LOCUS BT009825 504 bp mRNA linear HUM 02-AUG-2003 DEFINITION Homo sapiens cystatin F (leukocystatin) mRNA, complete cds. ACCESSION BT009825 VERSION BT009825.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 504) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA REFERENCE 2 (bases 1 to 504) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..504 /db_xref="H-InvDB:HIT000266387" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01079X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..504 /codon_start=1 /product="cystatin F (leukocystatin)" /protein_id="AAP88827.1" /translation="MLPEKALHGHPQLPRTVPTRAAMRAAGTLLAFCCLVLSTTGGPS PDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALV QIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFE VPVLRCH" BASE COUNT 125 a 152 c 121 g 106 t ORIGIN 1 atgctgcctg agaaggcact gcacggccac ccccaactgc cccgcactgt ccctacccgg 61 gcagccatgc gagcggctgg aactctgctg gccttctgct gcctggtctt gagcaccact 121 gggggccctt ccccagatac ttgttcccag gaccttaact cacgtgtgaa gccaggattt 181 cctaaaacaa taaagaccaa tgacccagga gtcctccaag cagccagata cagtgttgaa 241 aagttcaaca actgcacgaa cgacatgttc ttgttcaagg agtcccgcat cacaagggcc 301 ctagttcaga tagtgaaagg cctgaaatat atgctcgagg tggaaattgg cagaactacc 361 tgcaagaaaa accagcacct gcgtctggat gactgtgact tccaaaccaa ccacaccttg 421 aagcagactc tgagctgcta ctctgaagtc tgggtcgtgc cctggctcca gcacttcgag 481 gtgcctgttc tccgttgtca ctag //