKKL
                     KFKCQEVSEYTGSPEILGGRVKTLHPKIHAGILSKRNDKSHTKELKANQYDEIDLVIV
                     NFYPFEKTLDQTTNHSKIIENIDVGGPTMVRAAAKNYNDVTVITSSDQYETLINELEN
                     NKGSTSIEFREKMSLEAFSETAYYDAVISNYFNKIKKNNFPKKKIIYGNLIEKLRYGE
                     NPHQEAAIYSKTQNLNIKQIHGKQLSYNNYNDIFSALTISKSLPKNSGTVIVKHANPC
                     GVSINKNSLKSYKLALASDPVSAFGGIVSCNFKINKTLALELNKIFLEVIIANGFQAD
                     ALKILKKKKNIRIIDASEFMMKDLIRFGSVNESILTQSEDLKVFEPKDFKVVSKLRPN
                     KSQLKNLIFAFNVCRYVKSNAIVLASQEATVGIGSGQPSRLDSCQIAIDKMNKFQNLK
                     EDIVAASDAFFPFVDGIEKLVQSGVSAVIQPSGSIRDKEIIKFANQTGTILVFSKTRH
                     FRH"
     gene            complement(319204..319548)
                     /gene="phhB"
                     /locus_tag="SAR11_0321"
     CDS             complement(319204..319548)
                     /gene="phhB"
                     /locus_tag="SAR11_0321"
                     /EC_number="4.2.1.96"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative pterin-4-alpha-carbinolamine
                     dehydratase"
                     /protein_id="AAZ21144.1"
                     /translation="MSDLLNKKCVPCEGGILPFDISEIHKYQKKVDGWDVKKNTKEIY
                     FLEKNFIFKNFVNSQNFINKVGEISENENHHPDISFGWGYAKIIITTHAIEGLSENDF
                     ILAAKIDQIFNV"
     gene            319571..319645
                     /locus_tag="SAR11_tRNA_r_28"
     tRNA            319571..319645
                     /locus_tag="SAR11_tRNA_r_28"
                     /product="tRNA-Gly"
     gene            319743..320384
                     /locus_tag="SAR11_0322"
     CDS             319743..320384
                     /locus_tag="SAR11_0322"
                     /note="similar to the N-terminal domain of Lon protease"
                     /codon_start=1
                     /transl_table=11
                     /product="Uncharacterized protein"
                     /protein_id="AAZ21145.1"
                     /translation="MKKQDLPKTIPVFPLSNFIIFPHTTVPLNIFEPRYIEMINDSMK
                     TNKMIGLIQPKNNDDSSIPGLHKVGCLGKITNFKDTSDGRYMIDLNGITRFEVTKEIK
                     SSKPYRICETTYDNFELDLTSEKKKLKLSDLEPIFKDLKLLFEKKGYIINWKSLEKQD
                     LNETINALAMASPFSLEEKQILLESKNLEARKDKISEILSTYSFDDFHNTTIQ"
     gene            complement(320387..321520)
                     /gene="ubiH"
                     /locus_tag="SAR11_0323"
     CDS             complement(320387..321520)
                     /gene="ubiH"
                     /locus_tag="SAR11_0323"
                     /EC_number="1.14.13.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative ubiquinone biosynthesis monooxgenase
                     COQ6"
                     /protein_id="AAZ21146.1"
                     /translation="MYHLIFIVKIKIIMNVCIIGEGLTALSLAKSLINKKINVHYYYK
                     SKNSNFSSNRTIGISKSNFEFFKEKIFQISKNNYWKINRIEIYTDKIDTENLLKFEND
                     KNDLFYIIKNDELLKSLNSNLIKNKFFKKIILSKNINEEFLNKKGYDLIINCDANNFL
                     AKKYFTKKISKNYYNLAYTTILKHKKIENNTATQIFTKQGPIAFLPISSTETSVVYSM
                     DIKNKKFDNSDVIDLINKNNPKYLINKIDKLNSFELSSSNLRNYYHKNILAFGDMLHR
                     VHPLAGQGFNMTIRDLRILTKIIEDKIELGMQLDSQIFDEFEKKTKDKNFVFSKAIDL
                     IYESFNLDKKVQNKSFSKIIKNIGKNKNLNNYFIKLADVGINF"
     gene            321546..323636
                     /gene="ftsK"
                     /locus_tag="SAR11_0324"
     CDS             321546..323636
                     /gene="ftsK"
                     /locus_tag="SAR11_0324"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein"
                     /protein_id="AAZ21147.1"
                     /translation="MEFKKLANNTINFGINRIIETAGIAFVIIGLLLLVSLATFSPDD
                     PNFIFPDNTEIKNLLGFNGSYTADLFFQTFGLISLLIPFTLIFSGINIVLNKKIFLIF
                     ESIFYSVLYSSFGSLFFSFFYPTAFNLYINGNGGFIGKYLETTFLTSLININSQISYY
                     FLILIILVLFLISIHFKIIYFYKLIKKLFKLIFIKKEKSYTNENEIISEFIPQEEITN
                     LIQEDLPFIKSENKSPSKKIRFKLPTIDLLKIPTQKDRGKLKDEDYIDSEFLEKILLD
                     FGVSGDIKKVSHGPVVTLNEFEPAAGVKVSKIINLSDDIARNTSSESARIATIPGRST
                     IGIELPNSSRENVYLSEILSNSDFNKKDIRLPIALGKNISGVPIVGDLASMPHLLIAG
                     TTGSGKSVCINTIILSLLYRHTPDKCKFILIDPKMLELSTYEGIPHLLCPVITEAKKA
                     ASVLGWVVKEMENRYRLMTKEGVRNIDGYNAKHTLAMPYIVVVVDEMSDLMLVAGKEI
                     ENYIQKLSQMARAAGIHIIMATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGE
                     QGAEQLLGKGDMLYMSSANRIVRIHAPFVSETEIEKVNNYLRSQAEPDYIDEILNFAD
                     EKELSGETSSSGDKDELYQAALDIIKSEGKASTSFLQRKLQIGYNRAARIIDMMEADG
                     VVSKANHVGKRDVL"
     gene            323636..324190
                     /locus_tag="SAR11_0325"
     CDS             323636..324190
                     /locus_tag="SAR11_0325"
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane lipoprotein carrier protein"
                     /protein_id="AAZ21148.1"
                     /translation="MLKVIIILLFFSFYLPGNSSPKDKIISQMKLTNNLNFNFKQTIN
                     DKSEDGKCIIEYPKKIFCVYNNANKKILVSNGSSLVIETNNKGSYYRYPLNKTPLEFL
                     LDKEYLISKIEKLEPRDIDNKYLNFKIFENNNEINIFFDKKDLNLIGWQTKDIYQNLS
                     ITFISSIKKNQEIDGNIFKLPENN"
     gene            complement(324191..324694)
                     /locus_tag="SAR11_0326"
     CDS             complement(324191..324694)
                     /locus_tag="SAR11_0326"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acetyltransferase"
                     /protein_id="AAZ21149.1"
                     /translation="MTEKIYRSYLEIRSLDELKEVKRPAENYSVELVEPKDFQLNKFF
                     YKSIGKNCQWIDRLIWTDLKWTDYVSNDQLFTYILKDKGEIAGYFELLFNKQSKEAEI
                     AYFGILEEYFGKKLGGYLLSEAIKCSFNMGGVRVWLHTCSLDHKNALKNYLARGMKNF
                     KSETLIR"
     gene            complement(324691..325056)
                     /locus_tag="SAR11_0327"
     CDS             complement(324691..325056)
                     /locus_tag="SAR11_0327"
                     /codon_start=1
                     /transl_table=11
                     /product="Histidine triad (HIT) protein"
                     /protein_id="AAZ21150.1"
                     /translation="MSYDKNNIFAKILRKEIPCKKIFENEYVLSFHDISPQKKIHALV
                     IPKGEYIDLDDFNARASDQEIIALSKAISEVSKILNISTDTGKGYRALTNLSEDGGQE
                     VPHLHFHLFGGEKVGKMVV"
     gene            complement(325056..325361)
                     /gene="hisE"
                     /locus_tag="SAR11_0328"
     CDS             complement(325056..325361)
                     /gene="hisE"
                     /locus_tag="SAR11_0328"
                     /EC_number="3.6.1.31"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-ATP diphosphatase with
                     Escherichia coli pyrophosphohydrolase MazG domain"
                     /protein_id="AAZ21151.1"
                     /translation="MSENLLNLVNTIRDRKNKDEDKSYTSSLLSGGLSKCIDKMEEEF
                     DELKEALNDKSNIVHEAADTIYHILVTLEAADIKFEDVLKELEGRKKQSGIEEKNNR"
     gene            complement(325364..326119)
                     /gene="hisF"
                     /locus_tag="SAR11_0329"
     CDS             complement(325364..326119)
                     /gene="hisF"
                     /locus_tag="SAR11_0329"
                     /EC_number="4.1.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Imidazole glycerol phosphate synthase subunit of
                     hisF"
                     /protein_id="AAZ21152.1"
                     /translation="MLKNRIIPCLDVKNGRVVKGINFVDLKDAGDPVEQAKIYSDGGA
                     DEICFLDITASKENRDTIYDVVERTSKKCFVPLTVGGGVRGVEDINKLLNCGADKVSI
                     NTAAVQSPEMIIESSKKFGSQCIVVAIDAKKNGDKWEVFTHGGRNNTNIDAIEFAKKM
                     EDNGAGELLVTSMDRDGTQIGYDNDLMFKISSTVNIPIIASGGVGNLDHLVDGIRLGN
                     ASAVLAASIFHYGTHSINEAKQYLNSKGIPVRI"
     gene            complement(326112..326831)
                     /gene="hisA"
                     /locus_tag="SAR11_0330"
     CDS             complement(326112..326831)
                     /gene="hisA"
                     /locus_tag="SAR11_0330"
                     /EC_number="5.3.1.16"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformimino-5-aminoimidazole
                     carboxamide ribotide isomerase"
                     /protein_id="AAZ21153.1"
                     /translation="MKIFPAIDIKDKKCVRLIKGDFNNKTEYEISPVDQAGKYKDHGF
                     KNLHIVDLDGALTGETVNLDIIKEIVHKFDLKIEVGGGVRSIDSIEKYINAGVEKVIL
                     GSAAIKNKNFLKEACQKFPNKIALGLDAKDGYLSVSGWKENSNQLTLDFLKEVNDYGA
                     SRLIYTDINRDGTKESPNFEETTNVANVSNCPVIISGGVSSIDDIKKAKGLKNIEGII
                     VGKAIYDGDIKLEELVKELDA"
     gene            complement(326834..327460)
                     /gene="hisH"
                     /locus_tag="SAR11_0331"
     CDS             complement(326834..327460)
                     /gene="hisH"
                     /locus_tag="SAR11_0331"
                     /EC_number="2.4.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Imidazole glycerol phosphate synthase subunit of
                     hisH"
                     /protein_id="AAZ21154.1"
                     /translation="MNVTIVDYNSGNISSVINSFKEVAKDKVNIEVTSDLNKIRSSDK
                     VVLPGQGSFKSCVDALNAINGLVETLNEFTVTNKKPLLGICVGLQMFADLGYEETETK
                     GLGWISGKVSKIDNQNNKFKLPHIGWNEINIVKESKIFEGIKNKSHMYFVHSYEFIPD
                     DKSVISATTDYSSNIVCSVEKENIFGTQFHPEKSDKLGLKIIENFLNL"
     gene            complement(327466..328056)
                     /gene="hisB"
                     /locus_tag="SAR11_0332"
     CDS             complement(327466..328056)
                     /gene="hisB"
                     /locus_tag="SAR11_0332"
                     /EC_number="4.2.1.19"
                     /note="half of bifunctional hisB"
                     /codon_start=1
                     /transl_table=11
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="AAZ21155.1"
                     /translation="MNRIGKVSRKTKETSISVEVNIDGKGQYKIDTGIGFLDHMLEQL
                     SKHSLIDLKVKAKGDTHIDLHHTTEDTGIAIGEALKKALKDFKGIKRYAHAMIPMDET
                     LTRVAIDVSNRPYLIWKVKLKVERLGEMDTELFKEWFQAFSQSAGITLHMENIYGDNS
                     HHIIESCYKALARSLRIALEIDPRNKKSIPSTKGSL"
     gene            328148..328663
                     /gene="hslV"
                     /locus_tag="SAR11_0333"
     CDS             328148..328663
                     /gene="hslV"
                     /locus_tag="SAR11_0333"
                     /EC_number="3.4.25.-"
                     /note="heat shock hslV"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease"
                     /protein_id="AAZ21156.1"
                     /translation="MTTIVLIRKNNEVVVAGDGQVSMGNTVIKSTAAKVRKIEKRNVI
                     AGFAGSTADALTLFERLEAKLEKHAGNLPRAAVELAKDWRTDKYLRRLEALMAIGDKE
                     NSFIISGTGDVLEPEGDAIGIGSGGNYALAAAKVLLDTDLSAEEVARKAIQVASEICV
                     FTNNNIKIEKI"
     gene            328663..330030
                     /gene="hslU"
                     /locus_tag="SAR11_0334"
     CDS             328663..330030
                     /gene="hslU"
                     /locus_tag="SAR11_0334"
                     /note="heat shock hslU"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease"
                     /protein_id="AAZ21157.1"
                     /translation="MKDTNVTPFPKEKTEKKDNSLVSSLSPREIVSELDRYVVGQNKA
                     KKAVAIALRNRWRRQALKGEMKNEVLPKNILMIGPTGVGKTEISRRLSKLAEAPFVKV
                     EATRFTEVGYVGRDVEQIIRDLLEIAIAMEKVKKRKEVHAKAQKLAEEKVLDALVGDK
                     ASLATRESFRKRLRDGDLDDNEIEIEVNNSGSQAAFEIPGMPGANIGMINIGEMIGKS
                     VGNKQKKKKMTVKESHEILINDEADKLIEEDKIIKSAKDSTENNGIVFLDEIDKISGR
                     TDRSGGDVSREGVQRDLLPLIEGTTVSTKYGTIKTDHILFIASGAFQLAKPSDLLPEL
                     QGRLPIRVELEALTSDDFKRILKEPDYSLIKQYIALLKTENVELEFSDDGIDAIANMA
                     SEVNNTVENIGARRLHTIIERILDDISFTATDRAGEKIIIDSNYVKQNLDELVKDTDL
                     SKFIL"
     gene            complement(330020..330541)
                     /locus_tag="SAR11_0335"
     CDS             complement(330020..330541)
                     /locus_tag="SAR11_0335"
                     /codon_start=1
                     /transl_table=11
                     /product="probable Smr (Small MutS Related) protein"
                     /protein_id="AAZ21158.1"
                     /translation="MIKKITDKDKEDWENFLNNKKKIINKNSAKQKNINNPDENKQDW
                     ENFLNNKDKIPNKDFILKKNIRYEKIKKIDLHGYTIEEANKAIEQFIQKCFDENVTKI
                     IVITGKGLRSKNIENPYLSKDLSILKYSVPEFIEKNISLTQFIIETTDAKIEDGGSGA
                     FYIYLKNKNKFKE"
     gene            complement(330542..331135)
                     /locus_tag="SAR11_0336"
     CDS             complement(330542..331135)
                     /locus_tag="SAR11_0336"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative translocase transmembrane protein with
                     Tim44 Pfam domain"
                     /protein_id="AAZ21159.1"
                     /translation="MSYSFEYIDIILLAMIAGFIFLRLRGILGKKTGFEGKIPPQFEK
                     EFQKTNITPKPVSENFDEVSQKEFLKGAKIAYETIITDFSDSDNKLIASKPLLSKKIY
                     DQFKEALEDRANKGHFAEITFIGIKSAVIKTHKKIEDSLEVTVDFVSEIITCIKDKDK
                     NIVSGDSDKIKTVYDTWVFSKDIKSSNPNWLLINTIT"
     gene            331194..331616
                     /gene="fxsA"
                     /locus_tag="SAR11_0337"
     CDS             331194..331616
                     /gene="fxsA"
                     /locus_tag="SAR11_0337"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytoplasmic membrane protein"
                     /protein_id="AAZ21160.1"
                     /translation="MNTFLLLLVGIPIVEIYLFIKLGSQIGAFNTILLIFITAFFGVI
                     YARYEGFNTLKSGMSQMVKNELPVYEIISGAALAFAALLLILPGFATDFLGLLIIFPP
                     TRKLIFKKVSIKKKPINKKQDFINGEFEDIEDENDRKL"
     gene            331600..332022
                     /gene="secB"
                     /locus_tag="SAR11_0338"
     CDS             331600..332022
                     /gene="secB"
                     /locus_tag="SAR11_0338"
                     /note="SecB"
                     /codon_start=1
                     /transl_table=11
                     /product="Bacterial protein export chaperone"
                     /protein_id="AAZ21161.1"
                     /translation="MTENYKIIGNFIKDMSSETPDTPTYIFVRDKISKYKLNIDINSK
                     AVKNGIIEVNTILRFSDQPEILKKAHFEITYTSIVKVDEKVSDKKEMEKIILCDVPNK
                     IYPDLERIFLNLLTDSGYPGIKFEKKIDFTELYKQRAN"
     gene            complement(332015..332686)
                     /gene="dnaQ"
                     /locus_tag="SAR11_0339"
     CDS             complement(332015..332686)
                     /gene="dnaQ"
                     /locus_tag="SAR11_0339"
                     /EC_number="2.7.7.7"
                     /note="epsilon chain, dnaQ"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III"
                     /protein_id="AAZ21162.1"
                     /translation="MKEVILDTETTGLSVRDGHRIVEIGCIELENLIPTKNRFHCYLN
                     PERKVSEKALEVHGYTDEFLSTHKKFGDIVDEFLVFIENKRLVIHNAEFDLSHLNNEL
                     SLLGKEKLNSENVVDTLALARDKFPGSPISLDALCKRYRIDNSKRTQHTALIDCDLLA
                     KVYINLLDQKEPTLNFKNEDNEKIIINSNDTNRYYKKVVKPSEAELKLHKEYLKNSLK
                     KNFFN"
     gene            complement(332688..333257)
                     /gene="coaE"
                     /locus_tag="SAR11_0340"
     CDS             complement(332688..333257)
                     /gene="coaE"
                     /locus_tag="SAR11_0340"
                     /EC_number="2.7.1.24"
                     /codon_start=1
                     /transl_table=11
                     /product="Dephospho-CoA kinase"
                     /protein_id="AAZ21163.1"
                     /translation="MIKIAVVGDIGSGKSHIAKLFSYPVFNADQEVASIYKKNKNCFR
                     KLKKILPKYFSAFPANKIQIIKAIEDSEKNLKKITKIIHPEVRKKLTIFLKKNKKRKA
                     IILDIPLLLENKLNQKSDIIVFVQSKKSEIIKRIKKRDNFNLNLYNQFKKIQLPLSYK
                     KKKANHVIKNNFTNKLVKKSVKKILKEII"
     gene            complement(333254..334051)
                     /gene="aroE"
                     /locus_tag="SAR11_0341"
     CDS             complement(333254..334051)
                     /gene="aroE"
                     /locus_tag="SAR11_0341"
                     /EC_number="1.1.1.25"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate 5-dehydrogenase"
                     /protein_id="AAZ21164.1"
                     /translation="MKKTFLVIGNPIKHSLSPKLHNYWIKKYKINATYEKNLLDHSEI
                     EDLIFNIRKEKIHGLNITVPFKKMIIPFLDELSEEAEISQSVNTIYKRDNKIIGDNTD
                     IEGFKLSLEKTEQNVKNKKALILGAGGVVSSIIIALKKIQIEKIYLSNRTELKAIELK
                     KHFPEIEIIKWGETIDFDMIINATSIGLKEEDEININYQKISKDKFFYDVIYNPPETN
                     FLKNAKKYGGITKNGKMMFIYQAQKAFFIWHKIVPEVDSETINLLDV"
     gene            complement(334048..334635)
                     /gene="orfE"
                     /locus_tag="SAR11_0342"
     CDS             complement(334048..334635)
                     /gene="orfE"
                     /locus_tag="SAR11_0342"
                     /codon_start=1
                     /transl_table=11
                     /product="Maf-like protein"
                     /protein_id="AAZ21165.1"
                     /translation="MVKEIILASKSGVRKKILEENNIQFRVEPSNVDEDSVKESLLKE
                     KVTPTIISKNLAELKANKISQKFTEEIVLGADSVIDLEGKIISKPNDREEALEILKRM
                     NGKTHQLISSVCISRGGSMIWNYTDKASLTMKNMTFLELENYLKKISDKDLYAYNVYQ
                     IEGEGRNLFSKIEGDEDTIMGLPVKKIKEYLKIIK"
     gene            complement(334628..335452)
                     /locus_tag="SAR11_0343"
     CDS             complement(334628..335452)
                     /locus_tag="SAR11_0343"
                     /codon_start=1
                     /transl_table=11
                     /product="Conserved hypothetical protein"
                     /protein_id="AAZ21166.1"
                     /translation="MSNTYQIYLISDSTGETLDRVFLAIKAQFKNIKYDVKSYFFTRT
                     ENQVSKIMDEAKKNDNAIILYTIVDTSLAKFLANKGDEKKIPCFSVLGNLIMNFSKLL
                     NQKASHVPSGQHALNEEYYERIEAIQFTMAHDDGNLVEDVDKADLILLGVSRTSKTPT
                     SIYLANRGYKTLNIPLVNEQSIPESLKKNPKLSCVVGLTTEPQRLVDIRKNRMNALKE
                     KENTNYTNINKIEKEINEAKKTFIKYKWPTIDVTRKSVEETAASIIKIYEINKNNG"
     gene            335797..336738
                     /gene="hemE"
                     /locus_tag="SAR11_0344"
     CDS             335797..336738
                     /gene="hemE"
                     /locus_tag="SAR11_0344"
                     /EC_number="4.1.1.37"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="AAZ21167.1"
                     /translation="MRQAGRYLPEFREIRKLNPDFINLCLNENLSSEITLQPLKRFDL
                     DAAIIFSDILMIPYGLNQEVKFEKNFGPKLGLLDLEKISKIDEIDFVEKLYPVYKSIK
                     KVSEDNLIKNKNLIGFVGAPWTLLVYMINKHSPKKELVKDFFKDEFLINRVLIILEKF
                     LKLHIDQQIKNGATVIQIFDSWAGLLEEKDLPNYVYVPTLNLVNYIKSLNIPVICFPR
                     GIKNYKNYCDIVKPDAVNIDYDVDPVSACKEIKIPVQGGLDPKILLTDKENLKKETLK
                     YLNTFKDHPYIFNLGHGVLPETNPNMVEYLVKIVKDY"
     gene            336739..337773
                     /gene="hemH"
                     /locus_tag="SAR11_0346"
     CDS             336739..337773
                     /gene="hemH"
                     /locus_tag="SAR11_0346"
                     /EC_number="4.99.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="probable ferrochelatase"
                     /protein_id="AAZ21168.1"
                     /translation="MKKAVILFNLGGPDKIENVEPFLFNLFNDPAILNLPTILRYPLA
                     KLISNRRAPVAKKIYKELGGSSPILKLTMAQSKALETKLNQTEIDSEYKCFIVMRCWN
                     PRANDVIKDVQSFNPEEIILMPLYPQYSAATSGSSIKEWRDVCKKNNYHVKTNTICCY
                     PTDQNFINAHTKEIIKKIKDLKNFKLIFSAHGLPEKNIKKGDPYQWQVEQSVKKIVEN
                     LNIENLDWILSYQSRVGPLKWIGPSTEDIIVENSKLAKHIVLVPIAFVSEHSETLVEL
                     DIEYKEIADANGCKNYTRVPALGTNEDFIKAMSELIIKKNEYKFSENLYPPKIQCPSN
                     FKKCPCLNYE"
     gene            337766..338200
                     /locus_tag="SAR11_0347"
     CDS             337766..338200
                     /locus_tag="SAR11_0347"
                     /codon_start=1
                     /transl_table=11
                     /product="possible cytochrome functioning/assembly related
                     protein"
                     /protein_id="AAZ21169.1"
                     /translation="MNSYLLFKSLHLIAVISWMAGLLYLPRIFVYHIENIDHKISSSI
                     FKTMERKLFYFIMMPAMILSWLFGLILISVIGHEVILTLWLKLKLILITLLTIYHFYL
                     GKLLNDFKLDQNTKSSKFFRIINEVPTILLILVVFIVIFKPI"
     gene            338267..339535
                     /gene="rho"
                     /locus_tag="SAR11_0348"
     CDS             338267..339535
                     /gene="rho"
                     /locus_tag="SAR11_0348"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor rho"
                     /protein_id="AAZ21170.1"
                     /translation="MNIQELKLKSSEQLIAQAEKLGIENASTLRKQEILFAILKKVAE
                     KEEITGAGVLQLLQDGFGFLRAMESNYLAGPDDIYVSPSQIRKFGLRTGDTVEGPVRA
                     PKEGERYFALLQVEKINFEEPEKARHKIAFDNLTPLYPNKQMVMEVETTKIEKKPDLT
                     PRLIDLVSPIGKGQRSIIISPPKAGKTMILQSIANSIAKNYPESYLMVLLIDERPEEV
                     TDMKRTVKGEVISSTFDEPASRHVAVAEMVIEKAKRLTEHKKDVVILLDSITRLGRAY
                     NAVIPSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIISTALIDTGSRMDEVIF
