LOCUS       BT009825                 504 bp    mRNA    linear   HUM 02-AUG-2003
DEFINITION  Homo sapiens cystatin F (leukocystatin) mRNA, complete cds.
ACCESSION   BT009825
VERSION     BT009825.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 504)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
REFERENCE   2  (bases 1 to 504)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..504
                     /db_xref="H-InvDB:HIT000266387"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01079X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..504
                     /codon_start=1
                     /product="cystatin F (leukocystatin)"
                     /protein_id="AAP88827.1"
                     /translation="MLPEKALHGHPQLPRTVPTRAAMRAAGTLLAFCCLVLSTTGGPS
                     PDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALV
                     QIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFE
                     VPVLRCH"
BASE COUNT          125 a          152 c          121 g          106 t
ORIGIN      
        1 atgctgcctg agaaggcact gcacggccac ccccaactgc cccgcactgt ccctacccgg
       61 gcagccatgc gagcggctgg aactctgctg gccttctgct gcctggtctt gagcaccact
      121 gggggccctt ccccagatac ttgttcccag gaccttaact cacgtgtgaa gccaggattt
      181 cctaaaacaa taaagaccaa tgacccagga gtcctccaag cagccagata cagtgttgaa
      241 aagttcaaca actgcacgaa cgacatgttc ttgttcaagg agtcccgcat cacaagggcc
      301 ctagttcaga tagtgaaagg cctgaaatat atgctcgagg tggaaattgg cagaactacc
      361 tgcaagaaaa accagcacct gcgtctggat gactgtgact tccaaaccaa ccacaccttg
      421 aagcagactc tgagctgcta ctctgaagtc tgggtcgtgc cctggctcca gcacttcgag
      481 gtgcctgttc tccgttgtca ctag
//