LOCUS       BT011312                 558 bp    mRNA    linear   PLN 14-JAN-2004
DEFINITION  Arabidopsis thaliana At1g19080 gene, complete cds.
ACCESSION   BT011312
VERSION     BT011312.1
KEYWORDS    FLI_CDNA.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 558)
  AUTHORS   Cheuk,R., Chen,H., Kim,C.J., Shinn,P. and Ecker,J.R.
  TITLE     Arabidopsis ORF clones
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 558)
  AUTHORS   Cheuk,R., Chen,H., Kim,C.J., Shinn,P. and Ecker,J.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-JAN-2004) Salk Institute Genomic Analysis Laboratory
            (SIGnAL), Plant Biology Laboratory, The Salk Institute for
            Biological Studies, 10010 N. Torrey Pines Road, La Jolla, CA 92037,
            USA
FEATURES             Location/Qualifiers
     source          1..558
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="1"
                     /clone="C63240"
                     /ecotype="Columbia"
                     /note="This clone is in pUNI 51"
     CDS             1..558
                     /note="unknown protein"
                     /codon_start=1
                     /product="At1g19080"
                     /protein_id="AAR92348.1"
                     /translation="MAKYFDIDDILIEEEFVPVLFHKTANGVTIDPSAETNCAEQGSK
                     VELPFWLAHELHLRQAVTINLPPCFDQKTRLEVQADAAYVDLRSRCPYFYEFGCKIEP
                     LVTDRTLGILLSTAFKIRYKEALTKVYTAAHITASKYLSFLTKEETNLYEAAHLSMTA
                     FKKWRTGGPRFQRASILGRKRKDSN"
BASE COUNT          179 a          112 c          122 g          145 t
ORIGIN      
        1 atggcgaagt actttgacat tgatgacata cttatagagg aagagtttgt accggtttta
       61 ttccataaaa cagcaaacgg agtgactatt gatccaagtg cagaaacaaa ttgtgctgaa
      121 caaggctcta aagttgaact tcccttctgg cttgctcatg agttgcatct gaggcaagct
      181 gttaccataa accttcctcc ctgttttgac caaaagacga ggcttgaagt tcaggctgat
      241 gctgcatacg tcgatcttag atcgcgatgt ccatactttt atgaatttgg atgcaagata
      301 gagccactgg tcacagatag aacactgggg atcttgctat cgactgcgtt taagatcaga
      361 tacaaagagg cactgacaaa agtatacaca gcagctcaca taacagcttc caagtacttg
      421 tcgtttttaa caaaagaaga aacaaacttg tatgaagcag ctcacttgtc gatgacagcc
      481 ttcaagaagt ggagaacagg tggtcctaga ttccagagag cttcaatact cggaagaaaa
      541 cgcaaggatt ctaattaa
//