                     EEFKGTGNSETVLDRKIAERRIYPAIDITKSGTRREELLFDKDDLSKMNVLRRIISPM
                     GTMDAIEFINSKLKETKSNADFFSSMNKPA"
     gene            339853..341526
                     /locus_tag="SAR11_0349"
     CDS             339853..341526
                     /locus_tag="SAR11_0349"
                     /note="SPINDLY family"
                     /codon_start=1
                     /transl_table=11
                     /product="Predicted O-linked N-acetylglucosamine
                     transferase"
                     /protein_id="AAZ21171.1"
                     /translation="MSIKPENINLNKIFIKYLNEKQYSKLQLHYEKLGKTEKQLPAII
                     FYYACAITLNPSSNIKNLKHAHNLFEMLYVNNRHDLQLLCNMIELSFRTQEFKVVLPY
                     VEEAYKINQSDERLLLGLSKIHLYLANLKESIKYYKILFKINPKSKINRDEFLTSLNY
                     ASGITQEYYLSECKNYLKLLETNKDLEDYNFNFKNLKNNKIKIGFLSSDFKTHPVSFF
                     LKGLLLNFNKDKFEISLISNLHKSHYDNITDELKLLTKNWININSLSDSEATNLLRSF
                     ELDILIDLCGFFRGNRFQVISNRAAKIQACWLGYNNTTGIKNMDYLIADHNLIKKEEE
                     KLYSEKVLFLPKIWNAMTPSNILPEIQKNNSIFTYASFNNFHKISDDTIDVWSKILNN
                     SNSQIILKNPMPSSIVGEELKLNLLKKFIARGVEKKKILFINRKKDFQDHLGLYNNVD
                     VALDTFPYPGVTTTFDAVLMGVPVLTMKGHNLNSRCGESININLQMQNFIAENKDDYF
                     NKALSLQKEKNILQNFGKNLREKVLKSSLFDTKDFTKSFEKIIQKIISK"
     gene            341586..342917
                     /gene="trmE"
                     /locus_tag="SAR11_0350"
     CDS             341586..342917
                     /gene="trmE"
                     /locus_tag="SAR11_0350"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA modification GTPase"
                     /protein_id="AAZ21172.1"
                     /translation="MTIYALSTGPGISGIAIVRVSGKDTKKVIKLLTNAALPETRVAT
                     LRKINKINTSELIDEGIILWFPGPESYTGEDMAEFHIHGSKAVIDALHHSISKIKNCR
                     LADPGEFTKLAFQNGKINLLKAESIADLISAETEIQRQQAIKIMNGKSADKFNNLREK
                     LLKILSHVEAKIDFPDEDLPEDILKNIKKISNEVILNIKKILDDQKVGERIREGFKIA
                     IIGPTNAGKSSLLNHLSNRDVAIVSEIAGTTRDVIETHLNIDGYPVVVSDTAGIRDSK
                     NEIEKKGIKLALDKADNADLKLIVIDAKSIDFKGVLKELMDENAILVINKSDLLNKDL
                     NSEIKNYEHVLISVKNNLNLEDLISKIKNKLKNKFITSEDILITRARHRQHLEQSLNC
                     LKNFEEKNEAEDFDKAAEDLRLATRHLGMIVGKVDVEEILGSIFNDFCIGK"
     gene            343083..344954
                     /gene="gidA"
                     /locus_tag="SAR11_0351"
     CDS             343083..344954
                     /gene="gidA"
                     /locus_tag="SAR11_0351"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose inhibited division protein A"
                     /protein_id="AAZ21173.1"
                     /translation="MKNDLSFEVVVIGGGHAGCEAAAASARLGINTALFTHKIETIGE
                     MSCNPAIGGLGKGHLVRELDALDGVMGDVADKSGIQFRLLNRSRGPAVQGPRTQSDRS
                     LYRKYMQEKLLNYCNLSVFSDPVIKFIFNKNTISGFETNSGKKILCGKLILTTGTFLN
                     GLIHIGDERTPAGRFNEKPSTGLSEQLEKYDFKIGRLKTGTPPRLDARTIKYDNLEEQ
                     FADEDPYFFSFLTKKNLNKQISCRMTYTNEKVHKIIQKNLKRSAMYSGSIQGVGPRYC
                     PSIEDKIVKFADKDRHQIYLEPEGLNDHTIYPNGISTSLPEDVQQEICNNISGLENVK
                     IIRPGYAIEYDYIDPRELFLTLETKKIQNLYLAGQINGTTGYEEAAAQGLIAGINAAL
                     SFKKQEPFILDRSDAYIGVMIDDLVTKGVAEPYRMFTSRAEYRLSLRADNADQRLTNK
                     GIEIGLISKEREDIFKDKEKKLGIISKIMGESLISPTKIKSFNIKIAKDGILRKSNEI
                     LTQKGVNMKKIREIWPEIPYFDKKIDEQIEINAHYRGYLKKQKADILAFKRDENLVIP
                     ENVNYDDLSGLSNEVKAKFNQIKPKTMGQALRIDGITPAAVYILLSHVKRKSIKLIA"
     gene            344954..345595
                     /gene="gidB"
                     /locus_tag="SAR11_0352"
     CDS             344954..345595
                     /gene="gidB"
                     /locus_tag="SAR11_0352"
                     /EC_number="2.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Glucose inhibited division protein"
                     /protein_id="AAZ21174.1"
                     /translation="MEEIFKNYPLLKNQNVPRETLIEFDLFISMLQEENEKINIISKE
                     TAKNEVIRERHIVDSAQIIEFVDLNSNIITDIGSGGGMPGIIISIMIKNQKNLAKVHL
                     YEKSHHKSSFLRKVSRDLKLNTEVMQENIFEAEKLDSGTIMARAFKPLPIILDLVYKN
                     FNSYKNLIVFMGKNGEKVLEETLMNWDFDFEKKKSITSEDSFLLNIKKIKKKN"
     gene            345604..346398
                     /locus_tag="SAR11_0353"
     CDS             345604..346398
                     /locus_tag="SAR11_0353"
                     /codon_start=1
                     /transl_table=11
                     /product="ParA family ATPase for plasmid partitioning and
                     other plasmid related functions"
                     /protein_id="AAZ21175.1"
                     /translation="MQIISIINQKGGVGKTTTVINLAAGLAQHEKKVLVIDLDPQGNA
                     TTGLGLSNLEGSTDTIYGVLNGTRVISDVIRKTEFKNLDIITSNVDLSGLEVETADDS
                     MRAFILKRELTAYLNDSRATYDYVLIDCPPSLSLLTVMALVSSHSLLVPLQTEFFALE
                     GLTQLMKTIERIKVNLNPELKIRGILLTMFDKRNKLSTQVEKEARDYFNEKVYLTVIP
                     RNVRLSEAPSHGMPVLMYDKSCPGSKSYFNFTDEFINQEQTIGSAA"
     gene            346398..347246
                     /gene="parB"
                     /locus_tag="SAR11_0354"
     CDS             346398..347246
                     /gene="parB"
                     /locus_tag="SAR11_0354"
                     /EC_number="2.7.7.-"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein"
                     /protein_id="AAZ21176.1"
                     /translation="MDANKIKKGLGRGLSSLIGETKVEINVNKVSISDLVRNKFQPRK
                     TFDAESLQDLTNSIKERGIIQPIIVRRSSEDNSKYEIIAGERRWLSAQKAGLHEVPVV
                     ITNIDDLKSLEFAIIENVQRNDLNVIEEAQGYQRLIEEFSYDQEKVAQFIGKSRSHIA
                     NCLRLLNLPQAVLKLIQTQKLSAGHAKILVGLDNAEFVANKIIEKNLSVRQSENFVKI
                     FKTKKHSLKTSKDINLQVLENSIREKIGLNVLIKNKKNNSGSLLLEYKDLDQLNKIIE
                     IIKSNY"
     gene            complement(347236..348231)
                     /gene="holA"
                     /locus_tag="SAR11_0355"
     CDS             complement(347236..348231)
                     /gene="holA"
                     /locus_tag="SAR11_0355"
                     /EC_number="2.7.7.7"
                     /note="delta subunit, holA"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed DNA polymerase III"
                     /protein_id="AAZ21177.1"
                     /translation="MILKSFELPKIKLNNYKFYLFYGDNEGLKEENIKNLFEKNYKDK
                     IHRYEEKEILDDINIFFNNIFNKSFFDNEKLIIINRATDKIKTIIEELMEKKPEDIQI
                     ILNSKNLEKKSSLRKLFEKEKSIACIPFYEDNNQTLNSIISLFFRNKKIPISQQLINV
                     LVERSRGDRKNLNNELEKIENFSLNKKNLNIQEIIKLTNIADNYSASELVDHSLAKNT
                     RKTVTILGENNYSDEDNIIIIRTLLAKLKRLVKIHELVEEKNNIEQAITACKPPIFWK
                     DKPLVIQQIRSWKKDGLEQLIYKTNEIELLVKKNSVLAKNILADFIINNSKKTNN"
     gene            complement(348228..348692)
                     /locus_tag="SAR11_0356"
     CDS             complement(348228..348692)
                     /locus_tag="SAR11_0356"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAZ21178.1"
                     /translation="MLRKQIILLLLLLLSSCGYEAIYSKKNSVNYSFSVSDLSFVGDR
                     IVNLKIKEKLNNYAQAKKDKDFILRISSTSEKITLAKNTAGDSTSFKNLVSINVEVLM
                     NNKFKSNFIILESFNYNSISNKFNLKKYEDEIKNNLAETAADKLIFKLSNIQ"
     gene            complement(348696..351230)
                     /gene="leuS"
                     /locus_tag="SAR11_0357"
     CDS             complement(348696..351230)
                     /gene="leuS"
                     /locus_tag="SAR11_0357"
                     /EC_number="6.1.1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="Leucyl-tRNA synthetase"
                     /protein_id="AAZ21179.1"
                     /translation="MDRYNFKTVEEKWQKFWHKNKVFSSKLDKTKKKFYCLEMFPYPS
                     GKIHMGHVRNYTIGDVLARYKTLQGYNVLHPMGWDSFGMPAENAARQNNLDPKTWTES
                     NIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVYRKENYVNWDPV
                     DETVLANEQVVDGKGWRSGATVERKKLNQWFFNISKFSEDLLQGLDALENWPNKVKVM
                     QKNWIGKSFGCEVEFKIESEKPIESIKCYTTRPDTLFGFSFLALSVDHPLAKYYEEDK
                     EFQKFREECSKTGTTEESIASAEKLGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLG
                     AVFGCPAHDQRDLDFAKKYNLKITPVVKPEKDKDFKINNEAYTGEGYLCNSDFLDGLK
                     VPSQSIIKTIEFLEKNNLGTKKTNYRLKDWGISRQRYWGCPIPIAYDENDQPIKIPRD
                     MLPVKLPEIEKLSNTGNPLDSEDNWKFFILDGKKYRRETDTLDTFVDSSWYFLRFCSP
                     HNLDRGFTQEEANYWMPVDQYIGGVEHAILHLLYSRFFMQALSYKNDDFKLKEPFDGL
                     FTQGMVCHETYKDQNNKWLSPDEVTSEDGKKFYKKDNPSEKIIVGPTESMSKSKKNTI
                     DPENIIKNYGADSVRLFILSDSPPEKDVQWSDQGMLASFKFVQKLWTLNSKILDKIKN
                     NDQGSEGNDLAKFTNQLINKITQNLEKFHYNVIVANFYEMYNFLIKEIDKPIKKEILI
                     ENYKKILIVMNPFIPHFSNECLSTINENQISWPEISKEDLIEEDINFVVQINGKKRAI
                     LKIKRDVVEKEILEIIKTNLEIEKFLKDKTIKKSIFVPNRLINIIL"
     gene            complement(351261..351818)
                     /locus_tag="SAR11_0358"
     CDS             complement(351261..351818)
                     /locus_tag="SAR11_0358"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAZ21180.1"
                     /translation="MNIAKNLKFLFLIFLSAIFLNSCGGKLPGADARKYPPNPEARVK
                     KNIEEGRGFRLSDVGKNKGGTFEFASSNELWRASLDTIDFMPLASVNYSGGIIITDWY
                     SSNVDNESIKISIRFLTNEVRSDALDIKVFNRECNVQFNCVITEKSGNLVSELTNKIL
                     KTAAVYEKQMKDKNFKPYITSDPKD"
     gene            352028..353017
                     /locus_tag="SAR11_0359"
     CDS             352028..353017
                     /locus_tag="SAR11_0359"
                     /codon_start=1
                     /transl_table=11
                     /product="putative porin"
                     /protein_id="AAZ21181.1"
                     /translation="MNNLKKIGLTALAGCLAVTSVHASELTASGSASIGFGGADKGTS
                     ANGFYMNDEVTFSGSGELDNGWNVTLSMQVDNNENVGTSTFDNRSVTINMGDAGTFAF
                     GGHGLDSVVGGVDDVMPTAYGETWDIISNTVDNGGVTSTASTLFGAIGSAGSNNMMRY
                     DNTTAVEGLKISASYVPSGTGEVESSVDYGLEYTGYEGLTLGYAMGENNAAGGTSNTD
                     NDTMYVKYAYGPVTVGYQKSEIDATTATDTDEWTAYGVTYAVSDSLSVGYAESTYDAG
                     SSTTDQENSNLSVSYTQGGMTLAAGFAEEKNRGGLTTAVNDVKGYDISLAFAF"
     gene            complement(353054..353596)
                     /locus_tag="SAR11_0360"
     CDS             complement(353054..353596)
                     /locus_tag="SAR11_0360"
                     /codon_start=1
                     /transl_table=11
                     /product="Thiamine monophosphate synthase"
                     /protein_id="AAZ21182.1"
                     /translation="MHNKILKKYYFINKFNQSHIDKQDQETTIIYRNYDQDIDEKLIL
                     RIKSYCKKRGHKFLLSNNIKLAIKLNLNGAYIPSFNNDKKHLSYSFKKNFIILGSAHN
                     VFEIRNKESQNVKAIFLSSIFKKNKNFLGINRFKFLSRLSKKPFIALGGISKTSLKKL
                     NLVNCIGFAGISFFEQKKGP"
     gene            353591..354241
                     /gene="yggS"
                     /locus_tag="SAR11_0361"
     CDS             353591..354241
                     /gene="yggS"
                     /locus_tag="SAR11_0361"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAZ21183.1"
                     /translation="MHNTVKNLIYIEDLVKSKVNHVKLPKIIAVSKTFPIENILPLIE
                     YGHLHFGENKVQEALDKWVHIKNQNPSIQLHLIGRLQTNKVKVALRIFDYIHALDSEK
                     LANKIADEQTKQGKKPKIFIQVNIGNENQKSGINKERLSDFYKFCKNLNLDIIGTMCI
                     PPNDDNTKKYFSEMNEINQELDFKELSMGMSGDYLEAIRYNATYVRVGSKIFGSRT"
     gene            complement(354238..354726)
                     /locus_tag="SAR11_0362"
     CDS             complement(354238..354726)
                     /locus_tag="SAR11_0362"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAZ21184.1"
                     /translation="MIIHVPNKNTLIIDEFKLKCSVGKSGLNSNKKEGDHSTPKGLFN
                     LRKLYFRKDRVGIPKCKINKKIIEQDMAWCDDPKHKKYNEEITTNNKNFRENLHRKDH
                     KYDYIISISHNEKKTPGKGSAVFIHLTDDYKPTAGCVTLKKKDFEILLKLIDKKTKIK
                     IG"
     gene            354747..355328
                     /locus_tag="SAR11_0363"
     CDS             354747..355328
                     /locus_tag="SAR11_0363"
                     /note="C-terminal effector"
                     /codon_start=1
                     /transl_table=11
                     /product="Bipartite response regulator"
                     /protein_id="AAZ21185.1"
                     /translation="MQNVFILNFNSLYEILDEIKENLSFTIIKIENEEDFQKKFDLNR
                     LDYLIISKTGHKLLRNINITDKNFLHFNDLPLSFKKLIELINIKLIKLKFNQQSKIII
                     KGYELNLNSKFFSKDNLKLKLTEKEIEIILYLNNKKIKHNVEDLQKNIWCYSANMETH
                     TVETHIYRLRKKISDLFKDEKFILSHKNGYFID"
     gene            complement(355334..356263)
                     /gene="frk"
                     /locus_tag="SAR11_0364"
     CDS             complement(355334..356263)
                     /gene="frk"
                     /locus_tag="SAR11_0364"
                     /EC_number="2.7.1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="fructokinase"
                     /protein_id="AAZ21186.1"
                     /translation="MKILGIGNAIVDVICKVDDQYLINNQLIKSTMKLVDEIEFKKLL
                     SSLKIEQTISGGSVANSIVGLSQLGNDVGFIGKVNDDNLGQKYEEGLTKEKVQYFYNK
                     KKEISPTGTCLILITPDAERTMVTFLGIAGKISPSDINEKAIQESKMIFLEGYLWDEG
                     EPKSAFDKAMSMSNTKAMSLSDQFCVDRHKSDFLDLVKNKLDITFANEQEIRSLINAK
                     NFEEVIEFGKQLGKLLIITRGEKGSIAVKNQEITECKSKPNLKIVDLTGAGDLFAAGF
                     LHGLINNSSTRECLEKGTAMSSKIIQKIGARLD"
     gene            complement(356265..356918)
                     /gene="nth"
                     /locus_tag="SAR11_0365"
     CDS             complement(356265..356918)
                     /gene="nth"
                     /locus_tag="SAR11_0365"
                     /EC_number="4.2.99.18"
                     /codon_start=1
                     /transl_table=11
                     /product="probable endonuclease III"
                     /protein_id="AAZ21187.1"
                     /translation="MDEKDKAKTILKILNKLYPTTPIPLDHINNFTLLMSVLLSAQCT
                     DLNVNNVTKNIYPKYNKPEHFVKLGKKRIEKLIKSIGLFRVKAKSIYLMSKQLLEKHG
                     GKVPKSFEELEKLPGVGHKTASVVMSQGFGVPAFAVDTHIHRLAQRWGLTNGKNVIQT
                     EKDLKRIFPEKTWSKLHLQIIYYGREFCKARECYGLTCKICTTCYPNRKNPVKIKKA"
     gene            complement(356918..357694)
                     /gene="dapB"
                     /locus_tag="SAR11_0366"
     CDS             complement(356918..357694)
                     /gene="dapB"
                     /locus_tag="SAR11_0366"
                     /EC_number="1.17.1.8"
                     /codon_start=1
                     /transl_table=11
                     /product="Dihydrodipicolinate reductase"
                     /protein_id="AAZ21188.1"
                     /translation="MKKINLAISGCLGRMGQQLIKSSKNNKNFKLTALTENKAISKKI
                     AGIKLDVNTEQTFKKTDVIIDFTVPNCTLDILKIASKLKKRVVIGTTGFNQKEEALIK
                     KFSKTIPILKAGNMSLGVNLLMYLTEITSKSLNEEYLSKVFEVHHKHKKDYPSGTALM
                     LGKGIADGKNKNLYNLMGKKFLNKKSFPYGKKINFNSIRKGEIIGEHEVTFSSGKEII
                     KLNHEAFDRALYSDGALTAAKWLINKKPGLYSMRDLLNFR"
     gene            complement(357731..358861)
                     /locus_tag="SAR11_0367"
     CDS             complement(357731..358861)
                     /locus_tag="SAR11_0367"
                     /note="DnaJ"
                     /codon_start=1
                     /transl_table=11
                     /product="Chaperone protein"
                     /protein_id="AAZ21189.1"
                     /translation="MAKRDFYDVLGVSKSASPEELKSAYRKLAVKYHPDKNPGDKASE
                     DKFKEAGEAYGVLSDKEKKQNYDNFGHAAFEGGGGRQGGGFGGGFGGADFSDIFEDFF
                     GDFGGGQSRGRRKTNNRGSDLRYDLSITLEEAYEGKKQDIKFSTTEKCNTCNGNGSKP
                     GHSPDRCTVCGGNGKVRSNQGFFTVQQTCPQCAGSGEEITNPCTDCNGQGNKQASKKI
                     SVTIPKGVDDGTRIRLAGKGEAGSKGGANGDLYLFVNVHSHDLFKRSDENLFFEFPIS
                     IADAALGTTIEIPTIDGGKAKIKIPDGTQNGKQFRLKGKGMPYMRGSGNGDLYVQVNT
                     EVPISLNKEQKALLEKFREIENEKSNPSIKQFFQKAKSFWKN"
     gene            complement(358894..360837)
                     /gene="dnaK"
                     /locus_tag="SAR11_0368"
     CDS             complement(358894..360837)
                     /gene="dnaK"
                     /locus_tag="SAR11_0368"
                     /note="DnaK (Heat shock protein 70, hsp70)"
                     /codon_start=1
                     /transl_table=11
                     /product="Chaperone protein"
                     /protein_id="AAZ21190.1"
                     /translation="MSKIIGIDLGTTNSCVSIMEGSQPKVLENAEGARTTPSVVAFTE
                     DGEKLVGQPAKRQAVTNPENTIFAVKRLIGRSFEDPTVKKDIAAAPFKIVNSEKGDAW
                     IEAKGEKYSPSQISAFILQKMKETAEKYLGQEVTKAVITVPAYFNDAQRQATKDAGKI
                     AGLEVLRIINEPTAASLAYGLDKKQNKKIAVYDLGGGTFDVSILELGDGVFEVKSTNG
                     DTFLGGEDFDNTIVDYLIGEFKKDSGIDLRSDKLALQRLKEAAEKAKIELSSAEQTDV
                     NLPFITADKTGPKHINLKMTRAKLEALVEDLISRTLPPCKTALKDAGLTASEIDEIVM
                     VGGMTRMPKVLSEVKNFFGKEPNKSVNPDEVVAMGAAIQAGVLQGDVKDVLLLDVTPL
                     SLGIETLGGVSTKLIEKNTTIPTKKSQVFSTADDNQPAVSIRVLQGEREMASDNKMLG
                     NFELVGIAPAPRGVPQIEVTFDIDANGIVSVSAKDKGTGKEQKIQIQASGGLSDEEIE
                     KMVKDAEANKEEDKKKRESVDVRNQADTLLHSTEKNLKEHGAKVSDADKKAIEDASTD
                     LKEAIKGTDTEEIKKKTETLVQASMKLGEAIYKSQEKKEGSPKEGDKNDEGKKDDNVV
                     DADFEEVKEESKEGKEEDKEKSA"
     gene            complement(360900..361352)
                     /gene="grpE"
                     /locus_tag="SAR11_0369"
     CDS             complement(360900..361352)
                     /gene="grpE"
                     /locus_tag="SAR11_0369"
                     /codon_start=1
                     /transl_table=11
                     /product="GrpE protein (HSP-70 cofactor)"
                     /protein_id="AAZ21191.1"
                     /translation="MENQRRRFEKEKDDAFDYGGFSFAKEALNLIDNLERSKQILESD
                     EVLKDTEALKKTLEHFEIISKDMVSIFSKNGITPVVSIGKKLDPNQHQAMMEIDDDQK
                     EPGTIVQEIQKGFMMKDRLLRPALVGVSKKTKTPDDQKSEENKENSDN"
     gene            361572..362174
                     /locus_tag="SAR11_0370"
     CDS             361572..362174
                     /locus_tag="SAR11_0370"
                     /codon_start=1
                     /transl_table=11
                     /product="HAM1-like protein"
                     /protein_id="AAZ21192.1"
                     /translation="MLKNKIIKLLVGTNNKGKLREIKDLLPKNVEIYSPQDFKIKSPP
                     ENGKTFKENSLIKAKFFSKKSKMICLSDDSGLEIDVLDGDPGIYSARWGGKKGDFKKA
                     MNRVFKELDKKDKNWREKKIKARFICALTIYNKNKEIINSIGKVEGFISPVIKGKNGF
                     GYDPIFIPLGKKITFGEMRASQKYKIDHRFKAFKKIKKLF"
     gene            complement(362158..363309)
                     /locus_tag="SAR11_0371"
     CDS             complement(362158..363309)
                     /locus_tag="SAR11_0371"
                     /codon_start=1
                     /transl_table=11
                     /product="possible transmembrane receptor"
                     /protein_id="AAZ21193.1"
                     /translation="MNKIIKIILFLAFGFSITPVALLANEKIRIGLLVPLTGKNSEIG
                     QSIIKSTRLAINTINNASIEIIPKDTQSNPEVTLKAAKELANSGIKIVIGPVFNESLI
                     YLSELSELTFLALTNKNDNFSKNIINAGINATSQLNAIKKFIELNEIKKTIFLTPDVG
                     FKNEIEKAISNSKIKILENYIYNTDPTKLTKQIEKITRYEIRKQNLEDEINRLEKSEQ
                     SNKELLIERLKKRDTLGSVKFDSVVISDFDESLKSVTTSLLYTDITPKEKYFITLNQW
                     FDESLLKETSSQPLYFPSANKDNYDEFSNEYFEKYNQYPNQLSFLSYDLVGLVYYLIL
                     QNESVIDKKMFTKKTLFKGKVGVFEIKNNKINHILNFYKAEDGEFKKVF"
     gene            363342..364205
                     /locus_tag="SAR11_0372"
     CDS             363342..364205
                     /locus_tag="SAR11_0372"
                     /codon_start=1
                     /transl_table=11
                     /product="possible methylase or methyltransferase"
                     /protein_id="AAZ21194.1"
                     /translation="MILHTENINNKVKSGLYIVSTPIGNLSDITLRALEVLKKSDYVL
                     CEDTRISKNLLERYEIKSKLIANHKFNEKKNLSKVIDILKSGSVVSLISDAGTPSISD
                     PGAILVNECVINEIDIFPIPGASAVSSAVSISGFNEKYFFYGFFPDKNSKLSEDFERL
                     ANLEGCIVFFISPRKFNRSIKDLKRYFLNRKILVCREMTKFYEEYIRTDVETLEPFKS
                     DPKGELTIVISEKVKEKNSSIILKESDKVIIQKLIKKLSIKDITDLISQNTNVSKKEI
                     YNYCLKIKNEK"
     gene            364195..364788
                     /locus_tag="SAR11_0374"
     CDS             364195..364788
                     /locus_tag="SAR11_0374"
                     /note="possible periplasmic protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative phospholipid-binding domain"
                     /protein_id="AAZ21195.1"
                     /translation="MKNKIFLISLIFLILTGCVGISSKGVFGTGVSVAFDPRSLGTQI
                     DDSVMQKNLAARLALRDKSYILAVSTKVLDGKIFVTGKVDDPEEKLQITKLAWETKGV
                     RSVKNDIKIKEDFNFKQSAKDLLITSQLRTALIFNKKIKATNYQIDTYKKKIFIYGIS
                     LTTEERKEVINEAKEILDVEDVIASIVLVEDLRIQKN"
     gene            complement(364785..366854)
                     /gene="maeB"
                     /locus_tag="SAR11_0375"
     CDS             complement(364785..366854)
                     /gene="maeB"
                     /locus_tag="SAR11_0375"
