LOCUS       BT011276                 237 bp    mRNA    linear   PLN 14-JAN-2004
DEFINITION  Arabidopsis thaliana At2g04800 gene, complete cds.
ACCESSION   BT011276
VERSION     BT011276.1
KEYWORDS    FLI_CDNA.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 237)
  AUTHORS   Cheuk,R., Chen,H., Kim,C.J., Shinn,P. and Ecker,J.R.
  TITLE     Arabidopsis ORF clones
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 237)
  AUTHORS   Cheuk,R., Chen,H., Kim,C.J., Shinn,P. and Ecker,J.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-JAN-2004) Salk Institute Genomic Analysis Laboratory
            (SIGnAL), Plant Biology Laboratory, The Salk Institute for
            Biological Studies, 10010 N. Torrey Pines Road, La Jolla, CA 92037,
            USA
FEATURES             Location/Qualifiers
     source          1..237
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="2"
                     /clone="C62955"
                     /ecotype="Columbia"
                     /note="This clone is in pUNI 51"
     CDS             1..237
                     /note="unknown protein"
                     /codon_start=1
                     /product="At2g04800"
                     /protein_id="AAR92312.1"
                     /translation="MGSKPSSLADEVAIIVEQVDKVMGMVFWCPLYWESIELLAKDEV
                     SRAIFYGLTEGCKLDYLKYKTKASMVPEMTRFYS"
BASE COUNT           72 a           41 c           55 g           69 t
ORIGIN      
        1 atgggatcta aacctagctc gctggctgat gaagtagcca ttattgttga gcaagtagac
       61 aaggttatgg ggatggtttt ttggtgcccc ctctactggg aatctataga actccttgca
      121 aaagatgagg tttcacgagc catattttat ggactaacag aaggatgtaa gcttgattat
      181 cttaaataca agacaaaagc ttccatggtc ccagaaatga cacggtttta tagttaa
//