LOCUS BT011276 237 bp mRNA linear PLN 14-JAN-2004 DEFINITION Arabidopsis thaliana At2g04800 gene, complete cds. ACCESSION BT011276 VERSION BT011276.1 KEYWORDS FLI_CDNA. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 237) AUTHORS Cheuk,R., Chen,H., Kim,C.J., Shinn,P. and Ecker,J.R. TITLE Arabidopsis ORF clones JOURNAL Unpublished REFERENCE 2 (bases 1 to 237) AUTHORS Cheuk,R., Chen,H., Kim,C.J., Shinn,P. and Ecker,J.R. TITLE Direct Submission JOURNAL Submitted (14-JAN-2004) Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey Pines Road, La Jolla, CA 92037, USA FEATURES Location/Qualifiers source 1..237 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /clone="C62955" /ecotype="Columbia" /note="This clone is in pUNI 51" CDS 1..237 /note="unknown protein" /codon_start=1 /product="At2g04800" /protein_id="AAR92312.1" /translation="MGSKPSSLADEVAIIVEQVDKVMGMVFWCPLYWESIELLAKDEV SRAIFYGLTEGCKLDYLKYKTKASMVPEMTRFYS" BASE COUNT 72 a 41 c 55 g 69 t ORIGIN 1 atgggatcta aacctagctc gctggctgat gaagtagcca ttattgttga gcaagtagac 61 aaggttatgg ggatggtttt ttggtgcccc ctctactggg aatctataga actccttgca 121 aaagatgagg tttcacgagc catattttat ggactaacag aaggatgtaa gcttgattat 181 cttaaataca agacaaaagc ttccatggtc ccagaaatga cacggtttta tagttaa //