                     /EC_number="1.1.1.40"
                     /codon_start=1
                     /transl_table=11
                     /product="probable NADP-dependent malic enzyme"
                     /protein_id="AAZ21196.1"
                     /translation="MISNGSAILGMGNLGALASKPVMEGKAVLFKRFADIDSIDLEID
                     SQDSDEIINSIKNFACSFGGINLEDIAAPDCFIIEEKLKEILDIPVFHDDQHGTAIIT
                     TAALINALDISGKSIKDIKVVVNGAGASAIACTNLFKNSGVLSENVIMLDRKGVVYRG
                     RTEGMDQWKSAHAVETKKRTLEEAINGADVFLGLSAKGALKKELVKTMAKNPIIFACA
                     NPDPEITPEEIMEVRDDAIIATGRSDYPNQVNNLIGFPYIFRGALDVRATTINEEMKV
                     AAANAIAKLAREDVPDEVVAAMGGDRPKYGKDYIIPSTFDPRLISVIPAAVAKAAMDS
                     GVAKKHIKDFEAYRDQLKQRLDPSVTIMQGINSHIKKNQKRIVFADGEDENTLKAAIA
                     FKNSKLGTPILIGKKNKIKERIKEIGYNQNFDIEIVNSEDKEKREKYVNFLFEKLQRE
                     KGLLERDCDRLVRNDRVVWASCMVACGDADGAVTGNTRRFGASFDKVTQVIDARPGEI
                     MFGLNMVVAKGKTIFVGDTSVNEYPSSEELAEIAISSARVVKMFGFVPKVAFVSHSTF
                     GQPLTSRTKHIKKAVEILKDKNVDFDFDGDMQPDVALNEEYKELYPFSSIVGNANILI
                     MPGQHSAAISYKMMKSLGDTKVIGPLLIGLGQPIEIAPLRSSTSEIINLASVAAYSAD
                     VIDYKKS"
     gene            367124..368650
                     /gene="mviN"
                     /locus_tag="SAR11_0376"
     CDS             367124..368650
                     /gene="mviN"
                     /locus_tag="SAR11_0376"
                     /codon_start=1
                     /transl_table=11
                     /product="Virulence factor MVIN-like"
                     /protein_id="AAZ21197.1"
                     /translation="MNLIKSTSTFSFFTIISRLLGYLRDILIAVFLGTGILADAFFVA
                     FRIPNTFRRLFSEGTFNAAFVPSYSSLLNKKKEAQNFANSIFNLLTLGLIILVLIVEI
                     LMPLFVYLIAPGFEGDYDKMELAITLTRITFPFLIFISLASFFSAILNSHNKFAIASA
                     APIILNILLIGVLLFAKILDDNLVYYLSYAVTISGVVQFIFLYFFVKKNFSPKIKFKI
                     NINKKIKNFFKKLLPSIFSSGVTQINILVGTIIASFQASAVSYLYYADRVYQINLAIA
                     GIAIGTVILPQLSKYVKSQNKDKINLIQNKALELSLFLSIPATVALLIASEEIISSLF
                     GYGSFDELSVKNSAKALFYFAIGLPAFSLIKVFSTFFFARHNTKIPFYISLLSVLLNI
                     FISVIFFKQIGFIIIPIATTTSSWFNALLLFIFLKKESFFNFNHVFIDRLIKILTASV
                     IMGIFFNYIIYFFNNELSYQENFKAIYLVGAVITGLIFYFFIAVLIKAFKRTDINLNY
                     "
     gene            368652..369653
                     /gene="trpS"
                     /locus_tag="SAR11_0377"
     CDS             368652..369653
                     /gene="trpS"
                     /locus_tag="SAR11_0377"
                     /EC_number="6.1.1.2"
                     /note="TrpS"
                     /codon_start=1
                     /transl_table=11
                     /product="Tryptophanyl-tRNA synthetase"
                     /protein_id="AAZ21198.1"
                     /translation="MIKKIFSGVQPTGNLHLGNYLGAIKNFVKLQNEKENECIFCVVD
                     LHAITVKQDPKELKKNIRETAATFIASGIDPNKSIIFNQSMVPAHSEAAWILSCVSRI
                     GWLNRMTQFKEKAGKDKEKASIGLYSYPVLMAADILLYDATHVPVGDDQKQHLELCRD
                     IAQKFNNDFNATDFLKVPEPLIQKEFSRIMSLKDGLKKMSKSDPSDLSRINLTDNSEE
                     ILNKIKKAKTDPLPLPSDIKDLNERPEAENLLGIYSSLKNQNLEKSIIEFKGKNFSEF
                     KEKLSETLIETIDPISKEIKKLLNDEGYLDKILLEGSNKANKIASKKIKEIKDLVGF"
     gene            369707..370249
                     /locus_tag="SAR11_0378"
     CDS             369707..370249
                     /locus_tag="SAR11_0378"
                     /codon_start=1
                     /transl_table=11
                     /product="NifU-like domain protein"
                     /protein_id="AAZ21199.1"
                     /translation="MFIQTEVTPNPNSLKFLPGKTVSNNGSFEVIKKEETDNELVRNI
                     LSINGVTGVFLGEDFISINKNEEVNWEDIKHIAISLINDFYSTGKEFVIANELLGEKK
                     EEHTEIEKQIISILESKIRPAVAKDGGDIKFKEFKDGIVKVELQGSCSGCPSSTMTLK
                     QGVQNLLCHYLPEVKEVVAI"
     gene            370252..371367
                     /gene="bax"
                     /locus_tag="SAR11_0379"
     CDS             370252..371367
                     /gene="bax"
                     /locus_tag="SAR11_0379"
                     /codon_start=1
                     /transl_table=11
                     /product="Bax protein (hydrolyses peptidoglycan)"
                     /protein_id="AAZ21200.1"
                     /translation="MRKKTIIRKKLTSFFETAKNLKKKNKLDAQKSGLDNLSRTFLSS
                     LIIISIFFIAPLAINLTKEKMILSKDYENNSKNNLKKLLENKTTKLDEQLNKKFLYED
                     VLTFDEQPSDAILLSAATIEELFKSTNYNLKDVRENKLVKPINLDLLPKEIGKIENTK
                     KRKELFIQIILPLVIDENNSIKLDRIKLFSILNKSKNTKTEQEWLNIKFKQYGVVNKD
                     LSTLKIRMDEVPVSMAIAQAAKETGWGTSRFAQEGNALFGQWTWSGEGIKPADAEDDS
                     THKVMRFKVLQASVKAYQRNLNTHSSYKDFRSARAELRDEGKELDSMILTEYLDKYAE
                     TGKEYVKILQQIIRQNDLTDFDDAKLLPSSKDLESLI"
     gene            complement(371364..372284)
                     /gene="cda1"
                     /locus_tag="SAR11_0380"
     CDS             complement(371364..372284)
                     /gene="cda1"
                     /locus_tag="SAR11_0380"
                     /EC_number="3.5.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="AAZ21201.1"
                     /translation="MYHRFDENKYPSTNIQMDIFKEQMSIINTSNYKFFDPQYLQKEF
                     NFPKNKKEILITVDDAFLSFYKIAWPYLKREKIPFILFVSTETVGKTGYMSWQQIQEV
                     EKEPYAYIGNHSHSHNYLVDLETKNFLADINASIEIFNQNLGYNPIFFSYPFGEYSKT
                     IKDFISKNFDFAFGQHSGVIDINKDPHELPRFPINEKYGDLERFKFLINLGPLPYKSL
                     NPKDKYIINNNPPKLSVEFFENQKNIENINCFSDEGSGWDKSNITFNKNILNINFREK
                     FTFRRGRVNCSLNDDGIWRWFGVQFSVNQN"
     gene            372370..372756
                     /locus_tag="SAR11_0381"
     CDS             372370..372756
                     /locus_tag="SAR11_0381"
                     /note="similar to unknown environmental sequence"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAZ21202.1"
                     /translation="MKNLIVDATRDKIFLTLIVSENIYTCTHENSKINFEKLMILIND
                     FLKVNSSTLDQINIIYVNRGPGSFAGIRNSLATIKALFLTKKINYYCFSFEDFKGFKE
                     VKYEEVPSLCEKFKIKKNLINPIYLS"
     gene            372766..373176
                     /gene="fur"
                     /locus_tag="SAR11_0382"
     CDS             372766..373176
                     /gene="fur"
                     /locus_tag="SAR11_0382"
                     /codon_start=1
                     /transl_table=11
                     /product="Ferric uptake regulation protein"
                     /protein_id="AAZ21203.1"
                     /translation="MSENIEQKCLAKGVKLTDQRKIIAKVMSESNDHPDVDELYNRVS
                     KIDPKISIATVYRTVKLFEESGILAKHDFKGGKARYEELNEGHHDHLIDVKSGEIIEF
                     VDEEIEKLQEKIADKYGYRLVDHKLELYGVKKKS"
     gene            373181..374521
                     /gene="miaB"
                     /locus_tag="SAR11_0383"
     CDS             373181..374521
                     /gene="miaB"
                     /locus_tag="SAR11_0383"
                     /note="MiaB"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-i(6)A37 modification enzyme"
                     /protein_id="AAZ21204.1"
                     /translation="MLKKIFIKTFGCQMNEYDSNRIFDTVKKIGFEKTEKYEDANCYL
                     LNTCHIRDKAKEKVYHEIGRVKKIFREKKKPIVVVAGCVAQAENQEMLKREPYIDIVI
                     GPQSYHKINEAILNHLKNKKKEEETEFDTISKFNYLSQIKNKDSKVSSFLTIQEGCDK
                     FCHFCVVPYTRGPEYSRPFDQIINEAKELVQSGAKEIILLGQNVNAYSYDEEGKKYRL
                     SDLLIKLDSFDKLERIRYTTSHPKDMTDDLINVYKTSSKLMPLVHLPVQSGSNKILNL
                     MNRKHTIEEYLLVYEKLRKINPKIEFSSDFIIGYPEEDEQDFKMTMELIEKVKFINSY
                     SFIFSPRPGTVAANLTLVDQKKSKQRLEIIQEKLFNNQIKKNKSLENKILNVLVENKM
                     KDGIKLFGRTEYMTSVIFDGNIENIGKLVQVEIISSNQNSLFGKLTESSKKKVA"
     gene            374524..375525
                     /gene="phoH"
                     /locus_tag="SAR11_0384"
     CDS             374524..375525
                     /gene="phoH"
                     /locus_tag="SAR11_0384"
                     /codon_start=1
                     /transl_table=11
                     /product="PhoH-like protein"
                     /protein_id="AAZ21205.1"
                     /translation="MNNTVSKKINSTLKFVYSDNNSLSVIFHDNDLLMGVVGEFNENL
                     KELEKITNTNLYSRGNSILIKSTPEQNEITKNAIQFLANQFINNGSIEKKDIISSIDK
                     FMIEEKVKNQNVSDIIKTPKKSVIPRSERQKEYVRALRQSDIVISAGPAGTGKTFLAV
                     AVGLTMLLDKKIERIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDSLYDLFDFEK
                     IQRMIEIGDIEIAPLAFMRGRTLKNSFAILDEAQNATDTQIKMFLTRIGENSKIVING
                     DPSQIDLPNKNMSGLSRSKKLLGHLKEISVVDFDHSDVVRHPLVSKIVKAYSDQEND"
     gene            375518..375979
                     /locus_tag="SAR11_0385"
     CDS             375518..375979
                     /locus_tag="SAR11_0385"
                     /codon_start=1
                     /transl_table=11
                     /product="Conserved hypothetical protein"
                     /protein_id="AAZ21206.1"
                     /translation="MIKIDVVSECTLWSKKIKRNKTFFNSILKFFPKKYKFIGKKINL
                     TILLSNNKNIKKLNKDFRNKNKPTDVLSFPFEKKFNPKKSNYLGDIVISYEFMNKPKN
                     ISILEFKQKVVKIFIHGFLHLLGHDHIKLKDFKKMIKEEDLIYKFIKTKVA"
     gene            375981..377525
                     /gene="lnt"
                     /locus_tag="SAR11_0386"
     CDS             375981..377525
                     /gene="lnt"
                     /locus_tag="SAR11_0386"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase (copper
                     homeostasis protein)"
                     /protein_id="AAZ21207.1"
                     /translation="MLKKNFLNILYVFFLGAISSYSLPPYNYFIINFFTFSLFFIFLF
                     TQKKNNPNNKSFFKYGWFFGFGYFLCSLYWIAISLTFDESFKFLIPIAIVLFPAFLAI
                     FYGLITYLFSVFYSRDVVSTFFIFSILFGSIEFIRGSILTGFPWNLIAFSFSESIYFI
                     QILSVIGTYSFNLICISLFTVPAVFILRKTRKEIIVCFFFIIISVGFLVFGNLKYNQF
                     NTTADIKNNFTIRAVSPNISLDRFYSKQDELKIIQELITLSSPEKKEPMIFLWPEGII
                     PDSYLRDMDIYKELFSNSFSSDDLIIMGLNSVKTKNNENLFFNSMAIFNNKLDLIHSY
                     NKNNLVPFGEFTPFESVLSLIGLKTVTNDYQSFSKGENQKALLIKNDKIELKLLPLIC
                     YEIIYSNRLFKDKNFDYIINISEDGWFGNSIGPKQHFAHSIFRSIESGKYVIRSANNG
                     ISAIVNPIGIIEKKVEFGTIGYVDFKESKILKSTPYMNYGDKIFFILILLYIFLIFSF
                     KKIIDE"
     gene            377518..378687
                     /gene="metK"
                     /locus_tag="SAR11_0387"
     CDS             377518..378687
                     /gene="metK"
                     /locus_tag="SAR11_0387"
                     /EC_number="2.5.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine adenosyltransferase"
                     /protein_id="AAZ21208.1"
                     /translation="MSNLKNFLFTSESVSEGHPDKVSDRISDMVVDSFLSGDPFSRVA
                     CETLTTTNKVVLAGEVRGPSIKEEDLIQKVRECIKDIGYDQDGFTWREATKIESHLHA
                     QSADIAMGVDSSSNKDEGAGDQGIMFGYACNETEELMPAPIHYSHKILRLMAEDRKSG
                     KLKNIEPDSKSQVTFEYVDGKPTKVKSVVISSQHSADVDQAKVRELLKPYLLKSIPEK
                     FLKDFNEEELYINPTGNFVIGGPDGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKV
                     DRSAAYAARYIAKNIVASNIAEKCLIQLAYAIGVSKPLSIYVDLFDNDLEKNKFVTEK
                     ISENFDLSPRGIREMLGLNKPIYEKTAAYGHFGRVPEANGSFSWEKTDKKDVFSK"
     gene            378786..380339
                     /gene="nusA"
                     /locus_tag="SAR11_0388"
     CDS             378786..380339
                     /gene="nusA"
                     /locus_tag="SAR11_0388"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor"
                     /protein_id="AAZ21209.1"
                     /translation="MLNRRSDKLELLRIAEAVALEKSIDKELIIDSMETGIAKAAKSK
                     FGQDNEIKVLIDRESGDIGIFRKLIVVEKPENTNTEINLQDAIILNEANKDKKIGDEI
                     LQPLPSFDFGRIAAQTAKQVISFNVREAERERQYNDFIDKKDSILSGIVKRLEFGNVI
                     VDLGRTEAIIQKNEMIPRENIKAGDRVKAYCYDVKREARGQQIFLSRAHPKFMEKLFV
                     QEVPEIYDGLIEIKSSARDPGSRAKICVKAVDTSLDPVGACVGMRGSRVQAVVNELQG
                     EKIDIVNWSEDPAIVVSNALSPAEVQRVNVDSVAKKLDVILTEENLSKAIGRRGQNVR
                     LATKLLNYEINIMTDAEDSERRQSEFKEKTENFVKNLELDETLGQLLVAEGFSSISDI
                     KDSSPENLMKIEGIEEDTAKALIERAKEFYQKDQEDITQRIKDLGLQDDLINHKGLTP
                     GMLVTLGEQKILKLEDFADLASDELTGGYDVVKGERIKIQGYLEDFALSKTEADELIM
                     SARSIIYKD"
     gene            380350..382554
                     /gene="infB"
                     /locus_tag="SAR11_0389"
     CDS             380350..382554
                     /gene="infB"
                     /locus_tag="SAR11_0389"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterial protein translation initiation factor
                     2 (IF-2)"
                     /protein_id="AAZ21210.1"
                     /translation="MENKKTKLTLSGIAKKSIENIELAKTQSKNSVVIEKKPSKFAPR
                     SSFTRPASVRSKPAVSTTSSFPPRTASVPKPASPITNDYEKRKLAEQRATRRLKGDTG
                     KPETKKRELKLTVSRALSDEIEARSRSMASLKRAKLKENRELTKEEIQESLKPVKRDV
                     NIPEAITVRELSNRMAEQSSNVIKHLFGMGVTVTINQTLAADTAEYLVKEFGHNPIRE
                     TKAEEIIQKIKESRSENLKNRPPIVTVMGHVDHGKTSVLDVLRSANVVSGEFGGITQH
                     IGAYQIQHESNKLTFIDTPGHAAFTEMRARGSKLTDVVVLVVAADDGVKPQTIESIKH
                     AKAANVPIVVAINKCDLPEADPQKIKNQLLEYELIAEDLSGDTLMVEISAKNKKNLDK
                     LVESIVLQAEILDLKTDFESKATGIVLESKIDIGRGAVATVVVTSGTIKKGDFFVSGL
                     KWGKVRALINDKGENVNEAPPSMPVEILGINGAAKSGDDFIVLDSEKEAKTLSQNRAE
                     ESKTGGSPLTFATQDSAFADKSAAELNIIVKSDVHGSAEAIKSAINQITHDEVKPKII
                     LSDIGMVTETDVTLAKASNAALIAFNVKPSKEAKKLAENEKIVISSYNIIYEVLDYIK
                     LRMSGLLAPDVQEKIIGTAQILEIFKVSGTGKVAGSKVTEGEITSGASARVVRDGAII
                     YTGKISTIFREKDQAKQVSNGQECGITLKDFIDFQKNDTIEAFSTTTTDRTV"
     gene            382554..382922
                     /gene="rbfA"
                     /locus_tag="SAR11_0390"
     CDS             382554..382922
                     /gene="rbfA"
                     /locus_tag="SAR11_0390"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribosome-binding factor A"
                     /protein_id="AAZ21211.1"
                     /translation="MADRIGKPVSQRQLRVGEMIRQSLGMIFARNEAKVPNLETNTIT
                     VTEVKMSQDLKIAKAYVLPLGGKDSELVIKKLKECSFLIRKALSKKIIMKYLPKILFA
                     KDDSFEYAEKIENLIKQTNK"
     gene            382936..383184
                     /locus_tag="SAR11_0391"
     CDS             382936..383184
                     /locus_tag="SAR11_0391"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S15"
                     /protein_id="AAZ21212.1"
                     /translation="MTKKAEELKMHEKDTGSSEVQIALLTGKIETLSAHIKQFKKDKH
                     SSVGLLRAVNRRKKLLEYLKKNKFDSYKNVLTQLNLRK"
     gene            383206..385278
                     /gene="pnp"
                     /locus_tag="SAR11_0392"
     CDS             383206..385278
                     /gene="pnp"
                     /locus_tag="SAR11_0392"
                     /EC_number="2.7.7.8"
                     /codon_start=1
                     /transl_table=11
                     /product="polyribonucleotide nucleotidyltransferase"
                     /protein_id="AAZ21213.1"
                     /translation="MFKVYKKEIEVAGKKISLETGKVARQADGAIIASCGETVILATV
                     VGAKKVNPDMDYFPLSVNYQEKYYAGGKIPGGYFKREARPTESEQLISRLIDRPIRPL
                     FPSEFKNEVQLLPTVISYDKDNQPDILAITASSAALAISGMPFMGPVGASRVGLVDGK
                     YILNPSKAELENSTLDLVVAGTKDAVLMVESETSGLTEEVMLDAVKFGHEGFVPVIEM
                     IEELAKECRKPEWTVEKKDLSEVKKKLEENFTEDLTKAFATIDKQDRSNQISEISDKA
                     KQLFADDENYSDFNVNDELKNLEKKIVRTDILKNKKRIDGRGLADVRAIECEVGVLPR
                     THGSALFTRGETQAIVVTTLGTSDDEQRLESLDGQHRERFMLHYNFPPFSVGETGRIG
                     TGRREVGHGKLAWRAINSSLPPKEEFPYTFRIVSEITESNGSSSMASVCGASLALMDA
                     GVPIKEPVAGIAMGLIKEGDDFSVLSDILGDEDHLGDMDFKVAGTKDGITSLQMDIKI
                     TGITFEIMEQALKQAKEGRIHILGEMNKALSESRADVGEHTPKMEQITVDKKDIAAVI
                     GKGGATIREIVEKSGAKLDVNDEGVVTVAAPDEESRNIAMQMIKDITAKAELNKIYSG
                     KVMKIMEFGAFVNFLGKQDGLVHISELATKRVEKVTDIVKEGDEVKVKVIGFDRGKVK
                     LSMKQAAE"
     gene            385353..386048
                     /locus_tag="SAR11_0393"
     CDS             385353..386048
                     /locus_tag="SAR11_0393"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative SAM-dependent methyltransferase"
                     /protein_id="AAZ21214.1"
                     /translation="MIFNYLKDIYKKLYILQNLYIKNKIYKKRKFYSQSKEDIFVLKY
                     FKNKKKGLYVDVGCHHPSRINNTFLLYKHGWRGVNIDMSKLSIDLFDVSRKEDVNIHS
                     AVSTKNKIIDYYTNKNLFLSASIIQKKGSSKFKYKEKVSSKPLTKILDKTIYKDKQID
                     FLSIDAEGADYEVLKSLDFKKYKPKLICIEIWQDQIEEFNIKKHEIYKFLFNKKYKLV
                     TNLADNFIFKKII"
     gene            complement(386111..386503)
                     /locus_tag="SAR11_0394"
     CDS             complement(386111..386503)
                     /locus_tag="SAR11_0394"
                     /codon_start=1
                     /transl_table=11
                     /product="Novel protein with potential Cupin domain"
                     /protein_id="AAZ21215.1"
                     /translation="MIFVKNLASVLSQEWSSTEKYPGVRWKFLIDADFDGSSGLSLGF
                     AEIAPGGDLTLHYHSPAEIYVVTNGKGILNKSGKLETIKKGDVVYIAGNAEHALKNNG
                     KETLEFYWIFPTDRFSEVEYFPAKQKSG"
     gene            complement(386597..387373)
                     /gene="fabI"
                     /locus_tag="SAR11_0395"
     CDS             complement(386597..387373)
                     /gene="fabI"
                     /locus_tag="SAR11_0395"
                     /EC_number="1.3.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-[acyl-carrier-protein] reductase (NADH2)"
                     /protein_id="AAZ21216.1"
                     /translation="MKGKRGLIMGVANERSIAWGISQKLAEAGAELAFTYLGDALKKR
                     VIPLAEKLNSKATFSCDVENKEEVIKLFEDIKSEWGQIDFVVHAVAFSDKSELSGEYL
                     NTTRENFLRSMLISCFSFTEVAKEASKIMKEGGSMLTLTYESTKAIPNYNVMGVCKSA
                     LEASVKYLARDLGAKGMRVNAISAGPIKTLAASAIGDAKFLYKWNEDHSFLKRNVDIH
                     DVGNSALYLLSDLANGVTGEIHYVDAGYNKVGMPDPKNIT"
     gene            complement(387383..388594)
                     /gene="fabB"
                     /locus_tag="SAR11_0396"
     CDS             complement(387383..388594)
                     /gene="fabB"
                     /locus_tag="SAR11_0396"
                     /EC_number="2.3.1.41"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-[acyl-carrier-protein] synthase"
                     /protein_id="AAZ21217.1"
                     /translation="MRRVVVTGLGVVSCLGNNQEEVYQSLLNSKSGISFCEEYKEHNL
                     RSHIHGKPNIKLEDHVDRKTIRFMGSGSAYNYIAMKEAIKDSGLEDKDISNFKTGIVM
                     GSGGPSIENVVLSVDKTRAKTPKLMGPFIVPRTMASTSSATLAVPFKIKGVNYTMSSA
                     CATSGHCIGHASELIQMGKQDVVFAGGSEELHWAMTAMFDAMTALSSKYNDAPETASR
                     AYDKTRDGFVIAGGGGVLVLEEYEHAKARGANIYAELTGYGATSDGYDMVAPSGEGAV
                     RCMKMALATAKNKMDYLNTHGTSTPVGDITELRGVGEAFGAEVPKISSTKSLSGHPLG
                     AASVHEAIYSLIMMKNNFITASANITDMDDEAKKFPIVTKTETDVKLNSVMSNSFGFG
                     GTNATLIFEKV"
     gene            complement(388594..389094)
                     /gene="fabA"
                     /locus_tag="SAR11_0397"
     CDS             complement(388594..389094)
                     /gene="fabA"
                     /locus_tag="SAR11_0397"
                     /EC_number="4.2.1.59"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxydecanoyl-(acyl-carrier-protein)
                     dehydratase"
                     /protein_id="AAZ21218.1"
                     /translation="MKKNSFTYDELISCGNGELFGPGNAKLPLPPMLMFDRITEINED
                     NGAFSKGSLKAELDIKKDLWFFDCHFKGDPVMPGCLGLDAMWQLVGFYLGWLGNPGKG
                     RALGVSTVKFTGEVLQNVKNVRYEIDMKKIMAPGGTTVGLANGLVFADDKKIYSAESL
                     KVGLFK"
     gene            389168..389596
                     /locus_tag="SAR11_0398"
     CDS             389168..389596
                     /locus_tag="SAR11_0398"
                     /note="Fur-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Ferric uptake regulator (fur) family"
                     /protein_id="AAZ21219.1"
                     /translation="MNNINIYKEKLRESGLRPTRQRLKICEVLFSPEKTFHFTINDLT
                     KIIEEKLSEKISLATVYNTIHAFKKKGYLKEISINSDKSYFDTNVTEHHHFFDEDTNE
                     LIDCSNEEIDSVNIKRNITGKKIKSVEVLIKVATDNQTQK"
     gene            389701..390117
                     /gene="rbr"
                     /locus_tag="SAR11_0399"
     CDS             389701..390117
                     /gene="rbr"
                     /locus_tag="SAR11_0399"
                     /codon_start=1
                     /transl_table=11
                     /product="Rubrerythrin"
                     /protein_id="AAZ21220.1"
                     /translation="MSLKGSKTEENLKDAFAGESQANRRYLYFAQKADIEGYNDVASV
                     FRSTAEGETGHAHGHLEYLEEVGDPATGLPIGETKANLASAVQGETHEYTDMYPGMAK
                     TAREEGFPEIADWFETLAKAEKSHAGKFQKTLESIA"
     gene            390175..391506
                     /gene="glpC"
                     /locus_tag="SAR11_0400"
     CDS             390175..391506
