LOCUS       BT019888                 618 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens heat shock 27kDa protein 1 mRNA, complete cds.
ACCESSION   BT019888
VERSION     BT019888.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 618)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 618)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..618
                     /db_xref="H-InvDB:HIT000266710"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01219X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..618
                     /note="Mutations: 36:OK"
                     /codon_start=1
                     /product="heat shock 27kDa protein 1"
                     /protein_id="AAV38691.1"
                     /translation="MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQ
                     WLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVN
                     HFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPE
                     GTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK"
BASE COUNT          106 a          234 c          188 g           90 t
ORIGIN      
        1 atgaccgagc gccgcgtccc cttctcgctc ctgcgtggcc ccagctggga ccccttccgc
       61 gactggtacc cgcatagccg cctcttcgac caggccttcg ggctgccccg gctgccggag
      121 gagtggtcgc agtggttagg cggcagcagc tggccaggct acgtgcgccc cctgcccccc
      181 gccgccatcg agagccccgc agtggccgcg cccgcctaca gccgcgcgct cagccggcaa
      241 ctcagcagcg gggtctcgga gatccggcac actgcggacc gctggcgcgt gtccctggat
      301 gtcaaccact tcgccccgga cgagctgacg gtcaagacca aggatggcgt ggtggagatc
      361 accggcaagc acgaggagcg gcaggacgag catggctaca tctcccggtg cttcacgcgg
      421 aaatacacgc tgccccccgg tgtggacccc acccaagttt cctcctccct gtcccctgag
      481 ggcacactga ccgtggaggc ccccatgccc aagctagcca cgcagtccaa cgagatcacc
      541 atcccagtca ccttcgagtc gcgggcccag cttgggggcc cagaagctgc aaaatccgat
      601 gagactgccg ccaagtag
//