LOCUS       BT008481                1176 bp    mRNA    linear   PLN 15-MAY-2003
DEFINITION  Arabidopsis thaliana At1g47710 gene, complete cds.
ACCESSION   BT008481
VERSION     BT008481.1
KEYWORDS    FLI_CDNA.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1176)
  AUTHORS   Cheuk,R., Chen,H., Kim,C.J., Shinn,P., Bowser,L., Carninci,P.,
            Dale,J.M., Hayashizaki,Y., Hsuan,V.W., Ishida,J., Jones,T.,
            Kamiya,A., Karlin-Neumann,G., Kawai,J., Lam,B., Lin,J., Miranda,M.,
            Narusaka,M., Nguyen,M., Onodera,C.S., Palm,C.J., Quach,H.L.,
            Sakurai,T., Satou,M., Seki,M., Southwick,A., Toriumi,M., Wong,C.,
            Wu,H.C., Yamada,K., Yu,G., Yuan,S., Shinozaki,K., Davis,R.W.,
            Theologis,A. and Ecker,J.R.
  TITLE     Arabidopsis ORF clones
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1176)
  AUTHORS   Cheuk,R., Chen,H., Kim,C.J., Shinn,P., Bowser,L., Carninci,P.,
            Dale,J.M., Hayashizaki,Y., Hsuan,V.W., Ishida,J., Jones,T.,
            Kamiya,A., Karlin-Neumann,G., Kawai,J., Lam,B., Lin,J., Miranda,M.,
            Narusaka,M., Nguyen,M., Onodera,C.S., Palm,C.J., Quach,H.L.,
            Sakurai,T., Satou,M., Seki,M., Southwick,A., Toriumi,M., Wong,C.,
            Wu,H.C., Yamada,K., Yu,G., Yuan,S., Shinozaki,K., Davis,R.W.,
            Theologis,A. and Ecker,J.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-MAY-2003) Salk Institute Genomic Analysis Laboratory
            (SIGnAL), Plant Biology Laboratory, The Salk Institute for
            Biological Studies, 10010 N. Torrey Pines Road, La Jolla, CA 92037,
            USA
COMMENT     RIKEN Genomic Sciences Center (GSC) members carried out the
            collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
            Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
            Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
            Hayashizaki,Y. and Shinozaki,K.
            
            The Salk, Stanford, PGEC (SSP) Consortium members constructed and
            sequenced the pUNI (ORF) clones using the RAFL cDNAs: Cheuk,R.,
            Chen,H., Kim,C.J., Shinn,P., Bowser,L., Chan, M.M., Chang,C.M.,
            Dale,J.M., Hsuan,V.W., Jones,T., Karlin-Neumann,G., Lam,B.,
            Lee,J.M., Lin,J., Miranda,M., Nguyen,M., Onodera, C.S., Palm,C.J.,
            Quach,H.L., Southwick,A., Tang,C.C., Toriumi,M., Wong,C., Wu,H.C.,
            Yamada,K., Yu,G., Yuan,S., Davis,R.W.,  Theologis,A., and
            Ecker,J.R.
            
            Cheuk,R. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
            this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
            contributed equally to this work as PIs.
FEATURES             Location/Qualifiers
     source          1..1176
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="1"
                     /clone="U24647"
                     /ecotype="Columbia"
                     /note="This clone is in pUNI 51"
     CDS             1..1176
                     /note="serpin protein"
                     /codon_start=1
                     /product="At1g47710"
                     /protein_id="AAP37840.1"
                     /translation="MDVRESISLQNQVSMNLAKHVITTVSQNSNVIFSPASINVVLSI
                     IAAGSAGATKDQILSFLKFSSTDQLNSFSSEIVSAVLADGSANGGPKLSVANGAWIDK
                     SLSFKPSFKQLLEDSYKAASNQADFQSKAVEVIAEVNSWAEKETNGLITEVLPEGSAD
                     SMTKLIFANALYFKGTWNEKFDESLTQEGEFHLLDGNKVTAPFMTSKKKQYVSAYDGF
                     KVLGLPYLQGQDKRQFSMYFYLPDANNGLSDLLDKIVSTPGFLDNHIPRRQVKVREFK
                     IPKFKFSFGFDASNVLKGLGLTSPFSGEEGLTEMVESPEMGKNLCVSNIFHKACIEVN
                     EEGTEAAAASAGVIKLRGLLMEEDEIDFVADHPFLLVVTENITGVVLFIGQVVDPLH"
BASE COUNT          337 a          258 c          255 g          326 t
ORIGIN      
        1 atggacgtgc gtgaatcaat ctcactgcaa aaccaagtct ccatgaatct cgcaaaacac
       61 gtaatcacca ccgtctctca aaactccaac gtcatcttct caccggcttc aatcaacgtc
      121 gtactcagta taatcgccgc tggatccgcc ggcgctacca aagatcagat cctctcgttt
      181 ctcaaattct cttccactga tcaacttaat tcattctctt ccgaaatcgt ctccgctgtt
      241 ctcgctgacg gtagtgctaa cggtggtcct aagctctcgg tggctaatgg cgcctggatc
      301 gataagtctc tctcctttaa accttccttt aaacagctct tggaagattc gtataaagct
      361 gcttcgaatc aagctgattt tcaatcgaag gctgtggagg tgattgctga agtgaattca
      421 tgggctgaaa aggagacaaa tggtctcatc actgaggttc ttccagaagg atcagctgat
      481 agtatgacca aactgatatt tgcaaatgca ttgtacttca agggaacatg gaacgagaaa
      541 ttcgatgagt cgttaacaca agaaggcgag tttcaccttc ttgacggtaa caaagtgact
      601 gcaccattca tgaccagcaa gaagaaacaa tacgtaagtg cttacgatgg tttcaaagtt
      661 ttgggacttc cttacttaca aggacaggat aagcgacaat tctccatgta cttttatctt
      721 cccgatgcaa acaacggact gtctgatctt ctggacaaaa tagtttccac tcctgggttc
      781 ttagacaacc acatcccacg cagacaagtt aaagtccgcg aattcaagat tccaaagttt
      841 aaattctctt tcgggttcga tgcttcaaat gttttaaaag gattgggact gacttcgcct
      901 ttcagcggtg aagaaggttt aactgagatg gttgaatctc ctgagatggg gaagaatcta
      961 tgcgtatcga acattttcca taaagcgtgt atcgaagtga atgaagaagg aacagaagct
     1021 gcagctgcat cagctggagt tataaagcta agaggattgc ttatggagga agatgaaata
     1081 gattttgttg cagaccatcc gtttctattg gtggtcacag agaacataac aggagtggtt
     1141 ctgttcattg gccaagttgt tgatccgttg cattaa
//