                     /gene="glpC"
                     /locus_tag="SAR11_0400"
                     /EC_number="1.1.5.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Anaerobic glycerol-3-phosphate dehydrogenase
                     subunit C"
                     /protein_id="AAZ21221.1"
                     /translation="MSKEGSIDAPIRHPINFEHPDFLDPKKLDDEMRRAFDICHGCRR
                     CFNLCDSFPKLFDMIDESENEDVESLKSEQFEPVVDACTLCDMCFMTKCPYVPPHDFD
                     LDFPHLMLRYRTAQKKLNKLPAVPAQLARIDRNAKIGVMLSSLINWASNIKNTFFRKI
                     LELVAGIDMRVKLPTYNSETFTKYFKKNNIPVNSEAPSKDRKVVIYSTCFVNFNKKDT
                     GVAALKVLKKNGVEVQEAYPGCCGMPYLEQADLPKVVEQAKKVSKDLLEWVDKGYQII
                     TLTASCGLMLKFEWPLLLPNDENIKRLSKSVSDIDEYIVDIAQNEGLAEGLQEIDGGV
                     TVHNACHARAQNMGIKSRDMLKFIPNIKMDVVERCAGHGGTFGVMKETHDLAIKVGTP
                     TAKQIKNKNNKYMASDCPLAGKHLKQLETDTNISNDEALHPIELMAKSYRL"
     gene            391509..392102
                     /locus_tag="SAR11_0401"
     CDS             391509..392102
                     /locus_tag="SAR11_0401"
                     /codon_start=1
                     /transl_table=11
                     /product="Conserved hypothetical protein"
                     /protein_id="AAZ21222.1"
                     /translation="MSKEKRLIEKEDLLPSDVYAKSRKQIRKDLVEFKKDRRIALGPY
                     ATFYFESFETMVAQVQEMLHIEKGGDEQLKDELIAYNPLVPSGKELIATLMFEIDNPI
                     SRAKFLGKVGGIEEKVFMKINNEIVKAVPEADVDRTSAEGKASSVQFIHFKLNDDQIS
                     KFKSDSATIELGIDHKEYTHTTKLSENSIKSLCDDFI"
     gene            complement(392095..392544)
                     /locus_tag="SAR11_0402"
     CDS             complement(392095..392544)
                     /locus_tag="SAR11_0402"
                     /codon_start=1
                     /transl_table=11
                     /product="Conserved hypothetical protein"
                     /protein_id="AAZ21223.1"
                     /translation="MIKKIAIWFLCLSVLFGQFSMAEEKFLSLKKSKVNVRYGPSFDS
                     KIKYIYKKINLPIKQIDQKENFRRIVDLKNNSGWIHISQIKKSNSIIILEDKILYKKP
                     SNFSKPIAKLEKGRLLILKKCENIWCNVKTEDYSGWIKTENIWGSIR"
     gene            complement(392541..393296)
                     /gene="moeB"
                     /locus_tag="SAR11_0403"
     CDS             complement(392541..393296)
                     /gene="moeB"
                     /locus_tag="SAR11_0403"
                     /note="MoeB"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein"
                     /protein_id="AAZ21224.1"
                     /translation="MNSQLKKASIERYSRQIVLKDIGTIGQKKIISSKVLIVGMGGLG
                     SPVAEFLARAGVGSIGIVDDDKVSLSNLHRQSLYNTSDIEKFKVQVARVKIKKINPSI
                     KIKIYKIRLDKNNFKKIIKDYDYIVDGSDNFSTKFLLNDFCYKFKKILVTGAISKFDG
                     HIFTFNFKNKKIPCLRCFFQDSDISDDLLNCESEGILGTVAGIIGTIQANEVLKKILG
                     IGKSLDGYIFILDLLQLNFRKVKLKKRKNCFCK"
     gene            complement(393293..393646)
                     /gene="dut"
                     /locus_tag="SAR11_0404"
     CDS             complement(393293..393646)
                     /gene="dut"
                     /locus_tag="SAR11_0404"
                     /EC_number="3.6.1.23"
                     /codon_start=1
                     /transl_table=11
                     /product="Deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="AAZ21225.1"
                     /translation="MAFIEEPIRIAPNSSYLVPTGLSMAFSEDYEVQIRPRSGLAAKK
                     SITVLNTPGTIDSDYRGEIKVILFNHGKEDFLINNKDRIAQMVLMPVIKMEFEETDNL
                     PDTLRGDGGFGSTGK"
     gene            complement(393737..394942)
                     /gene="dfp"
                     /locus_tag="SAR11_0405"
     CDS             complement(393737..394942)
                     /gene="dfp"
                     /locus_tag="SAR11_0405"
                     /EC_number="4.1.1.36"
                     /EC_number="6.3.2.5"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantothenoylcysteine decarboxylase"
                     /protein_id="AAZ21226.1"
                     /translation="MNNISERKILLIICGGISAYKSLELIRSLKKLGAKVKTILTKSA
                     KEFVTPLSVASLSQEKVYDDLFNPENEAEMDHISLSRWADLIVVAPATANTISKLSTG
                     SSDDLASTVILASDKDIFLTPAMNVRMWDHPSTKENLKKLRSFGYKIIGPEIGDMACG
                     EFGEGKMTEPDNIVQEINLYFSELNKNYKLKALVTAGPTNEYIDPVRFITNKSSGKQG
                     YALAKAFAKKGFQTTLISGPTNLEVGNNINLIKVETADEMFKAAQNNLPTDVAIFSAA
                     VADFKVKEISNSKIKKQEKLNLELEKNIDILNYVSKHNSLRPKLVIGFAAETNNIEEN
                     AKKKLDEKNCDWIIANDVSNKAIGFDSSFNEVSIYYRDKNMDDERLTIKSKSEISDEI
                     VDRVIKRLN"
     gene            complement(394951..396318)
                     /gene="aarF"
                     /locus_tag="SAR11_0406"
     CDS             complement(394951..396318)
                     /gene="aarF"
                     /locus_tag="SAR11_0406"
                     /note="AarF"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone biosynthesis protein"
                     /protein_id="AAZ21227.1"
                     /translation="MGTTFIKLGQFLVTRPDIIGDDLAKQLEGLQDRLPAFTLTEAKA
                     IIKKDLGDDTFNSIIDLSEPVAAASIAQVHKAKINDNGTIKDVAIKILRPNIKKVFNE
                     EIDALMLFAFMVESFIKKTKRLKLVEVVFLLKEITNLEMDLRFEAAAANEYAENTKND
                     AGFRVPAIYWNFTSENVMTLDWVEGVSIRETEDLQKRNIDTKRIASDVIQHFLRHAVR
                     DGFFHADMHQGNIFIDDNGQIVPIDFGIMGRLDNLSKRFLAEILFGFIQRDYKKVAEV
                     HLVAGLVPKDVPVNDLAQALRSIGEPIFGQSVKDISGGKLLKQLFEVTEKFNMQTQPQ
                     LLMLQKTMVVVEGVARKLNPNTNIWETSKPVLESWLRETKDPINTLNESLKSTTEVIK
                     RLPDFPEIMDKANQALSFLASGQIPQNSNSFTALNEKRSEMTAFRNQSIVGLLLLVIF
                     GLVVF"
     gene            complement(396519..397223)
                     /gene="ubiE"
                     /locus_tag="SAR11_0407"
     CDS             complement(396519..397223)
                     /gene="ubiE"
                     /locus_tag="SAR11_0407"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Ubiquinone/menaquinone biosynthesis
                     methyltransferase"
                     /protein_id="AAZ21228.1"
                     /translation="MQQYLQNKKGLVQSVFDNVYDKYDLMNDFMSLGVHRIWKKDLLS
                     WMNPSNNKTLIDVACGTGDLGKLFLDATDKNGEIFCVDPNKGMIGKGKEKLNTYKNIN
                     WIIAPAEKLPIKDNSCDYYTISFGLRNTKDLNKALSEAYRVLKPGGRYLCLEFSKIQN
                     SNLDFIYKNYSKLIPLVGKAIVGQKEPYEYLVKSIEEFINQEELIDLMNKNKFVNCSY
                     RNLSGGIVAIHSGWKI"
     gene            397259..398122
                     /gene="mutM"
                     /locus_tag="SAR11_0408"
     CDS             397259..398122
                     /gene="mutM"
                     /locus_tag="SAR11_0408"
                     /EC_number="3.2.2.23"
                     /codon_start=1
                     /transl_table=11
                     /product="Formamidopyrimidine-DNA glycosylase"
                     /protein_id="AAZ21229.1"
                     /translation="MPELPEVEIVKQSLSKKLEHKKIKKIIITNRNLRFKIPLKFEEL
                     LKNKIIKKVTRFSKYLILNFSDQSFCLIHLGMSGTVHLIKKNNISKFTNTSFYNSPSL
                     PKKHNHVEIHFKGLRVIYNDPRRFGFFKFIENKKELEKRFSHLGPEPFFKNFNLEYLI
                     GYFTNKKKDIKSFLLDQKFVSGIGNIYASEILFLCKINPITYASKLTKQDCKKIITYS
                     KSVLNRAIKKGGSSIRDFKNITGKSGNFQKEFRVYQRENLSCLRTKCNGKIQKIFISN
                     RSTFFCNTCQK"
     gene            398173..398433
                     /gene="rpsT"
                     /locus_tag="SAR11_0409"
     CDS             398173..398433
                     /gene="rpsT"
                     /locus_tag="SAR11_0409"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S20"
                     /protein_id="AAZ21230.1"
                     /translation="MANTKSAIKRIRRIATQTLVNKARKSKYRNAIKKMNLLLVEKKK
                     DEALKFLPKLNSELMKVAKTGIIKKANASRNISRITKKISAL"
     gene            398915..400249
                     /gene="dnaA"
                     /locus_tag="SAR11_0410"
     CDS             398915..400249
                     /gene="dnaA"
                     /locus_tag="SAR11_0410"
                     /codon_start=1
                     /transl_table=11
                     /product="Chromosomal replication initiator protein"
                     /protein_id="AAZ21231.1"
                     /translation="MKNKLGSDIYESWLRKIDFVEEMNSYVLLSVSTRFIRDWITSRY
                     LDQILQIVKTYKKDLTRIEFKIIEKNSENEIENNFTKNENNENVSFIKDTYLQYNRID
                     PNKRFDNFITGTSNKLAYEASMKVSENISHYNPLYIYGGVGMGKTHLLNSIGLSLKEK
                     NKVMFISAERFMYQFVKSIKSNDMVKFKEYFRNTDILLIDDIQFMNGKEAMQEEFFHT
                     FNALLDKGSQVIISADRAPNKLSRIQDRIKSRFAGGLVVDIQKPDYELRSKIVKQKTE
                     ELNIFYSNQVNISEEIQKFISTEITTSIRELVGAINRVVSFSRIYNKVPNLSEVKVVL
                     KDLLNIGENKVTIDLIQSTVCKFFKISKSEMLSSRRSRYLVRPRQTAIYLTKILTSKS
                     LPEIGREFSNRDHTTIIHSVKTIEKLKEKDPEMTNNINNLKNQILYNKENEI"
     gene            400461..401351
                     /gene="dnaN"
                     /locus_tag="SAR11_0411"
     CDS             400461..401351
                     /gene="dnaN"
                     /locus_tag="SAR11_0411"
                     /EC_number="2.7.7.7"
                     /note="beta chain, dnaN"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III"
                     /protein_id="AAZ21232.1"
                     /translation="MYDIIRKFSSGKKINLSLTDVSKLQVESEKSVFNLNCISASEFP
                     LTDENFNQNEFSIKSKQLLKLLNKCKFSVSNDETRHYLSGIFFHQTQTEDKNFLTAAA
                     TDSHRMSISKIRLDQQVDFEPIILPKKTIFQLCSLLESYDGDVKISNIKSKIKFELNN
                     SILISKLIDGKFPNYIQVIPKNNQKKLEIDLKLFLDSVDRVASVSLDKKDGVKFNLSK
                     DVLNLSVNNTNSGDGKESLTVKFDHDLEISFNSRYLIDVASQLDGDKIEIFFNDTGSP
                     ALIKDPGDFDSIFVVMPMKG"
     gene            complement(401348..402049)
                     /gene="plsC"
                     /locus_tag="SAR11_0412"
     CDS             complement(401348..402049)
                     /gene="plsC"
                     /locus_tag="SAR11_0412"
                     /EC_number="2.3.1.51"
                     /codon_start=1
                     /transl_table=11
                     /product="probable 1-acyl-sn-glycerol-3-phosphate
                     acyltransferase"
                     /protein_id="AAZ21233.1"
                     /translation="MIRNFLFSLFFFLGIVLISIIFLPAILLPKKIVLFGGKIMGFWT
                     SLCLKIFLSTKIIIKGRENIIRGKKFFIAASHQSMFETFFLQTIFNSPVFILKKELLM
                     IPIFGWYLKKIGSISIKRNKISKENLGFFDDISKQVKLSERPLIIFPQGTRLSAEDRT
                     PFKKGSGRIYEELNIPCQPIAINSGNTWPKHGWKKINTTLTVSILKPIEPGLSKEIFT
                     KELEKTIYTELDTLS"
     gene            complement(402062..403276)
                     /gene="lysA"
                     /locus_tag="SAR11_0413"
     CDS             complement(402062..403276)
                     /gene="lysA"
                     /locus_tag="SAR11_0413"
                     /EC_number="4.1.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="Diaminopimelate decarboxylase"
                     /protein_id="AAZ21234.1"
                     /translation="MKYIKKNLTIEKVNVQKIAKKFGTPTYCYSHKRLTENIKNFKKN
                     FSSFSPLICFAVKSNTNVNLIREIRKLGLGADVVSMGELMMALKAGIDPKKIVFSGVG
                     KTSKEISYAIDKKILLINAESKSEIIEIEKIAKSKKKIVNIGIRLNPNTDAKTLKQIS
                     TGKKENKFGVDEKTFFELVNFTNHSKNINLKCLSVHIGSQILDHKPYEKMLSVVNKII
                     KKSGHIFEFIDLGGGMGISYEKNSKKLNYQKYNTAIQKFLKGQKTKIIFEPGRSIVGN
                     IGFLISQVIYIKENTKKDFIILDAAMNDLMRPALYGANHQTIPVVKNNRISNKTYEFV
                     GPICESTDKFTTIKGFQKLKEKDLVLMCDVGAYGMSLSSNYNVRPKPAELIIKGSKIN
                     IIKKRQKLKDLI"
     gene            complement(403276..403392)
                     /locus_tag="SAR11_0414"
     CDS             complement(403276..403392)
                     /locus_tag="SAR11_0414"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ21235.1"
                     /translation="MIKKLILIFIICSFLFSCGKKGDPQYEGNEMVFPKSVD"
     gene            complement(403394..404782)
                     /gene="argH"
                     /locus_tag="SAR11_0415"
     CDS             complement(403394..404782)
                     /gene="argH"
                     /locus_tag="SAR11_0415"
                     /EC_number="4.3.2.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Argininosuccinate lyase"
                     /protein_id="AAZ21236.1"
                     /translation="MVKNKNNMAIWGSRIKKDASTLFQKVGNSIDIDKKLFQEDILGS
                     IAHVEMLFRQKIISFKIKNKIIFGLNKIEKEILKNKFEYNKKYEDIHMNIEKRLFQII
                     GEEAGYVHTARSRNDQVITDFKMWTTSATKEINKNLDNIIKTILKISEKNIETIMPGF
                     THLKNAQAVSFAHYLMSYVEMFNRDKKRFTYNLESLSENPLGVAALTGTSFNIDRNFT
                     SKKLGFKRPTNNSIDTVADRDFVLDFLYSASVCSMHISRIAEELIIWNSDGFNLITLS
                     DKVVTGSSIMPQKKNPDLLEYLRGKTGTVYGNLFSMLTILKGLPISYFKDLQDDKEIL
                     FKSNEILNNSIAILNEVLKNLKPNKQQMLDLANSGYITATDLADYLVKNHSMPFRKAY
                     QTTASIVNYAEKKKKKLNELNIDELKKIEPRLTIEVLKIFNVKNSVNSKKSYGGTSFD
                     NIKKMIMKYKKT"
     gene            404807..405322
                     /gene="tlpA"
                     /locus_tag="SAR11_0416"
     CDS             404807..405322
                     /gene="tlpA"
                     /locus_tag="SAR11_0416"
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="AAZ21237.1"
                     /translation="MKLLLIFIYLITSNISYALEKPNIKNLVLSKNTKIYEGVVFKDS
                     NNYDVNLDDFKGKLLILNFWATWCAPCREEMPSLDDLQSNSNFDNLKIFPINIGQENF
                     SKSDSFFRELNIQNLEIYFDAPITLAKKFSLRGVPTTILFNKKGEEFGRIMGSIDFNN
                     LDFINWLKQYD"
     gene            405365..405535
                     /locus_tag="SAR11_1725"
     CDS             405365..405535
                     /locus_tag="SAR11_1725"
                     /codon_start=1
                     /transl_table=11
                     /product="unknown"
                     /protein_id="AAZ21238.1"
                     /translation="MNCSNTLSCISLFEYFLLVSPPLNKVPIPKIKTTATTIKSTIPK
                     ILTNVPVIMKLL"
     gene            405618..406229
                     /locus_tag="SAR11_0417"
     CDS             405618..406229
                     /locus_tag="SAR11_0417"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="similarity to serine esterase"
                     /protein_id="AAZ21239.1"
                     /translation="MPIKNAIILLHGYGGDGKDISMLTLNWKRFLPNTIFLCPDGHEE
                     CKINPAGFQWFDLTKDDPSYILEESKKAENKLQKYIEEVKTEYNLNNSQICLSGFSQG
                     CMMSINLGLTSNQNYNCIVGFSGKIINQDDLSMRKSSSTKMLLIHGDQDAVVSPTFLL
                     EAKDFLIRNNIEIETKMIKNCEHHIPIEASSAALNYIKNNFQI"
     gene            406281..406847
                     /gene="mcrA"
                     /locus_tag="SAR11_0418"
     CDS             406281..406847
                     /gene="mcrA"
                     /locus_tag="SAR11_0418"
                     /EC_number="3.1.21.-"
                     /codon_start=1
                     /transl_table=11
                     /product="5-methylcytosine-specific restriction enzyme A"
                     /protein_id="AAZ21240.1"
                     /translation="MIFNDQNLSLEKCPALVLNADYRPLSYYPLSLWSWQDSIKSVFL
                     DRVVIVSNYDRVIRSPSFNMRLPSVIALKSFIKPQSNPSFTRFNVFLRDKFSCQYCGS
                     GEDLTFDHLLPRSKGGQTNWDNVVTACSSCNVKKGGRLLKNLDMSLNQKPYQPSTEDL
                     HKNGKNFPPNFLHKSWMDYLYWDVELEA"
     gene            complement(406848..407381)
                     /gene="coq7"
                     /locus_tag="SAR11_0419"
     CDS             complement(406848..407381)
                     /gene="coq7"
                     /locus_tag="SAR11_0419"
                     /codon_start=1
                     /transl_table=11
                     /product="Coq7 family protein"
                     /protein_id="AAZ21241.1"
                     /translation="MKKTNKEKVKEFIRVDHAGERGAIKIYEGQLLALNTFVKDENLK
                     KKIEEMKIHEKEHCEYFENEIKKRNIKPTKFLPLWDLLGVGLGFGSTMLGKKAAMLCT
                     ASVEEVIDEHYLNQINELENDEKKLKEKIIKFREDELHHKDIAYKEGATKKGMYSILD
                     KLIKTGSKIAINISEKI"
     gene            complement(407365..407865)
                     /gene="dsbB"
                     /locus_tag="SAR11_0420"
     CDS             complement(407365..407865)
                     /gene="dsbB"
                     /locus_tag="SAR11_0420"
                     /note="DsbB"
                     /codon_start=1
                     /transl_table=11
                     /product="Disulfide bond formation protein"
                     /protein_id="AAZ21242.1"
                     /translation="MQLNNTNMIKRKTTLHLILLFSIFALLTAYFIEHILGHQPCNLC
                     LIERIPYVVSIVIILLFIFIQKFERFFLIILSITFIIAFSISFYHFGIEQGFIKESLV
                     CDLNSNNADLTKEALLNQLKEVTVSCKDATFKILGLSLATINIFISLIITTITIKLFL
                     TYEKNK"
     gene            complement(407852..408448)
                     /gene="dedA"
                     /locus_tag="SAR11_0421"
     CDS             complement(407852..408448)
                     /gene="dedA"
                     /locus_tag="SAR11_0421"
                     /note="DedA"
                     /codon_start=1
                     /transl_table=11
                     /product="DedA family protein"
                     /protein_id="AAZ21243.1"
                     /translation="MLNELYQKTLKLAAHKKSNTYLAILSFTESSFFPIPPDVMIAPM
                     VIAKKNDYLKIFLIATLFSSLGGILGYFIGSYFFDLGMIVVEFYNYEEKVINLKNSLS
                     EGSGLYVWLATLFLAGFTPLPFKVFTITSGMIGFNLPIFFIICLFSRGLRFFIVSYLS
                     YKFGDIFSKFMKTDAAKWFTILGIIIVLIFTLIYFAIK"
     gene            408517..408601
                     /locus_tag="SAR11_tRNA_f_0"
     tRNA            408517..408601
                     /locus_tag="SAR11_tRNA_f_0"
                     /product="tRNA-Leu"
     gene            408798..410315
                     /gene="faa1"
                     /locus_tag="SAR11_0422"
     CDS             408798..410315
                     /gene="faa1"
                     /locus_tag="SAR11_0422"
                     /EC_number="6.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative long-chain-fatty-acid--CoA ligase
                     (Long-chain acyl-CoA synthetase)"
                     /protein_id="AAZ21244.1"
                     /translation="MLISENRPEWMISDLSIMLSEGITVPAYTTYVERDYEYIIDDCT
                     PTVLIISNKTQYLKVKNIIPKKKFIKKIIFFDVIEEFDQELHVSINQIFANKNFNSLN
                     FSELKIQRKDIACIIYTSGTQGNPKGVVLSHGGILNNCEGALGLLKEFVSKKPKFLTW
                     LPLSHSYEHTVQFVQIVVGAQVFYAESIEKLIKNMENCSPEIMTAVPRFYQNLHQKIN
                     TNFSKATGIKKFLINQTIKLGNKKLNRVQFSLIESLINFVCDLLVRKKIKEQFGGNLK
                     AFISGGGALDKEVGCFLNAIGLPTLQGYGLTETSPVVSCNSINEIRVETVGKPFRGNL
                     VKIANDGEILVKGENVMLGYWNNEEETNKVLKNGWLSTGDIGEFDGEFLKITDRKKDI
                     IITPGGDNISPIKIESDLNKSNYIEQSLVYGDNKPYLVCLIVLSSEYKNIKNEEIKIE
                     IEKINKNLSKIEKIKKFFVIKNQFTIENNMMTPTLKLKRYKIIKTYQNELEKLFN"
     gene            complement(410672..411571)
                     /gene="carD"
                     /locus_tag="SAR11_0423"
     CDS             complement(410672..411571)
                     /gene="carD"
                     /locus_tag="SAR11_0423"
                     /note="similar to Myxococcus xanthus CarD; similar to
                     COG1329: Transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAZ21245.1"
                     /translation="MKKTSTTNILAKIFKKTPEKKVKKKTKAKVAKKPTLPKAKVVKK
                     KIPVKKTKTIKATPTKIKKNLKTVSKKAVPEKVEIKTDNLRISKSNEVKPEIKKVKKQ
                     ETEKREYKVKDYVVYPKHGVGQITEFKKINIGGIDVETYVLKFEKDKANGMVPVNKQS
                     HLRPLATINQVNKCISILKSKPKIKRSMWSRRAQEYEAKISSGKIYELAEVVRDLNKG
                     DDLMVDQSYSERQLFEKAYERILSEFQIVMGISLEDTQKKLDKALKRNLEGQAKAVAA
                     PTKIKEPITESDTDSEPITDTED"
     gene            complement(411528..411854)
                     /gene="fdxA"
                     /locus_tag="SAR11_0424"
     CDS             complement(411528..411854)
                     /gene="fdxA"
                     /locus_tag="SAR11_0424"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="AAZ21246.1"
                     /translation="MTYVVNDKCIKCKLMDCVEVCPVDCFYEGKNMLVIKPEECIDCG
                     VCEPECPVDAIVADTESGSEKWLELNTKYSEIWPNITIKKDPPEDNEKYKNEENKYDK
                     YFSENL"
     gene            complement(411851..412276)
                     /locus_tag="SAR11_0425"
     CDS             complement(411851..412276)
                     /locus_tag="SAR11_0425"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAZ21247.1"
                     /translation="MISFFKNKEKNEPQDNSYSKIAALLIHAAKIDEAYEKKEEDIIK
                     ETLIDLGAPVSEIDKIMSEAIIVEDNSNQILDFTREVKNVPDSDKIKIIESLWKIIYS
                     NNSADIYETNLMRRLSGLLYVDAKTMGDLKLKVKSELGK"
     gene            complement(412276..414756)
                     /gene="suv3"
                     /locus_tag="SAR11_0426"
     CDS             complement(412276..414756)
                     /gene="suv3"
                     /locus_tag="SAR11_0426"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="AAZ21248.1"
                     /translation="MSKNKITAVLGPTNTGKTYLAIETMLSFDSGMIGFPLRLLAREV
                     YDKIIKKISSDKVALITGEEKIIPPNAKYFLCTVESMPINKHLDFVGIDEIQMCADHE
                     RGHIFTDRLLNLRGEKLTMFMGSSTIKNIVNKLNEDTEFINRERLSKLTYVGHKKISR
                     INRKTAIIAFSTEEVYAIAELVRRQKGGAAIVMGSLSPKTRNAQVELYQSGDVDFLVA
                     TDAIGMGINMDLENVYFSNLKKFDGKKLRRLNMSEIGQIAGRAGRYLNDGSFGVTGDC
                     KDISAEEVELLENHKFEEIRMLFWRNSNLNFNNALSLIKSLEEKPNKDWLRKIHECGD
                     EKVLKYFLKDMEGNKIENNRETLELLWECCQIPDFVKKTYGNHIEVVGKVFNFLNSNY
                     GKITNDYMRLQLMKLDKLEGNVDSLSNRIANVRTWSYVSNKINWVENQDYWIEKTKLL
                     EDRLSDRLHEELTKTFIDKRASVLARGLNQDMDFKTEIMENDKVIIDEQFIGDLKGLK
                     FEMDLKVGALETDIKSLKKAARQTVGPELQKRVQLIIETGLIELKDDFKIYWKNFPIA
                     KLVTGKDYLNPDILLIVDDLLENNDKQKLSEFIEKWVNEKINLILKSLIDLRNLKESN
                     SSIKALAYQLYENNGVVKREMVTEYLKKLGQDERKILRDLGVKFGRYHIFLFKLLKPE
                     AVSLRTLLWKNFNQKYFELTPPTFGLNFLDDKNKRNKKFMLLCGFENFDNYFVRIDIL
                     ERLFMLIINASPEKDKEIKLVPEMLNLLGCSKDNFKKLIEKMNYKTLEKDNDMYFRYN
                     PKKQIKKTFKKIDTSNSPFKVLKNLNLN"
     gene            complement(414886..415407)
                     /locus_tag="SAR11_0427"
     CDS             complement(414886..415407)
                     /locus_tag="SAR11_0427"
                     /codon_start=1
                     /transl_table=11
                     /product="Thioesterase superfamily protein"
                     /protein_id="AAZ21249.1"
                     /translation="MATKIISTKISYIFFYNCFYNLINFNLHIIKIMSNEFEQISIKS
                     GFMKHNGGVLFRTMSETEYEFKSIINENHLNNAGITHGGYLSALIDAGAGTAAHRASG
                     NAPCVTISLDLKFIGASKVGDEITGFTRILKKTNSLVFLFCELKCNNKIITSASGIWK
                     ILKIKSSNLGPGG"
     gene            415434..415510
                     /locus_tag="SAR11_tRNA_r_27"
     tRNA            415434..415510
                     /locus_tag="SAR11_tRNA_r_27"
                     /product="tRNA-Arg"
     gene            415586..416773
                     /gene="thlA"
                     /locus_tag="SAR11_0428"
     CDS             415586..416773
                     /gene="thlA"
                     /locus_tag="SAR11_0428"
                     /EC_number="2.3.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="Acetyl-CoA acetyltransferase"
                     /protein_id="AAZ21250.1"
                     /translation="MTKKLDDVVITAALRTPIGTYKGSLKDLSADKLGALAIKEAVYK
                     SKLKSDDIDEVIMGHVLTSGLGQNPARQASIHAGIPVSKPAHIINQVCGSGLRSVISG
                     YQSIKLGENKIIVAGGQENMSRAPHAIFYREDKRLDENKLVDTMINDGLIDSFNNYHM
                     GITAENVAEKYKISRDEQDLFALNSQEKTQQAINENRFKNELIKLKIDTDNKNFLFEK
                     DEHPRSNLNLEDLKKLKTVFKENGTVTAGNSSGINDGAAATILMSRDEAEHRDIEPLA
                     KVVSWATCGVEPSLMGLGPIQAVNIALEKAEWRREDVDLFEINEAFAAQSIAVIRDLK
                     IPKEIVNVNGGAIALGHPIGASGTRILVTLIHEMIRRNKSKGCATLCIGGGMGIAMCI
                     ERN"
     gene            416904..419942
                     /gene="aceE"
                     /locus_tag="SAR11_0429"
     CDS             416904..419942
                     /gene="aceE"
                     /locus_tag="SAR11_0429"
                     /EC_number="1.2.4.1"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase (lipoamide) e1 component"
                     /protein_id="AAZ21251.1"
                     /translation="MSEKLLVPDIGEFEKVEVIELLVKVGDQINLNDPVVTIESDKSS
                     VEIPSTVSGKIESVNIKVGDKVSKGDILLSIESSKESPSEKPIPKDTESIIKQAESVL
                     KNEKKEEASQQSPAPEKKQTIIQVTNENDIDPLETQDWLESLSAVVEKDGNQRAHFLI
                     KELINKAYQEGANIPYTQHTPYINTIPPEAEVKSNGDQNIERRIRSLIRWNAAAMVVR
                     ANKKFPELGGHIGTFASAATLYDVGMNHFWRAKNNKFGGDLVYFQGHSAPGIYARAFL
                     EGRLNEKQLDSFRQEVKPGGLSSYPHPWLMPKFWQFPTVSMGLGPMLAIYQARYMKYL
                     INRGLIKDEGRKVWAFLGDGEMDEPESLGAIGLASREKLDNLIFVINCNLQRLDGPVR
                     GNGKIIQELEGSFRGAGWNVIKVIWGSYWDSLIANDKTGHLVKAMNETVDGEYQAMKA
                     RDGAYVREKFFGKYPETQELVSSLSDKDIWRLNRGGHDPHKVYAAYDQASKNQGSPTV
                     IIAKTIKGYGMGKTGESVNTTHQTKKLDVDDLLYYRDRFDVPLTDDQVKNVEYFKPDE
                     KSPEIKYIKERRTNLGGSLPERTTYAKPIKAPAKDIFDFMKVSTGEKEMSTTMALVRM
                     FTNLLRDKNVSPRLVPIIPDEARTFGMEGFFQKIGIYAHEGQKYEPEDSAQLSSYRED
                     KSGQVLEEGINEAGAMSSWIAAATAYTNHDIEMIPIYIFYSMFGFQRIGDLAWAAGDS
                     QARGFLIGATAGRTTLAGEGLQHQDGHSHLIASTIPNCVTYDPTFHYELAVIFREGLR
                     RMHEKNENVFYYITTMNENYSHPGMPKDKNCEEGILKGMYKIKEFNRYGKTKIQLLGS
                     GTILREMMSAAEILQNEYQIDSEIWSVTSFNELRKDGMEVERYNLLNPDKEQKVSFVE
                     QCLGKTEGPIMAASDYMRMNSDQIRPYTNKSFYSLGTDGYGRSDTRKNLRKFFEVDKE
                     HIVAYGLSVLAKEQLIASKYAKEAIKKYNIDGSKPMPTKL"
     gene            419944..421215
                     /gene="aceF"
                     /locus_tag="SAR11_0430"
     CDS             419944..421215
                     /gene="aceF"
                     /locus_tag="SAR11_0430"
                     /EC_number="2.3.1.12"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide S-acetyltransferase"
                     /protein_id="AAZ21252.1"
                     /translation="MSDKEIKVPNIGEFKDVEVIEVLVSNGQSVSKNDPLITIESDKS
                     SVEIPASFDGKIKSVKIKVGDRVSEGDLILTIEQSGEEEKKIEQKTIKEAEQVTNQNQ
                     VEKIAKVNPAQNTIKKDNSEISSASPKVRKFARELGVNINEIVGSERQGRIVEDDVKN
                     FISSRINKAPDKTEVQPKKIVSEYSHSDFGEIEVKDMPRVKKLASTYLVNSWTTIPHV
                     TNHDEADITEMEDFRTSLTDMYTGERKKITPLAFIVKALVASLKKFPSFNSSIDDIEN
                     GKITMKNYFHVGIAVDTPHGLMVPKIRNADNKSISYISNELKIVSDQCRNLKIDKKEF
                     FGGSMTITSLGGIGGSFFTPIINYPEVAILGVGKAQKKQIFINGKFETRTMLPLSLSY
                     DHRIIDGAEAARFNNDLKENLGKNFAYKLAV"
     gene            421222..422109
                     /gene="ydeD"
                     /locus_tag="SAR11_0431"
     CDS             421222..422109
                     /gene="ydeD"
                     /locus_tag="SAR11_0431"
                     /note="Drug/Metabolite Exporter family"
                     /codon_start=1
                     /transl_table=11
                     /product="Transporter"
                     /protein_id="AAZ21253.1"
                     /translation="MSKTSSLFCALLCTFIWGTTFIAQDTGMDDIGPFTFNAVRFFVG
                     FLVVAPLAFIFERKKISKSVQKNQKEFINLAILIGLSLFLGSALQQVALLYTDVANAA
                     FFTIFYVPMVPFIIFFMYKKPIHWSIWPSVLLCVMGGYLLTNFYSATVRNGDALIIIG
                     AFFWSTHIIFTGKIIEKYNLPLTIGAIQTLIVSSLSLIIGLIFEDFIWSNILKEKFQI
                     LYAGILSGGLAFVLQIYAQKNISPAPSAIIFSLEGVFATIAAWILLDQILDINNLFGC
                     LFILFGVLFSQLAPILKKN"
     gene            complement(422106..422876)
                     /gene="bacA"
                     /locus_tag="SAR11_0432"
     CDS             complement(422106..422876)
                     /gene="bacA"
                     /locus_tag="SAR11_0432"
                     /EC_number="2.7.1.66"
                     /codon_start=1
                     /transl_table=11
                     /product="bacitracin resistance protein (putative
                     undecaprenol kinase)"
                     /protein_id="AAZ21254.1"
                     /translation="MFSNIIEIIILSIVQGISEFLPISSSAHLNIVEIIFEFNSNSLM
                     IDVSLHLGSLLAIVFYFRRELLDLRNNQKLLSLLIIGSIPIVIAGYVISSTGLVNLLE
                     NNLKIIAWTTLIFGIILYLADKSKFDKKISSNLNFKTILYIGLFQILALIPGVSRAGI
                     TITAARLFRFNRFDSSKISFLLAIPAIAGASVLQLKNAIGQSFELNYLVLISITLSFL
                     FSYFTVKFFLDYINKFSLNVFVIYRIIISIILFIIIYN"
     gene            423061..424500
                     /gene="gltD"
                     /locus_tag="SAR11_0433"
     CDS             423061..424500
                     /gene="gltD"
                     /locus_tag="SAR11_0433"
                     /EC_number="1.4.1.13"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase (NADPH) beta chain"
                     /protein_id="AAZ21255.1"
                     /translation="MSENMLKFVKIGQQTPPKREVGNRKEDFNEIYKEFINDKASEQS
                     SRCSQCGVPFCQVHCPLSNNIPDWLKLTAEGRLKEAYELSQSTNNMPEVCGRICPQDR
                     LCEGNCVIEQSGHGTVTIGSVEKYITDNAWEQGWVNPIKVKNEKSQSIGIIGAGPAGL
                     AAAEQLRKSGYQITVYDRYDRAGGLMIYGIPNFKLEKFVVERRTKLLEEGGIKFVQNF
                     EVGKDATLEQLRKKHDALLIATGVYKAREIDLPGKDLGNIFPAMEFLTASNKKGLGDK
                     VELFDNGTLNAEGKNIVVIGGGDTAMDCVRTSIRQKAKSVKCLYRRDKENMPGSAREV
                     ANAEEEGVEFVWLSSPKEFIGTNKVEGLIVDKIKLGEPDDSGRRKPEIQNNSHFNIKA
                     DIVIKALGFDPENLPKLFGSEDLQVTKWGTLKTNFDTMETNLPGVFAAGDIIRGASLV
                     VWAIKDGRDVAVSIKNFLETKELSKEKVA"
     gene            424500..429005
                     /gene="gltB"
                     /locus_tag="SAR11_0434"
     CDS             424500..429005
                     /gene="gltB"
                     /locus_tag="SAR11_0434"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase large subunit"
                     /protein_id="AAZ21256.1"
                     /translation="MKNYKKNLKILEDGHVYSKEMEHDACGVGLIASTEGKKSRKVVE
                     YGINALKAVWHRGAVDADGKTGDGAGIHLEIPSDFFAEKIEITGHDHDGSEICVGMIF
                     LPRNNYQAQENARTLVESELTKSNFSIYGWRQVPVNPKVLGEKANLTRPEITQVLFKH
                     NNKDLTEKELERKIYESRRKIEKEAIKDAIEGFYICSLSSKSVIYKGMFLAESIADFY
                     LDLKDERFISRFAIFHQRFSTNTAPSWDLAQPFRALAHNGEINTFKGNTNWMKVHEQE
                     MNSPLFDNMENLKPVIQPGSSDSAALDSVFELLNISGQSAPLAKLMLIPDAWSKKSQT
                     LSKDHQQLFNFLNSTMEPWDGPAAIAATDNEWAIVAADRNGLRPMRYTISKDKILCAG
                     SETGMVEIDEKQILKKGRLGPGEILGVRIAKGKVFSNVEIKDYLAKEFKHFNNQIIDL
                     EKKFPIKNEKSTFSGDELKKRQHTFGYSLEDLELILHPMAEDAKEAIGSMGDDTPLAV
                     LSDRYRPLYHFFRQNFSQVTNPPIDSLRENKVMSLKTRFGNLGNILDFTNLTEENIYV
                     LDSPILSNSQLEKFINFFGEKSITIDCTFDKSENLETSIERIRKESEIAVRQGLTQLV
                     LSDKNISEKRLPIPMLLCVGAINTYLIKKKLRGYASINAQTGEALDTHSFATLIGVGA
                     TTVNPYLALDSLYQRFEKKLFGKFEYDECIDRYIQSVNYGLLKIMSKMGISVISSYRG
                     GCNFETVGLSRTVASEYFPGILSKISGIGLNGIEKKLRTIHKEAFEGTDAVLPIGGIY
                     RYRKDGETHQYQGKLIHLLQSAVSSNSFEAYKKYAEGIYNLPPIHLRDLIGFRDKNLN
                     PSLDISEVEPIENILTRFGSGSMSHGALSKEAHETLAIGMNRIKGASCSGEGGEDEKR
                     FIKMENGDSANSRVKQIASARFGVTLKYLNNCNEIEIKIAQGAKPGEGGQLPGFKVTE
                     EIAKLRHSTPGVTLISPPPHHDIYSIEDLAQLIYDLKQANPKARVGVKLVASSGIGTI
                     AAGVAKAKADIILISGHNGGTGATPQTSVKYVGIPWEMGLTEANQVLTLNNLRHKVTL
                     RTDGGIKTGRDVVIAAMMGAEEYGVATTALVAMGCIMVRQCHSNTCPVGVCTQDEKLR
                     EKFSGTPEKVVNLFKFIAEEVREILAQIGFKSLNEIIGRTDLLRQVSKASPNLDDLDL
                     NPLFVQTDAGENTRYCTVPEINSVPNTLDQEILPEIKEQIGKVKIIEKEYIIKNTHRT
                     VGTRISNHLYEKYGSEKLEDGFLSLKFKGSAGQSFGAFAIKGLKLILKGDANDYVGKG
                     LSGATVVVKLPDESNLVSHENTIIGNTVLYGATSGKLFAAGQAGERYSVRNSGSISVI
                     EGCDSNACEYMTGGTVIILGDVGDNFGAGMTGGMAFIYDINKKFDKKVNPETVVWQTP
                     ETDYWITYLKNLVQEHHQETNSDFSKKIIENFDREISNFIQVCPKEMIDKLKNPISLK
                     SIIKEVS"
     gene            429007..429882
                     /locus_tag="SAR11_0435"
     CDS             429007..429882
                     /locus_tag="SAR11_0435"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate-sugar epimerases"
                     /protein_id="AAZ21257.1"
                     /translation="MKDINIFCFGFGQVAKNFIKKLSVEQYNINLSATSRSESSKKSF
                     NGINYNSYLFNSENFDQSLVVKLKEADHILVSIPPENQEDLVIKNFSKFIESSKTKWI
                     TYLSATSIYGDHKGEWVNENSKTNPISNNGIARLKAENAWFSLEKNKKVPIQIFRLSG
                     IYSNEKNILMRLKSGGVKVINKKNHFFSRIHVDDISNILFKSLSKFKSGEIYNLSDDK
                     PSTSEEVTLFGAKILNIENIEKIEVDQIKGEMLKNFYNESKKVSNKKMKSYFNYNLKF
                     PSYIEGLNHISCNFI"
     gene            complement(429853..430506)
                     /locus_tag="SAR11_0436"
     CDS             complement(429853..430506)
                     /locus_tag="SAR11_0436"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase fold protein"
                     /protein_id="AAZ21258.1"
                     /translation="MSNIEGEKPQAIQKFAKKNKLGFLALEYSGHGKSSGKFTKGNIT
                     QWSKEVEIVIKKIVKKNKFILVGSSMGAWLSLNQFKYFKDQIKGFLGIGSAPEFLQNL
                     MWKKFTKKMKNETIKKGIYNLKHGNYEYPITYQLIKDGRKNKILNKNIKSKINVTMIH
                     GSKDEVVPTSYSRKVLKLFTKANKKLVIIKNGDHSLSSKRGLKKILLELNKITANMV"
     gene            430651..431805
                     /gene="capM"
                     /locus_tag="SAR11_0437"
     CDS             430651..431805
                     /gene="capM"
                     /locus_tag="SAR11_0437"
                     /EC_number="2.4.1.-"
                     /note="group 1 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="AAZ21259.1"
                     /translation="MSSELKVLQVIPKLGYGGAETGCYDLAHYLPENNCGSYIVTSGG
                     ELLKFIDKKKVKVIKLPVHSKNPFLMLFNSIALIFIILLNNISIVHARSRAPAWSCLF
                     ATKITRRKFVTTFHGTYNFKNSIKKFYNSVMVRSDLIIAGSNFIFSHINQNYPKFLDL
                     KKKFLVIFRGINVDYFELSTILDSEENRLISDWEVDRNKKTILMPGRLTAWKGQETFI
                     EALNLVNKELGYESFNAVILGSDQERDIYTKKIKRLAEQYRLTSQLKFIEHCKNMPLA
                     YKISDIVVSASVEPEAFGRVAVEAQSMEKPIIASDIGGSNETIIDNVTGFLFQSGNAE
                     ALSKKIIEVLQLDESRLKSIGIEGRKNIIKKFNVEKMCFSTYSEYKKLLN"
     gene            431806..433722
                     /gene="thrS"
                     /locus_tag="SAR11_0438"
     CDS             431806..433722
                     /gene="thrS"
                     /locus_tag="SAR11_0438"
                     /EC_number="6.1.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Threonyl-tRNA synthetase"
                     /protein_id="AAZ21260.1"
                     /translation="MPLITLPDGNTIEFPNKVTGLEVAEKISKSLSKQATIISVNEEL
                     KDLSFVLDKDCSVKIFTSKDKEGLETIRHDTAHITAMAVQELFPGTQVTIGPIIENGF
                     YYDFSRKEPFTEDDLNKIENKMKEIVDRDVPTTREVWKRDKAISHFKDKGEIYKAEII
                     ESIPQGEDVSIYFHGDWHDLCRGPHLSSTGKIGKYFKLTKVSGAYWRGDSNNEMLQRI
                     YGTSWASQKDLDEYLKRIEEAEKRDHRKLGKEMDLFHFREESPGSVFWHEKGWKLFQK
                     LVAYMRARQEKAGYKEVNTPEILDRSLWEKSGHWEKYGEHMYTSQTPDEKIFAIKPMN
                     CPGHVQVFNQGLKSYRDLPLRISEFGKVHRYEPSGALHGLLRVRAFTQDDAHIFCTED
                     QITSECLIVTNLILDIYKDLGFEDVILKYSDRPDLRVGDDNVWDKAEKALLDAVKASK
                     LQYTINKGEGAFYGPKIEFVLRDAIGRDWQCGTLQVDLNLPGRLDASFVDKDGTKKIP
                     VMLHRALFGSLERFIGILIENYAGKFPFWIAPLQVVVIPISEEFDSYAKEVNEKINNA
                     GISSEVDLKNHNLNYKIREHSLSKIPLLLICGKKEVDSNSVTIRRLDTNKQENMELNL
                     FLETFSALNKASSN"
     gene            433723..434268
                     /gene="infC"
                     /locus_tag="SAR11_0439"
     CDS             433723..434268
                     /gene="infC"
                     /locus_tag="SAR11_0439"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-3"
                     /protein_id="AAZ21261.1"
                     /translation="MADFKQNYFQRRTKDKGPRSNNRISSPEVQVIGSDGENIGIINT
                     NEAISMAKEQGLDLIEIAPNAKPPVCKIIDMGKFKYDAQKKANVAKKKQKIVLLKEIK
                     MRPVTETHDYDFKVKNAKKFIGKGDKVKFTIRFKGRELQHSHLGRELMDKIKADMQDI
                     GKVELHPKFDGKQMIMVIQPL"
     gene            434322..434528
                     /gene="rpmI"
                     /locus_tag="SAR11_0440"
     CDS             434322..434528
                     /gene="rpmI"
                     /locus_tag="SAR11_0440"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="AAZ21262.1"
                     /translation="MPKLKTKSSAKKRFKISATGKVMMAQAGKRHGMIKRTNSQIRKL
                     RGTTAMSKQDGKIVKSYMPYSLRG"
     gene            434530..434886
                     /gene="rplT"
                     /locus_tag="SAR11_0441"
     CDS             434530..434886
                     /gene="rplT"
                     /locus_tag="SAR11_0441"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="AAZ21263.1"
                     /translation="MARVKRGVTSHAKHKKVLKAVKGQWGRRKSTIRVAKQAMEKAMQ
                     YAYRDRRTKKREFKSLWIQRINAGVRSEGITYSKFINGLTKCGIKLDRKILAEIAYDS
                     PEAFKTIVQKAQSALN"
     gene            434930..435997
                     /gene="pheS"
                     /locus_tag="SAR11_0442"
     CDS             434930..435997
                     /gene="pheS"
                     /locus_tag="SAR11_0442"
                     /EC_number="6.1.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase alpha chain"
                     /protein_id="AAZ21264.1"
                     /translation="MSDIKKIKDEFLLKLKENLDLNQVNQIKTELFGKTGLISSQFKQ
                     LGKLAEEERKKFASDLNLVKSELENLITIKIDDIEKKEINKKLEKEKIDITLPERPFV
                     QGKIHPVSQVIDEISSIFSEIGFSVEEGPDVENEYNNFTALNTPDNHPARDMHDTFYL
                     DDTKELLLRTHTSPVQIRTMLNDKPPFKIIAPGRTYRSDSDQTHTPMFHQVEGLHIDK
                     NINMGHLKGCLNYFIKEFFEVDKIKMRFRPSHFPFTEPSAEVDIGYEIKDGKIVIGEG
                     DKWLEVLGCGMVHPNVLKNVKVNPDEFQGYAFGIGIDRLAMLKYGINDLRAFFDCDYR
                     WLNHFGFDPIDVPTNYRGLSR"
     gene            435994..438402
                     /gene="pheT"
                     /locus_tag="SAR11_0443"
     CDS             435994..438402
                     /gene="pheT"
                     /locus_tag="SAR11_0443"
                     /EC_number="6.1.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanine-tRNA ligase"
                     /protein_id="AAZ21265.1"
                     /translation="MKITTAWLKDHLDTKLNENQIIDKLTDIGLEVEGVDSQSGELDQ
                     FVIAKILKAEKHPDADRLRVCDVDIGSGKSVKVVCGAPNAKEGLLTIYAPPGAVVPKS
                     QMKLVVSKIRGVTSYGMLCSESELNLSNESDGITELLPEKYNKKVGENYFPKKNLNVI
                     DISITPNRADCLGVRGIARDLAAAGAGRLINQKEKKLDKKNKQTISVKIENEKNQACI
                     SFGSCLIKGVKNTESPEWLKDKIIALGQKPISAIVDITNYIMFDLNRPLHAYDVDKID
                     KAIVVRNSKKGETFEALDNKEYKLEDEMCVISDASGVLGLGGIIGGTRTGTELDTKNV
                     LIESAYFSPRSIRKSSKILNIDTDAKFRFERGIDPLSIDQGLERAANLIQEICGGEVS
                     EFDIQKIEDVKKKSLKFDPSLFEKITGFNIDIKEMIKILDNLGFEIKENKGILDAVIP
                     SWRPDISQEVDVVEELVRIKGYDQIKIIEPEKVRKKQTLNLKQKLFHFLQRSIASKGY
                     FEAITWSFTDSKINQLFIENNKEIKIINPISSDLNVLRSSIFSNLIIHLNKNLGRGFK
                     DLSFFEIGPTFLGSEPGEQQTVATGLRSGKLARQSWLEKERLIDVFDVKSDVIKSLVE
                     AGYNKDKLYIDDEAPSYYHPGKSGRIFLNKGKEKVVAFFGDIHPGILKKLDIKVESLV
                     GFEIFLDNLKQPKKSLKDQKTQYKYSDFQKSERDFAFVLDKNFKVQELIETISNVDKE
                     LIKSVKVFDVYEGANIPEGKKSIALNVIIQPLEKTLTEDDLNKINQLIISAVESKTGA
                     KIRS"
     gene            438405..440213
                     /gene="lepA"
                     /locus_tag="SAR11_0444"
     CDS             438405..440213
                     /gene="lepA"
                     /locus_tag="SAR11_0444"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-Binding protein lepA"
                     /protein_id="AAZ21266.1"
                     /translation="MTKIDHIRNFAIIAHIDHGKSTIADRIIHSCGGLTEREMKAQVL
                     DSMDIERERGITIKAQTVKLNYKAKDGKDYILNIIDTPGHVDFSYEVSRSLYACEGSI
                     LIVDSTQGVEAQTLANVYQALDTKHEIVPVLNKVDLPASDLEKTKKQIEEVIGIDTEN
                     AIPCSGKTGEGIEDILEQIIVSLPAPEGEKDADLKCLLVDSWYDTYLGVVILVRVING
                     KISKNMKIKMMSTDQEYIIEKVGVFTPKATDVNELNAGEIGFITTGIKILSETKVGDT
                     ICDATKPPQEALPGFKPSKPVVFCGLFPVDSSEYQKLKDGLGKLQLNDASFSYEAESS
                     SALGLGFRCGFLGLLHLEIITERLEREFDINLLTTTPGVVYKVHMNKGDIIELQNPSS
                     LPEPTLIKFIEEPWIKATIITPDQYLGAIIKVCQDKRGVQTNLSYSGNRAVLNYEIPL
                     NEVVFDFNDRLKSMTSGYASFDYEIIGHREGDLVKLGILVNAEPVDALSMMVHKDFAQ
                     TVGREVCEKLKDLIPRHNFMIPVQAAIGGKIIARETIKGFKKDVLTKIHGGGARDRKR
                     KLLDKQKKGKARGKQFGKVEIPQEAFIGVLKINKDQ"
     gene            440216..440305
                     /locus_tag="SAR11_tRNA_f_1"
     tRNA            440216..440305
                     /locus_tag="SAR11_tRNA_f_1"
                     /product="tRNA-Ser"
     gene            complement(440311..441081)
                     /locus_tag="SAR11_0445"
     CDS             complement(440311..441081)
                     /locus_tag="SAR11_0445"
                     /codon_start=1
                     /transl_table=11
                     /product="possible Methyltransferase FkbM"
                     /protein_id="AAZ21267.1"
                     /translation="MKLRSILRSIPILKRIYPSLFLKFSYLLNKNIFLSKFKNVYLNL
                     DIRDPIDKSILLFNFYEDKQIKYLCKIFKENKINYFFDVGANCGIYSLIISKLFPKTS
                     TLSFEPVKFTFKKLKKNISLNPNLKNIRKYNYGLSDKNSKLKMKALFKKEFIQSGGYG
                     VINNKDNLKNLHTEFAVFKKADDKFKYKKKTICLKIDVEGHEVFVLNGLKKIFKNNKI
                     FLQIEILPNNFIKTNRWLNNFGFKKINKINADYYFINK"
     gene            441234..443291
                     /gene="gyrB"
                     /locus_tag="SAR11_0446"
     CDS             441234..443291
                     /gene="gyrB"
                     /locus_tag="SAR11_0446"
                     /EC_number="5.99.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase (ATP-hydrolyzing) chain B (DNA
                     gyrase B)"
                     /protein_id="AAZ21268.1"
                     /translation="MNNKNTYQADSIKVLKGLEAVRKRPGMYIGDTDDGTGLHHMVYE
                     VVDNSIDEALAGHCKNIDVKINSDGTITVRDDGRGIPVDMHKGEKMSAAEVIMTQLHA
                     GGKFDHDSYKVSGGLHGVGVSVVNALSEKLKLEIDRDGNRYFIEFKDGASKAPLKVIG
                     KSKETGTQITFLPSKEIFSSIKFTPSIIIKRMRELAFLNKGIKITVNDLNQKKEKIIV
                     FKFDGGVLEFVDFLDEKREKLVNKTGNDLFKKPIYIEGKKDNIEIECSLKWNASYGED
                     IYPYTNNIYQKDGGTHLLGFRSALTRVINKYATEHNLLKKNKLTISGDDIKEGLTCVI
                     SAKIPDPKFSSQTKDKLVSSEVRMIVESIVSEKLSIWFDQNPTLSKIILAKVMQAALA
                     RDVARKARENVRRKGALELSGLPGKLADCQIGKQEGTELFIVEGDSAGGSAKQGRNRS
                     NQAVLPLRGKILNTYVEEIVLKKNSNRDGSEHRTKSLSKMMSSNEVVTLINALGLDPK
                     VEDIDLKDLRYGKIIIMTDADVDGSHIRALLLTFFNNKPFNKLIENGHVYLAQPPLFK
                     INKGTKGIYIKDEKELEDYILKNNKELQKIKKGTKEFTKAYEDEKSRMSIQRFKGLGE
                     MNPEELWNTTLDPETRNLLQVQYSKDIKKDQDLIHTLMGNDVALRKDFIVSNAINVQN
                     LDI"
     gene            443294..444574
                     /gene="regB"
                     /locus_tag="SAR11_0447"
     CDS             443294..444574
                     /gene="regB"
                     /locus_tag="SAR11_0447"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Sensor histidine kinase (two component sensor)"
                     /protein_id="AAZ21269.1"
                     /translation="MKFFETSKYFSLKKSTYINLRWIAIIGQLITVNVIYFFFDFRFN
                     LILENSIILIGALSNLYLIYINKNTQLSDKTAFLFLSIDILQLSCLIYLTGGIINPFS
                     IFLIIPAIFSSSNLGFRSNLLLVSLTVLVIIFLTFFNQPLPYPIKEHFHVDSYYYYSI
                     PIALIIALIFLNYFALTFGSESRIRKEALNKMEEIMSKEHELLSLGGQAAAAAHSLGT
                     PFSTMKIISTDLLERFKDNEDVKKDIELLSSQLERCSEILKKLTLNPIIEDNFIDRDL
                     TMAEYVSEIVKSFQEVSKKDFIVNYDQNSNPLNITKSIEIIYGLRNFIGNANKFSENK
                     IFINIKSDSDFTEVMIEDDGEGYPKDVLSKIGEPYIKSFKSSIKSKSGLGLGIFIGKT
                     LLEKNYANILCRNSQTRSGAEVSIKWKNEDLLKL"
     gene            complement(444571..446379)
                     /gene="cobT"
                     /locus_tag="SAR11_0448"
     CDS             complement(444571..446379)
                     /gene="cobT"
                     /locus_tag="SAR11_0448"
                     /EC_number="6.6.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="Cobalamin biosynthesis protein CobT"
                     /protein_id="AAZ21270.1"
                     /translation="MSSKENNFKEQFKQALISTAKVISEDYKLDVKKLDKDLSNKKTD
                     FFDVTNLSNKNDFVKLRAETDSGALKKKFSNKEIFNKNLPNNPSCKSLYNIAEKIRYE
                     LLGGKMLKGVGKNLSENYNQKILSNRKEQLKNKEDVPVNEAFELYMLNKFFKLELNDV
                     STKMLDFWKKEFDESIDKHFDFLSKNLEDQNNYSLKFSEILENMDVFASNNEENNEEN
                     DEQENEQDNKSENDNDGQSDDKEEENNQDDSQTSLDAGFDLSDQQMEEQLEDSDSLKE
                     SAESVLQKTNIDNIDQDYKVFTTEFDEIAKAEILEDIKETQKLRKNLDQQLVGFQDLI
                     TKLANKLQRQLLAKQNRAWEFDLEEGLLDSSKLTRIIMDPYNSLSFMKEKDLDFKDTI
                     VTLLIDNSGSMRGRPITIAALCADILSRTLERCSVKVEVLGFTTKNWKGGKSREAWTK
                     NDKPKNPGRLNDLRHIIYKGADTQWRQAKNNIGLMLKEGLLKENIDGEAISWAYNRII
                     KRKEERKILMVISDGAPVDDSTLSVNSGDFLEKHLKKMVKFIETKSDVEILAIGIGHD
                     VSRYYNKAIKITDVHELGDVMVSQLSGLFENKKKLH"
     gene            complement(446380..447354)
                     /gene="cobS"
                     /locus_tag="SAR11_0449"
     CDS             complement(446380..447354)
                     /gene="cobS"
                     /locus_tag="SAR11_0449"
                     /EC_number="6.6.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="Cobalamin biosynthesis protein CobS"
                     /protein_id="AAZ21271.1"
                     /translation="MTPNLNIQPDIKMSLKQSFGIDSDMEVDAFSKRSEYVPEIDKNY
                     KFDRDTTLAIISGFAFNKRVLVQGYHGTGKSTHIEQIAARLNWPCIRVNLDSHVSRID
                     LIGKDAIVVKDGKQITEFKEGILPWSIQNPVALVFDEYDAGRPDVMFVIQRVLEAEGN
                     FTLLDKNKVIKQNKFFRLFATSNTVGLGDTTGLYHGTQQINQGQMDRWNIVTSLNYLS
                     LDREMEIVLAKNKNLNNPKGKEKVSNMIKVASLTRKGFIAGDISTVMSPRTVLHWAEN
                     AEIFKDTGYAFRVTFLNKCDDIEKNTIAEYYQRCFGEELPESMVNIHI"
     gene            complement(447344..447871)
                     /locus_tag="SAR11_0450"
     CDS             complement(447344..447871)
                     /locus_tag="SAR11_0450"
                     /note="dnaJ-related"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="AAZ21272.1"
                     /translation="MKNICDWNNCFDTGEYKAPIEKDNSKRYRLLCLAHVKEFNKNWN
                     YFKGMDDEQVFDFLKSDMTWHKPTQSFSSSDNFFKVLWNNTLKDEFDKTKLRGEYNHM
                     NQFKFDANDIKAFSILGVSVGQKWEQIQDQFKTLVKKFHPDINLGNKEYEEKLKLITL
                     AYTQLKNTYKEKIDT"
     gene            447870..448157
                     /locus_tag="SAR11_0451"
     CDS             447870..448157
                     /locus_tag="SAR11_0451"
                     /codon_start=1
                     /transl_table=11
                     /product="BolA-like protein"
                     /protein_id="AAZ21273.1"
                     /translation="MLYSNKLLFMNINELIKIVKNKLEAKIVIQDLKIEDKSFLHKNH
                     KGNQEGMFHLKLIIKSEELKKLNKIVSTKKIYNILDHELKEHIHSIQILLS"
     gene            complement(448146..449252)
                     /gene="aroB"
                     /locus_tag="SAR11_0452"
     CDS             complement(448146..449252)
                     /gene="aroB"
                     /locus_tag="SAR11_0452"
                     /EC_number="4.2.3.4"
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate synthase"
                     /protein_id="AAZ21274.1"
                     /translation="MGLIKLKVNTNSQQYSIIIGNNILKKVNKFLKENSIDFNQCLLV
                     IDKNIPKNLVKDTLKSLPKGSVSIHYFNASEKNKNLKSVNEITSILLKKSFNRNDCLI
                     SIGGGITGDVSGFAASTFKRGLKFVNIPTTLLSQVDSSIGGKTGVNTKYGKNLIGSFY
                     QPSLVISDTNFLNSLPKREVVCGYGEILKHSLINGKKFFYFLNKNGKKIIQLKSPFIQ
                     TAIHQSCLIKKKVVEADEKELGIRKILNFGHTFAHAFEATLRYSAKLNHGEAVILGVK
                     TAARFSLLNKILNKKEFELIDGHLNDLNLPRDINKFFSIKNLNTIISFMRKDKKNNTK
                     KISLVLLKRIGSPVYKLQFNEKTINLFLKKELTK"
     gene            complement(449239..449751)
                     /gene="aroK"
                     /locus_tag="SAR11_0453"
     CDS             complement(449239..449751)
                     /gene="aroK"
                     /locus_tag="SAR11_0453"
                     /EC_number="2.7.1.71"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="AAZ21275.1"
                     /translation="MNSNKNLVFLGMMGSGKSSIGAMVSKQLNIPFIDIDNLIEEHAG
                     MTISEIFKVNGEAYFRNLEEKITIKSLKHKKVVVSLGGGSFINDKIRKDILKNHFSFW
                     LDWDDLVLIKRIKGSKKRPLASNSTDLEIKAIINKRKKVYSKANFKINCNKLTKSEIV
                     KTIIKTYGLN"
     gene            449810..449986
                     /locus_tag="SAR11_0454"
     CDS             449810..449986
                     /locus_tag="SAR11_0454"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ21276.1"
                     /translation="MQFSKNTSNGSGKSLLIKIVFVLIIFIGAIVLLGKIEFPSPNKD
                     IEKIIPNEKLKIVK"
     gene            450066..451721
                     /locus_tag="SAR11_0455"
     CDS             450066..451721
                     /locus_tag="SAR11_0455"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical transmembrane protein"
                     /protein_id="AAZ21277.1"
                     /translation="MGEKKPKENLILTEDELEKNIPQNSIYDMQSQKEGELSIEETQT
                     LISKEKKLIGIYDPAENGLDINMWSNSNGDQILNIFKRIDKLELSRDAEEILDVLLLT
                     NAHYPEMNISKEQFLEIKSKWLIKRSNFDLIEKYLLNNEIINEHPKLTKHLVDHYLSQ
                     SDVEKACEIFSKINEPIQDLYLSKFNIYCLINNNKRDEAQLLIDLQLELGIADKFFNK
                     KIDYLMGYNTEPATEVSEKTILDFHLSHRTNPEFKFEPKNTTSRQIWKYLSTSNLLDD
                     ISDIELTDIEKITSIEKATHEGNYAEKELFELYKRFQFNINQLLNIKESTKVLSRIET
                     RALIYQGILITTEIENKLQLMNALKNSFKNDGIENAFNIELKNFLKNIEENKVPSNFT
                     TFYQDNLGNEETEQANIKINNKILHQSKLINYLKLEKSKNDPTKDINDFLKKIKKDKK
                     YFFSKKDVILVETFKSDGVKILEKYDDLYQINDSEIPSDIQIFVNSGDMAAALLRIVE
                     VIGQDSLNAIDEDTLYFIISTLNQLNADPLRNKILFKVLPLKV"
     gene            451748..452266
                     /gene="def"
                     /locus_tag="SAR11_0456"
     CDS             451748..452266
                     /gene="def"
                     /locus_tag="SAR11_0456"
                     /EC_number="3.5.1.88"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="AAZ21278.1"
                     /translation="MSVKSILTEPNKLLRQISKPVENVGDEERRLMDDMLDTMYAAPG
                     IGLAAIQIGVPKRIIVMDISRDEDKKEPRYFVNPVIKNKNDITSKYEEGCLSVPDQFA
                     EIERPNECEVEYLDYNGKKQLLKADGLLATCIQHEMDHLEGVLFIDYLSKLKKSMIIK
                     KLSKIKSNRIIV"
     gene            452267..453199
                     /gene="fmt"
                     /locus_tag="SAR11_0457"
     CDS             452267..453199
                     /gene="fmt"
                     /locus_tag="SAR11_0457"
                     /EC_number="2.1.2.9"
                     /codon_start=1
                     /transl_table=11
                     /product="Methionyl-tRNA formyltransferase"
                     /protein_id="AAZ21279.1"
                     /translation="MTKKIVFMGTPFFAVPILKSLYEKNYIIPAVYTQPPKKSQRGQK
                     INKSPIQIVAEDYNIDCRTPDTLKTNKEEYEYLKQLDLDLVIVVAYGQIIPKEYLNLA
                     KKGFINIHASLLPKWRGAAPIQRSIMNLEKETGISIMKIGEKLDTGPVGNIYRIKIKD
                     SDNAETISTKLSILASEKIIENVENIFEDKLTFKEQDDTSATYASKIEKSEGEIKWND
                     NAESIIGKINGLYPSPGAFFIFKDERYKILKAELGNKSGEIGEVMSNDLEISCGNQKS
                     IKIIEIQRQGKKPQNINEFVLGSQIIKGSRITNV"
     gene            453192..453932
                     /gene="truA"
                     /locus_tag="SAR11_0458"
     CDS             453192..453932
                     /gene="truA"
                     /locus_tag="SAR11_0458"
                     /EC_number="4.2.1.70"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="AAZ21280.1"
                     /translation="MFRYQVLIEYIGTNFVGWQIQSKGKSIQKEIQVKLSKFLKEKVV
                     LIGSGRTDAGVHAIEQSAHFDCKKEIQNLDKLLKSINHFINDKGISVLAIKKRSLKFH
                     ARHSAKQRIYKYIIFNRLSKPSLEKERGWHIIKKLDIELMKKGSKKLLGTKDFSTFRA
                     SSCNAKSPIKTMKSVNIKSKDGRIEIQFKSQSFLQQQVRSMVGSLKYLAENKWDLKKF
                     EFVIKSKKRILCAPPAPAEGLFLEKVIY"
     gene            complement(453922..454401)
                     /gene="set1"
                     /locus_tag="SAR11_0459"
     CDS             complement(453922..454401)
                     /gene="set1"
                     /locus_tag="SAR11_0459"
                     /codon_start=1
                     /transl_table=11
                     /product="Nuclear protein SET"
                     /protein_id="AAZ21281.1"
                     /translation="MKLYKIKKSDIDKKGRGLYAAKDIKKGTRIIDYVGKIITKKQTE
                     ESQKFDNAKPIYLFNLNKKYDLDGDVSWNTARLINHSCSNNCDYNGTGLKLWVVAIKD
                     IKKGEEITADYGFGYDEDYKQFPCKCKSKNCCGYIVRAESRWRINKKFSIGRQKTSK"
     gene            complement(454433..455362)
                     /gene="acuC"
                     /locus_tag="SAR11_0460"
     CDS             complement(454433..455362)
                     /gene="acuC"
                     /locus_tag="SAR11_0460"
                     /codon_start=1
                     /transl_table=11
                     /product="histone deacetylase family protein"
                     /protein_id="AAZ21282.1"
                     /translation="MKTGLITSDTYQNHNTGDGHPEKIDRVTVVIDNFKKLDNKNLIW
                     KKPSKFNRSLLEITHNSDYINFVEKSFPEKGLSFLDGDTIVSPGSKDATLDAVGSIIT
                     AIDGVQNKDFKNAFCAVRPPGHHAEKNKAMGFCIYNNVAVGANYLINKYKLKKIAIID
                     FDVHHGNGTQDIFYDNEKVLYISTHQYPYYPGSGTNDEKGKHNNILNIPLPAGTTSEE
                     YLNAYEFVLNKIKEFKPEFILLSAGFDAHKDDPLAQLQLESKDFYNITKRTLELSKQY
                     CDGKVVSILEGGYDLQALQESTEMHVKALLEFN"
     gene            complement(455363..455557)
                     /locus_tag="SAR11_0461"
     CDS             complement(455363..455557)
                     /locus_tag="SAR11_0461"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ21283.1"
                     /translation="MICIKTDIPKELNDIDDELKAIYHSKDTVCFFVFKNREQRNEFV
                     ERTKGMPKVERETIYQEYLS"
     gene            complement(455557..456711)
                     /gene="dapE"
                     /locus_tag="SAR11_0462"
     CDS             complement(455557..456711)
                     /gene="dapE"
                     /locus_tag="SAR11_0462"
                     /EC_number="3.5.1.18"
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-diaminopimelate desuccinylase"
                     /protein_id="AAZ21284.1"
                     /translation="MPTYNEITLAKELIRFPSITPIDAGVMKFLAKKLTTIGFKCKIL
                     EFKDKNSKPVKNLYARLGNTQPNFMFAGHLDVVPPGNIQDWTIKPFSPTIKKNHLIGR
                     GANDMKSAIASWVVAVNNYVLTNKKINGSISLLITGDEEGVAINGTKKVVDYLKKKKE
                     KIDFCLVGEPTNPNKLGEMIKIGRRGSINAELTIIGTQGHVAYPHRAKNPSTSLIKIL
                     NEIKEIKFDKGTKDFQPTNLEVTKININNTADNVIPGLARATFNIRFNNKHTSSSLKN
                     RLNKIFKKITKKDKSNFKVEYRVSGEAFLTKPNKTTYMIQDVIKKITKIKPQLSTTGG
                     TSDARFIRKIAPCLEFGLVGKTMHKVDEAVSISDLKKLTKIYSEILKNYF"
     gene            complement(456712..457539)
                     /gene="dapD"
                     /locus_tag="SAR11_0463"
     CDS             complement(456712..457539)
                     /gene="dapD"
                     /locus_tag="SAR11_0463"
                     /EC_number="2.3.1.117"
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
                     N-succinyltransferase"
                     /protein_id="AAZ21285.1"
                     /translation="MKEFESIINTAWENKDSINGQSDKSILDAINQTIELVDKGELRV
                     AEKNGNEWVVNQWVKKAIMLSFRTHDMDSLSGPYSSWYDKSHLLKGKTANWTKEDHIK
                     AGFRMVPNSPVRKGSFIGKNAVLMPCFVNIGAYVDEGTMVDTWASVGSCAQIGKNCHI
                     SGGAGIGGVLEPMQANPTIIEDNCFIGARSEIVEGVIVGEGSVLSMGVFIGQSTKIVY
                     RETGEVIYGKIPPYSVIVPGSIPSKDGKGPALYCAVIIKQVDEKTRSKTSINDLLRD"
     gene            complement(457569..458240)
                     /locus_tag="SAR11_0464"
     CDS             complement(457569..458240)
                     /locus_tag="SAR11_0464"
                     /note="subfamily IA, variant 3"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-superfamily hydrolase"
                     /protein_id="AAZ21286.1"
                     /translation="MKNLIDTKYWLFDLDNTLYSGQTKVFSEVDKKMSSFISKKFNVD
                     LIKAREIQKKYFYEYGTTLSGLMSHDKIDPHEFLEFVHDIDISWLPKDEILREELIKI
                     KEKKYIFTNGSHAHVENVTKQLGIDGLFDGAFDIVDANFIPKPKIEPYEKIVEKFELD
                     PTKSILIEDIAHNLEQAKNLGMKTCWLENDEVFAKKDADKPYIDYKIKNLPSFLQEIN
                     ILKAQ"
     gene            complement(458237..459103)
                     /gene="argB"
                     /locus_tag="SAR11_0465"
     CDS             complement(458237..459103)
                     /gene="argB"
                     /locus_tag="SAR11_0465"
                     /EC_number="2.7.2.8"
                     /codon_start=1
                     /transl_table=11
                     /product="Acetylglutamate kinase"
                     /protein_id="AAZ21287.1"
                     /translation="MSSLREEELINILPKDGPTVEEVKKYLEKYNDEFIIIKCGGSVL
                     VDPKLFKVFIEDVVVLKKLGFNPIIVHGGGKRINSKLLEVNIKSNFINGLRVTDKDTI
                     NIVEDVLIEFNKEIVEALNELDCKAKRITSKENNIITVVQENKDLGFVGRPTGINKEF
                     LTEIIKANKVPVIAPLGLDKDNQTFNINADTTAGSIAIELKARRLMIISDVEGVLDSE
                     KKLIPEINSKKANELIDQEVISGGMIPKIKNCLDVASNGVKAVVIIDGRKNHSLLFEL
                     LSDKGSGTLIRE"
     gene            complement(459104..460780)
                     /gene="yidC"
                     /locus_tag="SAR11_0466"
     CDS             complement(459104..460780)
                     /gene="yidC"
                     /locus_tag="SAR11_0466"
                     /note="YidC"
                     /codon_start=1
                     /transl_table=11
                     /product="60 kDa inner membrane protein"
                     /protein_id="AAZ21288.1"
                     /translation="MDTRNVIAAISLSAAVIILYSLFFQPDPATIKKNLAEQNKIENN
                     EDTPSLDKNENFSKLSRADALKENDRIQFENGSVVGSISLKGAAIDDLTFKEYNIELN
                     RNEKITLLSPRNVEDGYLIESGFVSTNKNIDIPDASTVWEVSGNNKLTNNNPVKLTWS
                     NTQGITFEKHISLDDQFLFTVKEKIINSSDKSYNFYSYGQIIRNELPEISGFYILHEG
                     FLSVLDDELIEEDYDDIQDKKFTQIAQDGFVAISDKFWVTSVIPPKGKEFKTTFDYKN
                     KFRANYISTKGIEVKANSSIEEKIQIIVAAKRVNVIDGYAENLNINKFDLAIDWGFMY
                     FITKPLFFVLDYFFKLLGNYGLAIIAVTICIRLAFFPLANFSFKSMGKMKLLAPEMAR
                     LKELHKDDKMKLQQAMMALYKKEKVNPMSGCLPILVQIPVFFALYKVLFVTIEMRHMP
                     FYGWIHDLSDRDPTSLFNVFGLIPWDPPSFLLIGAWPIIMGITMWIQQKLNPTPPDPI
                     QAKIFMFFPVFLTVILAPFPAGLVIYWSFNNIFTMIQQYIVQRKMTIKTT"
     gene            complement(460780..461031)
                     /locus_tag="SAR11_0467"
     CDS             complement(460780..461031)
                     /locus_tag="SAR11_0467"
                     /codon_start=1
                     /transl_table=11
                     /product="Uncharacterized conserved protein"
                     /protein_id="AAZ21289.1"
                     /translation="MNIISNILIGLIKFYKMVISPYLTPSCRYLPTCSEYTIECLRTY
                     GLVKAISKSTKRIFSCHPIKILGGGEGFDPVNKEFKAKK"
     gene            complement(461031..461375)
                     /locus_tag="SAR11_0468"
     CDS             complement(461031..461375)
                     /locus_tag="SAR11_0468"
                     /codon_start=1
                     /transl_table=11
                     /product="Bacterial ribonuclease P protein"
                     /protein_id="AAZ21290.1"
                     /translation="MKSKIVALSKNEDFKNLLKKKKISNKYITLFFGPLADKDNKKLN
                     ISFVAKKKLIRSAVKRNKIKRRLRNIMNEAIKKVSINFNYSYLVIAKITMLNNEYAII
                     KDTLFQDIEKIK"
     gene            461643..462362
                     /locus_tag="SAR11_0469"
     CDS             461643..462362
                     /locus_tag="SAR11_0469"
                     /codon_start=1
                     /transl_table=11
                     /product="DedA family protein"
                     /protein_id="AAZ21291.1"
                     /translation="MEKSKKVKITLGLFYLLVVSSFLYFFLSKFTLEELTSYEFIKNN
                     RDYFFGLKQTNLFLISLIFLTATIIWVVMAGFGLPVALLAGFIFGKWLGTIILIIGMT
                     IGATILYIIGNYFFKEIIKEKFLNRFKNLEVKFKKSEFIYLLAYRFIGGIPFALSNVL
                     PCIFNVRVSNFFWATLIGLTPPLFLVVSIGSGLEKIIEQNLEAPRIIDLIYSPDIYIP
                     MIAFGALLVAAIVARKIFYKK"
     gene            462365..462438
                     /locus_tag="SAR11_tRNA_r_26"
     tRNA            462365..462438
                     /locus_tag="SAR11_tRNA_r_26"
                     /product="tRNA-Thr"
     gene            462540..462737
                     /locus_tag="SAR11_0470"
     CDS             462540..462737
                     /locus_tag="SAR11_0470"
                     /codon_start=1
                     /transl_table=11
                     /product="unknown protein"
                     /protein_id="AAZ21292.1"
                     /translation="MGIHYDYKSTKGNKLMEKQAKREKKLAEKKAKREAKEGPKVQEE
                     PEKTLDASKPITLDFLTNPDK"
     gene            462737..462838
                     /locus_tag="SAR11_0471"
     CDS             462737..462838
                     /locus_tag="SAR11_0471"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ21293.1"
                     /translation="MNDKEKNEKLSLALRKNLKKRKIFQKKNKKKSK"
     gene            462838..463395
                     /gene="dcd"
                     /locus_tag="SAR11_0472"
     CDS             462838..463395
                     /gene="dcd"
                     /locus_tag="SAR11_0472"
                     /EC_number="3.5.4.13"
                     /codon_start=1
                     /transl_table=11
                     /product="Deoxycytidine triphosphate deaminase"
                     /protein_id="AAZ21294.1"
                     /translation="MSVLSDKSIRKLAVEQSMISPFIDKQVRDGKISYGLSSFGYDAR
                     VGDEFKIFHNVNSSIVDPKEFSSDNFVTKKSSDYIIIPPNSFALGTTIEVFKIPRDIM
                     CIVVGKSTYARTGIIVNVTPIESEFFGTVTLEFSNTTPLPAKIYANEGVAQFLFLKGD
                     QSPETSYADRKGKYMGQTGVTLPKV"
     gene            463398..464651
                     /gene="murA"
                     /locus_tag="SAR11_0473"
     CDS             463398..464651
                     /gene="murA"
                     /locus_tag="SAR11_0473"
                     /EC_number="2.5.1.7"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="AAZ21295.1"
                     /translation="MKKLEVFGAAKLKGQIRISGSKNASLPILAATLLSNKKISLANL
                     PRVKDIETMILLLKSLGSIIEDNKKELIIKNTKQTKTFAAYSLVKTMRAGILVLGPLL
                     AKFGKAKVSLPGGCAIGTRPVDIHLQALSKLGVKYKIIQGYVHANAPKGLIGANIKFP
                     KVSVGATENLIIAACLAKGKTTLSNCAIEPEIKDLVNFLINMGCNIKWTAKRTVRIEG
                     VNNLKELDYSVMPDRIEAGTYLIAAALTEGNLKITGIDPKIISTEINILKKVGSKITL
                     KKNEILIQGSKKIKNINIKTSPYPGFPTDLQAQMMVLLCKANKRSHIKEEIFENRFMH
                     VAELNRMGAKISINGNQASIEGNIKFEAAELMATDLRASVSLILAALAAKGKSVINRI
                     YHLDRGYEDIEKKLKKVGAKIKRIN"
     gene            464651..465046
                     /locus_tag="SAR11_0474"
     CDS             464651..465046
                     /locus_tag="SAR11_0474"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ21296.1"
                     /translation="MDKKYLSKIIATDNEGLQVISACCSGAEVKVNEIKYLQKNKVFL
                     LSLKRSKVETEEQDKKIISICKFEFVDRVKSKNIKQNDPEEKLELIGMDYLKNNDNYE
                     INLMFTNNAYITLSTEIIEVTLDDQNKAD"
     gene            465046..466332
                     /gene="hisD"
                     /locus_tag="SAR11_0475"
     CDS             465046..466332
                     /gene="hisD"
                     /locus_tag="SAR11_0475"
                     /EC_number="1.1.1.23"
                     /codon_start=1
                     /transl_table=11
                     /product="Histidinol dehydrogenase"
                     /protein_id="AAZ21297.1"
                     /translation="MIKILDSKNKNFDKTLDALLSKRKNKVQLNSVSVIKIIKDVKKN
                     GDKAILKYEKRFNKNSIIAPSIKQINRAIQSLDQKVKKAIDLAYDRIYKFHSLQKFKN
                     ISYTDKLKNKLEYKYVPIESVAIYVPGSTASYPSSVLMNAVPAIVAGVKRLVMVNPGQ
                     KGKQNPAVLYAAKKCKIKEIYSIGGPSAIAAVAYGTKKIKKVDKIIGPGNSYVAAAKK
                     EVFGDVGIEGMIAGPSEVTIVCDKFSNPEWIASDLIGQAEHDNLAQCILISKDKSIIK
                     KVNYEIINQLKELPRAVIAKNSLLNNGILIYMPSDQKIINTVNKIAPEHLELNTKNYK
                     KVVSKIKNAGSICLGKYAVMAMTDYNVGSNHVLPTNSSARYSSGVSVNEFYKRISYIN
                     LSKKGIETLGPSVITLANYEGLVGHAKSVEKRIRRK"
     gene            466335..466550
                     /gene="infA"
                     /locus_tag="SAR11_0476"
     CDS             466335..466550
                     /gene="infA"
                     /locus_tag="SAR11_0476"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor if-1"
                     /protein_id="AAZ21298.1"
                     /translation="MSKQEMLSFSGIVEDLLPNAMFRVKLENGHIVTAHAAGKLRKNR
                     IRVLQGDKVQVEMTPYDLTKGRITFRG"
     gene            466556..466631
                     /locus_tag="SAR11_tRNA_f_2"
     tRNA            466556..466631
                     /locus_tag="SAR11_tRNA_f_2"
                     /product="tRNA-Phe"
     gene            466720..466932
                     /gene="cspE"
                     /locus_tag="SAR11_0477"
     CDS             466720..466932
                     /gene="cspE"
                     /locus_tag="SAR11_0477"
                     /codon_start=1
                     /transl_table=11
                     /product="cold shock protein"
                     /protein_id="AAZ21299.1"
                     /translation="MSTLKGTVKWFNGKKGFGFIEREDKEKDAFVHASAVKTAGMRFL
                     NEGDKLEFEMEDGPKGPSAVNLKKID"
     gene            467168..467242
                     /locus_tag="SAR11_tRNA_f_3"
     tRNA            467168..467242
                     /locus_tag="SAR11_tRNA_f_3"
                     /product="tRNA-His"
     gene            467248..468645
                     /gene="hisS"
                     /locus_tag="SAR11_0478"
     CDS             467248..468645
                     /gene="hisS"
                     /locus_tag="SAR11_0478"
                     /EC_number="6.1.1.21"
                     /codon_start=1
                     /transl_table=11
                     /product="Histidyl-tRNA synthetase"
                     /protein_id="AAZ21300.1"
                     /translation="MNKENKLIPGLPSGFEDRWGKKLILKKKLINTIEANFVKFGFGA
                     LETPSFEISENIGSFLADDDSNPMSDVFSFKDGEKNITLRYDLSSPLARFVAQNNQEL
                     PLPYKRYQMGDVWRNEKAGNARYRSFLQCDADIVGNVNPAQANAELCNLIASTLLACG
                     LKKDQFVVNISNRKIVQGLIEDLKISDDKKIKVMRAIDKLDKPGFGLRGVEDLLKEER
                     VDASGAVTKGANLTDDQASQIINFLKVKDLKELKENLKNPLSQEGIKELEDLLEIVSY
                     GDYLDQIKTNFTIVRGLAYYDGFCVETNLNFKAKNSKGKEVDIGSICSGGQYNKLISR
                     FKGVDIPGTGMSFGVDRLLFAMMQLDQIEVDEKKPVIICVMDEKYLKNYYEILKVLRD
                     NNINSEIFLDSKKNLGKQLTYANKKQCPVAVICGENEFKDNTITLKNLLGVKGENNQL
                     TFPKENLINEIKKFI"
     gene            468623..469675
                     /gene="hisZ"
                     /locus_tag="SAR11_0479"
     CDS             468623..469675
                     /gene="hisZ"
                     /locus_tag="SAR11_0479"
                     /EC_number="6.1.1.21"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine-tRNA ligase"
                     /protein_id="AAZ21301.1"
                     /translation="MKSKNLSEKILRSVKSKGFKYIDLPSVIEANHIVQRSGENFRKF
                     IFSFTDQNGSELCLRPDLTIASCLRYLENNLKGKEKIFYSGQAYRKSNNKRDSIIRDQ
                     VGFEIIGSKDEKKDDKEIINTALKSLSNLQYSSGTLKIGNVEIFNLLISKLDIPKRWK
                     LRLSRHFWREEYFNDLLKRLETNSDVDPTIVEVDKKRYLKMLKDNQQTIVAGRSIEEI
                     LKRFDNKIKDPRRASRGKNVSKIIKEFLKINCPIGQAAENLNIFFKKNKINLVVDQKY
                     FPTSLNKIQKLNVEFSASFGRQLEYYTGMVFKIDIKSKSKNINVINGGRYDKLISDLG
                     SKKQVPAVGAALNLNY"
     gene            469675..470364
                     /gene="hisG"
                     /locus_tag="SAR11_0480"
     CDS             469675..470364
                     /gene="hisG"
                     /locus_tag="SAR11_0480"
                     /EC_number="2.4.2.17"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="AAZ21302.1"
                     /translation="MTKNIINIGIPSKGRLRADILKIFKKNKLNLVSERGERDLLGSI
                     KNLNNVKVLYLHAREIVERLGDGSLDLGFSGFDLLKESEVNIQKKISVVKNYGFGKAT
                     LVVAIPDPWIDVQTVADLEEIAFEFKDKKKKRLRVATKYPNLTREFLFSKGVTQFKLV
                     SSLGATEAYPFTGSSEIITDITSSGETLRANNLRILKDGEILKSEACMMASKSSLKNS
                     LVKKLVKLLSK"
     gene            470546..471643
                     /gene="rmuC"
                     /locus_tag="SAR11_0481"
     CDS             470546..471643
                     /gene="rmuC"
                     /locus_tag="SAR11_0481"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombination protein"
                     /protein_id="AAZ21303.1"
                     /translation="MDIILLTVLVLLLGVALAILYLNLRSKPKDESENKEAEEMANLK
                     TEITSLKDTLNTTINTSLGSMSTSFTALSTGVTKDMTEALTKVDEKVGNFNSQVELLN
                     KSQEGITKILAGVKKYGTLAEFSLDALIKDLLPASQFMTNVKMKEDTSENVEFAIKLQ
                     GDVLVPVDSHFPVEKFKAITDGYDADDKRAVADARAKLATAFKAKAKSVNEKYIVPPK
                     TTDFAIVYAPTESLYKELTEYQDPTTKELLTQELMKKHKVVICGPNTLSAYLQSLHMG
                     FQSLKVQKGATEIYDHLKTISSRFGKHFDNIIALRKKLEEAMIVVDKFGTDARSISRS
                     LENIKDPEQVDKAVQTENVEKFVDHSKQAKN"
     gene            471726..472370
                     /locus_tag="SAR11_0482"
     CDS             471726..472370
                     /locus_tag="SAR11_0482"
                     /note="possible atypical protein kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAZ21304.1"
                     /translation="MVSGSRMYAVNQEKLPSVTSILQATQSEEKKASLANWKARVGAA
                     EANRIKNDASSRGTSMHSHLEKYLLGQLNLELLEEEASKSKKMADEIIEQGIKGKLSE
                     IYGTEATLYYPGKYAGTCDACGVYEGQETIIDFKQSNKPKKEEWIEDYYLQLGAYSLA
                     HNVVHNSNITQGIVLLCTVDNLFQDFRIQGVKLEEYQNKFLEKVEQYYHQRNMN"
     gene            472372..473799
                     /gene="sbcB"
                     /locus_tag="SAR11_0483"
     CDS             472372..473799
                     /gene="sbcB"
                     /locus_tag="SAR11_0483"
                     /EC_number="3.1.11.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Exodeoxyribonuclease I"
                     /protein_id="AAZ21305.1"
                     /translation="MNLAIWDIESSSANTSWGSIIEVGGILVDPNFKELDRFNFRCRL
                     PEGEVPQAMALIVNKTSVDLLTKGNLSHYQMLSQLEATFKKWSPAMFMGWSNIGFDDE
                     MIRNEFFRGIRYPYITNATPNKRHDGLNIVRGAHAVDESVVKTEINAKGNAVMKLESL
                     ARMNGFESSGAHSALFDAELTVKVLGLIKKNQPQTWDTFLRTANKSDTETIFKTEKMF
                     TLAEYHFGKNYRFVVAPLHPKHCIHPIYQWGQAFDLKIDPIPLFDMSISELKSAIKKL
                     KFLRTIRSNKAPIILDASYGLQVEPYSNLDPDLIKERAKLVNSNERFSQNVLTALRET
                     AEEKAQFDSQVDLLAEETIYKKFTPQKDTALFPKWHAASWKDKLILLDKFEDERMVSF
                     GKKIIYQESPETLPPDMFKTIKRGIAERILSDEKEKWWTCKEFYFECDNLRDRYTNEK
                     DEKKLKFLDEINEFVEGIQKKYEQA"
     gene            473875..474192
                     /gene="trxA"
                     /locus_tag="SAR11_0484"
     CDS             473875..474192
                     /gene="trxA"
                     /locus_tag="SAR11_0484"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin 1"
                     /protein_id="AAZ21306.1"
                     /translation="MLIDFKDEEFETKIKNEDISVVQFSAEWCAPCKSLKPIMDKFSD
                     SYKDKANFYYADIENGGINTGSAAGVRGVPTVIVYKKGVEVDRKVGGVAESQMKEFLD
                     KNI"
     gene            complement(474189..475457)
                     /gene="folC"
                     /locus_tag="SAR11_0485"
     CDS             complement(474189..475457)
                     /gene="folC"
                     /locus_tag="SAR11_0485"
                     /EC_number="6.3.2.12"
                     /codon_start=1
                     /transl_table=11
                     /product="FolC bifunctional protein (Folylpolyglutamate
                     synthase/Dihydrofolate synthase)"
                     /protein_id="AAZ21307.1"
                     /translation="MKLQKIVERLQKLHPKEIDLSLDRTKNLLEKLGNPQDQINCISI
                     VGTNGKFSTIQALYAILKEADYKCNIYTSPHIQKINERFVFNNKPLTDDELANLFSEV
                     EEANNQTQITFFEILTVAYFHYAKKYPENINLIESGLFHRFDATNILKKNLASIVTAI
                     GLDHLDWLPKEEQTVEKIIFEKTSTLLNSKIVVAKQSSNEISKSIENTIKDNTSKKII
                     FNKNYNFTLKENDFFYFEDEFGALKLPKPNLPGEFQLENVSTAIATVRQLTDYKITDE
                     HIKSGITKIESIARLQELKSGKLKDLTSNNLLFVDGSHNPLGAKVLNEYLQSLNCNKH
                     IILGMMANKDHNEYMSYFKDIKSLTTIDIPNQPNAIKGSELKEKIKNFENINYKNSIE
                     EAISSIDLQENDIILITGSLYLAGEVLNLN"
     gene            complement(475411..476340)
                     /gene="accD"
                     /locus_tag="SAR11_0486"
     CDS             complement(475411..476340)
                     /gene="accD"
                     /locus_tag="SAR11_0486"
                     /EC_number="6.4.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="Acetyl-coenzyme A carboxylase carboxyl
                     transferase subunit beta"
                     /protein_id="AAZ21308.1"
                     /translation="MNWIKKTLRFGEKIKTIIKARATKTEIANSDWTSCCKGPILKKD
                     LEENLWVCPSCNKHHRISPRQRFDIIFGKNNYEVLKTPIPQDDPLNWNDAKPYKDRLK
                     AARKKTGMDCGMMVVNTNILNLKITAIASDFDFVGGSIGAAEGEAFLYGIQHAIENEQ
                     PFVVFTSGGGMRMMESLISLSQMTRTTLAINELKKNNLPYIVVLTDPTAGGITASYAM
                     LGDLHLAEPGALIAFAGARVIQGTVREELPEGFQRSEYVEKTGFVDLIVERKDLREKI
                     GSLLSILLKKNSAINSSENETSEDSRALTKAAS"
     gene            complement(476337..477134)
                     /gene="trpA"
                     /locus_tag="SAR11_0487"
     CDS             complement(476337..477134)
                     /gene="trpA"
                     /locus_tag="SAR11_0487"
                     /EC_number="4.2.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="Tryptophan synthase alpha chain"
                     /protein_id="AAZ21309.1"
                     /translation="MSLINLAFKKVKTEKRPALLTYTVAGDSTKKKSLEILKSIAKYA
                     DICEIGFPHNTPIADGGQIQSSAYRALKNGIKIKDVFSIVKNFKKSKQSKPVILMGYY
                     NMIYQYGDNNFINICKKVGVDGLIVVDLPYPENKEFAKKCKKKDISFIQLVSPTTSLD
                     RMKKIIRDSHDMVYYISMLSTTGGKLKVSPKKILERYGKIKKLNKNKNIVIGFGITEK
                     TIASLRKADGLVVGSALCKEISNSIKKRQNPVTNVTNIVLKLRKKIS"
     gene            complement(477136..478368)
                     /gene="trpB"
                     /locus_tag="SAR11_0488"
     CDS             complement(477136..478368)
                     /gene="trpB"
                     /locus_tag="SAR11_0488"
                     /EC_number="4.2.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="Tryptophan synthase beta chain 1"
                     /protein_id="AAZ21310.1"
                     /translation="MKLKKKIPLIDQHNKNGFWGGKFGGNFIPETLKKPIEDLTELFE
                     KLRYDKKFLKERDYYFKNYIGSPTSFIKLQNLSDHLSGAQIYAKMVSEANGGAHKIYN
                     ATVHCLIAKKAGKKYVVGDTGAGYAGKMLSMAAKKFGLKCKIFMGAKDIKRQKPNVDA
                     MKKNGAEVVPVYSGSQTLVDAVSECMRYWVSNCDNTHMCVGSTVGPNIFVKICGWSTA
                     QISRELKVQIQSEFKKMPKKIKLINCVGGGSSAYGFWSEFIDYDKKQIELIGVEAGGP
                     KNSKLHAAPLTNGAKLGILHGAAAYVCQNSEGQINDTASISAGLDYPGVSPIHCFLKD
                     TKRARYTSATDEAALNAYKLVTKLEKINPSLEPSHAFAEAIKIAPKLNKDTIIIVNSC
                     GDAKKDRDILKERLGKIN"
     gene            complement(478358..478987)
                     /gene="trpF"
                     /locus_tag="SAR11_0489"
     CDS             complement(478358..478987)
                     /gene="trpF"
                     /locus_tag="SAR11_0489"
                     /EC_number="5.3.1.24"
                     /codon_start=1
                     /transl_table=11
                     /product="N-(5'-phosphoribosyl)anthranilate isomerase"
                     /protein_id="AAZ21311.1"
                     /translation="MIQPCKICGISDSKTLEFLTSHPTPPKMIGFICNWPKSKRFVEH
                     SKLKKLLKVDKKKSEYVAVLVKPNEDILEKIKDLPFDYYQLYDCTPTEVKSVKEKYNK
                     KIIVAITVKDQNDTVKYLEYNELADIILFDSKGYEKSMSFDHQLIKNIKINKELMLAG
                     NIQIEDNLENYKEIADIIDISGGLETSGLKDVSKINIFLNKIKLINNET"
     gene            complement(478984..479676)
                     /gene="pyrF"
                     /locus_tag="SAR11_0490"
     CDS             complement(478984..479676)
                     /gene="pyrF"
                     /locus_tag="SAR11_0490"
                     /EC_number="4.1.1.23"
                     /codon_start=1
                     /transl_table=11
                     /product="Orotidine 5'-phosphate decarboxylase"
                     /protein_id="AAZ21312.1"
                     /translation="MMNKNIFVACDTSSLKEIKKIISDTKTNKLQIIPKFGLQFFYSK
                     SGRAFLQNFKRDYFLDLKINDIPQTALSAMDSLKDLKKCKYITVHVSGGLEMLKAITK
                     KAKSINKNLKVLGVTILTSLNKKSLEEIGHTKTVEQLVLKQAGLIKKSGAAGIVCSAQ
                     EAKIVRKKYKNLFIVTPGIRLPGDDANDQSRVMTPNDAFKNKVSGIVMGRSLIKGNIK
                     NNIKRLINHLNQ"
     gene            complement(479666..479956)
                     /gene="himD"
                     /locus_tag="SAR11_0491"
     CDS             complement(479666..479956)
                     /gene="himD"
                     /locus_tag="SAR11_0491"
                     /codon_start=1
                     /transl_table=11
                     /product="Integration host factor beta-subunit (IHF-beta)"
                     /protein_id="AAZ21313.1"
                     /translation="MAIVKSKLLKQLANNYPNFLKKDLEKFTDIILTEIKQALKRGDR
                     VELRGFGMFSTNIQKARISRNPKTGEKVNTPEKKTIHFKMSKEMFKKLNNDE"
     gene            complement(479960..481690)
                     /gene="rpsA"
                     /locus_tag="SAR11_0492"
     CDS             complement(479960..481690)
                     /gene="rpsA"
                     /locus_tag="SAR11_0492"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S1"
                     /protein_id="AAZ21314.1"
                     /translation="MEIYKDLSNPASKEFEQLLNSQFTKTANLEEGKIITGVVNKVTD
                     NFVFLEVPGLKSEPILDINELKSMGMLDKAKVGEKISVLLERLEDKKGEVLVSASKAQ
                     KIQGWDKLVEAYEKNEPIMGKITGRVKGGCIVEHIDTGSLMFLPGSQISDKPLKDISH
                     LMNEPQKFALIKLDKVRGNACVSRREIISSFKKEDKIKIVEKFKVGDIIKGAEVKGYS
                     SFGCFFSVNGELDVLVHLQEISYSRVNHPDEVFTIGEKHDLKVISVDLEKLQVGCSVK
                     QLTPDPFENISNYELNKIYKVKVVKLMDFGAFCELEKGLSTLLHSSELSWTKKNISAK
                     KMFKVGDEIDCVITEIDKEKRRVAISHRLTTDNPFETFEKTYPIGSEVEGEVASKNEY
                     SIFLKVDGLDIDAFLHCNDLTYLNNGEEELAKYKIGDKLKVKVLEVKAAEQKVRVGLR
                     QTQPDPFDWFNDKKVKQTITVKIISTDNKGLVVRPEGCEMDFIIKKSAIAINAADARP
                     ARFTGGERIDCAIQELDIDKRKATLSIKLLEEIERKVALDTYGSEASGKNLPFSSLSD
                     DLEKKKKEDE"
     gene            complement(481690..482343)
                     /gene="cmk"
                     /locus_tag="SAR11_0493"
     CDS             complement(481690..482343)
                     /gene="cmk"
                     /locus_tag="SAR11_0493"
                     /EC_number="2.7.4.14"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytidylate kinase"
                     /protein_id="AAZ21315.1"
                     /translation="MKLKKKIKIAIDSPAAAGAGTQAKLISKYFNLFYLDTGKIYRLI
                     ANIKLTQPNKYSHSLIKKKMLKLTMKDLQNKKLLSDEVGTMASIISKDKKIRKLVHAF
                     QIKSAYHPPKKYNGSCLDGRDITYKIIPDADFKFFITANTKTRALRRYKELKGLNKKI
                     SFNEVLKSIKNRDKSDYNRKVSPLMRTRDSVLINTTNLTKRSCFLKIKQIMDRKLKA"
     gene            complement(482340..483527)
                     /gene="aroA"
                     /locus_tag="SAR11_0494"
     CDS             complement(482340..483527)
                     /gene="aroA"
                     /locus_tag="SAR11_0494"
                     /EC_number="2.5.1.19"
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="AAZ21316.1"
                     /translation="MSEDVLAAIDSIKKLGIKVRIQKNYCEIVGNGINGFKYIKNLTI
                     DAKNSGTLGRLILGLLIKSPKKIKIIGDKSLSKRDFSRVTTPLRKFGVKFFYKIKNKL
                     PLTILGTQSAKGIKYFENKGSAQCKSSVMLAALNASGTTSIKAKKSRNHTELLFKYLK
                     IPIKVRKTKKFDFIDIKKPKKIIAFNYQIPGDISSSAFFMVLTTLADNSKLLIKNVNI
                     NPSRVGVITILKKMGAKITLENQKNYRGEKISDILIKSSKKLKAINCPVELNSSAIDE
                     FLVIFLIAAKAKGISYFKDLSELNQKESPRLIWGSKILNMMGIKTDLTNDSIKIYGQP
                     DLEIKKPITVKNYLKDHRVFMMSTIAALTFGGKWKIYDKDSINTSFPSFLKIIKNINH
                     SSL"
     gene            complement(483672..484448)
                     /gene="yhbG"
                     /locus_tag="SAR11_0495"
     CDS             complement(483672..484448)
                     /gene="yhbG"
                     /locus_tag="SAR11_0495"
                     /EC_number="3.6.3.25"
                     /note="YhbG"
                     /codon_start=1
                     /transl_table=11
                     /product="probable sulfate/thiosulfate import ATP-binding
                     protein cysA"
                     /protein_id="AAZ21317.1"
                     /translation="MGVIKKFRIKSFKNPQPFISLENISLSFGKRKILDNVSFKINHG
                     QILGMLGPNGVGKSTIFNLITGLIKPDFGKIKFEGIDVVDYPIYLRTTKFRIGYVPQY
                     GGYFSDLTLLENLKAIAEIVIDDKNLIHHKIDMLIAKFELDAIRDIKAKFLSGGQKKK
                     LVIALALLSDPKVLLLDECFAALDVLTIKMLQEIIVNLQTESNITICICDHQARDLLS
                     CVDVAVILSNCKIVAQGSPNELINNTEAKNAYFGDSFKFN"
     gene            complement(484450..485034)
                     /locus_tag="SAR11_0496"
     CDS             complement(484450..485034)
                     /locus_tag="SAR11_0496"
                     /codon_start=1
                     /transl_table=11
                     /product="unknown protein"
                     /protein_id="AAZ21318.1"
                     /translation="MNKKTGLQVVMVLIIILISLWFYLKYFTENFEDVKETQVKEKID
                     ENQNSNSTYIDDINYVSTDVKGNKYQITAKQAEIKVENSDVMFLRDVVAFIFIKDSDT
                     VKITSNFGKYNSKNYDTIFSENVIVIYPRHKISGEYLDFSFLSNLGTFTENVVYAGEK
                     TNLYADKIEMNLTTKDTKIFMNDTGKKVLIEGTK"
     gene            complement(485035..486006)
                     /gene="gutQ"
                     /locus_tag="SAR11_0497"
     CDS             complement(485035..486006)
                     /gene="gutQ"
                     /locus_tag="SAR11_0497"
                     /EC_number="5.3.1.13"
                     /codon_start=1
                     /transl_table=11
                     /product="Arabinose 5-phosphate isomerase"
                     /protein_id="AAZ21319.1"
                     /translation="MKKRNYKKIAKSVIDLEIKALKKLKDSINNSFNEAVESLANCQS
                     KVILCGVGKSGLIAAKISATLSSVGTPSFSLSANDCSHGDLGSISKKDILILISYSGS
                     TEELKNIIKYANRNKITLIGIMSKKNSILYKASDIKLLIPEVTEAGLGIVPTSSTINQ
                     LSIGDALAVAVLNKKNINKKDFKKFHPSGNLGAQLRTVEELMITGKKIPFVNESLNMK
                     KALQIISNKKLGTLIVQNNKKITTGIITDGQIRRVNAMSNNLQDLSVKKVMTKNPISI
                     NLDTLAEKALSIMNAKKITSLCVHKDKNKKKTIGILHIHNILHSNIR"
     gene            complement(486007..486618)
                     /gene="rnd"
                     /locus_tag="SAR11_0498"
     CDS             complement(486007..486618)
                     /gene="rnd"
                     /locus_tag="SAR11_0498"
                     /EC_number="3.1.26.3"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease D"
                     /protein_id="AAZ21320.1"
                     /translation="MNIDIKLHKNDLPEDLDLGNIIAVDGEFMGLNVKRDPLCLIQIS
                     TGNSDAHIIQLDREKYDAPNLNKVLSDASIIKIFHYGRADMAHIKHYLKTETNNILDT
                     KIASKLARSYSDSHSLKTLIKEFMNVDVSKQFQSSDFGGELSPAQLKYCANDVIYLHK
                     IHEELNKILVREKRIDLYKSCLAFLKTRVDLDLALFKDDIWSH"
     gene            486635..487603
                     /locus_tag="SAR11_0499"
     CDS             486635..487603
                     /locus_tag="SAR11_0499"
                     /codon_start=1
                     /transl_table=11
                     /product="probable NADH-ubiquinone oxireductase"
                     /protein_id="AAZ21321.1"
                     /translation="MKAKNCLIFGGSGQIGRHLIRKLTKNNYKVTVVTRNLHQKGYAI
                     KTQANAGYIDIVEANIFDEKKIRKLFSQTDICINLIGILYESGKGNTFKNIHSIFPSI
                     LSKLCKEYKVQQFIHLSALGINDAPDSEYAKSKLDGELNIQKNFPLATILRPSVVYSV
                     DDNFTTSFMTLLSRLPFFPLYYNGSTKFAPIHCSDLTDTIYHVVSKSIYSKIIECVGP
                     DILSLKEILKKLLHLIDKKRLLVPLPLFVATMSAKVFQLFPKPLLTIDQLTLLKYDNV
                     PSGKYQTNADIGVPSTRVFDNEVEKYSYMWREGGQFSTKKYNPANS"
     gene            complement(487775..488275)
                     /locus_tag="SAR11_0500"
     CDS             complement(487775..488275)
                     /locus_tag="SAR11_0500"
                     /codon_start=1
                     /transl_table=11
                     /product="Uncharacterized protein conserved in bacteria"
                     /protein_id="AAZ21322.1"
                     /translation="MSWNEEKVEKLKELWGKGSTASQIAEIIGGISRNAVIGKAHRLN
                     LSSKIKTRNASSSQNFDNSSEENSSKQKRGRKSKFQSLIIEKDFEPENPKKLEELDES
                     SCKWPIGHPEEQSFYFCGRSSLKDFSYCKLHLLYAYQPKGRKEEPVADKDEETPQYID
                     KKINTA"
     gene            488408..489211
                     /locus_tag="SAR11_0501"
     CDS             488408..489211
                     /locus_tag="SAR11_0501"
                     /codon_start=1
                     /transl_table=11
                     /product="YadH-like ABC-2-type transport protein"
                     /protein_id="AAZ21323.1"
                     /translation="MDKKYHIGVKKFGFVNWIGFKSLWLKECNRFMAVWQQTLLSPLV
                     SSLLFLSVLSLALGNNRGDVLGYSFINFLAPGLIAMSILTQSFSHSVSSLMIGKIQGN
                     IVDMLYAPLSALEVSMAIILAALTRSFLIAIISIAVFSLIVDITIYNIFYIFVFGFLG
                     AFILGSLGFITGLWAEKFDHTATVINFIITPLSFLSGVFYSIDKLPQFFQTISHINPF
                     FYMIDGFRYGFLGKSDGSITVGLIYLIILSVLMWYVAFLLYKKGYKIKS"
     gene            489215..490381
                     /gene="argD"
                     /locus_tag="SAR11_0502"
     CDS             489215..490381
                     /gene="argD"
                     /locus_tag="SAR11_0502"
                     /EC_number="2.6.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="Acetylornithine aminotransferase"
                     /protein_id="AAZ21324.1"
                     /translation="MSALAKNYNRKKISFKYGKGSFLYSTNGKKYLDFVQGIAVNSLG
                     HANPNLIKAVNKQSKKLWHVSNAFIIPEGEKLAKRLAKKTFADFIIFQNSGAEATEAA
                     IKVARRYFYSIGQPSKNRILCVKNSFHGRTLATIYASGSKKMTEGFGPKVDGFDHFEF
                     GNHKDFKKKITKKTAAIMVETVMGEGGIKVIPNWCLKELRKICDKKKILLILDEVQCG
                     IGRSGNFFAFENSKIKPDIVPIAKGIGGGFPLGAVLMNKKVASGMTAGTHGSTFGGNP
                     LAMSVGNAVLDQISKKGFLSNVKKLSKYFHSELNILRKKFPKIIKEVRGVGLLIGLQL
                     HNDQTKFIQKLMDNKLLTIRAAENVIRILPPLNVKKEEIKIAINIIEKVCSTYK"
     gene            490384..491313
                     /gene="argF"
                     /locus_tag="SAR11_0503"
     CDS             490384..491313
                     /gene="argF"
                     /locus_tag="SAR11_0503"
                     /EC_number="2.1.3.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Ornithine carbamoyltransferase"
                     /protein_id="AAZ21325.1"
                     /translation="MKHFINLKDIPSADLKKIIIDAKNRKQKRKNYNTLEVDKDKPLK
                     GKLLIQMFEKASLRTRLSFYLAIKQLGGGTITLRANELHLGKGGESLADTAKILSTYG
                     DGFMLRTDSDKKIEEFSRYLKIPVINGLSPSSHPTQVLSDIFTVEEIKKKSISKLNIC
                     WIGDSNNVLNSLIAASVKFSFNLNIGCPKNYGPKKFVLDWVKKNKRKIHIFYDAKKAV
                     KNADVIFSDKVISLNDKVNKNKKIKDFRNFQINSKLMSFAKKDTTFLHCLPRGEEVAA
                     DVFLGKNSEVWLQALNRVHVQKSILLYCFGKLR"
     gene            complement(491305..491844)
                     /gene="cycM"
                     /locus_tag="SAR11_0504"
     CDS             complement(491305..491844)
                     /gene="cycM"
                     /locus_tag="SAR11_0504"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="AAZ21326.1"
                     /translation="MDSFELNKIIAAILMVALLVIGLGKVADGVFHVNKPENPGYQVE
                     VEGQPASTVSQVAEVEQKVDIAAIMALGDVTLGEKIFKKCAACHSIEKGGPNKIGPAL
                     YNVVGSKVGAVEDYKYSKTLASYGKDWTFEELNGFLTKPSSYLKGTKMSYAGLRKEAD
                     RASIIKYLNQNSDSPKQLP"
     gene            491948..492688
                     /gene="kdsB"
                     /locus_tag="SAR11_0505"
     CDS             491948..492688
                     /gene="kdsB"
                     /locus_tag="SAR11_0505"
                     /EC_number="2.7.7.38"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-manno-octulosonate cytidylyltransferase"
                     /protein_id="AAZ21327.1"
                     /translation="MAKTLILIPSRMSASRLPGKPLLTINNLSIISHVFKRAEETNIG
                     EVVVATEDQEILDDVEKNGGRAVLTSNTHKTGTDRIFEAYEKLNIKDIDFILNLQGDE
                     PNINKNDIINLNNFMINSNSGIGTLAAEIKNDKMLIDQNIVKVITETKLEKNNFPIAL
                     NFTRDGFSRNDQNIYHHIGIYSYKTSTLKKFVSLDQTFKEKKNRLEQLRALDNDLKIN
                     VALANFSPIGVDTKEDYLAIKKIMEYKS"
     gene            492690..493520
                     /gene="pheA"
                     /locus_tag="SAR11_0506"
     CDS             492690..493520
                     /gene="pheA"
                     /locus_tag="SAR11_0506"
                     /EC_number="4.2.1.51"
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydratase"
                     /protein_id="AAZ21328.1"
                     /translation="MTKIYFQGTFGAYSHLAALEIDPKAEIIPCKTFDECFLKTSQDK
                     NSRMVIPESNRITGNIGIEYLIFKYRLNIYAEHFQKIEHNLLGQPDSNLSDIKDVYSH
                     AQALSQCSKFIKKNNLVEHIRADTAGSAETISKSKIKTEAAIASTLSAEIYDLKILSK
                     NIENEKGNATRFLVMGNEVLQPDFGDKKYITSFLFKLKSKPAALYQSLGGFAINGVNL
                     TKLQSYPEQNSFESYFFLCDLEGHIDNPKVQKSLEELGLHCQDFHVLGVFEADKFREK
                     "
     gene            493665..495338
                     /gene="dnaX"
                     /locus_tag="SAR11_0507"
     CDS             493665..495338
                     /gene="dnaX"
                     /locus_tag="SAR11_0507"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed DNA polymerase gamma/tau subunit"
                     /protein_id="AAZ21329.1"
                     /translation="MNKNTKVLALKYRPQTFNDLIGQDVVAETISNSIKANKVPNAYL
                     FTGIRGIGKTTTARIVAKSLNCSNGIDNLCKEELCENCNAISNSNHIDVLEMDAASKT
                     GVDDVRDLIEFSRYGPTTAKYKIFIIDEVHMLSKQAFNALLKTLEEPPEYLKFIFATT
                     EIKKIPITVVSRCQRFDLSRIKSLELFDFIRKIKEKENGNASDDALKLIVKISEGSVR
                     DALSLLDRALLTLDKDKELDLAAAQKIFGYFDKSQLIDLFELIFEGKETEVLNTYREI
                     YNQGVEPKIFINDFLELLYYFKNIDSLNLDGNNFLLNDEEFNKIKDLSEKVNNETLIL
                     FWQFTIKTLEELDIVSNQHLSMEMFLIRLIHLKSIKQESEKYKEDSKLLVESENQTSF
                     SPKKTNEDIFGIKDKSETIGQMKNIVQEKDIKEKENNNIETNTSLINSFDDLLKACSS
                     KKEIKLKYELEKNVNLVSFENKRIEISFNEDLDKDFIKDLSTKLFEWTNERWIISLSK
                     TKGQPSKKEEEINEKKELIESVKNSSIYKDILKNFPDAELIDVKPRKED"
     gene            495342..495659
                     /gene="ybaB"
                     /locus_tag="SAR11_0508"
     CDS             495342..495659
                     /gene="ybaB"
                     /locus_tag="SAR11_0508"
                     /note="YbaB family COG0"
                     /codon_start=1
                     /transl_table=11
                     /product="Uncharacterized BCR"
                     /protein_id="AAZ21330.1"
                     /translation="MTDFTKILDKAKELEAKMKESQEKIKNIQVEGTSGSNSVKVTLN
                     GENEMIKIDLSDEILKENKIIIEDLIVAAHNNAKSELKSKTSEEISKSTSGLGIPGFK
                     WPL"
     gene            495664..496275
                     /gene="recR"
                     /locus_tag="SAR11_0509"
     CDS             495664..496275
                     /gene="recR"
                     /locus_tag="SAR11_0509"
                     /codon_start=1
                     /transl_table=11
                     /product="recR-like protein"
                     /protein_id="AAZ21331.1"
                     /translation="MQNINEIEELIKLISKLPGLGPKSAKRIVLKLINNRDELVKPMA
                     NTLAQVYKNVIRCQSCGTLKSNSLGCNNCENSKEKYNKICVVEDIADQWSIENSNIYK
                     GYFHILGGTISSAGQRKEDLLINSLVERVSRENIEEVILATSATVEGQTTAYYIEDSL
                     KKTSTKVTKLAQGLPVGGEIESLDDGTLYSAFKNRTGIKTNSD"
     gene            complement(496262..498457)
                     /gene="glcB"
                     /locus_tag="SAR11_0510"
     CDS             complement(496262..498457)
                     /gene="glcB"
                     /locus_tag="SAR11_0510"
                     /EC_number="2.3.3.9"
                     /codon_start=1
                     /transl_table=11
                     /product="malate synthase"
                     /protein_id="AAZ21332.1"
                     /translation="MGAMKEQYTKIHNLSVSNKLLNFVNEELLKDTNISSEKFWEGFD
                     QVVHELAPKNKELLKIREDLQKKIDDWHIANKGNEINLEEYKKFLKEIDYLKEVGPDF
                     KIKTNNVDEEITSIAGPQLVVPIMNERYALNAANARWMSLYDSLYGTDVIDQSEDSPT
                     QRYDPLRGEMVIKYGRDFLEKYFPLENFEWHNITAFKIDNGSLTVLKDSNKSSLKNKD
                     KYIGHRGEANDPSAIILKNNNLHIEIIIDPNAFSAQQDPAKISDIIVEAAVSTICDNE
                     DSVAAVDADDKVICYRNWLGLMKGDLKSTFEKNGKTYERKLNPDRSYISKDGKGLKLH
                     GRSLLLVRNVGHLMTNSAITLKDGSEIPEGIMDAFITSAACLHDIKKKGNSRTGSIYI
                     VKPKMHGPDETSFTDLIFTKVEEVLGLEKYTCKIGIMDEERRTSSNLKECIRTLQNRV
                     FFINTGFLDRTGDEMHTSMEAGPMIKKGDMKSSKWIGAYENNNVDIGLQCGLSGKAQI
                     GKGMWAMPDKMKEMMEQKTSHLNAGANCAWVPSPTAAALHALHYHEINIFEKQKEIQK
                     RESAKLDDLLTIPVADRPNWSMEEINSEISNSAQTLLGYVVRWIDHGVGCSKVPDINN
                     VGLMEDRATLRISSQHIANWIHHDICTKSQVMEVMKKMAKIVDDQNKNDGAYTRSGRG
                     SYEMMSENFEQSIAFKTACDLIFKGKEQPSGYTEPLLHLNRLLKKSSQN"
     gene            498707..499813
                     /gene="accA"
                     /locus_tag="SAR11_0511"
     CDS             498707..499813
                     /gene="accA"
                     /locus_tag="SAR11_0511"
                     /EC_number="6.4.1.2"
                     /note="similar to carboxyltransferase alpha chain -
                     Aquifex aeolicus"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase"
                     /protein_id="AAZ21333.1"
                     /translation="MKNYLNFETDIKNLEIEIDKLKDPYNQDGLSEVDTKKISESQKE
                     IDNKLQEIYSNLDPWQTTLVARHEDRPKAKFFIDNLFEDFIPLSGDRYYGEDKSVLAG
                     FAKFDEKSVLVIGQEKGDSLESRIERNFGMMRPEGYRKTIRLMKLANKFNIPIISFID
                     TPGAYPGVGAEERGQAEAIAKSIECCMSLNVPTLAIVIGEGGSGGAIALASSNKVIML
                     ENAIYSVISPEGCATILWRDPKRTLEAAKAMKLSSKDLLELKVIDEIIPEPIGGAHRD
                     RDLILDNVRKSIEKNLNEFFNMSGEEIFNHRKNKFLTIGRSKGFVNQIDDLSTLSMKE
                     SKVNLFIKNFFKSKLNLAVLFGVIVLLGYFIFSL"
     gene            complement(499808..502372)
                     /gene="secA"
                     /locus_tag="SAR11_0512"
     CDS             complement(499808..502372)
                     /gene="secA"
                     /locus_tag="SAR11_0512"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase secA"
                     /protein_id="AAZ21334.1"
                     /translation="MLNPLNFITKFIKSSNQKELDRINKIVVKVNSLEASVKNLSDED
                     FPKKTTELKDKLKNGENLDTLLPEAFALVREASKRTRNERHHDVQILGGVVLHEGKIA
                     EMRTGEGKTLTISLAAYLNALTEEGVHIVTVNDYLAKRDSQEMGEIYKFLGLTFGFIN
                     NDQDDLERKKNYNFDITYATNSELGFDYLRDNMKFSKEQMVQRGHVYTIVDEIDSCLI
                     DEARTPLVISGAAEDKTEQYLAIDKLIKRLLPEHYEIDEKDRNILLTNEGINNVEKIF
                     SDAGILKNNNFYDPENLSLVHHVNQSLRAHHLFEKGKDYIVKDGTLKIIDELTGRILE
                     GRRFGDGLHQALEAKERIDVQAENQTLASITYQNYFKLYNKISGCTGTAATESQEFYE
                     IYNLVVVIIPTNKEMIRKDWNDQIFRTEEEKNKAIIEKVLECHKQGQPILVFTSSINK
                     SEIYSKLLNDEKIKHVVLNAKNHENEAEIIANAGKMNSVIITTSISGRGVDIQLGGKK
                     GSQPDDELLENKNKIKSLGGLFVIGTERMESRRVDNQARGRAGRQGDEGSSIFYVSLE
                     DDLMRIFGSESMNNILQKLGLKDGESIDHPWINKALERAQQKVEARNFDIRKNLLKFD
                     DVLNDQRHVIFSQRNGVMNSEKVFDYSDEFLSEIISHLISLKTQKLSTTKNNEFNNQL
                     KTLLGKSVDDNEFKNVTELKDEEFKNKINSKFLEARNERIKMLDEEKAKEVEKRIFLQ
                     CIDLNWKSHIQYLEQLRQVIGLRSYGQRDPLVEYKKEAFFLFENLLNKLKMDFVTILI
                     NLKIVQEPSESISRPLKKETSNDPNCLLIKRKNEKISRNEKCEATGKKFKNCCGAL"
     gene            502576..503739
                     /gene="argJ"
                     /locus_tag="SAR11_0513"
     CDS             502576..503739
                     /gene="argJ"
                     /locus_tag="SAR11_0513"
                     /EC_number="2.3.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="ArgJ family"
                     /protein_id="AAZ21335.1"
                     /translation="MVMFYFRDGANYASVYTQSKIVSENIKWNLNIKSKKISSLIINT
                     RNANAFTGSDGYKGLKEIAEEAALQLTKKQTEDEDFPKKISSNQVLFGCTGTIGEKYP
                     TEKIKKNIPELIKKIKYTQNKFTWMKAALGIMTTDLQPKISMEECKIGNKNVKIYGIA
                     KGSGMIFPNMATTLGYVFTDADLSNDILNKLLKKNINTTFNAISCDGDTSTNDMVSIF
                     STGKVKNSIINNINDKKIFSFDKALHSVLLNLSKRVVKDGEGATKFITINIVKSKSEK
                     EARVIAFSIANSNLVKTAIAGEDPNWGRIIMAIGKSGVKIDLKKLAINFGGIKIIEKG
                     QIFKYYKENEATNYMKSQSIDISVDLNMGSKSFTAYTMDLTKKYIEINADYRS"
     gene            503781..504212
                     /locus_tag="SAR11_0514"
     CDS             503781..504212
                     /locus_tag="SAR11_0514"
                     /note="similar to protein of unknown function (DUF1178)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAZ21336.1"
                     /translation="MIKYKLICKDCETTFDSWFSSSKEYEKLKKKKFLNCHFCNSLNV
                     GKGLMSPNVSTSKNILTDIDSSSEKYKEIKKTIYKYQEFIKKNFEYVGENFAYEARSL
                     HYKDKKKAKGIYGTATKKDLNELKEEGIKAEILPWIKDTTN"
     gene            complement(504209..504931)
                     /gene="ubiG"
                     /locus_tag="SAR11_0515"
     CDS             complement(504209..504931)
                     /gene="ubiG"
                     /locus_tag="SAR11_0515"
                     /EC_number="2.1.1.64"
                     /codon_start=1
                     /transl_table=11
                     /product="probable 3-demethylubiquinone-9
                     3-O-methyltransferase RP622"
                     /protein_id="AAZ21337.1"
                     /translation="MNSINKKEIEKFSKIAEEWWDPNGKFKPLHNFNPIRIRYIKENI
                     IKDFKIRSSDKPLKNIKLLDIGCGGGLLSEPMCRLGASVVGIDASKKNIEVAKFHAKK
                     NKLKIDYKVASPEMLKDKKKFDVILNMEIVEHVNDIDFFIKESSKLLKKNGIMFIATL
                     NKTLKSYVFAIVGAEYILKWLPIGTHDWEKFVKPSELIDISKKNNLSLKKLDGMNFNI
                     LDNSWKVTNDTSVNYITKFIKN"
     gene            504997..506208
                     /gene="lysC"
                     /locus_tag="SAR11_0516"
     CDS             504997..506208
                     /gene="lysC"
                     /locus_tag="SAR11_0516"
                     /EC_number="2.7.2.4"
                     /codon_start=1
                     /transl_table=11
                     /product="Aspartate kinase"
                     /protein_id="AAZ21338.1"
                     /translation="MKTVVLKFGGTSVGSIDRIKSVAKIISSYKKKKMGVIVVSSAMS
                     GTTNELIKKTKELSNTFDAAEYDVLLATGEQATCALIAGRLKHLGFKARSWMSWQLPI
                     ITEGPYSSSRISKINKGKILSFMKSGGIPIITGFQGINLENRLTTLGRGGTDASAIML
                     AKFFNTDACDIYTDVDGVYTTDPRNHSKAKKIHKISYDEMLEMASLGAKVMQPTSVQD
                     AKLNNINFSVKSSFQKKKGTLITGTKKTFSNQIITGITSTKNDSKVTIVGVKDRPGVA
                     AAVFKPLSLNQINVDMVVQNISLNGKETDLTFTIKSEDVKKTEKIIKQNKRISFRKLT
                     YDNNVSKVSIIGVGMITTPGITYRMFQALASKKINIMVISTSEIKISVLISNKQIKKA
                     VAVLHKEFKLD"
     gene            506212..507312
                     /gene="gcpE"
                     /locus_tag="SAR11_0517"
     CDS             506212..507312
                     /gene="gcpE"
                     /locus_tag="SAR11_0517"
                     /EC_number="1.17.7.1"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan acetylation"
                     /protein_id="AAZ21339.1"
                     /translation="MSLRPFRDIHRKKTKVINVGDVKIGGDNPISVQSMTNTLTTDIQ
                     ATIKQINDIHEEGADLVRVSCPDEESSLALKEITKHVSVPIIADIHFHYKRAIEAAEN
                     GAKCLRINPGNIGDKLKIHDVLSAAKNNDCSIRIGVNAGSLEKDILEKYKEPCPEALV
                     ESAQRNIKILEDQDFFNFKISVKSSDIFLSIAAYRQLSKVTDYPLHLGITEAGGFVSG
                     SVKSSIGLGSLLMDGIGDTIRISLSDDPVKEIKIGNEILKSLNLRNRGVKIISCPSCA
                     RQAFQVIDTVKILEDKLAHIKTPLTLSIIGCVVNGPGEAAMTDIGITGGGKGNNMLYL
                     SGIQSEKVLSEDIISRVVSEVEKKAAELDKKL"
     gene            507318..508391
                     /gene="prfA"
                     /locus_tag="SAR11_0518"
     CDS             507318..508391
                     /gene="prfA"
                     /locus_tag="SAR11_0518"
                     /codon_start=1
                     /transl_table=11
                     /product="protein release factor Class I (RF-1)"
                     /protein_id="AAZ21340.1"
                     /translation="MIPLKTIEDLISKHSILEKELSSGEVDKKLFAEKSKEYSDLNEV
                     IDDARKYFSYEGEKKDLEKILSDSNSDNEFKEMAEVELKDLKLENETIEKKLKLFLLP
                     KDEADKKNAIIEIRAGTGGLEASLFAADLFKMYEKVSHQKKWELELISMSQSEAGGLK
                     EVIASIRGKNIYSTLKYESGVHRVQRVPDTETQGRVHTSAATVAVLPEAEEVDIKIND
                     SDLRIDVFRAGGPGGQSVNTTDSAVRITHIPTGLSVSQQDQKSQHKNKAKGMLILRSR
                     LYELERSRIEGERSEDRKSKIGTGDRSERIRTYNFPQGRVTDHRINLTLHKLEAFLEG
                     EAFDEMVENLTLQAQEEKLSNLN"
     gene            508393..509235
                     /gene="hemK"
                     /locus_tag="SAR11_0519"
     CDS             508393..509235
                     /gene="hemK"
                     /locus_tag="SAR11_0519"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="HemK"
                     /protein_id="AAZ21341.1"
                     /translation="MNIENILKEGIKILQKNKIANPQLDSEILLSNSIKRDKKYIILN
                     PKEVLNSEQLRKFKSLIERRKKGEPIAYLINKKEFWKDEFFVNKDVLIPRPDSELIIE
                     QVLKIYSKDDHLQLLDIGTGSGCILLSILKERSNFYGTGIDISKKSINVSKFNAKQLN
                     LTNRVKFFHSSVDNFNNGKYDIVVSNPPYIEQLSLKYLEKDVVNFEPKLALSGGFDGF
                     SKIRKVINKTNNLIKKNGKFILEIGFNQKNKVIKILKEEGFYVNKAIKDYGNNDRCVI
                     STKI"
     gene            509250..509726
                     /locus_tag="SAR11_0520"
     CDS             509250..509726
                     /locus_tag="SAR11_0520"
                     /note="similar to hypothetical protein EBAC000-62A03.2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAZ21342.1"
                     /translation="MVTFRSNNSNNNRRPPFRSNNNRRPPFRSNNEGSKFSNNDNFQR
                     KVPGRNNHNAVKLIEKYNDLAREALANEDKILSENYFQHADHFTRVQNEQESLRMARV
                     NSSATATIKPLDSDKKVEETIKTEAETVKKEVTEPEVKKVVKSVDKKVVEKKVAAS"
     gene            complement(509729..511027)
                     /gene="yebA"
                     /locus_tag="SAR11_0521"
     CDS             complement(509729..511027)
                     /gene="yebA"
                     /locus_tag="SAR11_0521"
                     /codon_start=1
                     /transl_table=11
                     /product="M23/M37 peptidase"
                     /protein_id="AAZ21343.1"
                     /translation="MIFSSNKIIKIIKKNIEITFLFLLLLITISSTNIYNEKKVLIDE
                     NYKNLINNIYFQKSINEIFDNLVPRYKNIDHKISSGETFDKILNNYSIPNEEINQIKK
                     KLNSDYNINNLQPNLEIKITIDQSNNKKITSFLFPVSRTEKIQLIRNLDNNLFEKKTI
                     ITNLNKKIIFKEGKITQSLYKTAIDLKVQPNVIIEFARIYGFQVDFQRDIRKNDNFQI
                     MYEVFEDDEGKVFETSNIIFADLKLSGKNNALYYFEKKGSEGHYDENGKSVEKALMKT
                     PINGARLSSAFGMRKHPIDGFNKMHRGTDFAAPMGTPIMASGSGLITRARWCGGGGNC
                     IKIKHNSTYETIYAHMKNFARGIKEGIRVKQGQIIGYVGSTGKSTGPHLHYEVVVNGK
                     KVNSQKLKLPSGKTLKGKEREIFEVEKIKLDVLKSELIIG"
     gene            511358..512831
                     /locus_tag="SAR11_16S_rRNA"
     rRNA            511358..512831
                     /locus_tag="SAR11_16S_rRNA"
                     /product="16S ribosomal RNA"
     gene            512931..513007
                     /locus_tag="SAR11_tRNA_f_4"
     tRNA            512931..513007
                     /locus_tag="SAR11_tRNA_f_4"
                     /product="tRNA-Ile"
     gene            513017..513092
                     /locus_tag="SAR11_tRNA_f_5"
     tRNA            513017..513092
                     /locus_tag="SAR11_tRNA_f_5"
                     /product="tRNA-Ala"
     gene            513101..515997
                     /locus_tag="SAR11_23S_rRNA"
     rRNA            513101..515997
                     /locus_tag="SAR11_23S_rRNA"
                     /product="23S ribosomal RNA"
     gene            516442..516975
                     /locus_tag="SAR11_0523"
     CDS             516442..516975
                     /locus_tag="SAR11_0523"
                     /EC_number="5.3.1.9"
                     /note="protein function by Fugue structure prediction"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase-like protein"
                     /protein_id="AAZ21344.1"
                     /translation="MKIIINKKKISNYTERVFSDIFVLKSKYIKILKTKADKSNNKSY
                     RILFHKNNSHLTHEMMICFKKNAVVPVHKHPGKRSESYHIVEGSMDVYFFKDNGKPIG
                     YISLSKKNNQIFYRLSSSKFHLLVPTSEYLIYHETVTGPFLSKADIIYPKWSANFNEI
                     SKINSFIKKNKNVIKKL"
     gene            516956..517402
                     /locus_tag="SAR11_0524"
     CDS             516956..517402
                     /locus_tag="SAR11_0524"
                     /codon_start=1
                     /transl_table=11
                     /product="Unknown protein"
                     /protein_id="AAZ21345.1"
                     /translation="MLLKNYKKIQNLKNLVFYPKKKNDFVEVNLELLKCIKIAAKVNR
                     QNVFLCMHNSPKDKFHNMIIFLWKGTHYTMHKHKKKEEIINIITGKKRINIHNLNGRL
                     IKKVILDAKNNPIIRINKNKFHSVEVLSKFVIYHEIKQGPFNSKNK"
     gene            517419..518273
                     /locus_tag="SAR11_0525"